F490041

General Info

Members Datasets Scaffolds Average Seq Length
1099 468 971 471

Family's Representative Sequence

Representative Sequence 3300046526|Ga0495666_0040126|Ga0495666_0040126_443_2140
Length 565
Sequence LIYINRLWSRFVLAPAKTHEAGKACTGPGKKMLQVRDCYREVVDVLPLAGPAQPFLMQVKDLAEPDQYTAVNRAEPQPAGGSQGVSTMHPKVIPLAAQPERRGSQSVEFDGDLLGRLAKSGPRYTSYPTADRFTESFDYRDYLHAVAGVRTRGGAKPLSLYLHIPFCKSLCYYCGCNKIITKDSEKAAVYLGYLKREIEMQGLLFAGMNDVEQLHFGGGTPTYLSDEQMDDLMAHLRRQFRFAADSVGEYSIEVDPRTVSPSRVHKLRQQGFNRISLGVQDFDPDVQQAVNRIQPEAETRSIIDAARGAGFRSISIDLIYGLPRQNLQTMAQTLAKVVAASPDRIAVYHYAHMPHLFKSQRRISEAELPGSETKLAMLALCIERLTGAGYVYIGMDHFARPTDDLAIAQQQGRLHRNFQGYSTYADTDLVSCGVSAISAVGATYSQNVKTLEAYYDALDRNELPVARGIRLSMDDGLRRALIQKLMCQFEVSIPAIEQAFPIVFTKYFEQELEQLKELERDGLVTVTSEWITVSMKGRLLIRNVCMLFDRYLAARANGPRYSQTI

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
3 2511231018 Pseudomonas sp. GM60 Isolate Nodule
4 2511231019 Pseudomonas sp. GM67 Isolate Nodule
5 2511231022 Pseudomonas sp. GM79 Isolate Nodule
6 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
7 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
8 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
9 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
10 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
11 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
12 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
13 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
14 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
15 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
16 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
17 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
18 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
19 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
20 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
21 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
22 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
23 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
24 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
25 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
26 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
27 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
28 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
29 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
30 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
31 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
32 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
33 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
34 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
35 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
36 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
37 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
38 2643221556 Massilia sp. Root1485 Isolate Unclassified
39 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
40 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
41 2643221638 Duganella sp. Root336D2 Isolate Unclassified
42 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
43 2643221684 Massilia sp. Root133 Isolate Unclassified
44 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
45 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
46 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
47 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
48 2738541280 Massilia sp. GV090 Isolate Unclassified
49 2738541297 Duganella sp. GV083 Isolate Unclassified
50 2738541300 Massilia sp. GV016 Isolate Unclassified
51 2738541357 Duganella sp. GV053 Isolate Unclassified
52 2738543003 Duganella sp. GV066 Isolate Unclassified
53 2738543018 Massilia sp. GV045 Isolate Unclassified
54 2738543026 Duganella sp. GV089 Isolate Unclassified
55 2738543029 Duganella sp. GV039 Isolate Unclassified
56 2738543030 Massilia sp. GV097 Isolate Unclassified
57 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
58 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
59 2773857670 Pseudomonas sp. 478 Isolate Unclassified
60 2784132072 Pseudomonas sp. 460 Isolate Unclassified
61 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
62 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
63 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
64 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
65 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
66 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
67 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
68 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
69 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
70 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
71 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
72 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
73 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
74 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
75 2818991436 Collimonas arenae 515 Isolate Unclassified
76 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
77 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
78 2821131069 Duganella sp. 1224 Isolate Unclassified
79 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
80 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
81 2842711865 Duganella sp. R-73148 Isolate Unclassified
82 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
83 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
84 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
85 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
86 2857553236 Duganella sp. R-74557 Isolate Unclassified
87 2857564685 Duganella sp. R-74599 Isolate Unclassified
88 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
89 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
90 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
91 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
92 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
93 2904424332 Duganella sp. 1411 Isolate Rhizosphere
94 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
95 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
96 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
97 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
98 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
99 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
100 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
101 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
102 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
103 2919476304 Duganella sp. 3397 Isolate Unclassified
104 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
105 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
106 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
107 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
108 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
109 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
110 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
111 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
112 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
113 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
114 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
115 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
116 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
117 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
118 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
119 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
120 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
121 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
122 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
123 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
124 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
125 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
126 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
127 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
128 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
129 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
130 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
131 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
132 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
133 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
134 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
135 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
136 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
137 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
138 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
139 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
140 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
141 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
142 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
143 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
144 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
145 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
146 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
147 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
148 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
149 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
150 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
151 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
152 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
153 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
154 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
155 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
156 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
157 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
158 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
159 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
160 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
161 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
162 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
163 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
164 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
165 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
166 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
167 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
168 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
169 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
170 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
171 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
172 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
173 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
174 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
175 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
176 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
177 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
178 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
179 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
180 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
181 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
182 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
183 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
184 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
185 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
186 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
187 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
188 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
189 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
190 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
191 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
192 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
193 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
194 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
195 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
199 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
200 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
201 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
202 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
203 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
204 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
205 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
206 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
207 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
208 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
209 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
210 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
211 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
212 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
213 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
214 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
215 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
216 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
217 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
218 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
219 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
220 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
221 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
222 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
246 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
248 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
249 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
250 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
251 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
252 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
253 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
254 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
255 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
256 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
257 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
258 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
259 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
260 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
261 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
262 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
263 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
264 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
265 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
266 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
267 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
268 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
269 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
270 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
271 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
272 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
273 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
274 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
278 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
279 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
280 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
281 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
282 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
283 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
284 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
285 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
286 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
287 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
288 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
289 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
290 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
291 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
292 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
293 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
294 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
295 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
296 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
297 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
298 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
299 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
300 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
301 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
302 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
303 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
304 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
305 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
306 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
307 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
308 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
309 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
310 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
311 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
312 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
313 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
314 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
315 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
316 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
317 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
318 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
319 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
320 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
321 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
322 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
323 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
324 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
325 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
326 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
327 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
328 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
329 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
330 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
331 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
332 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
333 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
334 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
335 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
336 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
337 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
338 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
339 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
340 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
341 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
342 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
343 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
344 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
345 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
346 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
347 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
348 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
349 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
350 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
351 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
352 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
353 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
354 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
355 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
356 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
357 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
358 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
359 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
360 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
361 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
362 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
363 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
364 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
365 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
366 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
367 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
368 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
369 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
370 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
371 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
372 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
373 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
374 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
375 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
376 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
377 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
378 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
379 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
380 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
381 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
382 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
383 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
384 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
385 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
386 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
387 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
388 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
389 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
390 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
391 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
392 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
393 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
394 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
395 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
396 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
397 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
398 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
399 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
400 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
401 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
402 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
403 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
404 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
405 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
406 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
407 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
408 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
409 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
410 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
411 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
412 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
413 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
414 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
415 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
416 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
417 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
418 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
419 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
420 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
421 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
422 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
423 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
424 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
425 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
426 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
427 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
428 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
429 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
430 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
431 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
432 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
433 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
434 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
435 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
436 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
437 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
438 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
439 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
440 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
441 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
442 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
443 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
444 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
445 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
446 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
447 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
448 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
449 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
450 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
451 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
452 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
453 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
454 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
455 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
456 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
457 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
458 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
459 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
460 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
461 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
462 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
463 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
464 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
465 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
466 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
467 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
468 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.9
Metatranscriptomes 0.45
Isolates 11.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.55
Nodule 1.27
Rhizoplane 5.64
Rhizosphere 73.89
Stem 0
Stem Tuber 0
Unclassified 10.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_39 2124908027 Bacteria 13232
2 JGI25155J39150_1000045 3300002704 Bacteria 85779
3 JGI25155J39150_1000298 3300002704 Bacteria 16978
4 JGI25156J39149_1000054 3300002705 Bacteria 88728
5 JGI25156J39149_1002751 3300002705 Bacteria 6115
6 JGI25162J39368_1005488 3300002737 Bacteria 2465
7 JGI25154J39366_1000083 3300002738 Bacteria 88728
8 JGI25154J39366_1000128 3300002738 Bacteria 59551
9 JGI25154J39366_1001354 3300002738 Bacteria 8959
10 JGI25157J39369_1000208 3300002741 Bacteria 48951
11 JGI25150J39212_1000767 3300002774 Bacteria 11091
12 JGI25153J46596_10005972 3300003215 Bacteria 6267
13 rootL2_10051059 3300003322 Bacteria 3762
14 rootL2_10073623 3300003322 Bacteria 9616
15 JGI25161J50226_1000766 3300003374 Bacteria 12272
16 Ga0006562J51391_1010113 3300003578 Bacteria 6582
17 Ga0055539_1000040 3300003752 Bacteria 200831
18 Ga0055533_1000050 3300003756 Bacteria 200831
19 Ga0055532_1000099 3300003758 Bacteria 93811
20 Ga0055525_1000001 3300003759 Bacteria 1016948
21 Ga0055525_1000047 3300003759 Bacteria 261507
22 Ga0055525_1000060 3300003759 Bacteria 200831
23 Ga0055529_1000015 3300003763 Bacteria 366950
24 Ga0055526_1000007 3300003771 Bacteria 321998
25 Ga0055526_1000054 3300003771 Bacteria 113702
26 Ga0055526_1000665 3300003771 Bacteria 26412
27 Ga0055526_1002760 3300003771 Bacteria 11641
28 Ga0055537_1000005 3300003773 Bacteria 160497
29 Ga0055524_1000038 3300003775 Bacteria 162683
30 Ga0055524_1002052 3300003775 Bacteria 10704
31 Ga0055524_1004769 3300003775 Bacteria 6188
32 Ga0055534_1000493 3300003784 Bacteria 21773
33 Ga0055534_1002714 3300003784 Bacteria 5967
34 Ga0055528_1000082 3300003790 Bacteria 74945
35 Ga0055528_1002242 3300003790 Bacteria 10530
36 Ga0055530_10003717 3300003791 Bacteria 8480
37 Ga0055540_1000115 3300003792 Bacteria 84932
38 Ga0055541_1000027 3300003841 Bacteria 200831
39 Ga0055543_1001041 3300004625 Bacteria 12310
40 Ga0055543_1002381 3300004625 Bacteria 6264
41 Ga0065165_1000034 3300005262 Bacteria 214644
42 Ga0065165_1003116 3300005262 Bacteria 12310
43 Ga0065165_1018998 3300005262 Bacteria 2469
44 Ga0065165_1027437 3300005262 Bacteria 1857
45 Ga0065714_10000106 3300005288 Bacteria 10614
46 Ga0065714_10006891 3300005288 Bacteria 6107
47 Ga0065714_10065610 3300005288 Bacteria 9169
48 Ga0065714_10065916 3300005288 Bacteria 8103
49 Ga0065704_10071946 3300005289 Bacteria 9553
50 Ga0065704_10080329 3300005289 Bacteria 3968
51 Ga0065715_10150367 3300005293 Bacteria 1736
52 Ga0070658_10063700 3300005327 Bacteria 3006
53 Ga0070658_10102911 3300005327 Bacteria 2362
54 Ga0068869_100007564 3300005334 Bacteria 6952
55 Ga0070689_100003292 3300005340 Bacteria 10728
56 Ga0070673_100145510 3300005364 Bacteria 2003
57 Ga0070659_100000456 3300005366 Bacteria 30202
58 Ga0070659_100028389 3300005366 Bacteria 4321
59 Ga0070694_100018247 3300005444 Bacteria 4451
60 Ga0070708_100000083 3300005445 Bacteria 61330
61 Ga0070662_100051409 3300005457 Bacteria 2976
62 Ga0070681_10008565 3300005458 Bacteria 10021
63 Ga0070707_100056100 3300005468 Bacteria 3778
64 Ga0070698_100001188 3300005471 Bacteria 28865
65 Ga0070697_100059601 3300005536 Bacteria 3109
66 Ga0070695_100003126 3300005545 Bacteria 9644
67 Ga0070696_100075642 3300005546 Bacteria 2376
68 Ga0068855_100000243 3300005563 Bacteria 68537
69 Ga0068855_100039320 3300005563 Bacteria 5615
70 Ga0068855_100046878 3300005563 Bacteria 5108
71 Ga0068855_100078328 3300005563 Bacteria 3834
72 Ga0070664_100044530 3300005564 Bacteria 3747
73 Ga0068854_100003412 3300005578 Bacteria 9905
74 Ga0068856_100050845 3300005614 Bacteria 4087
75 Ga0068851_10002096 3300005834 Bacteria 8775
76 Ga0075364_10015806 3300006051 Bacteria 4684
77 Ga0097621_100009059 3300006237 Bacteria 7211
78 Ga0075431_100006058 3300006847 Bacteria 11988
79 Ga0075429_100075068 3300006880 Bacteria 2945
80 Ga0079104_1000554 3300006946 Bacteria 38699
81 Ga0079104_1007192 3300006946 Bacteria 4076
82 Ga0099826_10000008 3300006948 Bacteria 380974
83 Ga0099826_10018806 3300006948 Bacteria 5204
84 Ga0105251_10018623 3300009011 Bacteria 3686
85 Ga0105251_10068198 3300009011 Bacteria 1660
86 Ga0105244_10000282 3300009036 Bacteria 50739
87 Ga0105244_10002927 3300009036 Bacteria 12593
88 Ga0105240_10002667 3300009093 Bacteria 28399
89 Ga0105243_10149259 3300009148 Bacteria 2003
90 Ga0105241_10055615 3300009174 Bacteria 3032
91 Ga0105237_10009327 3300009545 Bacteria 10509
92 Ga0105237_10115202 3300009545 Bacteria 2681
93 Ga0105238_10000547 3300009551 Bacteria 39292
94 Ga0105239_10045286 3300010375 Bacteria 4822
95 Ga0105246_10077925 3300011119 Bacteria 2353
96 Ga0157373_10024922 3300013100 Bacteria 4331
97 Ga0157371_10000060 3300013102 Bacteria 170456
98 Ga0157370_10000365 3300013104 Bacteria 57133
99 Ga0157370_10002579 3300013104 Bacteria 21763
100 Ga0157370_10035870 3300013104 Bacteria 4816
101 Ga0157369_10009955 3300013105 Bacteria 10862
102 Ga0163162_10029773 3300013306 Bacteria 5404
103 Ga0182008_10001328 3300014497 Bacteria 16866
104 Ga0182008_10005516 3300014497 Bacteria 7196
105 Ga0182008_10012481 3300014497 Bacteria 4483
106 Ga0182008_10013967 3300014497 Bacteria 4212
107 Ga0157376_10141564 3300014969 Bacteria 2158
108 Ga0182006_1000007 3300015261 Bacteria 452190
109 Ga0182006_1000023 3300015261 Bacteria 275031
110 Ga0182006_1000448 3300015261 Bacteria 32576
111 Ga0182006_1000776 3300015261 Bacteria 21613
112 Ga0182006_1002579 3300015261 Bacteria 9810
113 Ga0182006_1005019 3300015261 Bacteria 6371
114 Ga0182006_1038477 3300015261 Bacteria 1891
115 Ga0182007_10000022 3300015262 Bacteria 189018
116 Ga0182007_10000226 3300015262 Bacteria 37935
117 Ga0182007_10000861 3300015262 Bacteria 16866
118 Ga0182005_1000006 3300015265 Bacteria 515188
119 Ga0182005_1000010 3300015265 Bacteria 434103
120 Ga0182005_1000529 3300015265 Bacteria 19383
121 Ga0182005_1000989 3300015265 Bacteria 12243
122 Ga0182005_1001155 3300015265 Bacteria 10935
123 Ga0182005_1001789 3300015265 Bacteria 8241
124 Ga0163161_10017270 3300017792 Bacteria 5049
125 Ga0213872_10000087 3300021361 Bacteria 84858
126 Ga0213872_10000157 3300021361 Bacteria 62892
127 Ga0213872_10001173 3300021361 Bacteria 17818
128 Ga0213872_10004189 3300021361 Bacteria 7754
129 Ga0213872_10005182 3300021361 Bacteria 6747
130 Ga0213872_10005483 3300021361 Bacteria 6520
131 Ga0213872_10006343 3300021361 Bacteria 5952
132 Ga0213872_10009009 3300021361 Bacteria 4797
133 Ga0209435_100034 3300025206 Bacteria 144486
134 Ga0209435_100115 3300025206 Bacteria 30475
135 Ga0209436_100505 3300025208 Bacteria 17076
136 Ga0209436_102413 3300025208 Bacteria 5645
137 Ga0209784_100005 3300025224 Bacteria 1040422
138 Ga0209566_100005 3300025225 Bacteria 1040422
139 Ga0209674_100009 3300025226 Bacteria 1040422
140 Ga0209147_100004 3300025229 Bacteria 1371850
141 Ga0209563_100003 3300025230 Bacteria 1932942
142 Ga0209563_100007 3300025230 Bacteria 1579402
143 Ga0209563_100012 3300025230 Bacteria 1040422
144 Ga0209437_100072 3300025233 Bacteria 305152
145 Ga0209437_105496 3300025233 Bacteria 2155
146 Ga0209258_100468 3300025242 Bacteria 43353
147 Ga0207425_1000009 3300025245 Bacteria 593135
148 Ga0207425_1000036 3300025245 Bacteria 225783
149 Ga0209646_1000023 3300025246 Bacteria 441100
150 Ga0209646_1000042 3300025246 Bacteria 343923
151 Ga0209646_1000118 3300025246 Bacteria 149446
152 Ga0209646_1000155 3300025246 Bacteria 95204
153 Ga0209026_1000106 3300025250 Bacteria 149446
154 Ga0209026_1000769 3300025250 Bacteria 17972
155 Ga0209026_1002712 3300025250 Bacteria 6377
156 Ga0209677_100006 3300025253 Bacteria 1040422
157 Ga0209677_102834 3300025253 Bacteria 6131
158 Ga0209677_104586 3300025253 Bacteria 3922
159 Ga0209759_1000190 3300025256 Bacteria 97956
160 Ga0209759_1000375 3300025256 Bacteria 55963
161 Ga0209129_1000051 3300025258 Bacteria 267104
162 Ga0209129_1008572 3300025258 Bacteria 2826
163 Ga0209565_1000074 3300025263 Bacteria 164237
164 Ga0209565_1000662 3300025263 Bacteria 21980
165 Ga0209565_1002796 3300025263 Bacteria 6040
166 Ga0209565_1009818 3300025263 Bacteria 2401
167 Ga0209455_1000031 3300025272 Bacteria 519952
168 Ga0209673_1000129 3300025273 Bacteria 164238
169 Ga0209130_1000016 3300025284 Bacteria 395540
170 Ga0209130_1000827 3300025284 Bacteria 26056
171 Ga0209130_1001825 3300025284 Bacteria 12323
172 Ga0209675_1000072 3300025291 Bacteria 164237
173 Ga0209675_1000839 3300025291 Bacteria 20131
174 Ga0209675_1001859 3300025291 Bacteria 11450
175 Ga0209676_1005362 3300025292 Bacteria 6738
176 Ga0209025_1006762 3300025294 Bacteria 8794
177 Ga0209564_1000010 3300025295 Bacteria 885399
178 Ga0209564_1000042 3300025295 Bacteria 392805
179 Ga0209564_1000160 3300025295 Bacteria 164214
180 Ga0209564_1000172 3300025295 Bacteria 155715
181 Ga0209564_1002005 3300025295 Bacteria 17786
182 Ga0209564_1006980 3300025295 Bacteria 5926
183 Ga0209758_1000054 3300025297 Bacteria 337655
184 Ga0209758_1000379 3300025297 Bacteria 77337
185 Ga0209050_1000013 3300025298 Bacteria 811408
186 Ga0209050_1000040 3300025298 Bacteria 408492
187 Ga0209050_1000309 3300025298 Bacteria 99432
188 Ga0209050_1006669 3300025298 Bacteria 6756
189 Ga0209256_1000018 3300025299 Bacteria 568467
190 Ga0209256_1000125 3300025299 Bacteria 165336
191 Ga0209256_1000307 3300025299 Bacteria 85852
192 Ga0209256_1000553 3300025299 Bacteria 53682
193 Ga0209256_1001318 3300025299 Bacteria 26552
194 Ga0207426_1001267 3300025302 Bacteria 22033
195 Ga0207426_1016649 3300025302 Bacteria 2632
196 Ga0209051_1000007 3300025303 Bacteria 811408
197 Ga0209257_1000054 3300025304 Bacteria 416957
198 Ga0209257_1008286 3300025304 Bacteria 5963
199 Ga0207656_10055940 3300025321 Bacteria 1718
200 Ga0207696_1009583 3300025711 Bacteria 3603
201 Ga0207655_1000289 3300025728 Bacteria 76246
202 Ga0207655_1000306 3300025728 Bacteria 73321
203 Ga0207655_1002948 3300025728 Bacteria 13082
204 Ga0207655_1008980 3300025728 Bacteria 6267
205 Ga0207655_1014803 3300025728 Bacteria 4380
206 Ga0207647_10001270 3300025904 Bacteria 19434
207 Ga0207705_10035388 3300025909 Bacteria 3572
208 Ga0207705_10125042 3300025909 Bacteria 1911
209 Ga0207654_10008958 3300025911 Bacteria 5077
210 Ga0207707_10018908 3300025912 Bacteria 6006
211 Ga0207695_10000913 3300025913 Bacteria 52943
212 Ga0207695_10005170 3300025913 Bacteria 17468
213 Ga0207671_10073384 3300025914 Bacteria 2555
214 Ga0207657_10001579 3300025919 Bacteria 24470
215 Ga0207657_10002390 3300025919 Bacteria 20292
216 Ga0207657_10013918 3300025919 Bacteria 7869
217 Ga0207657_10016888 3300025919 Bacteria 7023
218 Ga0207646_10072118 3300025922 Bacteria 3085
219 Ga0207694_10002807 3300025924 Bacteria 14066
220 Ga0207694_10019530 3300025924 Bacteria 5123
221 Ga0207690_10002331 3300025932 Bacteria 11550
222 Ga0207706_10103574 3300025933 Bacteria 2503
223 Ga0207670_10001925 3300025936 Bacteria 10866
224 Ga0207689_10022372 3300025942 Bacteria 5316
225 Ga0207661_10026967 3300025944 Bacteria 4384
226 Ga0207667_10000301 3300025949 Bacteria 68551
227 Ga0207667_10026963 3300025949 Bacteria 6268
228 Ga0207667_10082197 3300025949 Bacteria 3337
229 Ga0207667_10222414 3300025949 Bacteria 1934
230 Ga0207651_10126470 3300025960 Bacteria 1948
231 Ga0207640_10049942 3300025981 Bacteria 2711
232 Ga0207702_10036879 3300026078 Bacteria 4090
233 Ga0207648_10047676 3300026089 Bacteria 3754
234 Ga0207674_10008273 3300026116 Bacteria 12047
235 Ga0209281_1000009 3300027111 Bacteria 771717
236 Ga0209281_1005577 3300027111 Bacteria 3467
237 Ga0209996_1000577 3300027395 Bacteria 4441
238 Ga0209984_1000805 3300027424 Bacteria 3365
239 Ga0209282_1000005 3300027666 Bacteria 380858
240 Ga0209282_1030960 3300027666 Bacteria 3287
241 Ga0209971_1000985 3300027682 Bacteria 7323
242 Ga0207428_10027897 3300027907 Bacteria 4697
243 Ga0265336_10000482 3300028666 Bacteria 23594
244 Ga0316177_1117246 3300030731 Bacteria 2262
245 Ga0316182_1439657 3300030745 Bacteria 2045
246 Ga0265325_10000558 3300031241 Bacteria 27032
247 Ga0265331_10002066 3300031250 Bacteria 13900
248 Ga0265331_10013089 3300031250 Bacteria 4468
249 Ga0265331_10049056 3300031250 Bacteria 2029
250 Ga0265327_10001058 3300031251 Bacteria 38434
251 Ga0265327_10068967 3300031251 Bacteria 1776
252 Ga0307408_100000144 3300031548 Bacteria 79329
253 Ga0307408_100001520 3300031548 Bacteria 17258
254 Ga0307408_100007461 3300031548 Bacteria 7230
255 Ga0307408_100018225 3300031548 Bacteria 4712
256 Ga0307408_100023090 3300031548 Bacteria 4233
257 Ga0316575_10000621 3300031665 Bacteria 10451
258 Ga0316579_10000051 3300031691 Bacteria 28043
259 Ga0265314_10039633 3300031711 Bacteria 3390
260 Ga0316576_10000113 3300031727 Bacteria 30303
261 Ga0316576_10159052 3300031727 Bacteria 1703
262 Ga0316578_10000041 3300031728 Bacteria 26246
263 Ga0307405_10000911 3300031731 Bacteria 11757
264 Ga0316577_10000110 3300031733 Bacteria 23020
265 Ga0316577_10080336 3300031733 Bacteria 1823
266 Ga0307413_10000448 3300031824 Bacteria 13419
267 Ga0307406_10001728 3300031901 Bacteria 11993
268 Ga0307407_10088548 3300031903 Bacteria 1891
269 Ga0307412_10012924 3300031911 Bacteria 4879
270 Ga0307409_100173526 3300031995 Bacteria 1900
271 Ga0307416_100222226 3300032002 Bacteria 1812
272 Ga0307414_10080078 3300032004 Bacteria 2387
273 Ga0316583_10000306 3300032133 Bacteria 13809
274 Ga0316585_10026286 3300032137 Bacteria 1809
275 Ga0316593_10002065 3300032168 Bacteria 4652
276 Ga0316588_1000490 3300033528 Bacteria 5395
277 Ga0316596_1000008 3300033541 Bacteria 17584
278 Ga0373923_0031443 3300035111 Bacteria 2140
279 Ga0373939_0017833 3300035114 Bacteria 1892
280 Ga0373954_0001553 3300035118 Bacteria 9348
281 Ga0373954_0019505 3300035118 Bacteria 3059
282 Ga0373956_0004281 3300035119 Bacteria 5738
283 Ga0373956_0018668 3300035119 Bacteria 2938
284 Ga0373955_0006926 3300035172 Bacteria 5185
285 Ga0316574_0000013 3300035398 Bacteria 44586
286 Ga0316574_0000846 3300035398 Bacteria 13411
287 Ga0316574_0117770 3300035398 Bacteria 1704
288 Ga0373927_0000002 3300035695 Bacteria 966219
289 Ga0373933_0001827 3300035724 Bacteria 12318
290 Ga0373937_0007981 3300036401 Bacteria 9176
291 Ga0373937_0010093 3300036401 Bacteria 8233
292 Ga0316582_0000035 3300036647 Bacteria 31472
293 Ga0395899_0006858 3300037312 Bacteria 8821
294 Ga0395899_0030059 3300037312 Bacteria 4088
295 Ga0395899_0041252 3300037312 Bacteria 3449
296 Ga0395899_0049143 3300037312 Bacteria 3136
297 Ga0395899_0057880 3300037312 Bacteria 2859
298 Ga0395899_0061641 3300037312 Bacteria 2762
299 Ga0395899_0107788 3300037312 Bacteria 2005
300 Ga0395900_0000081 3300037418 Bacteria 174128
301 Ga0395900_0000148 3300037418 Bacteria 117889
302 Ga0395900_0000826 3300037418 Bacteria 40904
303 Ga0395900_0006552 3300037418 Bacteria 12126
304 Ga0395900_0024336 3300037418 Bacteria 6200
305 Ga0395900_0027035 3300037418 Bacteria 5873
306 Ga0395900_0063387 3300037418 Bacteria 3799
307 Ga0395900_0084866 3300037418 Bacteria 3254
308 Ga0395900_0138173 3300037418 Bacteria 2496
309 Ga0395900_0155633 3300037418 Bacteria 2334
310 Ga0395900_0179912 3300037418 Bacteria 2149
311 Ga0395898_0073808 3300037466 Bacteria 3295
312 Ga0395898_0117055 3300037466 Bacteria 2553
313 Ga0395898_0167311 3300037466 Bacteria 2102
314 Ga0395898_0168670 3300037466 Bacteria 2093
315 Ga0395905_0000955 3300037471 Bacteria 37080
316 Ga0395905_0007217 3300037471 Bacteria 11081
317 Ga0395905_0062601 3300037471 Bacteria 3480
318 Ga0395901_0000033 3300038443 Bacteria 232357
319 Ga0395901_0000237 3300038443 Bacteria 69208
320 Ga0395901_0004363 3300038443 Bacteria 14273
321 Ga0395901_0045255 3300038443 Bacteria 4566
322 Ga0395901_0155649 3300038443 Bacteria 2400
323 Ga0436361_0034355 3300039447 Bacteria 6996
324 Ga0436361_0124286 3300039447 Bacteria 9919
325 Ga0436361_0406312 3300039447 Bacteria 17480
326 Ga0436361_0492958 3300039447 Bacteria 54051
327 Ga0436361_0543848 3300039447 Bacteria 100906
328 Ga0436361_0595316 3300039447 Bacteria 75842
329 Ga0436361_0867989 3300039447 Bacteria 6042
330 Ga0436361_0917310 3300039447 Bacteria 14554
331 Ga0436361_1021977 3300039447 Bacteria 9441
332 Ga0436361_1043812 3300039447 Bacteria 29698
333 Ga0439438_000055 3300041405 Bacteria 54445
334 Ga0439438_000211 3300041405 Bacteria 26697
335 Ga0439438_002332 3300041405 Bacteria 8103
336 Ga0439447_008191 3300041407 Bacteria 3253
337 Ga0439447_017238 3300041407 Bacteria 1967
338 Ga0439466_0004912 3300041411 Bacteria 5136
339 Ga0439466_0006396 3300041411 Bacteria 4479
340 Ga0439466_0010782 3300041411 Bacteria 3393
341 Ga0439465_0006696 3300041413 Bacteria 3658
342 Ga0439445_0010393 3300042004 Bacteria 2201
343 Ga0439448_0000611 3300042005 Bacteria 8402
344 Ga0439432_002598 3300042006 Bacteria 6799
345 Ga0439432_008591 3300042006 Bacteria 3584
346 Ga0439450_004105 3300042008 Bacteria 2462
347 Ga0439451_003560 3300042009 Bacteria 3155
348 Ga0439451_007784 3300042009 Bacteria 2177
349 Ga0439452_000312 3300042010 Bacteria 31041
350 Ga0439456_000296 3300042013 Bacteria 11819
351 Ga0450911_002423 3300042115 Bacteria 3661
352 Ga0450890_000399 3300042127 Bacteria 6324
353 Ga0450903_005580 3300042138 Bacteria 2101
354 Ga0450903_009443 3300042138 Bacteria 1589
355 Ga0450904_000248 3300042139 Bacteria 11756
356 Ga0450904_000833 3300042139 Bacteria 5084
357 Ga0450907_000305 3300042146 Bacteria 16483
358 Ga0450907_000521 3300042146 Bacteria 10539
359 Ga0439446_0000549 3300042156 Bacteria 7579
360 Ga0439446_0002331 3300042156 Bacteria 4543
361 Ga0439446_0017338 3300042156 Bacteria 2012
362 Ga0439458_0016339 3300042157 Bacteria 1688
363 Ga0450909_003896 3300042185 Bacteria 2125
364 Ga0439434_0000374 3300042435 Bacteria 12747
365 Ga0439434_0011316 3300042435 Bacteria 2637
366 Ga0439435_0000807 3300042436 Bacteria 5317
367 Ga0439460_0009650 3300042461 Bacteria 2454
368 Ga0451577_0000002 3300042876 Bacteria 1731375
369 Ga0451577_0000519 3300042876 Bacteria 64350
370 Ga0451577_0000659 3300042876 Bacteria 54455
371 Ga0451577_0065763 3300042876 Bacteria 3233
372 Ga0451577_0164113 3300042876 Bacteria 2001
373 Ga0451577_0184923 3300042876 Bacteria 1879
374 Ga0439440_0011199 3300042993 Bacteria 1887
375 Ga0466965_0034896 3300044683 Bacteria 2462
376 Ga0466966_0002483 3300044684 Bacteria 12076
377 Ga0466966_0008394 3300044684 Bacteria 6840
378 Ga0466966_0025244 3300044684 Bacteria 3883
379 Ga0466964_0000761 3300044706 Bacteria 10480
380 Ga0466964_0021566 3300044706 Bacteria 2493
381 Ga0453684_0000005 3300044712 Bacteria 1431632
382 Ga0453684_0000114 3300044712 Bacteria 356610
383 Ga0453684_0000296 3300044712 Bacteria 211075
384 Ga0453684_0000419 3300044712 Bacteria 173463
385 Ga0453684_0002403 3300044712 Bacteria 45636
386 Ga0453684_0003153 3300044712 Bacteria 37966
387 Ga0453684_0125283 3300044712 Bacteria 3093
388 Ga0453684_0162412 3300044712 Bacteria 2641
389 Ga0453684_0352085 3300044712 Bacteria 1660
390 Ga0466970_0018908 3300044765 Bacteria 3568
391 Ga0466957_0025989 3300044842 Bacteria 3472
392 Ga0451576_0000060 3300045051 Bacteria 290345
393 Ga0451576_0000325 3300045051 Bacteria 115644
394 Ga0451576_0000335 3300045051 Bacteria 113806
395 Ga0451576_0002565 3300045051 Bacteria 26810
396 Ga0451576_0024180 3300045051 Bacteria 6564
397 Ga0451576_0027032 3300045051 Bacteria 6166
398 Ga0451576_0047280 3300045051 Bacteria 4525
399 Ga0451576_0051302 3300045051 Bacteria 4325
400 Ga0451576_0250464 3300045051 Bacteria 1851
401 Ga0466958_0020351 3300045836 Bacteria 3868
402 Ga0466958_0137304 3300045836 Bacteria 1538
403 Ga0466967_0034719 3300045976 Bacteria 4284
404 Ga0495617_000020 3300046452 Bacteria 230257
405 Ga0495617_000055 3300046452 Bacteria 102065
406 Ga0495617_000197 3300046452 Bacteria 37981
407 Ga0495617_003442 3300046452 Bacteria 5959
408 Ga0495627_000123 3300046453 Bacteria 94862
409 Ga0495592_0075265 3300046454 Bacteria 2451
410 Ga0495603_0042535 3300046455 Bacteria 2715
411 Ga0495603_0044155 3300046455 Bacteria 2659
412 Ga0495590_0000012 3300046457 Bacteria 303377
413 Ga0495590_0004232 3300046457 Bacteria 5805
414 Ga0495590_0007215 3300046457 Bacteria 4297
415 Ga0495590_0020294 3300046457 Bacteria 2362
416 Ga0495591_004570 3300046458 Bacteria 6706
417 Ga0495629_0012440 3300046459 Bacteria 6164
418 Ga0495629_0019266 3300046459 Bacteria 4877
419 Ga0495638_0000047 3300046460 Bacteria 216004
420 Ga0495638_0000086 3300046460 Bacteria 152781
421 Ga0495638_0003375 3300046460 Bacteria 12592
422 Ga0495638_0006643 3300046460 Bacteria 8400
423 Ga0495638_0026938 3300046460 Bacteria 3724
424 Ga0495638_0038734 3300046460 Bacteria 3027
425 Ga0495638_0099067 3300046460 Bacteria 1745
426 Ga0495638_0115552 3300046460 Bacteria 1590
427 Ga0495651_0010470 3300046462 Bacteria 7126
428 Ga0495653_0000384 3300046463 Bacteria 35425
429 Ga0495653_0003276 3300046463 Bacteria 12996
430 Ga0495653_0008448 3300046463 Bacteria 8441
431 Ga0495650_0000226 3300046471 Bacteria 115930
432 Ga0495650_0000437 3300046471 Bacteria 66997
433 Ga0495650_0000462 3300046471 Bacteria 63149
434 Ga0495650_0000868 3300046471 Bacteria 35989
435 Ga0495650_0002329 3300046471 Bacteria 15710
436 Ga0495650_0003209 3300046471 Bacteria 12161
437 Ga0495650_0004798 3300046471 Bacteria 9068
438 Ga0495650_0005042 3300046471 Bacteria 8752
439 Ga0495650_0007295 3300046471 Bacteria 6682
440 Ga0495650_0028036 3300046471 Bacteria 2592
441 Ga0495580_0043628 3300046472 Bacteria 3191
442 Ga0495582_0004406 3300046473 Bacteria 7924
443 Ga0495582_0053597 3300046473 Bacteria 2225
444 Ga0495582_0054099 3300046473 Bacteria 2214
445 Ga0495605_0000018 3300046474 Bacteria 270187
446 Ga0495605_0000035 3300046474 Bacteria 208069
447 Ga0495605_0000051 3300046474 Bacteria 163067
448 Ga0495605_0000206 3300046474 Bacteria 72593
449 Ga0495605_0001176 3300046474 Bacteria 17390
450 Ga0495605_0004537 3300046474 Bacteria 8134
451 Ga0495605_0008905 3300046474 Bacteria 5657
452 Ga0495605_0032172 3300046474 Bacteria 2672
453 Ga0495639_0000378 3300046475 Bacteria 21345
454 Ga0495639_0002171 3300046475 Bacteria 8643
455 Ga0495639_0030467 3300046475 Bacteria 2398
456 Ga0495584_0000006 3300046491 Bacteria 301775
457 Ga0495584_0000150 3300046491 Bacteria 48158
458 Ga0495584_0000205 3300046491 Bacteria 42494
459 Ga0495584_0001531 3300046491 Bacteria 13751
460 Ga0495584_0003231 3300046491 Bacteria 9042
461 Ga0495584_0003885 3300046491 Bacteria 8096
462 Ga0495584_0012336 3300046491 Bacteria 4361
463 Ga0495584_0015671 3300046491 Bacteria 3865
464 Ga0495584_0020340 3300046491 Bacteria 3373
465 Ga0495584_0028955 3300046491 Bacteria 2808
466 Ga0495584_0037765 3300046491 Bacteria 2441
467 Ga0495585_0000005 3300046492 Bacteria 328103
468 Ga0495585_0000049 3300046492 Bacteria 119546
469 Ga0495585_0000184 3300046492 Bacteria 66520
470 Ga0495585_0001621 3300046492 Bacteria 17308
471 Ga0495585_0003097 3300046492 Bacteria 11429
472 Ga0495585_0005919 3300046492 Bacteria 7652
473 Ga0495585_0006119 3300046492 Bacteria 7517
474 Ga0495585_0009510 3300046492 Bacteria 5824
475 Ga0495585_0015494 3300046492 Bacteria 4431
476 Ga0495585_0019617 3300046492 Bacteria 3897
477 Ga0495585_0023218 3300046492 Bacteria 3559
478 Ga0495585_0025601 3300046492 Bacteria 3377
479 Ga0495585_0042775 3300046492 Bacteria 2535
480 Ga0495585_0066866 3300046492 Bacteria 1967
481 Ga0495594_0001450 3300046499 Bacteria 12301
482 Ga0495594_0005063 3300046499 Bacteria 6783
483 Ga0495594_0011980 3300046499 Bacteria 4511
484 Ga0495594_0030023 3300046499 Bacteria 2939
485 Ga0495596_0000033 3300046500 Bacteria 101960
486 Ga0495596_0000594 3300046500 Bacteria 22683
487 Ga0495596_0001387 3300046500 Bacteria 13907
488 Ga0495596_0001767 3300046500 Bacteria 12100
489 Ga0495596_0004603 3300046500 Bacteria 6687
490 Ga0495596_0037203 3300046500 Bacteria 1925
491 Ga0495607_0000447 3300046501 Bacteria 41522
492 Ga0495607_0000785 3300046501 Bacteria 30166
493 Ga0495607_0005007 3300046501 Bacteria 9611
494 Ga0495607_0007066 3300046501 Bacteria 7807
495 Ga0495607_0007279 3300046501 Bacteria 7676
496 Ga0495607_0023847 3300046501 Bacteria 3823
497 Ga0495607_0034727 3300046501 Bacteria 3057
498 Ga0495607_0039093 3300046501 Bacteria 2835
499 Ga0495607_0050774 3300046501 Bacteria 2412
500 Ga0495607_0060297 3300046501 Bacteria 2160
501 Ga0495583_0000008 3300046506 Bacteria 411092
502 Ga0495583_0000092 3300046506 Bacteria 158865
503 Ga0495583_0000456 3300046506 Bacteria 60762
504 Ga0495583_0000828 3300046506 Bacteria 37895
505 Ga0495583_0000903 3300046506 Bacteria 35338
506 Ga0495583_0000916 3300046506 Bacteria 34892
507 Ga0495583_0003151 3300046506 Bacteria 13002
508 Ga0495583_0003448 3300046506 Bacteria 12024
509 Ga0495583_0004073 3300046506 Bacteria 10730
510 Ga0495583_0004400 3300046506 Bacteria 10111
511 Ga0495583_0004730 3300046506 Bacteria 9574
512 Ga0495583_0005766 3300046506 Bacteria 8279
513 Ga0495606_0000066 3300046507 Bacteria 181028
514 Ga0495606_0000101 3300046507 Bacteria 146752
515 Ga0495606_0000161 3300046507 Bacteria 117607
516 Ga0495606_0000201 3300046507 Bacteria 103926
517 Ga0495606_0000716 3300046507 Bacteria 51314
518 Ga0495606_0000814 3300046507 Bacteria 47442
519 Ga0495606_0000830 3300046507 Bacteria 46705
520 Ga0495606_0002636 3300046507 Bacteria 20465
521 Ga0495606_0006442 3300046507 Bacteria 10823
522 Ga0495606_0012876 3300046507 Bacteria 6659
523 Ga0495606_0028765 3300046507 Bacteria 3914
524 Ga0495606_0041084 3300046507 Bacteria 3103
525 Ga0495606_0089356 3300046507 Bacteria 1898
526 Ga0495610_0000014 3300046512 Bacteria 444708
527 Ga0495610_0002023 3300046512 Bacteria 17347
528 Ga0495610_0007410 3300046512 Bacteria 7309
529 Ga0495610_0011341 3300046512 Bacteria 5457
530 Ga0495616_0000125 3300046513 Bacteria 66710
531 Ga0495616_0006356 3300046513 Bacteria 7161
532 Ga0495616_0008650 3300046513 Bacteria 6011
533 Ga0495616_0025433 3300046513 Bacteria 3163
534 Ga0495616_0032383 3300046513 Bacteria 2731
535 Ga0495616_0033851 3300046513 Bacteria 2658
536 Ga0495616_0052783 3300046513 Bacteria 2023
537 Ga0495616_0055464 3300046513 Bacteria 1961
538 Ga0495616_0058023 3300046513 Bacteria 1907
539 Ga0495618_0012144 3300046514 Bacteria 5227
540 Ga0495620_0004408 3300046515 Bacteria 7935
541 Ga0495628_0000315 3300046516 Bacteria 43763
542 Ga0495628_0009579 3300046516 Bacteria 8271
543 Ga0495630_0080027 3300046517 Bacteria 2465
544 Ga0495631_0000295 3300046518 Bacteria 34905
545 Ga0495631_0004077 3300046518 Bacteria 7845
546 Ga0495631_0011635 3300046518 Bacteria 4320
547 Ga0495631_0015959 3300046518 Bacteria 3589
548 Ga0495631_0018337 3300046518 Bacteria 3295
549 Ga0495632_0000029 3300046519 Bacteria 171022
550 Ga0495632_0000626 3300046519 Bacteria 32670
551 Ga0495632_0003009 3300046519 Bacteria 12300
552 Ga0495632_0063046 3300046519 Bacteria 1796
553 Ga0495637_0000293 3300046520 Bacteria 38928
554 Ga0495637_0004248 3300046520 Bacteria 7442
555 Ga0495637_0005056 3300046520 Bacteria 6777
556 Ga0495643_0000234 3300046522 Bacteria 84022
557 Ga0495643_0000237 3300046522 Bacteria 82853
558 Ga0495643_0000459 3300046522 Bacteria 51854
559 Ga0495643_0000607 3300046522 Bacteria 43153
560 Ga0495643_0003878 3300046522 Bacteria 10743
561 Ga0495643_0004720 3300046522 Bacteria 9440
562 Ga0495643_0018953 3300046522 Bacteria 3985
563 Ga0495643_0024387 3300046522 Bacteria 3431
564 Ga0495643_0033133 3300046522 Bacteria 2861
565 Ga0495644_0001185 3300046523 Bacteria 10679
566 Ga0495644_0013427 3300046523 Bacteria 3143
567 Ga0495644_0032291 3300046523 Bacteria 1978
568 Ga0495648_0000001 3300046524 Bacteria 696872
569 Ga0495648_0000019 3300046524 Bacteria 276407
570 Ga0495648_0000033 3300046524 Bacteria 199184
571 Ga0495648_0000315 3300046524 Bacteria 53425
572 Ga0495648_0001901 3300046524 Bacteria 19947
573 Ga0495648_0002606 3300046524 Bacteria 16490
574 Ga0495648_0009479 3300046524 Bacteria 7537
575 Ga0495648_0014385 3300046524 Bacteria 5796
576 Ga0495648_0030579 3300046524 Bacteria 3557
577 Ga0495663_0000588 3300046525 Bacteria 12752
578 Ga0495663_0001770 3300046525 Bacteria 6696
579 Ga0495666_0009015 3300046526 Bacteria 4989
580 Ga0495666_0040126 3300046526 Bacteria 2270
581 Ga0495666_0055932 3300046526 Bacteria 1890
582 Ga0495642_0000005 3300046528 Bacteria 176726
583 Ga0495642_0000220 3300046528 Bacteria 32909
584 Ga0495642_0000747 3300046528 Bacteria 16048
585 Ga0495642_0002263 3300046528 Bacteria 7871
586 Ga0495642_0002700 3300046528 Bacteria 7128
587 Ga0495642_0007923 3300046528 Bacteria 4069
588 Ga0495642_0012804 3300046528 Bacteria 3237
589 Ga0495652_0008518 3300046529 Bacteria 9354
590 Ga0495652_0012599 3300046529 Bacteria 7622
591 Ga0495654_0000014 3300046530 Bacteria 312126
592 Ga0495654_0000388 3300046530 Bacteria 37959
593 Ga0495654_0008041 3300046530 Bacteria 5852
594 Ga0495654_0008102 3300046530 Bacteria 5826
595 Ga0495640_0011151 3300046533 Bacteria 6919
596 Ga0495586_0030241 3300046535 Bacteria 2898
597 Ga0495587_0000142 3300046536 Bacteria 53480
598 Ga0495609_0000122 3300046538 Bacteria 87165
599 Ga0495609_0000377 3300046538 Bacteria 38049
600 Ga0495609_0000860 3300046538 Bacteria 22340
601 Ga0495609_0002035 3300046538 Bacteria 12747
602 Ga0495609_0002373 3300046538 Bacteria 11612
603 Ga0495609_0017972 3300046538 Bacteria 3280
604 Ga0495609_0034839 3300046538 Bacteria 2280
605 Ga0495621_0013216 3300046539 Bacteria 2590
606 Ga0495597_0000075 3300046542 Bacteria 86570
607 Ga0495597_0000081 3300046542 Bacteria 84083
608 Ga0495597_0000244 3300046542 Bacteria 49472
609 Ga0495597_0000980 3300046542 Bacteria 22023
610 Ga0495597_0002496 3300046542 Bacteria 11598
611 Ga0495597_0003811 3300046542 Bacteria 8575
612 Ga0495597_0006738 3300046542 Bacteria 5915
613 Ga0495597_0013484 3300046542 Bacteria 3911
614 Ga0495645_0052663 3300046543 Bacteria 2960
615 Ga0495645_0063608 3300046543 Bacteria 2671
616 Ga0495622_0000023 3300046557 Bacteria 155188
617 Ga0495622_0000037 3300046557 Bacteria 119690
618 Ga0495622_0000094 3300046557 Bacteria 79405
619 Ga0495622_0000800 3300046557 Bacteria 17443
620 Ga0495622_0010465 3300046557 Bacteria 4284
621 Ga0495622_0016990 3300046557 Bacteria 3386
622 Ga0495622_0032269 3300046557 Bacteria 2446
623 Ga0495622_0078263 3300046557 Bacteria 1523
624 Ga0495622_0090072 3300046557 Bacteria 1409
625 Ga0495633_0000073 3300046558 Bacteria 130286
626 Ga0495633_0000086 3300046558 Bacteria 124357
627 Ga0495633_0000096 3300046558 Bacteria 118933
628 Ga0495633_0000297 3300046558 Bacteria 56662
629 Ga0495633_0002689 3300046558 Bacteria 12338
630 Ga0495633_0007568 3300046558 Bacteria 6231
631 Ga0495633_0008517 3300046558 Bacteria 5764
632 Ga0495633_0014844 3300046558 Bacteria 4055
633 Ga0495633_0018060 3300046558 Bacteria 3588
634 Ga0495633_0028786 3300046558 Bacteria 2705
635 Ga0495633_0036330 3300046558 Bacteria 2361
636 Ga0495633_0060324 3300046558 Bacteria 1778
637 Ga0495633_0075118 3300046558 Bacteria 1574
638 Ga0495633_0086351 3300046558 Bacteria 1459
639 Ga0495656_0004683 3300046615 Bacteria 4698
640 Ga0495656_0006014 3300046615 Bacteria 4224
641 Ga0495656_0007988 3300046615 Bacteria 3763
642 Ga0495668_0000066 3300046616 Bacteria 178533
643 Ga0495668_0000684 3300046616 Bacteria 40835
644 Ga0495668_0001041 3300046616 Bacteria 29392
645 Ga0495668_0001514 3300046616 Bacteria 22099
646 Ga0495668_0002056 3300046616 Bacteria 17478
647 Ga0495668_0005481 3300046616 Bacteria 8585
648 Ga0495668_0006343 3300046616 Bacteria 7764
649 Ga0495668_0015334 3300046616 Bacteria 4478
650 Ga0495668_0018077 3300046616 Bacteria 4079
651 Ga0495668_0026584 3300046616 Bacteria 3283
652 Ga0495668_0042507 3300046616 Bacteria 2530
653 Ga0495668_0051149 3300046616 Bacteria 2288
654 Ga0495634_0000215 3300046642 Bacteria 53793
655 Ga0495634_0004312 3300046642 Bacteria 11213
656 Ga0495634_0024561 3300046642 Bacteria 4226
657 Ga0495611_0007154 3300046648 Bacteria 4741
658 Ga0495611_0040101 3300046648 Bacteria 2087
659 Ga0495625_0000208 3300046660 Bacteria 93861
660 Ga0495625_0000931 3300046660 Bacteria 39360
661 Ga0495625_0001872 3300046660 Bacteria 23907
662 Ga0495625_0002580 3300046660 Bacteria 19464
663 Ga0495625_0008924 3300046660 Bacteria 8474
664 Ga0495625_0024726 3300046660 Bacteria 4566
665 Ga0495625_0031448 3300046660 Bacteria 3948
666 Ga0495625_0031853 3300046660 Bacteria 3917
667 Ga0495625_0127251 3300046660 Bacteria 1728
668 Ga0495635_0000126 3300046663 Bacteria 46583
669 Ga0495659_0000277 3300046664 Bacteria 20966
670 Ga0495659_0000368 3300046664 Bacteria 17465
671 Ga0495659_0000402 3300046664 Bacteria 16623
672 Ga0495659_0001528 3300046664 Bacteria 7824
673 Ga0495659_0002879 3300046664 Bacteria 5521
674 Ga0495661_0000254 3300046665 Bacteria 61490
675 Ga0495661_0000324 3300046665 Bacteria 52421
676 Ga0495661_0000642 3300046665 Bacteria 35461
677 Ga0495661_0000654 3300046665 Bacteria 34904
678 Ga0495661_0000835 3300046665 Bacteria 28849
679 Ga0495661_0001245 3300046665 Bacteria 21981
680 Ga0495661_0003654 3300046665 Bacteria 11307
681 Ga0495661_0004933 3300046665 Bacteria 9547
682 Ga0495661_0005773 3300046665 Bacteria 8756
683 Ga0495661_0011893 3300046665 Bacteria 5892
684 Ga0495661_0012841 3300046665 Bacteria 5647
685 Ga0495661_0017135 3300046665 Bacteria 4787
686 Ga0495661_0021639 3300046665 Bacteria 4189
687 Ga0495661_0039948 3300046665 Bacteria 2913
688 Ga0495661_0041145 3300046665 Bacteria 2861
689 Ga0495661_0050005 3300046665 Bacteria 2533
690 Ga0495588_0000050 3300046674 Bacteria 335314
691 Ga0495588_0000055 3300046674 Bacteria 280059
692 Ga0495588_0010961 3300046674 Bacteria 4240
693 Ga0495588_0016620 3300046674 Bacteria 3558
694 Ga0495588_0039379 3300046674 Bacteria 2407
695 Ga0495588_0054113 3300046674 Bacteria 2070
696 Ga0495657_0028069 3300046675 Bacteria 3962
697 Ga0495657_0047663 3300046675 Bacteria 2896
698 Ga0495599_0021064 3300046678 Bacteria 4064
699 Ga0495623_0000655 3300046679 Bacteria 22971
700 Ga0495646_0023352 3300046680 Bacteria 3893
701 Ga0495646_0033669 3300046680 Bacteria 3185
702 Ga0495646_0034789 3300046680 Bacteria 3127
703 Ga0495669_0006472 3300046684 Bacteria 4893
704 Ga0495669_0030863 3300046684 Bacteria 2352
705 Ga0495669_0031588 3300046684 Bacteria 2325
706 Ga0495669_0048596 3300046684 Bacteria 1898
707 Ga0495613_0035537 3300046689 Bacteria 3697
708 Ga0495670_0000176 3300046691 Bacteria 28560
709 Ga0495670_0002053 3300046691 Bacteria 9920
710 Ga0495670_0003224 3300046691 Bacteria 8032
711 Ga0495670_0004781 3300046691 Bacteria 6652
712 Ga0495670_0006469 3300046691 Bacteria 5756
713 Ga0495670_0009249 3300046691 Bacteria 4846
714 Ga0495670_0010876 3300046691 Bacteria 4472
715 Ga0495670_0017854 3300046691 Bacteria 3494
716 Ga0495670_0026021 3300046691 Bacteria 2896
717 Ga0495670_0029129 3300046691 Bacteria 2739
718 Ga0495671_0000005 3300046692 Bacteria 509397
719 Ga0495671_0000280 3300046692 Bacteria 42762
720 Ga0495671_0000924 3300046692 Bacteria 20803
721 Ga0495671_0004548 3300046692 Bacteria 8267
722 Ga0495671_0012514 3300046692 Bacteria 4630
723 Ga0495671_0012612 3300046692 Bacteria 4610
724 Ga0495671_0012675 3300046692 Bacteria 4596
725 Ga0495671_0019116 3300046692 Bacteria 3625
726 Ga0495671_0025342 3300046692 Bacteria 3084
727 Ga0495649_0001632 3300046694 Bacteria 16686
728 Ga0495649_0001794 3300046694 Bacteria 15791
729 Ga0495649_0003129 3300046694 Bacteria 11336
730 Ga0495649_0010311 3300046694 Bacteria 5519
731 Ga0495649_0026242 3300046694 Bacteria 3242
732 Ga0495649_0048088 3300046694 Bacteria 2318
733 Ga0495649_0049279 3300046694 Bacteria 2288
734 Ga0495589_0000049 3300046794 Bacteria 116553
735 Ga0495589_0000156 3300046794 Bacteria 62672
736 Ga0495589_0000248 3300046794 Bacteria 44186
737 Ga0495589_0000917 3300046794 Bacteria 18111
738 Ga0495589_0017405 3300046794 Bacteria 3689
739 Ga0495589_0022199 3300046794 Bacteria 3240
740 Ga0495600_0001922 3300046809 Bacteria 11660
741 Ga0495600_0051551 3300046809 Bacteria 2686
742 Ga0495600_0055707 3300046809 Bacteria 2582
743 Ga0495600_0060142 3300046809 Bacteria 2481
744 Ga0495660_0000141 3300046810 Bacteria 77888
745 Ga0495660_0000167 3300046810 Bacteria 71094
746 Ga0495660_0000419 3300046810 Bacteria 35881
747 Ga0495660_0000965 3300046810 Bacteria 21003
748 Ga0495660_0002961 3300046810 Bacteria 10619
749 Ga0495660_0006369 3300046810 Bacteria 6987
750 Ga0495660_0016768 3300046810 Bacteria 4220
751 Ga0495660_0018123 3300046810 Bacteria 4048
752 Ga0495660_0020265 3300046810 Bacteria 3811
753 Ga0495660_0022455 3300046810 Bacteria 3603
754 Ga0495660_0030895 3300046810 Bacteria 3015
755 Ga0495660_0053140 3300046810 Bacteria 2200
756 Ga0495660_0067349 3300046810 Bacteria 1907
757 Ga0495581_0008329 3300047315 Bacteria 6010
758 Ga0495581_0036193 3300047315 Bacteria 2855
759 Ga0495604_0016678 3300047317 Bacteria 5874
760 Ga0495604_0075062 3300047317 Bacteria 2546
761 Ga0495636_0001381 3300047318 Bacteria 9172
762 Ga0495636_0002450 3300047318 Bacteria 7115
763 Ga0495636_0004311 3300047318 Bacteria 5583
764 Ga0495636_0013076 3300047318 Bacteria 3291
765 Ga0495636_0051182 3300047318 Bacteria 1731
766 Ga0495674_0033041 3300047319 Bacteria 4689
767 Ga0495674_0057663 3300047319 Bacteria 3398
768 Ga0495672_0000026 3300047320 Bacteria 340319
769 Ga0495672_0000226 3300047320 Bacteria 80307
770 Ga0495672_0006634 3300047320 Bacteria 8898
771 Ga0495672_0012229 3300047320 Bacteria 6001
772 Ga0495672_0012542 3300047320 Bacteria 5909
773 Ga0495672_0054516 3300047320 Bacteria 2336
774 Ga0495676_0017096 3300047321 Bacteria 6418
775 Ga0495676_0037016 3300047321 Bacteria 4067
776 Ga0495676_0037442 3300047321 Bacteria 4037
777 Ga0495680_0000251 3300047322 Bacteria 59525
778 Ga0495680_0002030 3300047322 Bacteria 21190
779 Ga0495683_0000560 3300047323 Bacteria 28049
780 Ga0495683_0004860 3300047323 Bacteria 7524
781 Ga0495683_0005240 3300047323 Bacteria 7203
782 Ga0495683_0011072 3300047323 Bacteria 4755
783 Ga0495683_0025502 3300047323 Bacteria 3030
784 Ga0495687_000024 3300047443 Bacteria 316676
785 Ga0495687_000223 3300047443 Bacteria 80309
786 Ga0495687_000930 3300047443 Bacteria 30359
787 Ga0495687_001335 3300047443 Bacteria 22983
788 Ga0495687_001979 3300047443 Bacteria 17467
789 Ga0495687_003707 3300047443 Bacteria 10857
790 Ga0495675_0001019 3300047444 Bacteria 17022
791 Ga0495675_0054684 3300047444 Bacteria 2533
792 Ga0495675_0097797 3300047444 Bacteria 1839
793 Ga0495677_0000017 3300047445 Bacteria 121483
794 Ga0495677_0000128 3300047445 Bacteria 36919
795 Ga0495677_0000136 3300047445 Bacteria 34884
796 Ga0495677_0000650 3300047445 Bacteria 14031
797 Ga0495677_0000652 3300047445 Bacteria 13994
798 Ga0495677_0002027 3300047445 Bacteria 8085
799 Ga0495677_0002804 3300047445 Bacteria 6798
800 Ga0495677_0005473 3300047445 Bacteria 4816
801 Ga0495677_0005536 3300047445 Bacteria 4783
802 Ga0495677_0006698 3300047445 Bacteria 4337
803 Ga0495677_0006725 3300047445 Bacteria 4327
804 Ga0495677_0030215 3300047445 Bacteria 1971
805 Ga0495679_005689 3300047446 Bacteria 5497
806 Ga0495679_006900 3300047446 Bacteria 4817
807 Ga0495679_013577 3300047446 Bacteria 3050
808 Ga0495685_004157 3300047447 Bacteria 4661
809 Ga0495685_006522 3300047447 Bacteria 3825
810 Ga0495685_028066 3300047447 Bacteria 1936
811 Ga0495673_0000003 3300047469 Bacteria 1491337
812 Ga0495673_0000008 3300047469 Bacteria 752462
813 Ga0495673_0000009 3300047469 Bacteria 731993
814 Ga0495673_0000012 3300047469 Bacteria 656908
815 Ga0495673_0020359 3300047469 Bacteria 3304
816 Ga0495681_0000274 3300047470 Bacteria 41155
817 Ga0495681_0002241 3300047470 Bacteria 13906
818 Ga0495681_0003096 3300047470 Bacteria 11665
819 Ga0495681_0003213 3300047470 Bacteria 11405
820 Ga0495681_0003921 3300047470 Bacteria 10260
821 Ga0495681_0006204 3300047470 Bacteria 7883
822 Ga0495681_0007023 3300047470 Bacteria 7274
823 Ga0495681_0007248 3300047470 Bacteria 7127
824 Ga0495681_0012451 3300047470 Bacteria 4996
825 Ga0495681_0029459 3300047470 Bacteria 2809
826 Ga0495681_0040933 3300047470 Bacteria 2253
827 Ga0495686_0000062 3300047472 Bacteria 235234
828 Ga0495686_0000431 3300047472 Bacteria 65240
829 Ga0495686_0001735 3300047472 Bacteria 22404
830 Ga0495686_0044360 3300047472 Bacteria 2815
831 Ga0495593_0002066 3300047673 Bacteria 11993
832 Ga0495593_0002258 3300047673 Bacteria 11560
833 Ga0495593_0022582 3300047673 Bacteria 3503
834 Ga0495593_0024738 3300047673 Bacteria 3325
835 Ga0495593_0033086 3300047673 Bacteria 2816
836 Ga0495602_0059250 3300048088 Bacteria 3343
837 Ga0495602_0179008 3300048088 Bacteria 1637
838 Ga0495614_0014150 3300048089 Bacteria 3496
839 Ga0495615_0000220 3300048090 Bacteria 12788
840 Ga0495626_0000004 3300048091 Bacteria 356599
841 Ga0495626_0000023 3300048091 Bacteria 214916
842 Ga0495626_0000202 3300048091 Bacteria 72266
843 Ga0495626_0000761 3300048091 Bacteria 29727
844 Ga0495626_0001315 3300048091 Bacteria 20219
845 Ga0495626_0001340 3300048091 Bacteria 19924
846 Ga0495626_0001461 3300048091 Bacteria 18694
847 Ga0495626_0002027 3300048091 Bacteria 14868
848 Ga0495626_0003246 3300048091 Bacteria 10526
849 Ga0495626_0005253 3300048091 Bacteria 7657
850 Ga0495626_0005437 3300048091 Bacteria 7457
851 Ga0495626_0012008 3300048091 Bacteria 4558
852 Ga0495626_0020925 3300048091 Bacteria 3253
853 Ga0495626_0024739 3300048091 Bacteria 2941
854 Ga0496100_0000756 3300048903 Bacteria 15379
855 Ga0496101_0000383 3300048904 Bacteria 29305
856 Ga0496101_0017131 3300048904 Bacteria 4909
857 Ga0496102_0000071 3300048905 Bacteria 154320
858 Ga0496102_0001689 3300048905 Bacteria 19367
859 Ga0496102_0042004 3300048905 Bacteria 4143
860 Ga0496102_0058565 3300048905 Bacteria 3520
861 Ga0496102_0197691 3300048905 Bacteria 1895
862 Ga0496102_0214526 3300048905 Bacteria 1814
863 Ga0496103_0001398 3300048906 Bacteria 16234
864 Ga0496103_0006128 3300048906 Bacteria 7186
865 Ga0496103_0029035 3300048906 Bacteria 3360
866 Ga0496103_0032432 3300048906 Bacteria 3188
867 Ga0496103_0040142 3300048906 Bacteria 2876
868 Ga0496104_0018963 3300048907 Bacteria 6285
869 Ga0496104_0221086 3300048907 Bacteria 1806
870 Ga0496105_0091603 3300048908 Bacteria 2510
871 Ga0496105_0145986 3300048908 Bacteria 1945
872 Ga0496105_0162974 3300048908 Bacteria 1830
873 Ga0496106_0006554 3300048909 Bacteria 8623
874 Ga0496106_0069807 3300048909 Bacteria 2682
875 Ga0496106_0146047 3300048909 Bacteria 1863
876 Ga0496107_0074321 3300048910 Bacteria 2473
877 Ga0496110_0000020 3300048913 Bacteria 78309
878 Ga0496110_0029331 3300048913 Bacteria 4734
879 Ga0496110_0057802 3300048913 Bacteria 3415
880 Ga0496110_0205610 3300048913 Bacteria 1789
881 Ga0496111_0031888 3300048914 Bacteria 3756
882 Ga0496112_0142181 3300048915 Bacteria 2369
883 Ga0496113_0001841 3300048916 Bacteria 12074
884 Ga0496113_0013106 3300048916 Bacteria 5599
885 Ga0496113_0162004 3300048916 Bacteria 1769
886 Ga0496114_0017245 3300048917 Bacteria 5826
887 Ga0496114_0183139 3300048917 Bacteria 1830
888 Ga0496115_0002346 3300048918 Bacteria 13577
889 Ga0496115_0002622 3300048918 Bacteria 12905
890 Ga0496115_0010819 3300048918 Bacteria 6824
891 Ga0496116_0000862 3300048919 Bacteria 37871
892 Ga0496116_0002196 3300048919 Bacteria 20783
893 Ga0496116_0008238 3300048919 Bacteria 9082
894 Ga0496116_0030500 3300048919 Bacteria 3872
895 Ga0496117_0000005 3300048920 Bacteria 777468
896 Ga0496117_0041685 3300048920 Bacteria 3359
897 Ga0496118_0000022 3300048921 Bacteria 438602
898 Ga0496118_0021757 3300048921 Bacteria 5632
899 Ga0496121_0002958 3300048924 Bacteria 24763
900 Ga0496121_0005797 3300048924 Bacteria 15671
901 Ga0496121_0009911 3300048924 Bacteria 10843
902 Ga0496121_0032250 3300048924 Bacteria 4767
903 Ga0496121_0066929 3300048924 Bacteria 2914
904 Ga0496122_0000121 3300048925 Bacteria 181589
905 Ga0496122_0000310 3300048925 Bacteria 107506
906 Ga0496122_0001042 3300048925 Bacteria 48555
907 Ga0496122_0005121 3300048925 Bacteria 15815
908 Ga0496122_0013188 3300048925 Bacteria 8117
909 Ga0496122_0013643 3300048925 Bacteria 7930
910 Ga0496122_0015222 3300048925 Bacteria 7360
911 Ga0496122_0018463 3300048925 Bacteria 6439
912 Ga0496122_0036180 3300048925 Bacteria 3999
913 Ga0496123_0000040 3300048926 Bacteria 258569
914 Ga0496123_0000312 3300048926 Bacteria 93478
915 Ga0496123_0001145 3300048926 Bacteria 39589
916 Ga0496123_0001343 3300048926 Bacteria 34736
917 Ga0496123_0006961 3300048926 Bacteria 10800
918 Ga0496123_0012033 3300048926 Bacteria 7420
919 Ga0496124_0003731 3300048927 Bacteria 18371
920 Ga0496124_0009957 3300048927 Bacteria 9712
921 Ga0496124_0026304 3300048927 Bacteria 5249
922 Ga0496124_0036882 3300048927 Bacteria 4257
923 Ga0496124_0055159 3300048927 Bacteria 3360
924 Ga0496124_0056134 3300048927 Bacteria 3323
925 Ga0496125_0000720 3300048928 Bacteria 54770
926 Ga0496125_0000995 3300048928 Bacteria 44209
927 Ga0496125_0008672 3300048928 Bacteria 10591
928 Ga0496125_0024968 3300048928 Bacteria 5483
929 Ga0496125_0091690 3300048928 Bacteria 2275
930 Ga0496126_0018447 3300048929 Bacteria 6913
931 Ga0496126_0088208 3300048929 Bacteria 2733
932 Ga0495678_000012 3300049459 Bacteria 333905
933 Ga0495678_000035 3300049459 Bacteria 200957
934 Ga0495678_000232 3300049459 Bacteria 63796
935 Ga0495678_000307 3300049459 Bacteria 52855
936 Ga0495678_002689 3300049459 Bacteria 11733
937 Ga0495678_002896 3300049459 Bacteria 11050
938 Ga0495678_006492 3300049459 Bacteria 6218
939 Ga0495678_014214 3300049459 Bacteria 3709
940 Ga0495678_043136 3300049459 Bacteria 1794
941 Ga0495682_0001282 3300049460 Bacteria 14044
942 Ga0495682_0002541 3300049460 Bacteria 8592
943 Ga0495682_0005611 3300049460 Bacteria 5192
944 Ga0495682_0008205 3300049460 Bacteria 4124
945 Ga0495682_0010351 3300049460 Bacteria 3615
946 Ga0495682_0011480 3300049460 Bacteria 3408
947 Ga0501315_001982 3300049531 Bacteria 1858
948 Ga0501034_0215818 3300049571 Bacteria 1872
949 Ga0501038_0079500 3300049574 Bacteria 2765
950 Ga0501227_001108 3300049665 Bacteria 5993
951 Ga0501269_000102 3300049766 Bacteria 26721
952 Ga0501269_000668 3300049766 Bacteria 5837
953 Ga0501279_001218 3300049775 Bacteria 3383
954 Ga0501035_0000292 3300049822 Bacteria 59353
955 Ga0501035_0003949 3300049822 Bacteria 14143
956 Ga0501044_0032695 3300049823 Bacteria 5468
957 Ga0501226_000017 3300049853 Bacteria 150879
958 nmdc:mga05p37_384856_c1 3300050507 Bacteria 1642
959 nmdc:mga0qj67_34487_c1 3300050509 Bacteria 3953
960 nmdc:mga06r32_80199_c1 3300050510 Bacteria 3176
961 nmdc:mga08x19_71357_c1 3300050514 Bacteria 2264
962 Ga0495601_0047626 3300053077 Bacteria 2699
963 Ga0495612_0063244 3300053078 Bacteria 1535
964 Ga0495595_0075439 3300053084 Bacteria 1599
965 Ga0495619_0009497 3300053085 Bacteria 6135
966 Ga0500594_0017419 3300053118 Bacteria 1759
967 Ga0500595_002845 3300053119 Bacteria 8313
968 Ga0500607_033089 3300053121 Bacteria 2835
969 Ga0500618_000069 3300053125 Bacteria 87204
970 Ga0500618_000088 3300053125 Bacteria 74892
971 Ga0500636_0004688 3300053177 Bacteria 7761

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046557 Ga0495622_0090072 Ga0495622_0090072_19_1236 405
2 3300021361 Ga0213872_10001173 Ga0213872_100011733 430
3 3300039447 Ga0436361_1043812 Ga0436361_1043812_10847_12253 430
4 3300049459 Ga0495678_000035 Ga0495678_000035_188300_189742 433
5 3300005366 Ga0070659_100000456 Ga0070659_10000045615 435
6 3300025919 Ga0207657_10001579 Ga0207657_100015794 435
7 3300025932 Ga0207690_10002331 Ga0207690_100023317 435
8 3300044712 Ga0453684_0000419 Ga0453684_0000419_46757_48151 438
9 3300046500 Ga0495596_0000594 Ga0495596_0000594_5149_6576 441
10 3300046513 Ga0495616_0032383 Ga0495616_0032383_10_1437 441
11 3300046684 Ga0495669_0030863 Ga0495669_0030863_448_1875 441
12 3300005471 Ga0070698_100001188 Ga0070698_10000118815 442
13 3300037418 Ga0395900_0000081 Ga0395900_0000081_52360_53721 442
14 3300038443 Ga0395901_0000237 Ga0395901_0000237_38144_39505 442
15 3300049822 Ga0501035_0000292 Ga0501035_0000292_2814_4175 442
16 3300049823 Ga0501044_0032695 Ga0501044_0032695_1425_2786 442
17 3300048919 Ga0496116_0030500 Ga0496116_0030500_178_1575 443
18 3300046492 Ga0495585_0023218 Ga0495585_0023218_708_2123 444
19 3300046523 Ga0495644_0013427 Ga0495644_0013427_250_1665 444
20 3300046615 Ga0495656_0007988 Ga0495656_0007988_1498_2913 444
21 3300046616 Ga0495668_0042507 Ga0495668_0042507_736_2151 444
22 3300046692 Ga0495671_0012675 Ga0495671_0012675_1175_2590 444
23 3300047470 Ga0495681_0012451 Ga0495681_0012451_1755_3170 444
24 3300049853 Ga0501226_000017 Ga0501226_000017_144965_146350 444
25 3300005340 Ga0070689_100003292 Ga0070689_10000329210 445
26 3300025936 Ga0207670_10001925 Ga0207670_1000192510 445
27 3300046459 Ga0495629_0012440 Ga0495629_0012440_3756_5411 445
28 3300047469 Ga0495673_0000003 Ga0495673_0000003_1175681_1177081 449
29 3300053125 Ga0500618_000069 Ga0500618_000069_23671_25071 449
30 iso_pu_bacteria 2643221556 2643799620 449
31 iso_pu_bacteria 2643221684 2644470760 449
32 iso_pu_bacteria 8047673197 8047677635 449
33 3300003322 rootL2_10073623 rootL2_100736236 450
34 3300003759 Ga0055525_1000047 Ga0055525_1000047172 450
35 3300025230 Ga0209563_100003 Ga0209563_100003703 450
36 3300025253 Ga0209677_102834 Ga0209677_1028343 450
37 3300025919 Ga0207657_10013918 Ga0207657_100139182 450
38 3300025933 Ga0207706_10103574 Ga0207706_101035741 450
39 3300035118 Ga0373954_0019505 Ga0373954_0019505_44_1414 450
40 3300037312 Ga0395899_0061641 Ga0395899_0061641_28_1413 450
41 3300037418 Ga0395900_0000148 Ga0395900_0000148_35438_36823 450
42 3300037418 Ga0395900_0063387 Ga0395900_0063387_911_2296 450
43 3300045836 Ga0466958_0020351 Ga0466958_0020351_2120_3505 450
44 3300046474 Ga0495605_0000051 Ga0495605_0000051_53239_54624 450
45 3300046491 Ga0495584_0000205 Ga0495584_0000205_10534_11919 450
46 3300046513 Ga0495616_0033851 Ga0495616_0033851_685_2070 450
47 3300046513 Ga0495616_0058023 Ga0495616_0058023_77_1462 450
48 3300046519 Ga0495632_0063046 Ga0495632_0063046_234_1619 450
49 3300046522 Ga0495643_0000607 Ga0495643_0000607_3713_5098 450
50 3300046543 Ga0495645_0063608 Ga0495645_0063608_626_2011 450
51 3300046665 Ga0495661_0000835 Ga0495661_0000835_25746_27131 450
52 3300046665 Ga0495661_0012841 Ga0495661_0012841_1577_2962 450
53 3300046665 Ga0495661_0021639 Ga0495661_0021639_2671_4056 450
54 3300046674 Ga0495588_0000050 Ga0495588_0000050_117828_119213 450
55 3300046794 Ga0495589_0000156 Ga0495589_0000156_53292_54677 450
56 3300046810 Ga0495660_0000141 Ga0495660_0000141_17471_18856 450
57 3300047443 Ga0495687_000223 Ga0495687_000223_19892_21277 450
58 3300047445 Ga0495677_0000128 Ga0495677_0000128_2132_3517 450
59 3300048091 Ga0495626_0000023 Ga0495626_0000023_183130_184515 450
60 3300048905 Ga0496102_0214526 Ga0496102_0214526_90_1475 450
61 3300048916 Ga0496113_0013106 Ga0496113_0013106_1514_2899 450
62 3300048925 Ga0496122_0001042 Ga0496122_0001042_3332_4717 450
63 3300048925 Ga0496122_0018463 Ga0496122_0018463_1772_3157 450
64 3300048926 Ga0496123_0012033 Ga0496123_0012033_2479_3864 450
65 3300048927 Ga0496124_0026304 Ga0496124_0026304_1244_2629 450
66 3300049766 Ga0501269_000102 Ga0501269_000102_18197_19609 450
67 iso_pu_bacteria 2548876994 2550692781 450
68 iso_pu_bacteria 2821131069 2821134873 450
69 iso_pu_bacteria 2857564685 2857567079 450
70 iso_pu_bacteria 2904424332 2904425151 450
71 3300025949 Ga0207667_10222414 Ga0207667_102224142 451
72 3300037418 Ga0395900_0155633 Ga0395900_0155633_431_1819 451
73 3300037471 Ga0395905_0062601 Ga0395905_0062601_1949_3337 451
74 3300038443 Ga0395901_0045255 Ga0395901_0045255_1755_3143 451
75 3300046457 Ga0495590_0020294 Ga0495590_0020294_277_1677 451
76 3300046463 Ga0495653_0003276 Ga0495653_0003276_5958_7352 451
77 3300046471 Ga0495650_0028036 Ga0495650_0028036_883_2313 451
78 3300046472 Ga0495580_0043628 Ga0495580_0043628_642_2036 451
79 3300046473 Ga0495582_0004406 Ga0495582_0004406_5860_7254 451
80 3300046507 Ga0495606_0012876 Ga0495606_0012876_2969_4363 451
81 3300046517 Ga0495630_0080027 Ga0495630_0080027_517_1911 451
82 3300046526 Ga0495666_0055932 Ga0495666_0055932_432_1826 451
83 3300046528 Ga0495642_0000747 Ga0495642_0000747_10162_11610 451
84 3300046529 Ga0495652_0008518 Ga0495652_0008518_7286_8680 451
85 3300046642 Ga0495634_0004312 Ga0495634_0004312_701_2095 451
86 3300046648 Ga0495611_0040101 Ga0495611_0040101_503_1933 451
87 3300046660 Ga0495625_0031448 Ga0495625_0031448_2257_3687 451
88 3300046810 Ga0495660_0053140 Ga0495660_0053140_329_1807 451
89 3300047317 Ga0495604_0016678 Ga0495604_0016678_3886_5280 451
90 3300047444 Ga0495675_0001019 Ga0495675_0001019_298_1692 451
91 3300048903 Ga0496100_0000756 Ga0496100_0000756_6601_7995 451
92 3300048904 Ga0496101_0000383 Ga0496101_0000383_20375_21769 451
93 3300048909 Ga0496106_0006554 Ga0496106_0006554_3028_4416 451
94 3300002738 JGI25154J39366_1001354 JGI25154J39366_10013542 452
95 3300003771 Ga0055526_1000665 Ga0055526_100066530 452
96 3300003773 Ga0055537_1000005 Ga0055537_100000583 452
97 3300003784 Ga0055534_1000493 Ga0055534_100049321 452
98 3300003790 Ga0055528_1000082 Ga0055528_10000823 452
99 3300005364 Ga0070673_100145510 Ga0070673_1001455102 452
100 3300005444 Ga0070694_100018247 Ga0070694_1000182472 452
101 3300005545 Ga0070695_100003126 Ga0070695_1000031262 452
102 3300005546 Ga0070696_100075642 Ga0070696_1000756422 452
103 3300006237 Ga0097621_100009059 Ga0097621_1000090596 452
104 3300006847 Ga0075431_100006058 Ga0075431_1000060589 452
105 3300006880 Ga0075429_100075068 Ga0075429_1000750683 452
106 3300025233 Ga0209437_105496 Ga0209437_1054962 452
107 3300025246 Ga0209646_1000023 Ga0209646_1000023124 452
108 3300025250 Ga0209026_1002712 Ga0209026_10027123 452
109 3300025263 Ga0209565_1000074 Ga0209565_100007472 452
110 3300025273 Ga0209673_1000129 Ga0209673_100012989 452
111 3300025291 Ga0209675_1000072 Ga0209675_100007289 452
112 3300025295 Ga0209564_1000160 Ga0209564_100016088 452
113 3300025299 Ga0209256_1000125 Ga0209256_100012589 452
114 3300025960 Ga0207651_10126470 Ga0207651_101264702 452
115 3300035111 Ga0373923_0031443 Ga0373923_0031443_560_1954 452
116 3300035114 Ga0373939_0017833 Ga0373939_0017833_409_1803 452
117 3300035119 Ga0373956_0018668 Ga0373956_0018668_155_1549 452
118 3300035724 Ga0373933_0001827 Ga0373933_0001827_7309_8703 452
119 3300036401 Ga0373937_0007981 Ga0373937_0007981_6646_8040 452
120 3300042156 Ga0439446_0017338 Ga0439446_0017338_518_1912 452
121 3300042435 Ga0439434_0011316 Ga0439434_0011316_564_1958 452
122 3300042436 Ga0439435_0000807 Ga0439435_0000807_719_2113 452
123 3300045051 Ga0451576_0000060 Ga0451576_0000060_62012_63406 452
124 3300045051 Ga0451576_0024180 Ga0451576_0024180_1625_3019 452
125 3300045836 Ga0466958_0137304 Ga0466958_0137304_14_1387 452
126 3300046459 Ga0495629_0019266 Ga0495629_0019266_663_2090 452
127 3300046460 Ga0495638_0000086 Ga0495638_0000086_95700_97118 452
128 3300046471 Ga0495650_0005042 Ga0495650_0005042_2741_4159 452
129 3300046506 Ga0495583_0000456 Ga0495583_0000456_4840_6258 452
130 3300046524 Ga0495648_0000001 Ga0495648_0000001_296412_297830 452
131 3300046538 Ga0495609_0000860 Ga0495609_0000860_15931_17349 452
132 3300046557 Ga0495622_0000094 Ga0495622_0000094_22411_23829 452
133 3300046558 Ga0495633_0000073 Ga0495633_0000073_91293_92720 452
134 3300046558 Ga0495633_0000096 Ga0495633_0000096_29094_30512 452
135 3300046675 Ga0495657_0047663 Ga0495657_0047663_1022_2416 452
136 3300047319 Ga0495674_0033041 Ga0495674_0033041_1760_3187 452
137 3300050507 nmdc:mga05p37_384856_c1 nmdc:mga05p37_384856_c1_215_1609 452
138 3300050509 nmdc:mga0qj67_34487_c1 nmdc:mga0qj67_34487_c1_1637_3034 452
139 3300050510 nmdc:mga06r32_80199_c1 nmdc:mga06r32_80199_c1_89_1486 452
140 iso_pu_bacteria 2574179768 2574432920 452
141 iso_pu_bacteria 2846037992 2846041225 452
142 3300035118 Ga0373954_0001553 Ga0373954_0001553_7427_8851 453
143 3300035119 Ga0373956_0004281 Ga0373956_0004281_4045_5469 453
144 3300035172 Ga0373955_0006926 Ga0373955_0006926_526_1950 453
145 3300036401 Ga0373937_0010093 Ga0373937_0010093_3309_4733 453
146 3300037312 Ga0395899_0049143 Ga0395899_0049143_226_1641 453
147 3300037312 Ga0395899_0107788 Ga0395899_0107788_26_1423 453
148 3300037418 Ga0395900_0138173 Ga0395900_0138173_414_1811 453
149 3300037471 Ga0395905_0000955 Ga0395905_0000955_19466_20896 453
150 3300038443 Ga0395901_0004363 Ga0395901_0004363_8568_9995 453
151 3300042876 Ga0451577_0164113 Ga0451577_0164113_600_1988 453
152 3300044684 Ga0466966_0008394 Ga0466966_0008394_603_2018 453
153 3300044712 Ga0453684_0003153 Ga0453684_0003153_4192_5574 453
154 3300044842 Ga0466957_0025989 Ga0466957_0025989_1638_3032 453
155 3300045051 Ga0451576_0000335 Ga0451576_0000335_43065_44453 453
156 3300046454 Ga0495592_0075265 Ga0495592_0075265_532_1956 453
157 3300046462 Ga0495651_0010470 Ga0495651_0010470_1677_3101 453
158 3300046473 Ga0495582_0054099 Ga0495582_0054099_266_1690 453
159 3300046474 Ga0495605_0000018 Ga0495605_0000018_191307_192704 453
160 3300046491 Ga0495584_0028955 Ga0495584_0028955_1177_2598 453
161 3300046499 Ga0495594_0001450 Ga0495594_0001450_6806_8215 453
162 3300046507 Ga0495606_0000201 Ga0495606_0000201_82426_83856 453
163 3300046512 Ga0495610_0011341 Ga0495610_0011341_2899_4341 453
164 3300046514 Ga0495618_0012144 Ga0495618_0012144_3685_5109 453
165 3300046516 Ga0495628_0009579 Ga0495628_0009579_4338_5762 453
166 3300046533 Ga0495640_0011151 Ga0495640_0011151_1301_2725 453
167 3300046558 Ga0495633_0008517 Ga0495633_0008517_2154_3569 453
168 3300046642 Ga0495634_0024561 Ga0495634_0024561_522_1946 453
169 3300046660 Ga0495625_0031853 Ga0495625_0031853_1030_2496 453
170 3300046675 Ga0495657_0028069 Ga0495657_0028069_1885_3309 453
171 3300046678 Ga0495599_0021064 Ga0495599_0021064_713_2137 453
172 3300046809 Ga0495600_0001922 Ga0495600_0001922_2315_3739 453
173 3300047319 Ga0495674_0057663 Ga0495674_0057663_1611_3035 453
174 3300047321 Ga0495676_0017096 Ga0495676_0017096_3029_4438 453
175 3300047444 Ga0495675_0054684 Ga0495675_0054684_548_1972 453
176 3300048906 Ga0496103_0006128 Ga0496103_0006128_3685_5139 453
177 3300048924 Ga0496121_0066929 Ga0496121_0066929_1386_2783 453
178 3300053078 Ga0495612_0063244 Ga0495612_0063244_35_1459 453
179 3300053084 Ga0495595_0075439 Ga0495595_0075439_106_1530 453
180 3300053085 Ga0495619_0009497 Ga0495619_0009497_3685_5109 453
181 iso_pu_bacteria 2643221603 2644031168 453
182 iso_pu_bacteria 2643221603 2644031474 453
183 iso_pu_bacteria 2808606418 2809146641 453
184 iso_pu_bacteria 2818991445 2819593687 453
185 iso_pu_bacteria 2884811622 2884815863 453
186 iso_pu_bacteria 2884836552 2884837888 453
187 iso_pu_bacteria 2884852848 2884854180 453
188 iso_pu_bacteria 2896154374 2896154703 453
189 3300002704 JGI25155J39150_1000045 JGI25155J39150_100004554 454
190 3300002705 JGI25156J39149_1000054 JGI25156J39149_100005428 454
191 3300002737 JGI25162J39368_1005488 JGI25162J39368_10054881 454
192 3300002738 JGI25154J39366_1000083 JGI25154J39366_100008328 454
193 3300002741 JGI25157J39369_1000208 JGI25157J39369_100020813 454
194 3300003322 rootL2_10051059 rootL2_100510592 454
195 3300003758 Ga0055532_1000099 Ga0055532_100009935 454
196 3300003759 Ga0055525_1000001 Ga0055525_1000001661 454
197 3300003771 Ga0055526_1000054 Ga0055526_100005472 454
198 3300005262 Ga0065165_1027437 Ga0065165_10274371 454
199 3300005293 Ga0065715_10150367 Ga0065715_101503671 454
200 3300005327 Ga0070658_10063700 Ga0070658_100637002 454
201 3300005563 Ga0068855_100039320 Ga0068855_1000393204 454
202 3300005563 Ga0068855_100046878 Ga0068855_1000468783 454
203 3300005614 Ga0068856_100050845 Ga0068856_1000508453 454
204 3300009011 Ga0105251_10018623 Ga0105251_100186233 454
205 3300009093 Ga0105240_10002667 Ga0105240_1000266716 454
206 3300009148 Ga0105243_10149259 Ga0105243_101492592 454
207 3300014497 Ga0182008_10012481 Ga0182008_100124813 454
208 3300025206 Ga0209435_100034 Ga0209435_100034112 454
209 3300025229 Ga0209147_100004 Ga0209147_100004153 454
210 3300025230 Ga0209563_100007 Ga0209563_100007438 454
211 3300025233 Ga0209437_100072 Ga0209437_100072205 454
212 3300025242 Ga0209258_100468 Ga0209258_10046834 454
213 3300025246 Ga0209646_1000118 Ga0209646_1000118112 454
214 3300025250 Ga0209026_1000106 Ga0209026_1000106112 454
215 3300025253 Ga0209677_104586 Ga0209677_1045862 454
216 3300025256 Ga0209759_1000190 Ga0209759_100019029 454
217 3300025295 Ga0209564_1000042 Ga0209564_100004267 454
218 3300025909 Ga0207705_10035388 Ga0207705_100353883 454
219 3300025911 Ga0207654_10008958 Ga0207654_100089583 454
220 3300025913 Ga0207695_10005170 Ga0207695_1000517016 454
221 3300025919 Ga0207657_10016888 Ga0207657_100168886 454
222 3300025949 Ga0207667_10026963 Ga0207667_100269633 454
223 3300026078 Ga0207702_10036879 Ga0207702_100368792 454
224 3300026089 Ga0207648_10047676 Ga0207648_100476762 454
225 3300031665 Ga0316575_10000621 Ga0316575_100006211 454
226 3300031691 Ga0316579_10000051 Ga0316579_100000518 454
227 3300031727 Ga0316576_10000113 Ga0316576_1000011328 454
228 3300031728 Ga0316578_10000041 Ga0316578_1000004127 454
229 3300031733 Ga0316577_10000110 Ga0316577_100001104 454
230 3300032137 Ga0316585_10026286 Ga0316585_100262863 454
231 3300032168 Ga0316593_10002065 Ga0316593_100020656 454
232 3300033528 Ga0316588_1000490 Ga0316588_10004902 454
233 3300033541 Ga0316596_1000008 Ga0316596_100000812 454
234 3300035398 Ga0316574_0000013 Ga0316574_0000013_23037_24422 454
235 3300035398 Ga0316574_0000846 Ga0316574_0000846_7361_8749 454
236 3300036647 Ga0316582_0000035 Ga0316582_0000035_17900_19285 454
237 3300037312 Ga0395899_0006858 Ga0395899_0006858_3633_5057 454
238 3300037312 Ga0395899_0041252 Ga0395899_0041252_412_1830 454
239 3300037312 Ga0395899_0057880 Ga0395899_0057880_884_2302 454
240 3300037418 Ga0395900_0006552 Ga0395900_0006552_5684_7108 454
241 3300037418 Ga0395900_0024336 Ga0395900_0024336_3797_5215 454
242 3300037418 Ga0395900_0027035 Ga0395900_0027035_3834_5258 454
243 3300037418 Ga0395900_0084866 Ga0395900_0084866_1516_2934 454
244 3300037418 Ga0395900_0179912 Ga0395900_0179912_300_1730 454
245 3300037466 Ga0395898_0073808 Ga0395898_0073808_115_1533 454
246 3300037466 Ga0395898_0117055 Ga0395898_0117055_991_2409 454
247 3300037466 Ga0395898_0167311 Ga0395898_0167311_351_1784 454
248 3300037466 Ga0395898_0168670 Ga0395898_0168670_289_1725 454
249 3300038443 Ga0395901_0155649 Ga0395901_0155649_230_1648 454
250 3300039447 Ga0436361_0492958 Ga0436361_0492958_25335_26732 454
251 3300042005 Ga0439448_0000611 Ga0439448_0000611_5421_6848 454
252 3300042008 Ga0439450_004105 Ga0439450_004105_477_1886 454
253 3300042157 Ga0439458_0016339 Ga0439458_0016339_244_1671 454
254 3300042876 Ga0451577_0065763 Ga0451577_0065763_1811_3202 454
255 3300042876 Ga0451577_0184923 Ga0451577_0184923_41_1432 454
256 3300044683 Ga0466965_0034896 Ga0466965_0034896_430_1866 454
257 3300044684 Ga0466966_0002483 Ga0466966_0002483_4112_5548 454
258 3300044684 Ga0466966_0025244 Ga0466966_0025244_674_2101 454
259 3300044706 Ga0466964_0000761 Ga0466964_0000761_3468_4895 454
260 3300044706 Ga0466964_0021566 Ga0466964_0021566_286_1713 454
261 3300044712 Ga0453684_0000114 Ga0453684_0000114_145000_146391 454
262 3300044712 Ga0453684_0125283 Ga0453684_0125283_1612_3003 454
263 3300045051 Ga0451576_0002565 Ga0451576_0002565_11576_12967 454
264 3300045051 Ga0451576_0027032 Ga0451576_0027032_2139_3530 454
265 3300045976 Ga0466967_0034719 Ga0466967_0034719_1337_2764 454
266 3300046474 Ga0495605_0000206 Ga0495605_0000206_37189_38640 454
267 3300046474 Ga0495605_0004537 Ga0495605_0004537_4771_6207 454
268 3300046491 Ga0495584_0003231 Ga0495584_0003231_3021_4457 454
269 3300046491 Ga0495584_0015671 Ga0495584_0015671_2190_3596 454
270 3300046492 Ga0495585_0066866 Ga0495585_0066866_177_1583 454
271 3300046500 Ga0495596_0000033 Ga0495596_0000033_95868_97274 454
272 3300046500 Ga0495596_0037203 Ga0495596_0037203_508_1902 454
273 3300046501 Ga0495607_0000785 Ga0495607_0000785_1175_2611 454
274 3300046501 Ga0495607_0005007 Ga0495607_0005007_658_2109 454
275 3300046501 Ga0495607_0007066 Ga0495607_0007066_1657_3093 454
276 3300046501 Ga0495607_0034727 Ga0495607_0034727_1363_2769 454
277 3300046506 Ga0495583_0000008 Ga0495583_0000008_340944_342326 454
278 3300046506 Ga0495583_0003448 Ga0495583_0003448_3909_5291 454
279 3300046507 Ga0495606_0000101 Ga0495606_0000101_65952_67349 454
280 3300046507 Ga0495606_0002636 Ga0495606_0002636_15000_16436 454
281 3300046507 Ga0495606_0006442 Ga0495606_0006442_1826_3226 454
282 3300046507 Ga0495606_0028765 Ga0495606_0028765_1341_2750 454
283 3300046512 Ga0495610_0002023 Ga0495610_0002023_6428_7825 454
284 3300046513 Ga0495616_0000125 Ga0495616_0000125_15158_16594 454
285 3300046522 Ga0495643_0004720 Ga0495643_0004720_3882_5333 454
286 3300046522 Ga0495643_0033133 Ga0495643_0033133_27_1448 454
287 3300046524 Ga0495648_0009479 Ga0495648_0009479_4619_6055 454
288 3300046525 Ga0495663_0000588 Ga0495663_0000588_7116_8531 454
289 3300046528 Ga0495642_0012804 Ga0495642_0012804_67_1503 454
290 3300046538 Ga0495609_0000122 Ga0495609_0000122_35616_37052 454
291 3300046539 Ga0495621_0013216 Ga0495621_0013216_177_1598 454
292 3300046557 Ga0495622_0078263 Ga0495622_0078263_13_1419 454
293 3300046558 Ga0495633_0018060 Ga0495633_0018060_1473_2879 454
294 3300046616 Ga0495668_0000684 Ga0495668_0000684_3629_5026 454
295 3300046616 Ga0495668_0051149 Ga0495668_0051149_848_2269 454
296 3300046660 Ga0495625_0001872 Ga0495625_0001872_21193_22611 454
297 3300046665 Ga0495661_0000254 Ga0495661_0000254_36855_38291 454
298 3300046665 Ga0495661_0000654 Ga0495661_0000654_10211_11647 454
299 3300046665 Ga0495661_0003654 Ga0495661_0003654_8518_9939 454
300 3300046674 Ga0495588_0000055 Ga0495588_0000055_171509_172945 454
301 3300046691 Ga0495670_0029129 Ga0495670_0029129_668_2074 454
302 3300046794 Ga0495589_0000049 Ga0495589_0000049_96584_98020 454
303 3300046794 Ga0495589_0000248 Ga0495589_0000248_5435_6886 454
304 3300046810 Ga0495660_0000167 Ga0495660_0000167_32455_33906 454
305 3300046810 Ga0495660_0030895 Ga0495660_0030895_232_1641 454
306 3300047318 Ga0495636_0004311 Ga0495636_0004311_3168_4550 454
307 3300047318 Ga0495636_0051182 Ga0495636_0051182_40_1455 454
308 3300047443 Ga0495687_000024 Ga0495687_000024_35616_37052 454
309 3300047443 Ga0495687_000930 Ga0495687_000930_27260_28696 454
310 3300047443 Ga0495687_001335 Ga0495687_001335_4685_6136 454
311 3300047445 Ga0495677_0000017 Ga0495677_0000017_84439_85875 454
312 3300047445 Ga0495677_0006725 Ga0495677_0006725_738_2189 454
313 3300047472 Ga0495686_0044360 Ga0495686_0044360_282_1679 454
314 3300047673 Ga0495593_0002066 Ga0495593_0002066_8267_9697 454
315 3300048090 Ga0495615_0000220 Ga0495615_0000220_7545_8960 454
316 3300048091 Ga0495626_0000202 Ga0495626_0000202_33754_35205 454
317 3300048091 Ga0495626_0000761 Ga0495626_0000761_23193_24629 454
318 3300048905 Ga0496102_0042004 Ga0496102_0042004_2045_3466 454
319 3300048905 Ga0496102_0058565 Ga0496102_0058565_1254_2636 454
320 3300048905 Ga0496102_0197691 Ga0496102_0197691_125_1552 454
321 3300048906 Ga0496103_0032432 Ga0496103_0032432_684_2066 454
322 3300048906 Ga0496103_0040142 Ga0496103_0040142_27_1409 454
323 3300048908 Ga0496105_0091603 Ga0496105_0091603_246_1667 454
324 3300048908 Ga0496105_0162974 Ga0496105_0162974_14_1441 454
325 3300048913 Ga0496110_0205610 Ga0496110_0205610_148_1569 454
326 3300048915 Ga0496112_0142181 Ga0496112_0142181_488_1912 454
327 3300048916 Ga0496113_0162004 Ga0496113_0162004_155_1591 454
328 3300048919 Ga0496116_0002196 Ga0496116_0002196_10598_12016 454
329 3300048925 Ga0496122_0000121 Ga0496122_0000121_36827_38245 454
330 3300048925 Ga0496122_0013188 Ga0496122_0013188_4677_6101 454
331 3300048925 Ga0496122_0015222 Ga0496122_0015222_4659_6095 454
332 3300048926 Ga0496123_0000040 Ga0496123_0000040_37127_38545 454
333 3300048926 Ga0496123_0001343 Ga0496123_0001343_28218_29654 454
334 3300048927 Ga0496124_0003731 Ga0496124_0003731_4641_6077 454
335 3300048927 Ga0496124_0009957 Ga0496124_0009957_695_2119 454
336 3300048927 Ga0496124_0036882 Ga0496124_0036882_149_1597 454
337 3300048927 Ga0496124_0055159 Ga0496124_0055159_1153_2550 454
338 3300048928 Ga0496125_0000720 Ga0496125_0000720_23146_24564 454
339 3300049531 Ga0501315_001982 Ga0501315_001982_279_1688 454
340 iso_pu_bacteria 2643221556 2643800033 454
341 iso_pu_bacteria 2643221684 2644475033 454
342 iso_pu_bacteria 2738541297 2738826318 454
343 iso_pu_bacteria 2738541357 2739150115 454
344 iso_pu_bacteria 2738543003 2739192034 454
345 iso_pu_bacteria 2738543026 2739318511 454
346 iso_pu_bacteria 2738543029 2739336752 454
347 iso_pu_bacteria 2818991436 2819541456 454
348 iso_pu_bacteria 2857564685 2857569740 454
349 iso_pu_bacteria 2919476304 2919476519 454
350 iso_pu_bacteria 8047673197 8047673541 454
351 3300005445 Ga0070708_100000083 Ga0070708_10000008341 455
352 3300005458 Ga0070681_10008565 Ga0070681_100085658 455
353 3300005468 Ga0070707_100056100 Ga0070707_1000561002 455
354 3300005536 Ga0070697_100059601 Ga0070697_1000596013 455
355 3300005834 Ga0068851_10002096 Ga0068851_100020966 455
356 3300013102 Ga0157371_10000060 Ga0157371_1000006063 455
357 3300021361 Ga0213872_10006343 Ga0213872_100063433 455
358 3300021361 Ga0213872_10009009 Ga0213872_100090094 455
359 3300025912 Ga0207707_10018908 Ga0207707_100189082 455
360 3300025922 Ga0207646_10072118 Ga0207646_100721183 455
361 3300028666 Ga0265336_10000482 Ga0265336_1000048216 455
362 3300030731 Ga0316177_1117246 Ga0316177_11172462 455
363 3300030745 Ga0316182_1439657 Ga0316182_14396572 455
364 3300031241 Ga0265325_10000558 Ga0265325_1000055813 455
365 3300031250 Ga0265331_10002066 Ga0265331_100020665 455
366 3300031250 Ga0265331_10013089 Ga0265331_100130894 455
367 3300031250 Ga0265331_10049056 Ga0265331_100490561 455
368 3300031251 Ga0265327_10001058 Ga0265327_1000105826 455
369 3300031251 Ga0265327_10068967 Ga0265327_100689671 455
370 3300032133 Ga0316583_10000306 Ga0316583_100003068 455
371 3300037312 Ga0395899_0030059 Ga0395899_0030059_902_2323 455
372 3300039447 Ga0436361_0867989 Ga0436361_0867989_2369_3775 455
373 3300039447 Ga0436361_1021977 Ga0436361_1021977_5384_6790 455
374 3300042139 Ga0450904_000833 Ga0450904_000833_2520_3974 455
375 3300042876 Ga0451577_0000002 Ga0451577_0000002_1363954_1365357 455
376 3300042876 Ga0451577_0000519 Ga0451577_0000519_52987_54381 455
377 3300042876 Ga0451577_0000659 Ga0451577_0000659_41210_42616 455
378 3300044712 Ga0453684_0000005 Ga0453684_0000005_1377224_1378618 455
379 3300044712 Ga0453684_0000296 Ga0453684_0000296_45687_47081 455
380 3300044712 Ga0453684_0002403 Ga0453684_0002403_11513_12907 455
381 3300044712 Ga0453684_0162412 Ga0453684_0162412_41_1435 455
382 3300044712 Ga0453684_0352085 Ga0453684_0352085_31_1584 455
383 3300044765 Ga0466970_0018908 Ga0466970_0018908_582_2006 455
384 3300045051 Ga0451576_0000325 Ga0451576_0000325_88567_89961 455
385 3300045051 Ga0451576_0047280 Ga0451576_0047280_2910_4304 455
386 3300045051 Ga0451576_0051302 Ga0451576_0051302_112_1503 455
387 3300046452 Ga0495617_000197 Ga0495617_000197_27615_29051 455
388 3300046455 Ga0495603_0042535 Ga0495603_0042535_862_2304 455
389 3300046460 Ga0495638_0003375 Ga0495638_0003375_6494_7942 455
390 3300046473 Ga0495582_0053597 Ga0495582_0053597_221_1657 455
391 3300046474 Ga0495605_0008905 Ga0495605_0008905_2556_3977 455
392 3300046491 Ga0495584_0000006 Ga0495584_0000006_271117_272553 455
393 3300046491 Ga0495584_0000150 Ga0495584_0000150_41791_43227 455
394 3300046491 Ga0495584_0003885 Ga0495584_0003885_4827_6269 455
395 3300046491 Ga0495584_0020340 Ga0495584_0020340_1289_2710 455
396 3300046491 Ga0495584_0037765 Ga0495584_0037765_219_1667 455
397 3300046492 Ga0495585_0000005 Ga0495585_0000005_299029_300465 455
398 3300046492 Ga0495585_0000049 Ga0495585_0000049_31877_33313 455
399 3300046492 Ga0495585_0000184 Ga0495585_0000184_60272_61708 455
400 3300046492 Ga0495585_0006119 Ga0495585_0006119_488_1924 455
401 3300046492 Ga0495585_0015494 Ga0495585_0015494_1907_3349 455
402 3300046492 Ga0495585_0025601 Ga0495585_0025601_1586_3022 455
403 3300046492 Ga0495585_0042775 Ga0495585_0042775_246_1694 455
404 3300046499 Ga0495594_0005063 Ga0495594_0005063_965_2407 455
405 3300046500 Ga0495596_0004603 Ga0495596_0004603_478_1914 455
406 3300046506 Ga0495583_0000828 Ga0495583_0000828_31579_33000 455
407 3300046506 Ga0495583_0000903 Ga0495583_0000903_3480_4916 455
408 3300046506 Ga0495583_0004730 Ga0495583_0004730_4313_5713 455
409 3300046507 Ga0495606_0041084 Ga0495606_0041084_1150_2586 455
410 3300046507 Ga0495606_0089356 Ga0495606_0089356_146_1594 455
411 3300046513 Ga0495616_0052783 Ga0495616_0052783_449_1891 455
412 3300046515 Ga0495620_0004408 Ga0495620_0004408_4660_6096 455
413 3300046518 Ga0495631_0011635 Ga0495631_0011635_431_1912 455
414 3300046519 Ga0495632_0003009 Ga0495632_0003009_4072_5481 455
415 3300046524 Ga0495648_0000033 Ga0495648_0000033_170114_171550 455
416 3300046525 Ga0495663_0001770 Ga0495663_0001770_5098_6579 455
417 3300046526 Ga0495666_0040126 Ga0495666_0040126_443_2140 455
418 3300046528 Ga0495642_0002700 Ga0495642_0002700_4031_5467 455
419 3300046528 Ga0495642_0007923 Ga0495642_0007923_2593_4041 455
420 3300046535 Ga0495586_0030241 Ga0495586_0030241_1356_2792 455
421 3300046538 Ga0495609_0034839 Ga0495609_0034839_381_1781 455
422 3300046542 Ga0495597_0000980 Ga0495597_0000980_5579_7027 455
423 3300046542 Ga0495597_0003811 Ga0495597_0003811_4612_6054 455
424 3300046542 Ga0495597_0013484 Ga0495597_0013484_1669_3117 455
425 3300046557 Ga0495622_0010465 Ga0495622_0010465_586_2283 455
426 3300046558 Ga0495633_0002689 Ga0495633_0002689_2299_3735 455
427 3300046558 Ga0495633_0007568 Ga0495633_0007568_4499_5932 455
428 3300046558 Ga0495633_0014844 Ga0495633_0014844_642_2090 455
429 3300046558 Ga0495633_0028786 Ga0495633_0028786_1142_2551 455
430 3300046558 Ga0495633_0075118 Ga0495633_0075118_87_1523 455
431 3300046616 Ga0495668_0005481 Ga0495668_0005481_2527_3963 455
432 3300046648 Ga0495611_0007154 Ga0495611_0007154_1426_2868 455
433 3300046660 Ga0495625_0024726 Ga0495625_0024726_2022_3458 455
434 3300046665 Ga0495661_0004933 Ga0495661_0004933_4428_5867 455
435 3300046665 Ga0495661_0041145 Ga0495661_0041145_190_1623 455
436 3300046674 Ga0495588_0054113 Ga0495588_0054113_76_1542 455
437 3300046684 Ga0495669_0048596 Ga0495669_0048596_317_1738 455
438 3300046691 Ga0495670_0003224 Ga0495670_0003224_1933_3369 455
439 3300046691 Ga0495670_0004781 Ga0495670_0004781_1896_3329 455
440 3300046691 Ga0495670_0017854 Ga0495670_0017854_136_1578 455
441 3300046691 Ga0495670_0026021 Ga0495670_0026021_1413_2861 455
442 3300046794 Ga0495589_0022199 Ga0495589_0022199_244_1644 455
443 3300046809 Ga0495600_0055707 Ga0495600_0055707_581_2278 455
444 3300047315 Ga0495581_0036193 Ga0495581_0036193_353_1789 455
445 3300047317 Ga0495604_0075062 Ga0495604_0075062_180_1616 455
446 3300047318 Ga0495636_0002450 Ga0495636_0002450_1642_3084 455
447 3300047320 Ga0495672_0054516 Ga0495672_0054516_125_1546 455
448 3300047321 Ga0495676_0037016 Ga0495676_0037016_2286_3728 455
449 3300047321 Ga0495676_0037442 Ga0495676_0037442_2276_3709 455
450 3300047323 Ga0495683_0000560 Ga0495683_0000560_2355_3791 455
451 3300047323 Ga0495683_0025502 Ga0495683_0025502_1136_2545 455
452 3300047444 Ga0495675_0097797 Ga0495675_0097797_260_1696 455
453 3300047445 Ga0495677_0000136 Ga0495677_0000136_4768_6168 455
454 3300047445 Ga0495677_0002027 Ga0495677_0002027_2057_3505 455
455 3300047445 Ga0495677_0030215 Ga0495677_0030215_354_1763 455
456 3300047446 Ga0495679_013577 Ga0495679_013577_1062_2471 455
457 3300047470 Ga0495681_0006204 Ga0495681_0006204_4181_5629 455
458 3300047470 Ga0495681_0007248 Ga0495681_0007248_5402_6811 455
459 3300047673 Ga0495593_0002258 Ga0495593_0002258_1639_3105 455
460 3300047673 Ga0495593_0033086 Ga0495593_0033086_296_1993 455
461 3300048091 Ga0495626_0005253 Ga0495626_0005253_5039_6475 455
462 3300048091 Ga0495626_0012008 Ga0495626_0012008_1895_3343 455
463 3300048907 Ga0496104_0018963 Ga0496104_0018963_3166_4596 455
464 3300048909 Ga0496106_0146047 Ga0496106_0146047_205_1656 455
465 3300048913 Ga0496110_0029331 Ga0496110_0029331_2602_4032 455
466 3300048918 Ga0496115_0002622 Ga0496115_0002622_2472_3926 455
467 3300049460 Ga0495682_0002541 Ga0495682_0002541_109_1557 455
468 3300053121 Ga0500607_033089 Ga0500607_033089_729_2201 455
469 3300053177 Ga0500636_0004688 Ga0500636_0004688_6209_7669 455
470 iso_pu_bacteria 2511231003 2511250390 455
471 iso_pu_bacteria 2643221554 2643792459 455
472 iso_pu_bacteria 2643221638 2644217024 455
473 iso_pu_bacteria 2842711865 2842715723 455
474 iso_pu_bacteria 2998344455 2998348186 455
475 3300002704 JGI25155J39150_1000298 JGI25155J39150_10002981 456
476 3300002705 JGI25156J39149_1002751 JGI25156J39149_10027516 456
477 3300002738 JGI25154J39366_1000128 JGI25154J39366_100012831 456
478 3300004625 Ga0055543_1002381 Ga0055543_10023812 456
479 3300005262 Ga0065165_1000034 Ga0065165_1000034128 456
480 3300009036 Ga0105244_10002927 Ga0105244_100029277 456
481 3300025206 Ga0209435_100115 Ga0209435_10011511 456
482 3300025246 Ga0209646_1000155 Ga0209646_100015543 456
483 3300025250 Ga0209026_1000769 Ga0209026_100076911 456
484 3300025256 Ga0209759_1000375 Ga0209759_100037533 456
485 3300025284 Ga0209130_1000016 Ga0209130_100001680 456
486 3300025302 Ga0207426_1016649 Ga0207426_10166492 456
487 3300025728 Ga0207655_1002948 Ga0207655_10029485 456
488 3300046457 Ga0495590_0004232 Ga0495590_0004232_259_1665 456
489 3300046460 Ga0495638_0006643 Ga0495638_0006643_4303_5709 456
490 3300046471 Ga0495650_0000437 Ga0495650_0000437_32239_33645 456
491 3300046471 Ga0495650_0002329 Ga0495650_0002329_11661_13067 456
492 3300046471 Ga0495650_0004798 Ga0495650_0004798_1608_3017 456
493 3300046491 Ga0495584_0001531 Ga0495584_0001531_4939_6345 456
494 3300046492 Ga0495585_0019617 Ga0495585_0019617_1443_2900 456
495 3300046506 Ga0495583_0005766 Ga0495583_0005766_267_1673 456
496 3300046513 Ga0495616_0006356 Ga0495616_0006356_4066_5472 456
497 3300046518 Ga0495631_0018337 Ga0495631_0018337_1777_3204 456
498 3300046522 Ga0495643_0000459 Ga0495643_0000459_4472_5911 456
499 3300046538 Ga0495609_0002035 Ga0495609_0002035_7264_8670 456
500 3300046558 Ga0495633_0036330 Ga0495633_0036330_178_1635 456
501 3300046616 Ga0495668_0000066 Ga0495668_0000066_95779_97233 456
502 3300046616 Ga0495668_0001514 Ga0495668_0001514_19408_20814 456
503 3300046616 Ga0495668_0006343 Ga0495668_0006343_3541_4947 456
504 3300046660 Ga0495625_0000931 Ga0495625_0000931_31905_33311 456
505 3300046660 Ga0495625_0002580 Ga0495625_0002580_15099_16505 456
506 3300046664 Ga0495659_0000368 Ga0495659_0000368_15099_16505 456
507 3300046665 Ga0495661_0001245 Ga0495661_0001245_4348_5754 456
508 3300046665 Ga0495661_0017135 Ga0495661_0017135_630_2084 456
509 3300046684 Ga0495669_0006472 Ga0495669_0006472_1598_3004 456
510 3300046694 Ga0495649_0001632 Ga0495649_0001632_360_1766 456
511 3300046810 Ga0495660_0006369 Ga0495660_0006369_1211_2617 456
512 3300047318 Ga0495636_0001381 Ga0495636_0001381_7407_8813 456
513 3300047318 Ga0495636_0013076 Ga0495636_0013076_392_1849 456
514 3300047443 Ga0495687_003707 Ga0495687_003707_1654_3060 456
515 3300047445 Ga0495677_0000650 Ga0495677_0000650_5219_6625 456
516 3300047445 Ga0495677_0005536 Ga0495677_0005536_505_1962 456
517 3300047447 Ga0495685_004157 Ga0495685_004157_124_1530 456
518 3300047470 Ga0495681_0003096 Ga0495681_0003096_2853_4259 456
519 3300047472 Ga0495686_0000062 Ga0495686_0000062_191014_192468 456
520 3300048091 Ga0495626_0001340 Ga0495626_0001340_1927_3366 456
521 3300048091 Ga0495626_0002027 Ga0495626_0002027_4544_6010 456
522 3300048905 Ga0496102_0000071 Ga0496102_0000071_72875_74308 456
523 3300048906 Ga0496103_0029035 Ga0496103_0029035_1666_3075 456
524 3300048913 Ga0496110_0000020 Ga0496110_0000020_72042_73478 456
525 3300048924 Ga0496121_0009911 Ga0496121_0009911_526_1956 456
526 3300048928 Ga0496125_0091690 Ga0496125_0091690_74_1480 456
527 3300049459 Ga0495678_014214 Ga0495678_014214_1828_3282 456
528 iso_pu_bacteria 2511231026 2511384657 456
529 iso_pu_bacteria 2521172590 2521559102 456
530 iso_pu_bacteria 2551306416 2553003914 456
531 iso_pu_bacteria 2765235838 2765570305 456
532 iso_pu_bacteria 2808606386 2808981410 456
533 iso_pu_bacteria 2808606415 2809128995 456
534 iso_pu_bacteria 2808606419 2809148615 456
535 iso_pu_bacteria 2818991449 2819615612 456
536 iso_pu_bacteria 2839094727 2839096751 456
537 iso_pu_bacteria 2852618963 2852621149 456
538 iso_pu_bacteria 2904439833 2904444835 456
539 iso_pu_bacteria 2904530477 2904532349 456
540 iso_pu_bacteria 2904584206 2904584791 456
541 iso_pu_bacteria 2904589729 2904591313 456
542 iso_pu_bacteria 2904601388 2904605144 456
543 iso_pu_bacteria 2919046199 2919048312 456
544 iso_pu_bacteria 2919079590 2919081162 456
545 iso_pu_bacteria 2923510766 2923512773 456
546 iso_pu_bacteria 2928130867 2928132774 456
547 3300003763 Ga0055529_1000015 Ga0055529_1000015180 457
548 3300003771 Ga0055526_1000007 Ga0055526_1000007215 457
549 3300006946 Ga0079104_1007192 Ga0079104_10071922 457
550 3300014969 Ga0157376_10141564 Ga0157376_101415642 457
551 3300015261 Ga0182006_1000023 Ga0182006_1000023164 457
552 3300015261 Ga0182006_1005019 Ga0182006_10050193 457
553 3300015265 Ga0182005_1000006 Ga0182005_1000006122 457
554 3300015265 Ga0182005_1000529 Ga0182005_100052916 457
555 3300021361 Ga0213872_10000087 Ga0213872_1000008729 457
556 3300021361 Ga0213872_10004189 Ga0213872_100041896 457
557 3300021361 Ga0213872_10005483 Ga0213872_100054833 457
558 3300025246 Ga0209646_1000042 Ga0209646_1000042283 457
559 3300025272 Ga0209455_1000031 Ga0209455_1000031181 457
560 3300025294 Ga0209025_1006762 Ga0209025_10067625 457
561 3300025295 Ga0209564_1000010 Ga0209564_1000010460 457
562 3300025297 Ga0209758_1000379 Ga0209758_100037966 457
563 3300025728 Ga0207655_1008980 Ga0207655_10089803 457
564 3300027111 Ga0209281_1005577 Ga0209281_10055772 457
565 3300031711 Ga0265314_10039633 Ga0265314_100396333 457
566 3300037418 Ga0395900_0000826 Ga0395900_0000826_19525_20994 457
567 3300037471 Ga0395905_0007217 Ga0395905_0007217_7395_8852 457
568 3300038443 Ga0395901_0000033 Ga0395901_0000033_163265_164734 457
569 3300039447 Ga0436361_0406312 Ga0436361_0406312_14513_15955 457
570 3300039447 Ga0436361_0543848 Ga0436361_0543848_66168_67619 457
571 3300039447 Ga0436361_0595316 Ga0436361_0595316_46034_47473 457
572 3300039447 Ga0436361_0917310 Ga0436361_0917310_9915_11366 457
573 3300045051 Ga0451576_0250464 Ga0451576_0250464_147_1550 457
574 3300046452 Ga0495617_000020 Ga0495617_000020_179438_180850 457
575 3300046452 Ga0495617_000055 Ga0495617_000055_46187_47665 457
576 3300046453 Ga0495627_000123 Ga0495627_000123_46854_48332 457
577 3300046457 Ga0495590_0000012 Ga0495590_0000012_172631_174046 457
578 3300046460 Ga0495638_0000047 Ga0495638_0000047_144127_145542 457
579 3300046460 Ga0495638_0026938 Ga0495638_0026938_2218_3636 457
580 3300046460 Ga0495638_0099067 Ga0495638_0099067_290_1702 457
581 3300046460 Ga0495638_0115552 Ga0495638_0115552_42_1484 457
582 3300046463 Ga0495653_0000384 Ga0495653_0000384_29485_30900 457
583 3300046471 Ga0495650_0000226 Ga0495650_0000226_105634_107076 457
584 3300046471 Ga0495650_0000462 Ga0495650_0000462_6576_7988 457
585 3300046471 Ga0495650_0000868 Ga0495650_0000868_30522_31937 457
586 3300046471 Ga0495650_0003209 Ga0495650_0003209_4345_5757 457
587 3300046474 Ga0495605_0000035 Ga0495605_0000035_147657_149135 457
588 3300046474 Ga0495605_0032172 Ga0495605_0032172_929_2350 457
589 3300046492 Ga0495585_0001621 Ga0495585_0001621_4351_5763 457
590 3300046492 Ga0495585_0003097 Ga0495585_0003097_4894_6348 457
591 3300046500 Ga0495596_0001387 Ga0495596_0001387_5520_6971 457
592 3300046500 Ga0495596_0001767 Ga0495596_0001767_4618_6096 457
593 3300046501 Ga0495607_0000447 Ga0495607_0000447_5567_6982 457
594 3300046501 Ga0495607_0023847 Ga0495607_0023847_1378_2856 457
595 3300046501 Ga0495607_0050774 Ga0495607_0050774_384_1826 457
596 3300046506 Ga0495583_0000092 Ga0495583_0000092_68070_69485 457
597 3300046506 Ga0495583_0003151 Ga0495583_0003151_4191_5633 457
598 3300046506 Ga0495583_0004073 Ga0495583_0004073_4594_6003 457
599 3300046506 Ga0495583_0004400 Ga0495583_0004400_2709_4151 457
600 3300046507 Ga0495606_0000066 Ga0495606_0000066_115758_117200 457
601 3300046507 Ga0495606_0000161 Ga0495606_0000161_71238_72650 457
602 3300046507 Ga0495606_0000814 Ga0495606_0000814_21258_22673 457
603 3300046512 Ga0495610_0000014 Ga0495610_0000014_76034_77446 457
604 3300046512 Ga0495610_0007410 Ga0495610_0007410_3836_5248 457
605 3300046513 Ga0495616_0008650 Ga0495616_0008650_4164_5642 457
606 3300046516 Ga0495628_0000315 Ga0495628_0000315_32371_33789 457
607 3300046518 Ga0495631_0000295 Ga0495631_0000295_13900_15342 457
608 3300046518 Ga0495631_0004077 Ga0495631_0004077_3649_5103 457
609 3300046519 Ga0495632_0000029 Ga0495632_0000029_108486_109928 457
610 3300046520 Ga0495637_0000293 Ga0495637_0000293_12757_14169 457
611 3300046522 Ga0495643_0000234 Ga0495643_0000234_68798_70219 457
612 3300046522 Ga0495643_0000237 Ga0495643_0000237_77272_78687 457
613 3300046522 Ga0495643_0003878 Ga0495643_0003878_1807_3228 457
614 3300046523 Ga0495644_0001185 Ga0495644_0001185_1495_2937 457
615 3300046524 Ga0495648_0000019 Ga0495648_0000019_202290_203705 457
616 3300046524 Ga0495648_0000315 Ga0495648_0000315_46826_48304 457
617 3300046524 Ga0495648_0001901 Ga0495648_0001901_5316_6758 457
618 3300046524 Ga0495648_0014385 Ga0495648_0014385_2084_3496 457
619 3300046524 Ga0495648_0030579 Ga0495648_0030579_1229_2650 457
620 3300046528 Ga0495642_0000005 Ga0495642_0000005_109817_111295 457
621 3300046528 Ga0495642_0002263 Ga0495642_0002263_2237_3652 457
622 3300046529 Ga0495652_0012599 Ga0495652_0012599_3415_4833 457
623 3300046530 Ga0495654_0000014 Ga0495654_0000014_24773_26185 457
624 3300046530 Ga0495654_0008102 Ga0495654_0008102_4070_5482 457
625 3300046538 Ga0495609_0000377 Ga0495609_0000377_26002_27444 457
626 3300046542 Ga0495597_0000075 Ga0495597_0000075_56227_57642 457
627 3300046542 Ga0495597_0000081 Ga0495597_0000081_78457_79869 457
628 3300046542 Ga0495597_0000244 Ga0495597_0000244_8504_9961 457
629 3300046542 Ga0495597_0002496 Ga0495597_0002496_5389_6819 457
630 3300046543 Ga0495645_0052663 Ga0495645_0052663_653_2071 457
631 3300046557 Ga0495622_0000023 Ga0495622_0000023_149043_150584 457
632 3300046557 Ga0495622_0000037 Ga0495622_0000037_73342_74757 457
633 3300046558 Ga0495633_0000086 Ga0495633_0000086_14359_15774 457
634 3300046558 Ga0495633_0000297 Ga0495633_0000297_40433_41866 457
635 3300046558 Ga0495633_0086351 Ga0495633_0086351_20_1432 457
636 3300046616 Ga0495668_0001041 Ga0495668_0001041_23721_25136 457
637 3300046616 Ga0495668_0002056 Ga0495668_0002056_11791_13203 457
638 3300046616 Ga0495668_0015334 Ga0495668_0015334_1607_3058 457
639 3300046616 Ga0495668_0018077 Ga0495668_0018077_1294_2736 457
640 3300046660 Ga0495625_0000208 Ga0495625_0000208_4197_5612 457
641 3300046660 Ga0495625_0008924 Ga0495625_0008924_3976_5397 457
642 3300046660 Ga0495625_0127251 Ga0495625_0127251_155_1597 457
643 3300046665 Ga0495661_0000324 Ga0495661_0000324_5252_6706 457
644 3300046665 Ga0495661_0000642 Ga0495661_0000642_4732_6165 457
645 3300046665 Ga0495661_0011893 Ga0495661_0011893_1302_2780 457
646 3300046665 Ga0495661_0039948 Ga0495661_0039948_1349_2782 457
647 3300046665 Ga0495661_0050005 Ga0495661_0050005_1077_2489 457
648 3300046674 Ga0495588_0016620 Ga0495588_0016620_1092_2570 457
649 3300046674 Ga0495588_0039379 Ga0495588_0039379_131_1582 457
650 3300046680 Ga0495646_0033669 Ga0495646_0033669_1011_2429 457
651 3300046680 Ga0495646_0034789 Ga0495646_0034789_1445_2863 457
652 3300046691 Ga0495670_0002053 Ga0495670_0002053_3573_5027 457
653 3300046691 Ga0495670_0010876 Ga0495670_0010876_736_2214 457
654 3300046692 Ga0495671_0000005 Ga0495671_0000005_370697_372109 457
655 3300046692 Ga0495671_0004548 Ga0495671_0004548_4780_6258 457
656 3300046692 Ga0495671_0012514 Ga0495671_0012514_1656_3098 457
657 3300046692 Ga0495671_0012612 Ga0495671_0012612_1508_2959 457
658 3300046692 Ga0495671_0019116 Ga0495671_0019116_1731_3143 457
659 3300046692 Ga0495671_0025342 Ga0495671_0025342_213_1634 457
660 3300046694 Ga0495649_0003129 Ga0495649_0003129_4120_5541 457
661 3300046694 Ga0495649_0048088 Ga0495649_0048088_690_2117 457
662 3300046694 Ga0495649_0049279 Ga0495649_0049279_604_2016 457
663 3300046794 Ga0495589_0000917 Ga0495589_0000917_4836_6293 457
664 3300046794 Ga0495589_0017405 Ga0495589_0017405_367_1845 457
665 3300046809 Ga0495600_0060142 Ga0495600_0060142_691_2112 457
666 3300046810 Ga0495660_0000965 Ga0495660_0000965_16573_18015 457
667 3300046810 Ga0495660_0002961 Ga0495660_0002961_431_1843 457
668 3300046810 Ga0495660_0022455 Ga0495660_0022455_1754_3196 457
669 3300046810 Ga0495660_0067349 Ga0495660_0067349_398_1840 457
670 3300047320 Ga0495672_0000226 Ga0495672_0000226_31386_32807 457
671 3300047323 Ga0495683_0005240 Ga0495683_0005240_3983_5395 457
672 3300047445 Ga0495677_0000652 Ga0495677_0000652_2206_3660 457
673 3300047445 Ga0495677_0005473 Ga0495677_0005473_22_1437 457
674 3300047445 Ga0495677_0006698 Ga0495677_0006698_1166_2644 457
675 3300047446 Ga0495679_006900 Ga0495679_006900_3271_4713 457
676 3300047447 Ga0495685_028066 Ga0495685_028066_363_1805 457
677 3300047469 Ga0495673_0000008 Ga0495673_0000008_475180_476592 457
678 3300047469 Ga0495673_0000009 Ga0495673_0000009_420899_422311 457
679 3300047469 Ga0495673_0000012 Ga0495673_0000012_301108_302520 457
680 3300047470 Ga0495681_0003213 Ga0495681_0003213_4487_5938 457
681 3300047470 Ga0495681_0003921 Ga0495681_0003921_3461_4912 457
682 3300047470 Ga0495681_0007023 Ga0495681_0007023_665_2119 457
683 3300047470 Ga0495681_0029459 Ga0495681_0029459_48_1490 457
684 3300047472 Ga0495686_0000431 Ga0495686_0000431_38695_40137 457
685 3300047472 Ga0495686_0001735 Ga0495686_0001735_13348_14778 457
686 3300048088 Ga0495602_0059250 Ga0495602_0059250_637_2055 457
687 3300048088 Ga0495602_0179008 Ga0495602_0179008_150_1568 457
688 3300048091 Ga0495626_0000004 Ga0495626_0000004_128151_129575 457
689 3300048091 Ga0495626_0001315 Ga0495626_0001315_2856_4289 457
690 3300048091 Ga0495626_0003246 Ga0495626_0003246_2310_3731 457
691 3300048091 Ga0495626_0005437 Ga0495626_0005437_1570_2979 457
692 3300048091 Ga0495626_0020925 Ga0495626_0020925_1312_2733 457
693 3300048904 Ga0496101_0017131 Ga0496101_0017131_2033_3466 457
694 3300048916 Ga0496113_0001841 Ga0496113_0001841_5909_7342 457
695 3300048917 Ga0496114_0017245 Ga0496114_0017245_1944_3389 457
696 3300048918 Ga0496115_0002346 Ga0496115_0002346_8027_9448 457
697 3300048925 Ga0496122_0000310 Ga0496122_0000310_4611_6044 457
698 3300048925 Ga0496122_0036180 Ga0496122_0036180_1493_2905 457
699 3300048926 Ga0496123_0000312 Ga0496123_0000312_87592_89025 457
700 3300048926 Ga0496123_0006961 Ga0496123_0006961_5995_7407 457
701 3300048928 Ga0496125_0000995 Ga0496125_0000995_32870_34315 457
702 3300048928 Ga0496125_0008672 Ga0496125_0008672_4660_6093 457
703 3300048929 Ga0496126_0018447 Ga0496126_0018447_1773_3185 457
704 3300048929 Ga0496126_0088208 Ga0496126_0088208_792_2237 457
705 3300049459 Ga0495678_000012 Ga0495678_000012_311655_313097 457
706 3300049459 Ga0495678_000232 Ga0495678_000232_55250_56659 457
707 3300049459 Ga0495678_000307 Ga0495678_000307_4294_5715 457
708 3300049459 Ga0495678_002689 Ga0495678_002689_4727_6178 457
709 3300049459 Ga0495678_002896 Ga0495678_002896_7558_8973 457
710 3300049459 Ga0495678_006492 Ga0495678_006492_938_2353 457
711 3300049460 Ga0495682_0001282 Ga0495682_0001282_7872_9314 457
712 3300049571 Ga0501034_0215818 Ga0501034_0215818_422_1795 457
713 3300049766 Ga0501269_000668 Ga0501269_000668_16_1479 457
714 3300049822 Ga0501035_0003949 Ga0501035_0003949_8102_9571 457
715 3300053077 Ga0495601_0047626 Ga0495601_0047626_1199_2617 457
716 3300053118 Ga0500594_0017419 Ga0500594_0017419_118_1530 457
717 3300053119 Ga0500595_002845 Ga0500595_002845_1718_3136 457
718 3300053125 Ga0500618_000088 Ga0500618_000088_47008_48420 457
719 iso_pu_bacteria 2600255292 2601671537 457
720 iso_pu_bacteria 2808606373 2808907221 457
721 iso_pu_bacteria 2857547612 2857548629 457
722 iso_pu_bacteria 2857553236 2857558459 457
723 iso_pu_bacteria 2885080285 2885081074 457
724 iso_pu_bacteria 2912963787 2912966125 457
725 iso_pu_bacteria 2932410948 2932416038 457
726 iso_pu_bacteria 2932416698 2932421949 457
727 3300002774 JGI25150J39212_1000767 JGI25150J39212_100076710 458
728 3300003215 JGI25153J46596_10005972 JGI25153J46596_100059722 458
729 3300003374 JGI25161J50226_1000766 JGI25161J50226_10007665 458
730 3300003752 Ga0055539_1000040 Ga0055539_1000040160 458
731 3300003756 Ga0055533_1000050 Ga0055533_1000050160 458
732 3300003759 Ga0055525_1000060 Ga0055525_1000060160 458
733 3300003771 Ga0055526_1002760 Ga0055526_10027607 458
734 3300003775 Ga0055524_1000038 Ga0055524_100003881 458
735 3300003775 Ga0055524_1002052 Ga0055524_10020528 458
736 3300003775 Ga0055524_1004769 Ga0055524_10047694 458
737 3300003784 Ga0055534_1002714 Ga0055534_10027143 458
738 3300003790 Ga0055528_1002242 Ga0055528_10022423 458
739 3300003791 Ga0055530_10003717 Ga0055530_100037175 458
740 3300003841 Ga0055541_1000027 Ga0055541_1000027160 458
741 3300004625 Ga0055543_1001041 Ga0055543_10010418 458
742 3300005262 Ga0065165_1003116 Ga0065165_10031168 458
743 3300005262 Ga0065165_1018998 Ga0065165_10189982 458
744 3300005563 Ga0068855_100000243 Ga0068855_10000024351 458
745 3300005563 Ga0068855_100078328 Ga0068855_1000783282 458
746 3300005578 Ga0068854_100003412 Ga0068854_1000034129 458
747 3300006948 Ga0099826_10000008 Ga0099826_10000008150 458
748 3300009545 Ga0105237_10009327 Ga0105237_100093278 458
749 3300009545 Ga0105237_10115202 Ga0105237_101152022 458
750 3300009551 Ga0105238_10000547 Ga0105238_1000054736 458
751 3300010375 Ga0105239_10045286 Ga0105239_100452863 458
752 3300015261 Ga0182006_1000007 Ga0182006_1000007375 458
753 3300015261 Ga0182006_1000776 Ga0182006_100077616 458
754 3300015262 Ga0182007_10000022 Ga0182007_10000022121 458
755 3300015265 Ga0182005_1000010 Ga0182005_1000010352 458
756 3300021361 Ga0213872_10000157 Ga0213872_1000015744 458
757 3300021361 Ga0213872_10005182 Ga0213872_100051823 458
758 3300025208 Ga0209436_100505 Ga0209436_10050515 458
759 3300025208 Ga0209436_102413 Ga0209436_1024132 458
760 3300025224 Ga0209784_100005 Ga0209784_100005766 458
761 3300025225 Ga0209566_100005 Ga0209566_100005766 458
762 3300025226 Ga0209674_100009 Ga0209674_100009766 458
763 3300025230 Ga0209563_100012 Ga0209563_100012766 458
764 3300025245 Ga0207425_1000009 Ga0207425_1000009181 458
765 3300025245 Ga0207425_1000036 Ga0207425_1000036144 458
766 3300025253 Ga0209677_100006 Ga0209677_100006766 458
767 3300025258 Ga0209129_1000051 Ga0209129_1000051104 458
768 3300025258 Ga0209129_1008572 Ga0209129_10085722 458
769 3300025263 Ga0209565_1000662 Ga0209565_100066216 458
770 3300025263 Ga0209565_1002796 Ga0209565_10027963 458
771 3300025263 Ga0209565_1009818 Ga0209565_10098182 458
772 3300025284 Ga0209130_1000827 Ga0209130_100082726 458
773 3300025284 Ga0209130_1001825 Ga0209130_10018259 458
774 3300025291 Ga0209675_1000839 Ga0209675_100083916 458
775 3300025291 Ga0209675_1001859 Ga0209675_10018597 458
776 3300025295 Ga0209564_1000172 Ga0209564_100017289 458
777 3300025295 Ga0209564_1002005 Ga0209564_100200517 458
778 3300025295 Ga0209564_1006980 Ga0209564_10069805 458
779 3300025297 Ga0209758_1000054 Ga0209758_1000054181 458
780 3300025298 Ga0209050_1000040 Ga0209050_10000409 458
781 3300025298 Ga0209050_1000309 Ga0209050_100030912 458
782 3300025298 Ga0209050_1006669 Ga0209050_10066694 458
783 3300025299 Ga0209256_1000018 Ga0209256_1000018155 458
784 3300025299 Ga0209256_1000307 Ga0209256_100030716 458
785 3300025299 Ga0209256_1000553 Ga0209256_100055317 458
786 3300025299 Ga0209256_1001318 Ga0209256_100131834 458
787 3300025302 Ga0207426_1001267 Ga0207426_100126719 458
788 3300025304 Ga0209257_1000054 Ga0209257_1000054389 458
789 3300025321 Ga0207656_10055940 Ga0207656_100559401 458
790 3300025913 Ga0207695_10000913 Ga0207695_1000091330 458
791 3300025914 Ga0207671_10073384 Ga0207671_100733842 458
792 3300025924 Ga0207694_10002807 Ga0207694_1000280710 458
793 3300025949 Ga0207667_10000301 Ga0207667_1000030150 458
794 3300025949 Ga0207667_10082197 Ga0207667_100821973 458
795 3300025981 Ga0207640_10049942 Ga0207640_100499422 458
796 3300027666 Ga0209282_1000005 Ga0209282_1000005150 458
797 3300031548 Ga0307408_100000144 Ga0307408_10000014465 458
798 3300031548 Ga0307408_100001520 Ga0307408_10000152017 458
799 3300031548 Ga0307408_100007461 Ga0307408_1000074613 458
800 3300032002 Ga0307416_100222226 Ga0307416_1002222262 458
801 3300035695 Ga0373927_0000002 Ga0373927_0000002_274676_276064 458
802 3300039447 Ga0436361_0034355 Ga0436361_0034355_669_2114 458
803 3300039447 Ga0436361_0124286 Ga0436361_0124286_3189_4688 458
804 3300046501 Ga0495607_0007279 Ga0495607_0007279_5195_6622 458
805 3300046501 Ga0495607_0060297 Ga0495607_0060297_532_1989 458
806 3300046507 Ga0495606_0000716 Ga0495606_0000716_4306_5727 458
807 3300046507 Ga0495606_0000830 Ga0495606_0000830_32862_34301 458
808 3300046520 Ga0495637_0004248 Ga0495637_0004248_1921_3342 458
809 3300046557 Ga0495622_0032269 Ga0495622_0032269_252_1700 458
810 3300046664 Ga0495659_0000277 Ga0495659_0000277_4838_6322 458
811 3300046692 Ga0495671_0000924 Ga0495671_0000924_4644_6128 458
812 3300046694 Ga0495649_0010311 Ga0495649_0010311_818_2245 458
813 3300046810 Ga0495660_0000419 Ga0495660_0000419_9611_11065 458
814 3300047320 Ga0495672_0000026 Ga0495672_0000026_149756_151240 458
815 3300048907 Ga0496104_0221086 Ga0496104_0221086_100_1545 458
816 3300048914 Ga0496111_0031888 Ga0496111_0031888_2139_3587 458
817 3300048919 Ga0496116_0008238 Ga0496116_0008238_1502_2950 458
818 3300048920 Ga0496117_0000005 Ga0496117_0000005_56254_57702 458
819 3300048921 Ga0496118_0000022 Ga0496118_0000022_380901_382349 458
820 3300048924 Ga0496121_0002958 Ga0496121_0002958_19755_21203 458
821 3300048925 Ga0496122_0013643 Ga0496122_0013643_3933_5381 458
822 3300048926 Ga0496123_0001145 Ga0496123_0001145_33810_35258 458
823 3300048927 Ga0496124_0056134 Ga0496124_0056134_1755_3203 458
824 3300049460 Ga0495682_0011480 Ga0495682_0011480_1769_3217 458
825 3300049665 Ga0501227_001108 Ga0501227_001108_1781_3211 458
826 3300049775 Ga0501279_001218 Ga0501279_001218_942_2372 458
827 iso_pu_bacteria 2511231018 2511339899 458
828 iso_pu_bacteria 2511231019 2511342732 458
829 iso_pu_bacteria 2511231022 2511365315 458
830 iso_pu_bacteria 2511231156 2511824988 458
831 iso_pu_bacteria 2599185188 2599500901 458
832 iso_pu_bacteria 2599185248 2599769020 458
833 iso_pu_bacteria 2599185289 2599884819 458
834 iso_pu_bacteria 2599185291 2599896003 458
835 iso_pu_bacteria 2599185300 2599932555 458
836 iso_pu_bacteria 2599185302 2599945115 458
837 iso_pu_bacteria 2599185304 2599955533 458
838 iso_pu_bacteria 2599185305 2599957888 458
839 iso_pu_bacteria 2599185306 2599966764 458
840 iso_pu_bacteria 2599185308 2599978043 458
841 iso_pu_bacteria 2599185309 2599984290 458
842 iso_pu_bacteria 2599185310 2599990540 458
843 iso_pu_bacteria 2599185311 2599996735 458
844 iso_pu_bacteria 2599185312 2600001520 458
845 iso_pu_bacteria 2599185313 2600004015 458
846 iso_pu_bacteria 2599185314 2600012230 458
847 iso_pu_bacteria 2599185315 2600015611 458
848 iso_pu_bacteria 2599185318 2600039284 458
849 iso_pu_bacteria 2599185319 2600041564 458
850 iso_pu_bacteria 2599185320 2600049098 458
851 iso_pu_bacteria 2599185321 2600050819 458
852 iso_pu_bacteria 2599185323 2600063773 458
853 iso_pu_bacteria 2599185324 2600074281 458
854 iso_pu_bacteria 2623620446 2624491746 458
855 iso_pu_bacteria 2643221633 2644184928 458
856 iso_pu_bacteria 2643221650 2644281327 458
857 iso_pu_bacteria 2651869719 2652545504 458
858 iso_pu_bacteria 2667528170 2671088695 458
859 iso_pu_bacteria 2675903515 2678263575 458
860 iso_pu_bacteria 2728369097 2729145775 458
861 iso_pu_bacteria 2738541280 2738738599 458
862 iso_pu_bacteria 2738541300 2738842592 458
863 iso_pu_bacteria 2738543018 2739273339 458
864 iso_pu_bacteria 2738543030 2739342383 458
865 iso_pu_bacteria 2744054620 2745009906 458
866 iso_pu_bacteria 2773857670 2774120616 458
867 iso_pu_bacteria 2784132072 2784313089 458
868 iso_pu_bacteria 2791355520 2794597047 458
869 iso_pu_bacteria 2808606361 2808857383 458
870 iso_pu_bacteria 2808606376 2808925947 458
871 iso_pu_bacteria 2808606377 2808929098 458
872 iso_pu_bacteria 2808606378 2808937455 458
873 iso_pu_bacteria 2808606380 2808948048 458
874 iso_pu_bacteria 2808606381 2808951219 458
875 iso_pu_bacteria 2808606383 2808965871 458
876 iso_pu_bacteria 2808606389 2809000759 458
877 iso_pu_bacteria 2825651385 2825652000 458
878 iso_pu_bacteria 2842854478 2842858629 458
879 iso_pu_bacteria 2913036834 2913040115 458
880 iso_pu_bacteria 2919481497 2919487706 458
881 iso_pu_bacteria 2919697872 2919697912 458
882 iso_pu_bacteria 2923586266 2923588378 458
883 iso_pu_bacteria 2929144301 2929147637 458
884 iso_pu_bacteria 2931369376 2931375122 458
885 iso_pu_bacteria 2931396565 2931401981 458
886 iso_pu_bacteria 2947233263 2947237048 458
887 iso_pu_bacteria 2988728565 2988729373 458
888 iso_pu_bacteria 2990196909 2990198899 458
889 iso_pu_bacteria 3007866637 3007869400 458
890 iso_pu_bacteria 640427133 640488059 458
891 iso_pu_bacteria 651053060 651176011 458
892 iso_pu_bacteria 8019775933 8019778584 458
893 iso_pu_bacteria 8056148874 8056153980 458
894 iso_pu_bacteria 8056155041 8056156986 458
895 3300005327 Ga0070658_10102911 Ga0070658_101029111 459
896 3300005334 Ga0068869_100007564 Ga0068869_1000075643 459
897 3300005366 Ga0070659_100028389 Ga0070659_1000283893 459
898 3300005457 Ga0070662_100051409 Ga0070662_1000514092 459
899 3300005564 Ga0070664_100044530 Ga0070664_1000445302 459
900 3300009174 Ga0105241_10055615 Ga0105241_100556153 459
901 3300013104 Ga0157370_10035870 Ga0157370_100358703 459
902 3300013105 Ga0157369_10009955 Ga0157369_100099555 459
903 3300025904 Ga0207647_10001270 Ga0207647_100012702 459
904 3300025909 Ga0207705_10125042 Ga0207705_101250422 459
905 3300025919 Ga0207657_10002390 Ga0207657_1000239012 459
906 3300025924 Ga0207694_10019530 Ga0207694_100195303 459
907 3300025942 Ga0207689_10022372 Ga0207689_100223722 459
908 3300025944 Ga0207661_10026967 Ga0207661_100269672 459
909 3300026116 Ga0207674_10008273 Ga0207674_100082738 459
910 3300042013 Ga0439456_000296 Ga0439456_000296_2329_3714 461
911 3300042139 Ga0450904_000248 Ga0450904_000248_4593_5978 461
912 3300049574 Ga0501038_0079500 Ga0501038_0079500_893_2278 461
913 2124908027 MRS2a_Contig_39 MRS2a_00279140 462
914 3300003578 Ga0006562J51391_1010113 Ga0006562J51391_10101137 462
915 3300003792 Ga0055540_1000115 Ga0055540_100011563 462
916 3300005288 Ga0065714_10000106 Ga0065714_100001063 462
917 3300005288 Ga0065714_10006891 Ga0065714_100068913 462
918 3300005288 Ga0065714_10065610 Ga0065714_100656102 462
919 3300005288 Ga0065714_10065916 Ga0065714_100659163 462
920 3300005289 Ga0065704_10071946 Ga0065704_100719461 462
921 3300005289 Ga0065704_10080329 Ga0065704_100803292 462
922 3300006051 Ga0075364_10015806 Ga0075364_100158064 462
923 3300006946 Ga0079104_1000554 Ga0079104_100055429 462
924 3300006948 Ga0099826_10018806 Ga0099826_100188063 462
925 3300009011 Ga0105251_10068198 Ga0105251_100681981 462
926 3300009036 Ga0105244_10000282 Ga0105244_1000028220 462
927 3300011119 Ga0105246_10077925 Ga0105246_100779252 462
928 3300013100 Ga0157373_10024922 Ga0157373_100249222 462
929 3300013104 Ga0157370_10000365 Ga0157370_1000036549 462
930 3300013104 Ga0157370_10002579 Ga0157370_1000257916 462
931 3300013306 Ga0163162_10029773 Ga0163162_100297732 462
932 3300014497 Ga0182008_10001328 Ga0182008_100013283 462
933 3300014497 Ga0182008_10005516 Ga0182008_100055166 462
934 3300014497 Ga0182008_10013967 Ga0182008_100139674 462
935 3300015261 Ga0182006_1000448 Ga0182006_10004485 462
936 3300015261 Ga0182006_1002579 Ga0182006_10025793 462
937 3300015261 Ga0182006_1038477 Ga0182006_10384771 462
938 3300015262 Ga0182007_10000226 Ga0182007_1000022621 462
939 3300015262 Ga0182007_10000861 Ga0182007_100008613 462
940 3300015265 Ga0182005_1000989 Ga0182005_10009898 462
941 3300015265 Ga0182005_1001155 Ga0182005_10011556 462
942 3300015265 Ga0182005_1001789 Ga0182005_10017893 462
943 3300017792 Ga0163161_10017270 Ga0163161_100172702 462
944 3300025292 Ga0209676_1005362 Ga0209676_10053621 462
945 3300025298 Ga0209050_1000013 Ga0209050_1000013455 462
946 3300025303 Ga0209051_1000007 Ga0209051_1000007455 462
947 3300025304 Ga0209257_1008286 Ga0209257_10082861 462
948 3300025711 Ga0207696_1009583 Ga0207696_10095832 462
949 3300025728 Ga0207655_1000289 Ga0207655_100028910 462
950 3300025728 Ga0207655_1000306 Ga0207655_100030610 462
951 3300025728 Ga0207655_1014803 Ga0207655_10148033 462
952 3300027111 Ga0209281_1000009 Ga0209281_1000009473 462
953 3300027395 Ga0209996_1000577 Ga0209996_10005773 462
954 3300027424 Ga0209984_1000805 Ga0209984_10008052 462
955 3300027666 Ga0209282_1030960 Ga0209282_10309602 462
956 3300027682 Ga0209971_1000985 Ga0209971_10009852 462
957 3300027907 Ga0207428_10027897 Ga0207428_100278972 462
958 3300031548 Ga0307408_100018225 Ga0307408_1000182252 462
959 3300031548 Ga0307408_100023090 Ga0307408_1000230904 462
960 3300031727 Ga0316576_10159052 Ga0316576_101590521 462
961 3300031731 Ga0307405_10000911 Ga0307405_100009114 462
962 3300031733 Ga0316577_10080336 Ga0316577_100803362 462
963 3300031824 Ga0307413_10000448 Ga0307413_100004486 462
964 3300031901 Ga0307406_10001728 Ga0307406_100017282 462
965 3300031903 Ga0307407_10088548 Ga0307407_100885482 462
966 3300031911 Ga0307412_10012924 Ga0307412_100129242 462
967 3300031995 Ga0307409_100173526 Ga0307409_1001735262 462
968 3300032004 Ga0307414_10080078 Ga0307414_100800781 462
969 3300035398 Ga0316574_0117770 Ga0316574_0117770_216_1613 462
970 3300041405 Ga0439438_000055 Ga0439438_000055_50384_51772 462
971 3300041405 Ga0439438_000211 Ga0439438_000211_22471_23859 462
972 3300041405 Ga0439438_002332 Ga0439438_002332_2603_3991 462
973 3300041407 Ga0439447_008191 Ga0439447_008191_445_1833 462
974 3300041407 Ga0439447_017238 Ga0439447_017238_515_1903 462
975 3300041411 Ga0439466_0004912 Ga0439466_0004912_3234_4622 462
976 3300041411 Ga0439466_0006396 Ga0439466_0006396_510_1898 462
977 3300041411 Ga0439466_0010782 Ga0439466_0010782_108_1496 462
978 3300041413 Ga0439465_0006696 Ga0439465_0006696_1666_3054 462
979 3300042004 Ga0439445_0010393 Ga0439445_0010393_763_2151 462
980 3300042006 Ga0439432_002598 Ga0439432_002598_733_2121 462
981 3300042006 Ga0439432_008591 Ga0439432_008591_2019_3407 462
982 3300042009 Ga0439451_003560 Ga0439451_003560_972_2360 462
983 3300042009 Ga0439451_007784 Ga0439451_007784_121_1509 462
984 3300042010 Ga0439452_000312 Ga0439452_000312_14563_15951 462
985 3300042115 Ga0450911_002423 Ga0450911_002423_220_1608 462
986 3300042127 Ga0450890_000399 Ga0450890_000399_3141_4529 462
987 3300042138 Ga0450903_005580 Ga0450903_005580_187_1575 462
988 3300042138 Ga0450903_009443 Ga0450903_009443_105_1493 462
989 3300042146 Ga0450907_000305 Ga0450907_000305_9381_10769 462
990 3300042146 Ga0450907_000521 Ga0450907_000521_7094_8482 462
991 3300042156 Ga0439446_0000549 Ga0439446_0000549_5494_6882 462
992 3300042156 Ga0439446_0002331 Ga0439446_0002331_2956_4344 462
993 3300042185 Ga0450909_003896 Ga0450909_003896_94_1482 462
994 3300042435 Ga0439434_0000374 Ga0439434_0000374_8712_10100 462
995 3300042461 Ga0439460_0009650 Ga0439460_0009650_607_1995 462
996 3300042993 Ga0439440_0011199 Ga0439440_0011199_316_1704 462
997 3300046452 Ga0495617_003442 Ga0495617_003442_1348_2736 462
998 3300046455 Ga0495603_0044155 Ga0495603_0044155_1135_2523 462
999 3300046457 Ga0495590_0007215 Ga0495590_0007215_1806_3194 462
1000 3300046458 Ga0495591_004570 Ga0495591_004570_2280_3668 462
1001 3300046460 Ga0495638_0038734 Ga0495638_0038734_545_1960 462
1002 3300046463 Ga0495653_0008448 Ga0495653_0008448_1064_2452 462
1003 3300046471 Ga0495650_0007295 Ga0495650_0007295_3023_4411 462
1004 3300046474 Ga0495605_0001176 Ga0495605_0001176_7616_9031 462
1005 3300046475 Ga0495639_0000378 Ga0495639_0000378_6451_7866 462
1006 3300046475 Ga0495639_0002171 Ga0495639_0002171_4649_6037 462
1007 3300046475 Ga0495639_0030467 Ga0495639_0030467_567_1955 462
1008 3300046491 Ga0495584_0012336 Ga0495584_0012336_251_1639 462
1009 3300046492 Ga0495585_0005919 Ga0495585_0005919_2138_3526 462
1010 3300046492 Ga0495585_0009510 Ga0495585_0009510_2288_3676 462
1011 3300046499 Ga0495594_0011980 Ga0495594_0011980_1233_2621 462
1012 3300046499 Ga0495594_0030023 Ga0495594_0030023_206_1594 462
1013 3300046501 Ga0495607_0039093 Ga0495607_0039093_35_1423 462
1014 3300046506 Ga0495583_0000916 Ga0495583_0000916_1455_2843 462
1015 3300046513 Ga0495616_0025433 Ga0495616_0025433_55_1443 462
1016 3300046513 Ga0495616_0055464 Ga0495616_0055464_341_1729 462
1017 3300046518 Ga0495631_0015959 Ga0495631_0015959_2170_3558 462
1018 3300046519 Ga0495632_0000626 Ga0495632_0000626_22337_23725 462
1019 3300046520 Ga0495637_0005056 Ga0495637_0005056_2283_3671 462
1020 3300046522 Ga0495643_0018953 Ga0495643_0018953_985_2373 462
1021 3300046522 Ga0495643_0024387 Ga0495643_0024387_1624_3012 462
1022 3300046523 Ga0495644_0032291 Ga0495644_0032291_377_1765 462
1023 3300046524 Ga0495648_0002606 Ga0495648_0002606_2456_3844 462
1024 3300046526 Ga0495666_0009015 Ga0495666_0009015_2666_4054 462
1025 3300046528 Ga0495642_0000220 Ga0495642_0000220_9221_10609 462
1026 3300046530 Ga0495654_0000388 Ga0495654_0000388_4400_5815 462
1027 3300046530 Ga0495654_0008041 Ga0495654_0008041_4268_5656 462
1028 3300046536 Ga0495587_0000142 Ga0495587_0000142_12170_13558 462
1029 3300046538 Ga0495609_0002373 Ga0495609_0002373_8255_9643 462
1030 3300046538 Ga0495609_0017972 Ga0495609_0017972_96_1484 462
1031 3300046542 Ga0495597_0006738 Ga0495597_0006738_1831_3219 462
1032 3300046557 Ga0495622_0000800 Ga0495622_0000800_8744_10159 462
1033 3300046557 Ga0495622_0016990 Ga0495622_0016990_828_2216 462
1034 3300046558 Ga0495633_0060324 Ga0495633_0060324_300_1688 462
1035 3300046615 Ga0495656_0004683 Ga0495656_0004683_1493_2881 462
1036 3300046615 Ga0495656_0006014 Ga0495656_0006014_377_1765 462
1037 3300046616 Ga0495668_0026584 Ga0495668_0026584_1607_2995 462
1038 3300046642 Ga0495634_0000215 Ga0495634_0000215_12910_14298 462
1039 3300046663 Ga0495635_0000126 Ga0495635_0000126_39727_41115 462
1040 3300046664 Ga0495659_0000402 Ga0495659_0000402_8724_10139 462
1041 3300046664 Ga0495659_0001528 Ga0495659_0001528_3625_5013 462
1042 3300046664 Ga0495659_0002879 Ga0495659_0002879_1832_3220 462
1043 3300046665 Ga0495661_0005773 Ga0495661_0005773_4359_5747 462
1044 3300046674 Ga0495588_0010961 Ga0495588_0010961_2296_3684 462
1045 3300046679 Ga0495623_0000655 Ga0495623_0000655_2872_4260 462
1046 3300046680 Ga0495646_0023352 Ga0495646_0023352_16_1404 462
1047 3300046684 Ga0495669_0031588 Ga0495669_0031588_377_1765 462
1048 3300046689 Ga0495613_0035537 Ga0495613_0035537_467_1855 462
1049 3300046691 Ga0495670_0000176 Ga0495670_0000176_3708_5096 462
1050 3300046691 Ga0495670_0006469 Ga0495670_0006469_2429_3817 462
1051 3300046691 Ga0495670_0009249 Ga0495670_0009249_2329_3717 462
1052 3300046692 Ga0495671_0000280 Ga0495671_0000280_5119_6507 462
1053 3300046694 Ga0495649_0001794 Ga0495649_0001794_5873_7288 462
1054 3300046694 Ga0495649_0026242 Ga0495649_0026242_32_1420 462
1055 3300046809 Ga0495600_0051551 Ga0495600_0051551_1111_2499 462
1056 3300046810 Ga0495660_0016768 Ga0495660_0016768_118_1506 462
1057 3300046810 Ga0495660_0018123 Ga0495660_0018123_523_1911 462
1058 3300046810 Ga0495660_0020265 Ga0495660_0020265_947_2335 462
1059 3300047315 Ga0495581_0008329 Ga0495581_0008329_860_2275 462
1060 3300047320 Ga0495672_0006634 Ga0495672_0006634_6755_8170 462
1061 3300047320 Ga0495672_0012229 Ga0495672_0012229_3005_4393 462
1062 3300047320 Ga0495672_0012542 Ga0495672_0012542_2240_3628 462
1063 3300047322 Ga0495680_0000251 Ga0495680_0000251_40033_41421 462
1064 3300047322 Ga0495680_0002030 Ga0495680_0002030_3034_4422 462
1065 3300047323 Ga0495683_0004860 Ga0495683_0004860_1743_3131 462
1066 3300047323 Ga0495683_0011072 Ga0495683_0011072_246_1634 462
1067 3300047443 Ga0495687_001979 Ga0495687_001979_3491_4906 462
1068 3300047445 Ga0495677_0002804 Ga0495677_0002804_3053_4441 462
1069 3300047446 Ga0495679_005689 Ga0495679_005689_2285_3673 462
1070 3300047447 Ga0495685_006522 Ga0495685_006522_2202_3590 462
1071 3300047469 Ga0495673_0020359 Ga0495673_0020359_54_1442 462
1072 3300047470 Ga0495681_0000274 Ga0495681_0000274_3328_4716 462
1073 3300047470 Ga0495681_0002241 Ga0495681_0002241_4905_6293 462
1074 3300047470 Ga0495681_0040933 Ga0495681_0040933_90_1478 462
1075 3300047673 Ga0495593_0022582 Ga0495593_0022582_1180_2568 462
1076 3300047673 Ga0495593_0024738 Ga0495593_0024738_604_1992 462
1077 3300048089 Ga0495614_0014150 Ga0495614_0014150_1342_2730 462
1078 3300048091 Ga0495626_0001461 Ga0495626_0001461_3868_5283 462
1079 3300048091 Ga0495626_0024739 Ga0495626_0024739_274_1662 462
1080 3300048905 Ga0496102_0001689 Ga0496102_0001689_3495_4883 462
1081 3300048906 Ga0496103_0001398 Ga0496103_0001398_2028_3416 462
1082 3300048908 Ga0496105_0145986 Ga0496105_0145986_432_1847 462
1083 3300048909 Ga0496106_0069807 Ga0496106_0069807_35_1450 462
1084 3300048910 Ga0496107_0074321 Ga0496107_0074321_236_1624 462
1085 3300048913 Ga0496110_0057802 Ga0496110_0057802_881_2269 462
1086 3300048917 Ga0496114_0183139 Ga0496114_0183139_92_1480 462
1087 3300048918 Ga0496115_0010819 Ga0496115_0010819_1796_3184 462
1088 3300048919 Ga0496116_0000862 Ga0496116_0000862_6361_7776 462
1089 3300048920 Ga0496117_0041685 Ga0496117_0041685_165_1553 462
1090 3300048921 Ga0496118_0021757 Ga0496118_0021757_1452_2840 462
1091 3300048924 Ga0496121_0005797 Ga0496121_0005797_7954_9369 462
1092 3300048924 Ga0496121_0032250 Ga0496121_0032250_1767_3155 462
1093 3300048925 Ga0496122_0005121 Ga0496122_0005121_5842_7257 462
1094 3300048928 Ga0496125_0024968 Ga0496125_0024968_2224_3612 462
1095 3300049459 Ga0495678_043136 Ga0495678_043136_126_1514 462
1096 3300049460 Ga0495682_0005611 Ga0495682_0005611_1921_3309 462
1097 3300049460 Ga0495682_0008205 Ga0495682_0008205_15_1403 462
1098 3300049460 Ga0495682_0010351 Ga0495682_0010351_15_1403 462
1099 3300050514 nmdc:mga08x19_71357_c1 nmdc:mga08x19_71357_c1_54_1469 462

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06969

HemN_C

HemN C-terminal domain

471

540

0.96

PF04055

Radical_SAM

Radical SAM superfamily

161

337

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1olt-assembly1.cif.gz_A coproporphyrinogen iii oxidase (hemn) from escherichia coli is a radical sam enzyme. 0.9617 5 444
1olt-assembly1.cif.gz_A coproporphyrinogen iii oxidase (hemn) from escherichia coli is a radical sam enzyme. 0.9552 5 444
5v1q-assembly1.cif.gz_A crystal structure of streptococcus suis suib 0.701 54 252
5v1s-assembly2.cif.gz_B crystal structure of streptococcus suis suib bound to s-adenosylmethionine 0.6992 54 246
6efn-assembly1.cif.gz_A-2 structure of a ripp maturase, skfb 0.6924 54 281
ID Description Score Start End Superfamily
af_P32131_364_457_1.10.10.920 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.9921 364 444 1.10.10.920
1oltA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.9891 364 444 1.10.10.920
1oltA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.9772 364 444 1.10.10.920
af_P32131_50_279_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9676 54 281 3.20.20.70
af_P32131_50_279_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9552 54 281 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A7R7JD35-F1-model_v4 Coproporphyrinogen-III oxidase (EC 1.3.98.3) 0.9858 1 456 GO:0004109
GO:0005737
GO:0006782
GO:0046872
GO:0051539
GO:0051989
AF-W1XPZ1-F1-model_v4 Oxygen-independent coproporphyrinogen-III oxidase 0.9838 181 272 GO:0005737
GO:0006782
GO:0051539
GO:0051989
AF-A0A7R7JD35-F1-model_v4 Coproporphyrinogen-III oxidase (EC 1.3.98.3) 0.9836 1 456 GO:0004109
GO:0005737
GO:0006782
GO:0046872
GO:0051539
GO:0051989
AF-A0A5E4S7X3-F1-model_v4 Oxygen-independent coproporphyrinogen III oxidase (EC 1.3.98.3) (Coproporphyrinogen III dehydrogenase) 0.981 5 456 GO:0004109
GO:0005737
GO:0006782
GO:0046872
GO:0051539
GO:0051989
AF-A0A2E2DCS7-F1-model_v4 Coproporphyrinogen-III oxidase (EC 1.3.98.3) 0.9798 5 456 GO:0004109
GO:0005737
GO:0006782
GO:0046872
GO:0051539
GO:0051989

Feature Viewer

pLDDT pTM Quality
93.67 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map