F490073

General Info

Members Datasets Scaffolds Average Seq Length
1101 446 1071 223

Family's Representative Sequence

Representative Sequence 3300041410|Ga0439461_0078468|Ga0439461_0078468_51_764
Length 237
Sequence VCACLACWLASEREDTMNLDFSFINWDVIRSYVANGFIFSIQLTLIAMLGGIALGTVLALMRLSGRKWLEVPATLYVDTLRSIPLVMVIMWFYLLIPFLIGRPIGAEVSAIVTFTLFEAAYYSEIMRAGIQSVPRGQVYAGYAVGMTYAQTTKLIVLPQAFRNMLPVLLTQTIILFQDTSLVYAIGAYDLLKGFETVGRNFNRPVETYLTAATVYFVICFSLSQLVRQLQKKIQIIR

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2547132374 Acidovorax radicis N35 Isolate Unclassified
3 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
4 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
5 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
6 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
7 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
8 2643221570 Acidovorax sp. Root568 Isolate Unclassified
9 2643221585 Pelomonas sp. Root662 Isolate Unclassified
10 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
11 2643221596 Acidovorax sp. Root70 Isolate Unclassified
12 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
13 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
14 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
15 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
16 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
17 2643221652 Acidovorax sp. Root402 Isolate Unclassified
18 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
19 2643221656 Pelomonas sp. Root405 Isolate Unclassified
20 2643221660 Methylibium sp. Root1272 Isolate Unclassified
21 2643221717 Acidovorax sp. Root267 Isolate Unclassified
22 2721755523 Delftia sp. HK171 Isolate Unclassified
23 2738541337 Pelomonas sp. BT06 Isolate Unclassified
24 2831864461 Roseateles noduli HZ7 Isolate Nodule
25 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
26 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
27 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
28 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
29 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
30 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
31 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
32 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
33 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
34 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
35 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
36 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
37 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
38 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
39 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
40 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
41 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
42 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
43 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
44 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
45 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
46 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
47 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
48 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
49 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
50 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
51 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
52 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
53 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
54 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
55 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
56 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
57 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
58 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
59 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
60 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
61 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
62 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
63 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
64 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
65 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
66 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
67 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
68 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
69 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
70 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
71 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
72 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
73 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
74 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
75 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
76 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
77 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
78 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
79 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
80 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
81 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
82 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
83 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
84 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
85 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
86 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
87 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
88 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
89 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
90 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
91 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
92 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
93 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
94 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
95 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
96 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
97 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
98 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
99 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
100 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
101 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
102 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
103 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
104 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
105 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
106 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
107 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
108 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
109 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
110 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
111 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
112 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
113 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
114 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
115 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
116 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
117 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
118 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
119 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
120 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
121 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
122 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
123 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
124 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
125 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
126 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
127 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
128 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
129 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
130 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
131 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
132 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
133 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
134 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
135 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
136 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
137 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
138 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
139 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
140 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
141 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
142 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
143 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
144 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
145 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
146 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
147 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
148 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
149 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
150 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
151 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
152 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
153 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
154 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
155 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
156 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
157 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
158 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
160 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
161 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
163 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
226 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
227 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
238 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
240 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
244 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
245 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
246 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
247 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
248 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
249 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
250 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
251 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
252 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
253 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
254 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
255 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
256 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
257 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
258 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
259 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
260 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
261 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
262 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
263 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
264 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
265 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
266 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
267 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
268 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
269 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
270 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
271 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
272 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
273 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
274 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
275 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
276 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
277 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
278 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
279 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
280 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
281 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
282 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
283 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
284 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
285 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
286 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
287 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
288 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
289 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
290 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
291 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
292 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
293 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
294 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
295 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
296 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
297 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
298 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
299 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
300 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
301 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
302 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
303 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
304 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
305 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
306 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
307 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
308 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
309 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
310 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
311 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
312 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
313 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
314 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
315 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
316 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
317 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
318 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
319 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
320 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
321 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
322 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
323 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
324 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
325 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
326 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
327 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
328 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
329 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
330 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
331 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
332 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
333 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
334 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
335 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
336 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
337 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
338 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
339 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
340 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
341 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
342 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
343 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
344 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
345 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
346 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
347 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
348 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
349 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
350 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
351 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
352 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
353 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
354 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
355 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
356 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
357 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
358 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
359 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
360 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
361 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
362 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
363 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
364 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
365 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
366 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
367 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
368 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
369 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
370 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
371 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
372 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
373 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
374 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
375 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
376 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
377 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
378 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
379 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
380 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
381 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
383 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
384 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
385 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
387 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
388 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
389 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
390 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
391 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
392 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
393 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
394 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
395 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
396 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
397 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
398 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
399 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
400 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
401 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
402 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
403 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
404 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
405 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
406 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
407 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
408 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
409 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
410 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
411 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
412 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
413 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
414 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
415 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
416 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
417 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
418 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
419 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
420 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
421 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
422 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
423 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
424 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
425 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
426 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
427 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
428 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
429 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
430 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
431 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
432 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
433 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
434 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
435 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
436 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
437 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
438 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
439 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
440 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
441 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
442 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
443 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
444 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
445 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
446 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.09
Metatranscriptomes 0.18
Isolates 2.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.08
Nodule 0.73
Rhizoplane 2.91
Rhizosphere 77.11
Stem 0
Stem Tuber 0
Unclassified 7.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C4527 2010549000 Bacteria 1399
2 JGI25152J39213_1001492 3300002773 Bacteria 9978
3 JGI25150J39212_1003621 3300002774 Bacteria 3590
4 JGI25153J46596_10008443 3300003215 Bacteria 4922
5 JGI25153J46596_10011154 3300003215 Bacteria 3995
6 rootL2_10001084 3300003322 Bacteria 4307
7 rootH1_10003132 3300003323 Bacteria 2387
8 JGI26128J50194_1001179 3300003347 Bacteria 1624
9 Ga0055526_1003022 3300003771 Bacteria 10967
10 Ga0055526_1003078 3300003771 Bacteria 10835
11 Ga0055524_1000052 3300003775 Bacteria 144959
12 Ga0055524_1000613 3300003775 Bacteria 25572
13 Ga0055530_10004318 3300003791 Bacteria 7394
14 Ga0055540_1000123 3300003792 Bacteria 80351
15 Ga0055531_10000001 3300003794 Bacteria 543586
16 Ga0055531_10001336 3300003794 Bacteria 18422
17 Ga0055531_10001994 3300003794 Bacteria 14186
18 Ga0055531_10019012 3300003794 Bacteria 2805
19 Ga0055543_1001394 3300004625 Bacteria 9650
20 Ga0065165_1000101 3300005262 Bacteria 141486
21 Ga0065165_1002234 3300005262 Bacteria 17216
22 Ga0065165_1006644 3300005262 Bacteria 5976
23 Ga0065712_10075809 3300005290 Bacteria 3785
24 Ga0065715_10008644 3300005293 Bacteria 3425
25 Ga0065715_10261108 3300005293 Bacteria 1138
26 Ga0070676_10001171 3300005328 Bacteria 13130
27 Ga0070676_10005365 3300005328 Bacteria 6826
28 Ga0070676_10138536 3300005328 Bacteria 1546
29 Ga0070676_10262193 3300005328 Bacteria 1157
30 Ga0070683_100055546 3300005329 Bacteria 3675
31 Ga0070683_100163651 3300005329 Bacteria 2111
32 Ga0070690_100053100 3300005330 Bacteria 2592
33 Ga0070670_100049214 3300005331 Bacteria 3624
34 Ga0070670_100082638 3300005331 Bacteria 2760
35 Ga0070670_100092938 3300005331 Bacteria 2594
36 Ga0070670_100300347 3300005331 Bacteria 1404
37 Ga0070670_100431867 3300005331 Bacteria 1165
38 Ga0070670_100445109 3300005331 Bacteria 1147
39 Ga0070677_10001325 3300005333 Bacteria 7908
40 Ga0068869_100002262 3300005334 Bacteria 11585
41 Ga0068869_100011174 3300005334 Bacteria 5883
42 Ga0068869_100019660 3300005334 Bacteria 4621
43 Ga0068869_100297286 3300005334 Bacteria 1303
44 Ga0068869_100354530 3300005334 Bacteria 1197
45 Ga0070666_10004330 3300005335 Bacteria 8637
46 Ga0070666_10023485 3300005335 Bacteria 4014
47 Ga0070666_10085745 3300005335 Bacteria 2157
48 Ga0070682_100089300 3300005337 Bacteria 2013
49 Ga0068868_100005809 3300005338 Bacteria 8695
50 Ga0068868_100012774 3300005338 Bacteria 6143
51 Ga0068868_100016664 3300005338 Bacteria 5464
52 Ga0068868_100033067 3300005338 Bacteria 3984
53 Ga0068868_100264828 3300005338 Bacteria 1451
54 Ga0068868_100483719 3300005338 Bacteria 1082
55 Ga0070660_100025818 3300005339 Bacteria 4369
56 Ga0070660_100045007 3300005339 Bacteria 3377
57 Ga0070660_100116756 3300005339 Bacteria 2128
58 Ga0070660_100134630 3300005339 Bacteria 1979
59 Ga0070687_100014496 3300005343 Bacteria 3540
60 Ga0070661_100018747 3300005344 Bacteria 4924
61 Ga0070661_100022405 3300005344 Bacteria 4523
62 Ga0070661_100256290 3300005344 Bacteria 1351
63 Ga0070668_100004485 3300005347 Bacteria 10355
64 Ga0070668_100008931 3300005347 Bacteria 7440
65 Ga0070668_100034404 3300005347 Bacteria 3860
66 Ga0070668_100183457 3300005347 Bacteria 1710
67 Ga0070668_100606094 3300005347 Bacteria 958
68 Ga0070669_100013732 3300005353 Bacteria 5757
69 Ga0070669_100017742 3300005353 Bacteria 5078
70 Ga0070669_100034486 3300005353 Bacteria 3664
71 Ga0070669_100169213 3300005353 Bacteria 1703
72 Ga0070669_100281987 3300005353 Bacteria 1331
73 Ga0070675_100002401 3300005354 Bacteria 13969
74 Ga0070675_100017177 3300005354 Bacteria 5751
75 Ga0070675_100024262 3300005354 Bacteria 4857
76 Ga0070675_100033082 3300005354 Bacteria 4189
77 Ga0070675_100182993 3300005354 Bacteria 1812
78 Ga0070671_100005377 3300005355 Bacteria 10209
79 Ga0070671_100012049 3300005355 Bacteria 6957
80 Ga0070671_100017573 3300005355 Bacteria 5796
81 Ga0070671_100023610 3300005355 Bacteria 5034
82 Ga0070671_100038539 3300005355 Bacteria 3967
83 Ga0070671_100041716 3300005355 Bacteria 3813
84 Ga0070671_100075476 3300005355 Bacteria 2816
85 Ga0070671_100487498 3300005355 Bacteria 1059
86 Ga0070671_100511445 3300005355 Bacteria 1033
87 Ga0070674_100001038 3300005356 Bacteria 14532
88 Ga0070674_100004070 3300005356 Bacteria 8301
89 Ga0070674_100073006 3300005356 Bacteria 2431
90 Ga0070674_100330793 3300005356 Bacteria 1224
91 Ga0070673_100020171 3300005364 Bacteria 4803
92 Ga0070673_100033792 3300005364 Bacteria 3864
93 Ga0070673_100059646 3300005364 Bacteria 3021
94 Ga0070673_100066127 3300005364 Bacteria 2887
95 Ga0070673_100268124 3300005364 Bacteria 1493
96 Ga0070659_100003529 3300005366 Bacteria 11140
97 Ga0070659_100020575 3300005366 Bacteria 5015
98 Ga0070659_100077321 3300005366 Bacteria 2654
99 Ga0070659_100111224 3300005366 Bacteria 2211
100 Ga0070659_100326992 3300005366 Bacteria 1282
101 Ga0070667_100007643 3300005367 Bacteria 8965
102 Ga0070667_100010597 3300005367 Bacteria 7611
103 Ga0070667_100016131 3300005367 Bacteria 6179
104 Ga0070667_100027316 3300005367 Bacteria 4748
105 Ga0070667_100041760 3300005367 Bacteria 3847
106 Ga0070667_100047349 3300005367 Bacteria 3617
107 Ga0070667_100098630 3300005367 Bacteria 2521
108 Ga0070667_100363153 3300005367 Bacteria 1313
109 Ga0070701_10042915 3300005438 Bacteria 2311
110 Ga0070701_10408804 3300005438 Bacteria 862
111 Ga0070711_100136160 3300005439 Bacteria 1836
112 Ga0070700_100113059 3300005441 Bacteria 1808
113 Ga0070708_100003939 3300005445 Bacteria 11653
114 Ga0070708_100437423 3300005445 Bacteria 1234
115 Ga0070708_100458971 3300005445 Bacteria 1202
116 Ga0070663_100013585 3300005455 Bacteria 5197
117 Ga0070663_100021948 3300005455 Bacteria 4257
118 Ga0070663_100325840 3300005455 Bacteria 1236
119 Ga0070663_100381095 3300005455 Bacteria 1149
120 Ga0070663_100527668 3300005455 Bacteria 984
121 Ga0070678_100015061 3300005456 Bacteria 4901
122 Ga0070678_100017251 3300005456 Bacteria 4643
123 Ga0070678_100024100 3300005456 Bacteria 4067
124 Ga0070678_100218397 3300005456 Bacteria 1583
125 Ga0070678_100288352 3300005456 Bacteria 1391
126 Ga0070678_100775331 3300005456 Bacteria 869
127 Ga0070662_100020801 3300005457 Bacteria 4474
128 Ga0070662_100027883 3300005457 Bacteria 3926
129 Ga0070681_10074021 3300005458 Bacteria 3368
130 Ga0070681_10539565 3300005458 Bacteria 1080
131 Ga0068867_100000042 3300005459 Bacteria 77140
132 Ga0068867_100007790 3300005459 Bacteria 7575
133 Ga0068867_100009088 3300005459 Bacteria 7011
134 Ga0068867_100043951 3300005459 Bacteria 3272
135 Ga0068867_100181287 3300005459 Bacteria 1675
136 Ga0068867_100315987 3300005459 Bacteria 1292
137 Ga0068867_100646294 3300005459 Bacteria 928
138 Ga0070685_10097104 3300005466 Bacteria 1793
139 Ga0070706_100001024 3300005467 Bacteria 30341
140 Ga0070707_100080121 3300005468 Bacteria 3152
141 Ga0070698_100143500 3300005471 Bacteria 2338
142 Ga0070679_100002789 3300005530 Bacteria 15890
143 Ga0070679_100059819 3300005530 Bacteria 3797
144 Ga0070679_100141961 3300005530 Bacteria 2380
145 Ga0070679_100273492 3300005530 Bacteria 1643
146 Ga0070679_100651821 3300005530 Bacteria 996
147 Ga0070684_100042630 3300005535 Bacteria 3918
148 Ga0070684_100934981 3300005535 Bacteria 813
149 Ga0068853_100111889 3300005539 Bacteria 2426
150 Ga0068853_100415061 3300005539 Bacteria 1262
151 Ga0068853_100654112 3300005539 Bacteria 1000
152 Ga0070672_100017161 3300005543 Bacteria 5205
153 Ga0070672_100030952 3300005543 Bacteria 4025
154 Ga0070672_100082242 3300005543 Bacteria 2583
155 Ga0070672_100114813 3300005543 Bacteria 2198
156 Ga0070672_100176791 3300005543 Bacteria 1777
157 Ga0070672_100188665 3300005543 Bacteria 1720
158 Ga0070672_100207649 3300005543 Bacteria 1639
159 Ga0070672_100532641 3300005543 Bacteria 1018
160 Ga0070672_100740067 3300005543 Bacteria 862
161 Ga0070686_100170788 3300005544 Bacteria 1538
162 Ga0070695_100237705 3300005545 Bacteria 1320
163 Ga0070693_100041469 3300005547 Bacteria 2590
164 Ga0070665_100012971 3300005548 Bacteria 8393
165 Ga0070665_100043173 3300005548 Bacteria 4531
166 Ga0070665_100078283 3300005548 Bacteria 3312
167 Ga0070665_100315467 3300005548 Bacteria 1567
168 Ga0070665_100735545 3300005548 Bacteria 1000
169 Ga0068855_100012468 3300005563 Bacteria 10259
170 Ga0068855_100033424 3300005563 Bacteria 6137
171 Ga0068855_100055466 3300005563 Bacteria 4654
172 Ga0068855_100228474 3300005563 Bacteria 2085
173 Ga0070664_100003987 3300005564 Bacteria 11873
174 Ga0070664_100028913 3300005564 Bacteria 4616
175 Ga0070664_100029484 3300005564 Bacteria 4575
176 Ga0070664_100060295 3300005564 Bacteria 3230
177 Ga0070664_100573149 3300005564 Unclassified 1045
178 Ga0068857_100063167 3300005577 Bacteria 3292
179 Ga0068857_100312648 3300005577 Bacteria 1450
180 Ga0068857_100678862 3300005577 Bacteria 978
181 Ga0068857_100847265 3300005577 Bacteria 875
182 Ga0068854_100026974 3300005578 Bacteria 3953
183 Ga0068854_100101606 3300005578 Bacteria 2156
184 Ga0068854_100252561 3300005578 Bacteria 1408
185 Ga0068854_100493575 3300005578 Bacteria 1030
186 Ga0068856_100012973 3300005614 Bacteria 8068
187 Ga0068856_100226542 3300005614 Bacteria 1885
188 Ga0068856_100231784 3300005614 Bacteria 1862
189 Ga0068856_100699493 3300005614 Bacteria 1034
190 Ga0070702_100244495 3300005615 Bacteria 1213
191 Ga0068852_100004800 3300005616 Bacteria 9601
192 Ga0068852_100077623 3300005616 Bacteria 2936
193 Ga0068852_100575561 3300005616 Bacteria 1128
194 Ga0068852_100575734 3300005616 Bacteria 1128
195 Ga0068852_100620795 3300005616 Bacteria 1087
196 Ga0068852_100678148 3300005616 Bacteria 1040
197 Ga0068859_100012908 3300005617 Bacteria 8391
198 Ga0068859_100025566 3300005617 Bacteria 5922
199 Ga0068859_100028193 3300005617 Bacteria 5629
200 Ga0068859_100538143 3300005617 Bacteria 1263
201 Ga0068859_100701667 3300005617 Bacteria 1103
202 Ga0068859_100821069 3300005617 Bacteria 1017
203 Ga0068864_100002240 3300005618 Bacteria 15980
204 Ga0068864_100003990 3300005618 Bacteria 12151
205 Ga0068864_100011575 3300005618 Bacteria 7284
206 Ga0068864_100014825 3300005618 Bacteria 6475
207 Ga0068864_100021989 3300005618 Bacteria 5346
208 Ga0068864_100547990 3300005618 Bacteria 1117
209 Ga0068864_100851120 3300005618 Bacteria 898
210 Ga0068866_10011662 3300005718 Bacteria 3809
211 Ga0068861_100001035 3300005719 Bacteria 17040
212 Ga0068861_100018432 3300005719 Bacteria 4973
213 Ga0068861_100112000 3300005719 Bacteria 2188
214 Ga0068861_100259191 3300005719 Bacteria 1488
215 Ga0068851_10009516 3300005834 Bacteria 4521
216 Ga0068851_10067504 3300005834 Bacteria 1844
217 Ga0068851_10139938 3300005834 Bacteria 1315
218 Ga0068851_10143677 3300005834 Bacteria 1299
219 Ga0068851_10373858 3300005834 Bacteria 834
220 Ga0068870_10004558 3300005840 Bacteria 5970
221 Ga0068870_10014716 3300005840 Bacteria 3701
222 Ga0068870_10090403 3300005840 Bacteria 1710
223 Ga0068863_100003394 3300005841 Bacteria 15715
224 Ga0068863_100009320 3300005841 Bacteria 9578
225 Ga0068863_100035196 3300005841 Bacteria 4770
226 Ga0068863_100185189 3300005841 Bacteria 2000
227 Ga0068863_100338571 3300005841 Bacteria 1463
228 Ga0068863_100522278 3300005841 Bacteria 1171
229 Ga0068863_100588660 3300005841 Bacteria 1100
230 Ga0068863_100617843 3300005841 Bacteria 1073
231 Ga0068863_100714410 3300005841 Bacteria 996
232 Ga0068858_100005065 3300005842 Bacteria 12920
233 Ga0068858_100008747 3300005842 Bacteria 9715
234 Ga0068858_100013579 3300005842 Bacteria 7686
235 Ga0068858_100361779 3300005842 Bacteria 1391
236 Ga0068860_100010520 3300005843 Bacteria 9146
237 Ga0068860_100036079 3300005843 Bacteria 4739
238 Ga0068860_100050308 3300005843 Bacteria 3967
239 Ga0068860_100067173 3300005843 Bacteria 3407
240 Ga0068860_100176830 3300005843 Bacteria 2063
241 Ga0068860_100286533 3300005843 Bacteria 1611
242 Ga0068862_100006554 3300005844 Bacteria 9657
243 Ga0068862_100034516 3300005844 Bacteria 4280
244 Ga0068862_100054762 3300005844 Bacteria 3415
245 Ga0068862_100072269 3300005844 Bacteria 2980
246 Ga0068862_100470833 3300005844 Bacteria 1188
247 Ga0075368_10021285 3300006042 Bacteria 2463
248 Ga0075368_10099428 3300006042 Bacteria 1193
249 Ga0075363_100048410 3300006048 Bacteria 2260
250 Ga0075363_100096713 3300006048 Bacteria 1631
251 Ga0075363_100113676 3300006048 Bacteria 1507
252 Ga0075363_100131718 3300006048 Bacteria 1402
253 Ga0075363_100162519 3300006048 Bacteria 1265
254 Ga0075363_100186231 3300006048 Bacteria 1182
255 Ga0075363_100293429 3300006048 Bacteria 942
256 Ga0075432_10004434 3300006058 Bacteria 4782
257 Ga0070715_10238949 3300006163 Bacteria 944
258 Ga0070715_10292073 3300006163 Bacteria 869
259 Ga0075362_10038402 3300006177 Bacteria 2103
260 Ga0075362_10052360 3300006177 Bacteria 1829
261 Ga0075367_10013717 3300006178 Bacteria 4367
262 Ga0075367_10037267 3300006178 Bacteria 2825
263 Ga0075367_10065933 3300006178 Bacteria 2169
264 Ga0075367_10172170 3300006178 Bacteria 1349
265 Ga0075367_10184114 3300006178 Bacteria 1302
266 Ga0075366_10005007 3300006195 Bacteria 7152
267 Ga0075366_10007659 3300006195 Bacteria 5975
268 Ga0075366_10020570 3300006195 Bacteria 3831
269 Ga0075366_10032208 3300006195 Bacteria 3087
270 Ga0075366_10124789 3300006195 Bacteria 1552
271 Ga0075366_10140053 3300006195 Bacteria 1462
272 Ga0075366_10140054 3300006195 Bacteria 1462
273 Ga0075366_10163871 3300006195 Bacteria 1347
274 Ga0075366_10199471 3300006195 Bacteria 1217
275 Ga0075366_10220139 3300006195 Bacteria 1156
276 Ga0075366_10230087 3300006195 Bacteria 1129
277 Ga0075366_10241016 3300006195 Bacteria 1102
278 Ga0075366_10297252 3300006195 Bacteria 987
279 Ga0097621_100006535 3300006237 Bacteria 8284
280 Ga0097621_100010322 3300006237 Bacteria 6827
281 Ga0097621_100278890 3300006237 Bacteria 1471
282 Ga0097621_100419739 3300006237 Bacteria 1200
283 Ga0075370_10005505 3300006353 Bacteria 6306
284 Ga0075370_10018576 3300006353 Bacteria 3774
285 Ga0075370_10027322 3300006353 Bacteria 3165
286 Ga0075370_10034483 3300006353 Bacteria 2836
287 Ga0075370_10061589 3300006353 Bacteria 2137
288 Ga0075370_10114036 3300006353 Bacteria 1570
289 Ga0075370_10137912 3300006353 Bacteria 1425
290 Ga0075370_10165131 3300006353 Bacteria 1300
291 Ga0075370_10186134 3300006353 Bacteria 1222
292 Ga0075370_10304858 3300006353 Bacteria 947
293 Ga0068871_100006033 3300006358 Bacteria 8529
294 Ga0068871_100007867 3300006358 Bacteria 7639
295 Ga0068871_100032026 3300006358 Bacteria 4149
296 Ga0068871_100179548 3300006358 Bacteria 1818
297 Ga0068871_100188729 3300006358 Bacteria 1774
298 Ga0068871_100240874 3300006358 Bacteria 1572
299 Ga0068871_100459457 3300006358 Bacteria 1142
300 Ga0068871_100689766 3300006358 Bacteria 935
301 Ga0075433_10333281 3300006852 Bacteria 1342
302 Ga0075434_100760382 3300006871 Bacteria 986
303 Ga0068865_100008020 3300006881 Bacteria 6519
304 Ga0068865_100019560 3300006881 Bacteria 4383
305 Ga0068865_100185989 3300006881 Bacteria 1603
306 Ga0068865_100340811 3300006881 Bacteria 1211
307 Ga0075436_100095176 3300006914 Bacteria 2072
308 Ga0097620_100012908 3300006931 Bacteria 8391
309 Ga0097620_100025566 3300006931 Bacteria 5922
310 Ga0097620_100028193 3300006931 Bacteria 5629
311 Ga0097620_100538151 3300006931 Bacteria 1263
312 Ga0097620_100701629 3300006931 Bacteria 1103
313 Ga0097620_100821036 3300006931 Bacteria 1017
314 Ga0099823_1000575 3300006944 Bacteria 25524
315 Ga0079104_1000020 3300006946 Bacteria 256848
316 Ga0079104_1000073 3300006946 Bacteria 152269
317 Ga0105244_10318349 3300009036 Bacteria 719
318 Ga0105250_10003253 3300009092 Bacteria 7735
319 Ga0105240_10006593 3300009093 Bacteria 17041
320 Ga0105240_10027286 3300009093 Bacteria 7478
321 Ga0105240_10052818 3300009093 Bacteria 5106
322 Ga0105240_10324621 3300009093 Bacteria 1753
323 Ga0105245_10044557 3300009098 Bacteria 3960
324 Ga0105245_10450233 3300009098 Bacteria 1296
325 Ga0105245_10614544 3300009098 Bacteria 1114
326 Ga0105247_10059115 3300009101 Bacteria 2372
327 Ga0105247_10311279 3300009101 Bacteria 1096
328 Ga0105247_10506642 3300009101 Bacteria 880
329 Ga0114129_10230337 3300009147 Bacteria 2495
330 Ga0105243_10000525 3300009148 Bacteria 39020
331 Ga0105243_10014258 3300009148 Bacteria 6014
332 Ga0105243_10095383 3300009148 Bacteria 2458
333 Ga0105243_10639524 3300009148 Bacteria 1029
334 Ga0105241_10066794 3300009174 Bacteria 2782
335 Ga0105241_10183250 3300009174 Bacteria 1738
336 Ga0105241_10258217 3300009174 Bacteria 1480
337 Ga0105241_10555148 3300009174 Bacteria 1032
338 Ga0105242_10344714 3300009176 Bacteria 1374
339 Ga0105242_11142359 3300009176 Bacteria 795
340 Ga0105248_10027604 3300009177 Bacteria 6322
341 Ga0105248_10083241 3300009177 Bacteria 3599
342 Ga0105248_10171516 3300009177 Bacteria 2445
343 Ga0105248_10220030 3300009177 Bacteria 2138
344 Ga0105248_10307005 3300009177 Bacteria 1787
345 Ga0105248_10554814 3300009177 Bacteria 1296
346 Ga0105248_10659570 3300009177 Bacteria 1180
347 Ga0105248_11405906 3300009177 Bacteria 789
348 Ga0105237_10000293 3300009545 Bacteria 69295
349 Ga0105237_10069489 3300009545 Bacteria 3517
350 Ga0105237_10294543 3300009545 Bacteria 1625
351 Ga0105238_10017388 3300009551 Bacteria 7306
352 Ga0105238_10038608 3300009551 Bacteria 4848
353 Ga0105238_10117669 3300009551 Bacteria 2638
354 Ga0105238_10341123 3300009551 Bacteria 1486
355 Ga0105249_10034394 3300009553 Bacteria 4593
356 Ga0105249_10072007 3300009553 Bacteria 3195
357 Ga0105249_10352834 3300009553 Bacteria 1490
358 Ga0105249_10443383 3300009553 Bacteria 1336
359 Ga0105239_10002229 3300010375 Bacteria 24806
360 Ga0105239_10080161 3300010375 Bacteria 3592
361 Ga0105239_10082739 3300010375 Bacteria 3535
362 Ga0105239_10270740 3300010375 Bacteria 1910
363 Ga0105239_10337352 3300010375 Bacteria 1701
364 Ga0105239_10403123 3300010375 Bacteria 1548
365 Ga0105246_10439667 3300011119 Bacteria 1093
366 Ga0157317_1006061 3300012475 Bacteria 834
367 Ga0157319_1000008 3300012497 Bacteria 315600
368 Ga0157373_10015813 3300013100 Bacteria 5509
369 Ga0157373_10350048 3300013100 Unclassified 1054
370 Ga0157371_10061369 3300013102 Bacteria 2666
371 Ga0157371_10184203 3300013102 Bacteria 1494
372 Ga0157370_10123429 3300013104 Bacteria 2418
373 Ga0157369_10005006 3300013105 Bacteria 15519
374 Ga0157369_10074950 3300013105 Bacteria 3628
375 Ga0157374_10007229 3300013296 Bacteria 9460
376 Ga0157374_10011240 3300013296 Bacteria 7743
377 Ga0157374_10086592 3300013296 Bacteria 2981
378 Ga0157374_10097576 3300013296 Bacteria 2812
379 Ga0157374_10745745 3300013296 Bacteria 994
380 Ga0157378_10030973 3300013297 Bacteria 4723
381 Ga0157378_10081670 3300013297 Bacteria 2921
382 Ga0157378_10312446 3300013297 Bacteria 1524
383 Ga0157378_10828240 3300013297 Bacteria 953
384 Ga0163162_10030548 3300013306 Bacteria 5338
385 Ga0163162_10043733 3300013306 Bacteria 4485
386 Ga0163162_10206635 3300013306 Bacteria 2093
387 Ga0163162_10582091 3300013306 Bacteria 1246
388 Ga0157372_10007733 3300013307 Bacteria 11419
389 Ga0157372_10021336 3300013307 Bacteria 6997
390 Ga0157372_10256101 3300013307 Bacteria 2032
391 Ga0157372_11473804 3300013307 Bacteria 784
392 Ga0157375_10017197 3300013308 Bacteria 6520
393 Ga0157375_10018712 3300013308 Bacteria 6286
394 Ga0157375_10026535 3300013308 Bacteria 5401
395 Ga0157375_10051621 3300013308 Bacteria 4039
396 Ga0157375_10089867 3300013308 Bacteria 3129
397 Ga0157375_10193985 3300013308 Bacteria 2186
398 Ga0163163_10065623 3300014325 Bacteria 3604
399 Ga0157380_10241252 3300014326 Bacteria 1629
400 Ga0157380_10363566 3300014326 Bacteria 1359
401 Ga0157377_10000038 3300014745 Bacteria 113777
402 Ga0157379_10002231 3300014968 Bacteria 16123
403 Ga0157379_10006232 3300014968 Bacteria 10271
404 Ga0157379_10014708 3300014968 Bacteria 6864
405 Ga0157379_10019318 3300014968 Bacteria 6018
406 Ga0157379_10071903 3300014968 Bacteria 3094
407 Ga0157379_10190746 3300014968 Bacteria 1852
408 Ga0157379_10553521 3300014968 Bacteria 1070
409 Ga0157376_10020032 3300014969 Bacteria 5167
410 Ga0157376_10167698 3300014969 Bacteria 1996
411 Ga0182007_10039395 3300015262 Bacteria 1581
412 Ga0163161_10013908 3300017792 Bacteria 5605
413 Ga0163161_10111266 3300017792 Bacteria 2047
414 Ga0163161_10397812 3300017792 Bacteria 1104
415 Ga0163161_10585733 3300017792 Bacteria 918
416 Ga0213876_10065823 3300021384 Bacteria 1913
417 Ga0207425_1000121 3300025245 Bacteria 73749
418 Ga0209129_1000012 3300025258 Bacteria 541516
419 Ga0209565_1008438 3300025263 Bacteria 2692
420 Ga0207666_1015925 3300025271 Bacteria 1075
421 Ga0209673_1007465 3300025273 Bacteria 5032
422 Ga0209673_1012217 3300025273 Bacteria 3478
423 Ga0209673_1036811 3300025273 Bacteria 1446
424 Ga0207673_1015908 3300025290 Bacteria 998
425 Ga0209564_1000008 3300025295 Bacteria 953227
426 Ga0209564_1000022 3300025295 Bacteria 555109
427 Ga0209758_1000099 3300025297 Bacteria 230054
428 Ga0209758_1000358 3300025297 Bacteria 81693
429 Ga0209050_1000760 3300025298 Bacteria 46346
430 Ga0209050_1000873 3300025298 Bacteria 40656
431 Ga0209050_1002331 3300025298 Bacteria 16690
432 Ga0209050_1008998 3300025298 Bacteria 5201
433 Ga0209256_1000036 3300025299 Bacteria 386664
434 Ga0209256_1000837 3300025299 Bacteria 38664
435 Ga0209256_1011749 3300025299 Bacteria 3453
436 Ga0209256_1017155 3300025299 Bacteria 2422
437 Ga0209256_1037305 3300025299 Bacteria 1267
438 Ga0209051_1000068 3300025303 Bacteria 220063
439 Ga0209051_1005571 3300025303 Bacteria 7317
440 Ga0209051_1005729 3300025303 Bacteria 7172
441 Ga0209051_1010724 3300025303 Bacteria 4589
442 Ga0209257_1000033 3300025304 Bacteria 671006
443 Ga0209257_1000146 3300025304 Bacteria 194261
444 Ga0209257_1000952 3300025304 Bacteria 39869
445 Ga0209257_1002605 3300025304 Bacteria 17477
446 Ga0209257_1024468 3300025304 Bacteria 2090
447 Ga0207697_10010273 3300025315 Bacteria 4009
448 Ga0207697_10032314 3300025315 Bacteria 2142
449 Ga0207697_10035213 3300025315 Bacteria 2049
450 Ga0207697_10035983 3300025315 Bacteria 2027
451 Ga0207656_10003251 3300025321 Bacteria 5563
452 Ga0207656_10009959 3300025321 Bacteria 3542
453 Ga0207656_10014449 3300025321 Bacteria 3042
454 Ga0207656_10033692 3300025321 Bacteria 2135
455 Ga0207696_1003921 3300025711 Bacteria 6560
456 Ga0207682_10000367 3300025893 Bacteria 20767
457 Ga0207682_10011645 3300025893 Bacteria 3437
458 Ga0207682_10011678 3300025893 Bacteria 3433
459 Ga0207682_10061091 3300025893 Bacteria 1577
460 Ga0207682_10115488 3300025893 Bacteria 1186
461 Ga0207688_10018614 3300025901 Bacteria 3778
462 Ga0207688_10037702 3300025901 Bacteria 2681
463 Ga0207688_10041077 3300025901 Bacteria 2571
464 Ga0207688_10157209 3300025901 Bacteria 1346
465 Ga0207680_10004392 3300025903 Bacteria 6683
466 Ga0207680_10014034 3300025903 Bacteria 4132
467 Ga0207680_10080280 3300025903 Bacteria 2048
468 Ga0207647_10174717 3300025904 Bacteria 1250
469 Ga0207685_10221656 3300025905 Bacteria 900
470 Ga0207645_10001049 3300025907 Bacteria 22870
471 Ga0207645_10014621 3300025907 Bacteria 5246
472 Ga0207645_10140455 3300025907 Bacteria 1574
473 Ga0207645_10277788 3300025907 Bacteria 1112
474 Ga0207645_10286726 3300025907 Bacteria 1094
475 Ga0207643_10009165 3300025908 Bacteria 5316
476 Ga0207643_10017376 3300025908 Bacteria 3933
477 Ga0207643_10034786 3300025908 Bacteria 2823
478 Ga0207684_10003630 3300025910 Bacteria 15000
479 Ga0207654_10029720 3300025911 Bacteria 2995
480 Ga0207654_10128747 3300025911 Bacteria 1600
481 Ga0207654_10141798 3300025911 Bacteria 1533
482 Ga0207654_10286426 3300025911 Bacteria 1116
483 Ga0207707_10156697 3300025912 Bacteria 1992
484 Ga0207707_10361384 3300025912 Bacteria 1250
485 Ga0207695_10015331 3300025913 Bacteria 9027
486 Ga0207695_10223980 3300025913 Bacteria 1787
487 Ga0207695_10242262 3300025913 Bacteria 1704
488 Ga0207695_10746672 3300025913 Bacteria 859
489 Ga0207671_10038461 3300025914 Bacteria 3546
490 Ga0207671_10449855 3300025914 Bacteria 1026
491 Ga0207660_10029033 3300025917 Bacteria 3789
492 Ga0207662_10061345 3300025918 Bacteria 2257
493 Ga0207662_10069806 3300025918 Bacteria 2124
494 Ga0207662_10149484 3300025918 Bacteria 1485
495 Ga0207657_10015678 3300025919 Bacteria 7331
496 Ga0207657_10028264 3300025919 Bacteria 5118
497 Ga0207657_10037698 3300025919 Bacteria 4313
498 Ga0207649_10001094 3300025920 Bacteria 16484
499 Ga0207649_10003313 3300025920 Bacteria 8816
500 Ga0207649_10276875 3300025920 Bacteria 1218
501 Ga0207652_10014128 3300025921 Bacteria 6464
502 Ga0207652_10182810 3300025921 Bacteria 1885
503 Ga0207652_10189841 3300025921 Bacteria 1848
504 Ga0207646_10147629 3300025922 Bacteria 2119
505 Ga0207681_10008956 3300025923 Bacteria 6112
506 Ga0207681_10031343 3300025923 Bacteria 3471
507 Ga0207681_10071478 3300025923 Bacteria 2420
508 Ga0207681_10134335 3300025923 Bacteria 1833
509 Ga0207681_10258025 3300025923 Bacteria 1363
510 Ga0207681_10667840 3300025923 Bacteria 862
511 Ga0207694_10045161 3300025924 Bacteria 3403
512 Ga0207694_10052315 3300025924 Bacteria 3167
513 Ga0207694_10090569 3300025924 Bacteria 2413
514 Ga0207650_10003357 3300025925 Bacteria 11014
515 Ga0207650_10003433 3300025925 Bacteria 10894
516 Ga0207650_10007340 3300025925 Bacteria 7505
517 Ga0207650_10031578 3300025925 Bacteria 3826
518 Ga0207650_10124634 3300025925 Bacteria 2010
519 Ga0207650_10220740 3300025925 Bacteria 1525
520 Ga0207650_10418621 3300025925 Bacteria 1111
521 Ga0207659_10003571 3300025926 Bacteria 9366
522 Ga0207659_10004238 3300025926 Bacteria 8674
523 Ga0207659_10006704 3300025926 Bacteria 7074
524 Ga0207659_10013572 3300025926 Bacteria 5224
525 Ga0207659_10096854 3300025926 Bacteria 2215
526 Ga0207659_10187546 3300025926 Bacteria 1643
527 Ga0207687_10101895 3300025927 Bacteria 2114
528 Ga0207687_10744315 3300025927 Bacteria 834
529 Ga0207644_10011880 3300025931 Bacteria 5771
530 Ga0207644_10016193 3300025931 Bacteria 5016
531 Ga0207644_10017481 3300025931 Bacteria 4844
532 Ga0207644_10021541 3300025931 Bacteria 4392
533 Ga0207644_10079366 3300025931 Bacteria 2421
534 Ga0207644_10099426 3300025931 Bacteria 2183
535 Ga0207644_10141609 3300025931 Bacteria 1852
536 Ga0207644_10177035 3300025931 Bacteria 1669
537 Ga0207644_10328223 3300025931 Bacteria 1238
538 Ga0207690_10001490 3300025932 Bacteria 14634
539 Ga0207690_10012303 3300025932 Bacteria 5120
540 Ga0207690_10046545 3300025932 Bacteria 2874
541 Ga0207690_10696238 3300025932 Bacteria 835
542 Ga0207706_10001701 3300025933 Bacteria 21679
543 Ga0207706_10241542 3300025933 Bacteria 1579
544 Ga0207706_10439737 3300025933 Bacteria 1129
545 Ga0207686_10004472 3300025934 Bacteria 7490
546 Ga0207709_10000198 3300025935 Bacteria 80022
547 Ga0207709_10001602 3300025935 Bacteria 15414
548 Ga0207709_10032252 3300025935 Bacteria 3066
549 Ga0207670_10023188 3300025936 Bacteria 3860
550 Ga0207670_10191084 3300025936 Bacteria 1549
551 Ga0207669_10015012 3300025937 Bacteria 3896
552 Ga0207669_10019944 3300025937 Bacteria 3503
553 Ga0207669_10035931 3300025937 Bacteria 2825
554 Ga0207669_10053942 3300025937 Bacteria 2425
555 Ga0207669_10331034 3300025937 Bacteria 1169
556 Ga0207704_10271029 3300025938 Bacteria 1285
557 Ga0207704_10402878 3300025938 Bacteria 1080
558 Ga0207691_10000244 3300025940 Bacteria 53634
559 Ga0207691_10008283 3300025940 Bacteria 9981
560 Ga0207691_10066141 3300025940 Bacteria 3271
561 Ga0207691_10069585 3300025940 Bacteria 3179
562 Ga0207691_10101817 3300025940 Bacteria 2562
563 Ga0207691_10114250 3300025940 Bacteria 2399
564 Ga0207691_10151310 3300025940 Bacteria 2040
565 Ga0207691_10181620 3300025940 Bacteria 1838
566 Ga0207691_10292570 3300025940 Bacteria 1400
567 Ga0207691_10380863 3300025940 Bacteria 1204
568 Ga0207711_10016975 3300025941 Bacteria 6047
569 Ga0207711_10023382 3300025941 Bacteria 5174
570 Ga0207711_10067721 3300025941 Bacteria 3091
571 Ga0207711_10072679 3300025941 Bacteria 2988
572 Ga0207711_10251874 3300025941 Bacteria 1622
573 Ga0207711_10565897 3300025941 Bacteria 1060
574 Ga0207711_10632905 3300025941 Bacteria 998
575 Ga0207711_10671916 3300025941 Bacteria 966
576 Ga0207689_10002740 3300025942 Bacteria 16293
577 Ga0207689_10005411 3300025942 Bacteria 11429
578 Ga0207689_10088018 3300025942 Bacteria 2551
579 Ga0207689_10159056 3300025942 Bacteria 1862
580 Ga0207689_10175351 3300025942 Bacteria 1768
581 Ga0207689_10424385 3300025942 Bacteria 1110
582 Ga0207661_10185879 3300025944 Bacteria 1818
583 Ga0207661_10548966 3300025944 Bacteria 1058
584 Ga0207679_10000754 3300025945 Bacteria 21384
585 Ga0207679_10020679 3300025945 Bacteria 4445
586 Ga0207679_10054821 3300025945 Bacteria 2937
587 Ga0207679_10082538 3300025945 Bacteria 2461
588 Ga0207679_10090436 3300025945 Bacteria 2366
589 Ga0207679_10474582 3300025945 Bacteria 1113
590 Ga0207667_10032208 3300025949 Bacteria 5651
591 Ga0207667_10045107 3300025949 Bacteria 4669
592 Ga0207667_10115027 3300025949 Bacteria 2773
593 Ga0207667_10291224 3300025949 Bacteria 1668
594 Ga0207667_10618836 3300025949 Bacteria 1091
595 Ga0207651_10001334 3300025960 Bacteria 11150
596 Ga0207651_10029487 3300025960 Bacteria 3477
597 Ga0207651_10037660 3300025960 Bacteria 3170
598 Ga0207651_10049896 3300025960 Bacteria 2838
599 Ga0207651_11122024 3300025960 Bacteria 705
600 Ga0207712_10106376 3300025961 Bacteria 2096
601 Ga0207712_10376992 3300025961 Bacteria 1186
602 Ga0207712_10485026 3300025961 Bacteria 1054
603 Ga0207668_10017895 3300025972 Bacteria 4449
604 Ga0207668_10044493 3300025972 Bacteria 3020
605 Ga0207668_10057311 3300025972 Bacteria 2717
606 Ga0207668_10079657 3300025972 Bacteria 2370
607 Ga0207668_10216369 3300025972 Bacteria 1535
608 Ga0207640_10034077 3300025981 Bacteria 3175
609 Ga0207640_10045926 3300025981 Bacteria 2808
610 Ga0207640_10144702 3300025981 Bacteria 1738
611 Ga0207640_10430997 3300025981 Bacteria 1082
612 Ga0207640_10945762 3300025981 Bacteria 755
613 Ga0207658_10001534 3300025986 Bacteria 17947
614 Ga0207658_10009608 3300025986 Bacteria 6563
615 Ga0207658_10028581 3300025986 Bacteria 3927
616 Ga0207658_10029554 3300025986 Bacteria 3871
617 Ga0207658_10087861 3300025986 Bacteria 2401
618 Ga0207677_10004562 3300026023 Bacteria 7449
619 Ga0207677_10018902 3300026023 Bacteria 4147
620 Ga0207677_10019193 3300026023 Bacteria 4123
621 Ga0207677_10021149 3300026023 Bacteria 3969
622 Ga0207677_10102380 3300026023 Bacteria 2111
623 Ga0207677_10204230 3300026023 Bacteria 1573
624 Ga0207703_10000788 3300026035 Bacteria 31170
625 Ga0207703_10001859 3300026035 Bacteria 18774
626 Ga0207703_10008117 3300026035 Bacteria 8297
627 Ga0207703_10066216 3300026035 Bacteria 2971
628 Ga0207639_10254434 3300026041 Bacteria 1533
629 Ga0207639_10422897 3300026041 Bacteria 1205
630 Ga0207678_10004374 3300026067 Bacteria 12704
631 Ga0207678_10020588 3300026067 Bacteria 5784
632 Ga0207678_10147138 3300026067 Bacteria 2011
633 Ga0207678_10180996 3300026067 Bacteria 1800
634 Ga0207678_10240781 3300026067 Bacteria 1549
635 Ga0207678_10308767 3300026067 Bacteria 1360
636 Ga0207678_10509974 3300026067 Bacteria 1049
637 Ga0207708_10113562 3300026075 Bacteria 2105
638 Ga0207708_10300276 3300026075 Bacteria 1306
639 Ga0207702_10011118 3300026078 Bacteria 7511
640 Ga0207702_10192364 3300026078 Bacteria 1886
641 Ga0207702_10195115 3300026078 Bacteria 1874
642 Ga0207702_10360811 3300026078 Bacteria 1393
643 Ga0207641_10009503 3300026088 Bacteria 8016
644 Ga0207641_10029764 3300026088 Bacteria 4516
645 Ga0207641_10033219 3300026088 Bacteria 4287
646 Ga0207641_10113692 3300026088 Bacteria 2404
647 Ga0207641_10152557 3300026088 Bacteria 2093
648 Ga0207641_10351973 3300026088 Bacteria 1404
649 Ga0207648_10000118 3300026089 Bacteria 77144
650 Ga0207648_10000357 3300026089 Bacteria 50390
651 Ga0207648_10007655 3300026089 Bacteria 10571
652 Ga0207648_10013897 3300026089 Bacteria 7466
653 Ga0207648_10059093 3300026089 Bacteria 3344
654 Ga0207648_10089580 3300026089 Bacteria 2688
655 Ga0207648_10296358 3300026089 Bacteria 1449
656 Ga0207676_10003850 3300026095 Bacteria 10598
657 Ga0207676_10010144 3300026095 Bacteria 6705
658 Ga0207676_10069368 3300026095 Bacteria 2822
659 Ga0207676_10116185 3300026095 Bacteria 2248
660 Ga0207676_10130524 3300026095 Bacteria 2135
661 Ga0207676_10662256 3300026095 Bacteria 1008
662 Ga0207674_10012770 3300026116 Bacteria 9382
663 Ga0207674_10042583 3300026116 Bacteria 4688
664 Ga0207674_10067419 3300026116 Bacteria 3603
665 Ga0207674_10079812 3300026116 Bacteria 3275
666 Ga0207674_10282240 3300026116 Bacteria 1609
667 Ga0207675_100000579 3300026118 Bacteria 35747
668 Ga0207675_100001372 3300026118 Bacteria 24404
669 Ga0207675_100002097 3300026118 Bacteria 19787
670 Ga0207675_100044100 3300026118 Bacteria 4166
671 Ga0207675_100140161 3300026118 Bacteria 2297
672 Ga0207683_10000230 3300026121 Bacteria 49516
673 Ga0207683_10007352 3300026121 Bacteria 9439
674 Ga0207683_10029469 3300026121 Bacteria 4752
675 Ga0207683_10117487 3300026121 Bacteria 2385
676 Ga0207683_10169887 3300026121 Bacteria 1974
677 Ga0207683_10359578 3300026121 Bacteria 1337
678 Ga0207683_10537712 3300026121 Bacteria 1080
679 Ga0207698_10017285 3300026142 Bacteria 4889
680 Ga0207698_10066881 3300026142 Bacteria 2831
681 Ga0207698_10166884 3300026142 Bacteria 1933
682 Ga0207698_10237181 3300026142 Bacteria 1660
683 Ga0209281_1000002 3300027111 Bacteria 1924012
684 Ga0209281_1000259 3300027111 Bacteria 101905
685 Ga0209389_1003489 3300027296 Bacteria 12697
686 Ga0209371_1008466 3300027312 Bacteria 3415
687 Ga0209969_1016405 3300027360 Bacteria 1086
688 Ga0209981_1003564 3300027378 Bacteria 2022
689 Ga0209996_1004592 3300027395 Bacteria 1757
690 Ga0209968_1000430 3300027526 Bacteria 6829
691 Ga0209999_1052357 3300027543 Bacteria 772
692 Ga0210002_1019689 3300027617 Bacteria 1084
693 Ga0209971_1000610 3300027682 Bacteria 9288
694 Ga0209966_1000118 3300027695 Bacteria 35137
695 Ga0209998_10006352 3300027717 Bacteria 2455
696 Ga0209813_10010910 3300027866 Bacteria 2362
697 Ga0209813_10014474 3300027866 Bacteria 2123
698 Ga0209974_10021685 3300027876 Bacteria 2128
699 Ga0207428_10109477 3300027907 Bacteria 2127
700 Ga0268266_10019382 3300028379 Bacteria 5792
701 Ga0268266_10053004 3300028379 Bacteria 3484
702 Ga0268266_10104683 3300028379 Bacteria 2499
703 Ga0268266_10128406 3300028379 Bacteria 2265
704 Ga0268265_10004979 3300028380 Bacteria 9123
705 Ga0268265_10019071 3300028380 Bacteria 4762
706 Ga0268265_10027331 3300028380 Bacteria 4071
707 Ga0268265_10060730 3300028380 Bacteria 2898
708 Ga0268265_10073330 3300028380 Bacteria 2673
709 Ga0268265_10303618 3300028380 Bacteria 1438
710 Ga0268264_10017136 3300028381 Bacteria 5933
711 Ga0268264_10034520 3300028381 Bacteria 4161
712 Ga0268264_10038813 3300028381 Bacteria 3932
713 Ga0268264_10044282 3300028381 Bacteria 3691
714 Ga0268264_10061039 3300028381 Bacteria 3161
715 Ga0268264_10068398 3300028381 Bacteria 3001
716 Ga0268264_10365416 3300028381 Bacteria 1378
717 Ga0307517_10000131 3300028786 Bacteria 113233
718 Ga0307517_10196499 3300028786 Bacteria 1269
719 Ga0307517_10218271 3300028786 Bacteria 1163
720 Ga0307515_10000011 3300028794 Bacteria 633903
721 Ga0307515_10000138 3300028794 Bacteria 173220
722 Ga0307515_10000382 3300028794 Bacteria 107907
723 Ga0307515_10016458 3300028794 Bacteria 13533
724 Ga0307515_10038069 3300028794 Bacteria 7708
725 Ga0307515_10112976 3300028794 Bacteria 3154
726 Ga0307515_10118360 3300028794 Bacteria 3024
727 Ga0307515_10162149 3300028794 Bacteria 2274
728 Ga0307515_10255090 3300028794 Bacteria 1500
729 Ga0307515_10278285 3300028794 Bacteria 1384
730 Ga0268256_1012730 3300030500 Bacteria 2584
731 Ga0307512_10015605 3300030522 Bacteria 7031
732 Ga0307512_10043490 3300030522 Bacteria 3704
733 Ga0265330_10045911 3300031235 Bacteria 1926
734 Ga0265332_10000035 3300031238 Bacteria 139554
735 Ga0265332_10013777 3300031238 Bacteria 3580
736 Ga0265328_10012101 3300031239 Bacteria 3437
737 Ga0265329_10081142 3300031242 Bacteria 1027
738 Ga0265331_10007025 3300031250 Bacteria 6569
739 Ga0265327_10000042 3300031251 Bacteria 287487
740 Ga0307513_10011084 3300031456 Bacteria 11240
741 Ga0307513_10018983 3300031456 Bacteria 8198
742 Ga0307513_10054060 3300031456 Bacteria 4309
743 Ga0307513_10243315 3300031456 Bacteria 1602
744 Ga0307513_10245325 3300031456 Bacteria 1592
745 Ga0307513_10275851 3300031456 Bacteria 1461
746 Ga0307509_10004038 3300031507 Bacteria 21555
747 Ga0307509_10004862 3300031507 Bacteria 19056
748 Ga0307509_10018297 3300031507 Bacteria 8037
749 Ga0307509_10035960 3300031507 Bacteria 5429
750 Ga0307509_10042328 3300031507 Bacteria 4936
751 Ga0307509_10136519 3300031507 Bacteria 2397
752 Ga0307509_10455111 3300031507 Bacteria 973
753 Ga0307408_100000089 3300031548 Bacteria 100712
754 Ga0307408_100052190 3300031548 Bacteria 2949
755 Ga0307408_100065288 3300031548 Bacteria 2669
756 Ga0307408_100097632 3300031548 Bacteria 2232
757 Ga0307408_100138807 3300031548 Bacteria 1905
758 Ga0307408_100150749 3300031548 Bacteria 1835
759 Ga0307508_10000509 3300031616 Bacteria 46521
760 Ga0307508_10094825 3300031616 Bacteria 2574
761 Ga0307514_10003857 3300031649 Bacteria 14090
762 Ga0307514_10028654 3300031649 Bacteria 4490
763 Ga0307514_10090249 3300031649 Bacteria 2236
764 Ga0265314_10001279 3300031711 Bacteria 28615
765 Ga0307516_10001343 3300031730 Bacteria 34183
766 Ga0307516_10005732 3300031730 Bacteria 14718
767 Ga0307516_10011470 3300031730 Bacteria 9622
768 Ga0307516_10015487 3300031730 Bacteria 8020
769 Ga0307516_10101753 3300031730 Bacteria 2688
770 Ga0307516_10334201 3300031730 Bacteria 1183
771 Ga0307405_10008322 3300031731 Bacteria 5247
772 Ga0307405_10050195 3300031731 Bacteria 2582
773 Ga0307405_10327066 3300031731 Bacteria 1173
774 Ga0307410_10255603 3300031852 Bacteria 1364
775 Ga0307412_10224351 3300031911 Bacteria 1442
776 Ga0307412_10270782 3300031911 Bacteria 1329
777 Ga0307412_10315321 3300031911 Bacteria 1242
778 Ga0307412_10463377 3300031911 Bacteria 1047
779 Ga0307409_100011369 3300031995 Bacteria 5606
780 Ga0307409_100190211 3300031995 Bacteria 1826
781 Ga0307409_100671679 3300031995 Bacteria 1032
782 Ga0307416_100229461 3300032002 Bacteria 1788
783 Ga0307414_10012084 3300032004 Bacteria 5095
784 Ga0307414_10335133 3300032004 Bacteria 1293
785 Ga0307414_10539073 3300032004 Bacteria 1038
786 Ga0307411_10003956 3300032005 Bacteria 6996
787 Ga0307411_10028011 3300032005 Bacteria 3419
788 Ga0307510_10016292 3300033180 Bacteria 8774
789 Ga0307510_10029238 3300033180 Bacteria 6276
790 Ga0307510_10132423 3300033180 Bacteria 2161
791 Ga0307510_10192955 3300033180 Bacteria 1582
792 Ga0373948_0004523 3300034817 Bacteria 2206
793 Ga0373928_0011197 3300035084 Bacteria 1773
794 Ga0373940_0016601 3300035088 Bacteria 1825
795 Ga0373940_0025148 3300035088 Bacteria 1549
796 Ga0373951_0014557 3300035091 Bacteria 1769
797 Ga0373939_0000041 3300035114 Bacteria 45477
798 Ga0373945_0008855 3300035116 Bacteria 3288
799 Ga0373953_0151115 3300035117 Bacteria 996
800 Ga0373960_0003175 3300035121 Bacteria 3713
801 Ga0373943_0239789 3300035170 Bacteria 1016
802 Ga0373955_0179207 3300035172 Bacteria 1257
803 Ga0373961_0004703 3300035241 Bacteria 3285
804 Ga0373962_0054560 3300035242 Bacteria 1159
805 Ga0373931_0000097 3300035691 Bacteria 40104
806 Ga0373931_0342992 3300035691 Bacteria 933
807 Ga0373935_0211397 3300035692 Bacteria 1344
808 Ga0373927_0272917 3300035695 Bacteria 1112
809 Ga0373927_0297132 3300035695 Bacteria 1063
810 Ga0373937_0484074 3300036401 Bacteria 1175
811 Ga0373937_1067607 3300036401 Bacteria 756
812 Ga0373925_0031877 3300037068 Bacteria 3877
813 Ga0373925_0198126 3300037068 Bacteria 1596
814 Ga0373925_0246724 3300037068 Bacteria 1431
815 Ga0395899_0039026 3300037312 Bacteria 3555
816 Ga0395900_0020054 3300037418 Bacteria 6818
817 Ga0395900_0112977 3300037418 Bacteria 2788
818 Ga0395898_0016994 3300037466 Bacteria 7429
819 Ga0395898_0035622 3300037466 Bacteria 4946
820 Ga0395905_0000088 3300037471 Bacteria 152506
821 Ga0395905_0004162 3300037471 Bacteria 15128
822 Ga0395905_0012925 3300037471 Bacteria 8025
823 Ga0395905_0054737 3300037471 Bacteria 3733
824 Ga0395905_0066847 3300037471 Bacteria 3366
825 Ga0395905_0106647 3300037471 Bacteria 2630
826 Ga0395901_0016216 3300038443 Bacteria 7589
827 Ga0395901_0036278 3300038443 Bacteria 5095
828 Ga0395901_0060112 3300038443 Bacteria 3954
829 Ga0395901_0101339 3300038443 Bacteria 3021
830 Ga0395901_0136131 3300038443 Bacteria 2582
831 Ga0400485_22416 3300038735 Bacteria 2238
832 Ga0400486_16027 3300038742 Bacteria 3975
833 Ga0436365_0041930 3300039437 Bacteria 2813
834 Ga0436365_0738692 3300039437 Bacteria 795
835 Ga0436363_0737230 3300039450 Bacteria 2127
836 Ga0439436_0050297 3300041404 Bacteria 1179
837 Ga0439453_0017957 3300041408 Bacteria 1247
838 Ga0439461_0078468 3300041410 Bacteria 776
839 Ga0439465_0055229 3300041413 Bacteria 1307
840 Ga0451789_0549618 3300041443 Bacteria 3665
841 Ga0451791_1199651 3300041451 Bacteria 1640
842 Ga0451793_1860797 3300041452 Bacteria 1250
843 Ga0451795_1118135 3300041456 Bacteria 883
844 Ga0451802_1020009 3300041460 Bacteria 1184
845 Ga0451802_1397458 3300041460 Bacteria 1683
846 Ga0451807_0616347 3300041486 Bacteria 2078
847 Ga0451833_0175603 3300041491 Bacteria 1303
848 Ga0451843_1165301 3300041509 Bacteria 753
849 Ga0451853_1221463 3300041512 Bacteria 946
850 Ga0451853_3333348 3300041512 Bacteria 996
851 Ga0439437_018286 3300042000 Bacteria 837
852 Ga0439462_0005393 3300042015 Bacteria 3152
853 Ga0439462_0013376 3300042015 Bacteria 2102
854 Ga0450923_015532 3300042125 Bacteria 1425
855 Ga0450888_000201 3300042126 Bacteria 5304
856 Ga0450890_000665 3300042127 Bacteria 5012
857 Ga0450890_001025 3300042127 Bacteria 4048
858 Ga0450891_000553 3300042129 Bacteria 3872
859 Ga0450892_000410 3300042130 Bacteria 5079
860 Ga0450903_014731 3300042138 Bacteria 1236
861 Ga0450889_001619 3300042144 Bacteria 2295
862 Ga0439446_0026929 3300042156 Bacteria 1649
863 Ga0450908_012273 3300042184 Bacteria 1557
864 Ga0439434_0017826 3300042435 Bacteria 2125
865 Ga0439434_0058814 3300042435 Bacteria 1200
866 Ga0439459_0002426 3300042438 Bacteria 2874
867 Ga0439459_0025177 3300042438 Bacteria 1173
868 Ga0439464_0001793 3300042439 Bacteria 5179
869 Ga0450918_000028 3300042531 Bacteria 30240
870 Ga0450918_000411 3300042531 Bacteria 9287
871 Ga0451577_0000190 3300042876 Bacteria 130692
872 Ga0451577_0001771 3300042876 Bacteria 27782
873 Ga0451577_0003355 3300042876 Bacteria 17937
874 Ga0451577_0301272 3300042876 Bacteria 1452
875 Ga0451577_0486706 3300042876 Bacteria 1120
876 Ga0451577_0650865 3300042876 Bacteria 955
877 Ga0466969_0000080 3300044656 Bacteria 51012
878 Ga0466969_0006147 3300044656 Bacteria 6393
879 Ga0466969_0117422 3300044656 Bacteria 1241
880 Ga0466965_0017859 3300044683 Bacteria 3393
881 Ga0466965_0024821 3300044683 Bacteria 2900
882 Ga0466966_0001432 3300044684 Bacteria 15345
883 Ga0466966_0020479 3300044684 Bacteria 4348
884 Ga0466961_0014860 3300044693 Bacteria 5002
885 Ga0466961_0042913 3300044693 Bacteria 2897
886 Ga0466964_0004774 3300044706 Bacteria 5011
887 Ga0453684_0000618 3300044712 Bacteria 129995
888 Ga0453684_0004127 3300044712 Bacteria 31463
889 Ga0453684_0148014 3300044712 Bacteria 2794
890 Ga0453684_0811333 3300044712 Bacteria 1008
891 Ga0466971_0005638 3300044719 Bacteria 5442
892 Ga0466970_0003670 3300044765 Bacteria 7499
893 Ga0466970_0038252 3300044765 Bacteria 2544
894 Ga0466957_0001651 3300044842 Bacteria 11705
895 Ga0466957_0090287 3300044842 Bacteria 1919
896 Ga0466957_0343767 3300044842 Bacteria 1011
897 Ga0466959_0001188 3300045049 Bacteria 15712
898 Ga0451576_0001041 3300045051 Bacteria 51115
899 Ga0451576_0036128 3300045051 Bacteria 5239
900 Ga0451576_0144214 3300045051 Bacteria 2483
901 Ga0451576_0227193 3300045051 Bacteria 1949
902 Ga0451576_0327579 3300045051 Bacteria 1603
903 Ga0451576_0530614 3300045051 Bacteria 1237
904 Ga0466967_0016964 3300045976 Bacteria 5761
905 Ga0495592_0000394 3300046454 Bacteria 33973
906 Ga0495592_0025833 3300046454 Bacteria 4458
907 Ga0495603_0093066 3300046455 Bacteria 1762
908 Ga0495590_0015716 3300046457 Bacteria 2742
909 Ga0495638_0062976 3300046460 Bacteria 2288
910 Ga0495638_0186073 3300046460 Bacteria 1181
911 Ga0495650_0018907 3300046471 Bacteria 3410
912 Ga0495610_0034200 3300046512 Bacteria 2620
913 Ga0495610_0103825 3300046512 Bacteria 1269
914 Ga0495618_0157151 3300046514 Bacteria 1451
915 Ga0495632_0021009 3300046519 Bacteria 3524
916 Ga0495632_0040412 3300046519 Bacteria 2349
917 Ga0495632_0101155 3300046519 Bacteria 1358
918 Ga0495643_0048403 3300046522 Bacteria 2298
919 Ga0495648_0151567 3300046524 Bacteria 1209
920 Ga0495586_0244637 3300046535 Bacteria 1023
921 Ga0495587_0131100 3300046536 Bacteria 1433
922 Ga0495621_0041723 3300046539 Bacteria 1612
923 Ga0495621_0125396 3300046539 Bacteria 995
924 Ga0495597_0000054 3300046542 Bacteria 95390
925 Ga0495597_0052809 3300046542 Bacteria 1789
926 Ga0495622_0236198 3300046557 Bacteria 807
927 Ga0495633_0001440 3300046558 Bacteria 18504
928 Ga0495668_0040777 3300046616 Bacteria 2589
929 Ga0495611_0025417 3300046648 Bacteria 2581
930 Ga0495625_0010664 3300046660 Bacteria 7574
931 Ga0495625_0082917 3300046660 Bacteria 2229
932 Ga0495646_0165703 3300046680 Bacteria 1221
933 Ga0495658_0022366 3300046683 Bacteria 3343
934 Ga0495658_0131962 3300046683 Bacteria 1521
935 Ga0495658_0149731 3300046683 Bacteria 1433
936 Ga0495613_0158493 3300046689 Bacteria 1611
937 Ga0495624_0073164 3300046690 Bacteria 2131
938 Ga0495649_0004929 3300046694 Bacteria 8607
939 Ga0495589_0151866 3300046794 Bacteria 1106
940 Ga0495676_0070688 3300047321 Bacteria 2686
941 Ga0495680_0131173 3300047322 Bacteria 1841
942 Ga0495687_002015 3300047443 Bacteria 17212
943 Ga0495686_0004723 3300047472 Bacteria 11031
944 Ga0495686_0032152 3300047472 Bacteria 3397
945 Ga0495615_0042239 3300048090 Bacteria 1143
946 Ga0495626_0173734 3300048091 Bacteria 897
947 Ga0496101_0125389 3300048904 Bacteria 1945
948 Ga0496102_0043616 3300048905 Bacteria 4068
949 Ga0496102_0060102 3300048905 Bacteria 3477
950 Ga0496102_0103468 3300048905 Bacteria 2648
951 Ga0496103_0041991 3300048906 Bacteria 2813
952 Ga0496104_0192156 3300048907 Bacteria 1953
953 Ga0496104_0389550 3300048907 Bacteria 1306
954 Ga0496105_0036505 3300048908 Bacteria 4049
955 Ga0496105_0069971 3300048908 Bacteria 2901
956 Ga0496106_0005982 3300048909 Bacteria 8993
957 Ga0496106_0050471 3300048909 Bacteria 3136
958 Ga0496106_0130283 3300048909 Bacteria 1972
959 Ga0496108_0371178 3300048911 Bacteria 1249
960 Ga0496108_0502915 3300048911 Bacteria 1058
961 Ga0496109_0044683 3300048912 Bacteria 4019
962 Ga0496109_0116759 3300048912 Bacteria 2484
963 Ga0496109_0238290 3300048912 Bacteria 1712
964 Ga0496109_0275498 3300048912 Bacteria 1585
965 Ga0496111_0429065 3300048914 Bacteria 976
966 Ga0496112_0118412 3300048915 Bacteria 2618
967 Ga0496113_0431245 3300048916 Bacteria 1059
968 Ga0496114_0011787 3300048917 Bacteria 6994
969 Ga0496114_0093290 3300048917 Bacteria 2559
970 Ga0496114_0178924 3300048917 Bacteria 1851
971 Ga0496114_0419899 3300048917 Bacteria 1185
972 Ga0496121_0019826 3300048924 Bacteria 6698
973 Ga0496124_0000126 3300048927 Bacteria 159539
974 Ga0496124_0091374 3300048927 Bacteria 2481
975 Ga0496125_0003500 3300048928 Bacteria 18970
976 Ga0501304_001185 3300049160 Bacteria 1619
977 Ga0501292_014570 3300049515 Bacteria 1221
978 Ga0501298_016292 3300049521 Bacteria 1346
979 Ga0501303_002235 3300049526 Bacteria 1486
980 Ga0501314_001679 3300049530 Bacteria 1635
981 Ga0501031_0008612 3300049568 Bacteria 6635
982 Ga0501043_0000009 3300049579 Bacteria 214823
983 Ga0501046_0000022 3300049580 Bacteria 215451
984 Ga0501047_0000021 3300049581 Bacteria 254841
985 Ga0501048_0002882 3300049582 Bacteria 13123
986 Ga0501198_000019 3300049649 Bacteria 83282
987 Ga0501199_016520 3300049650 Bacteria 832
988 Ga0501201_005344 3300049651 Bacteria 1200
989 Ga0501206_010883 3300049653 Bacteria 1223
990 Ga0501207_014275 3300049654 Bacteria 1211
991 Ga0501211_000514 3300049658 Bacteria 3764
992 Ga0501217_013658 3300049661 Bacteria 1824
993 Ga0501222_000059 3300049662 Bacteria 34949
994 Ga0501222_000866 3300049662 Bacteria 4369
995 Ga0501227_005054 3300049665 Bacteria 2832
996 Ga0501233_005173 3300049668 Bacteria 2416
997 Ga0501235_000554 3300049669 Bacteria 7483
998 Ga0501236_000725 3300049670 Bacteria 3686
999 Ga0501249_004420 3300049679 Bacteria 2856
1000 Ga0501249_050390 3300049679 Bacteria 955
1001 Ga0501252_002008 3300049682 Bacteria 1972
1002 Ga0501252_003132 3300049682 Bacteria 1690
1003 Ga0501253_012725 3300049683 Bacteria 1324
1004 Ga0501255_000139 3300049684 Bacteria 4407
1005 Ga0501257_029830 3300049686 Bacteria 1311
1006 Ga0501221_000277 3300049704 Bacteria 7624
1007 Ga0501225_0013921 3300049705 Bacteria 2249
1008 Ga0501225_0051887 3300049705 Bacteria 1143
1009 Ga0501229_003518 3300049706 Bacteria 1881
1010 Ga0501262_000612 3300049759 Bacteria 4190
1011 Ga0501262_001465 3300049759 Bacteria 2652
1012 Ga0501265_001107 3300049762 Bacteria 3037
1013 Ga0501265_003342 3300049762 Bacteria 1823
1014 Ga0501267_001500 3300049764 Bacteria 2014
1015 Ga0501272_005195 3300049769 Bacteria 1366
1016 Ga0501281_01614 3300049777 Bacteria 1744
1017 Ga0501282_002803 3300049778 Bacteria 1888
1018 Ga0501283_008493 3300049779 Bacteria 1482
1019 Ga0501045_0003093 3300049824 Bacteria 11377
1020 Ga0501226_011824 3300049853 Bacteria 967
1021 nmdc:mga03683_8085_c1 3300050489 Bacteria 3683
1022 nmdc:mga03683_82589_c1 3300050489 Bacteria 1390
1023 nmdc:mga0yw44_117262_c1 3300050492 Bacteria 1712
1024 nmdc:mga0k408_111655_c1 3300050493 Bacteria 1616
1025 nmdc:mga0k408_121117_c1 3300050493 Bacteria 1550
1026 nmdc:mga0k408_128999_c1 3300050493 Bacteria 1501
1027 nmdc:mga0k408_134251_c1 3300050493 Bacteria 1470
1028 nmdc:mga0k408_14075_c1 3300050493 Bacteria 3333
1029 nmdc:mga0k408_19415_c1 3300050493 Bacteria 3799
1030 nmdc:mga0k408_19526_c1 3300050493 Bacteria 3789
1031 nmdc:mga0k408_196261_c1 3300050493 Bacteria 1205
1032 nmdc:mga0k408_216774_c1 3300050493 Bacteria 1143
1033 nmdc:mga0k408_2384_c2 3300050493 Bacteria 3847
1034 nmdc:mga0k408_241871_c1 3300050493 Bacteria 1078
1035 nmdc:mga0k408_245217_c1 3300050493 Bacteria 1070
1036 nmdc:mga0k408_4130_c1 3300050493 Bacteria 7713
1037 nmdc:mga0k408_44714_c1 3300050493 Bacteria 1409
1038 nmdc:mga0k408_9389_c1 3300050493 Bacteria 5272
1039 nmdc:mga0k408_9407_c1 3300050493 Bacteria 5267
1040 nmdc:mga06z11_150973_c1 3300050494 Bacteria 1321
1041 nmdc:mga04h51_19339_c1 3300050495 Bacteria 2018
1042 nmdc:mga07m45_141466_c1 3300050496 Bacteria 1394
1043 nmdc:mga07m45_166674_c1 3300050496 Bacteria 1280
1044 nmdc:mga07m45_212_c1 3300050496 Bacteria 23044
1045 nmdc:mga07m45_2259_c1 3300050496 Bacteria 8999
1046 nmdc:mga07m45_321939_c1 3300050496 Bacteria 899
1047 nmdc:mga07m45_82439_c1 3300050496 Bacteria 1837
1048 nmdc:mga05p37_400143_c1 3300050507 Bacteria 1603
1049 nmdc:mga0n895_236806_c1 3300050512 Bacteria 1852
1050 nmdc:mga08x19_269422_c1 3300050514 Bacteria 1178
1051 nmdc:mga0sz30_42262_c1 3300050516 Bacteria 1918
1052 Ga0495601_0282789 3300053077 Bacteria 1081
1053 Ga0500578_0000673 3300053086 Bacteria 40901
1054 Ga0500646_0059832 3300053090 Bacteria 1118
1055 Ga0500651_0011330 3300053093 Bacteria 5373
1056 Ga0500651_0177895 3300053093 Bacteria 1265
1057 Ga0500593_009764 3300053117 Bacteria 3999
1058 Ga0500642_0039768 3300053130 Bacteria 2024
1059 Ga0500652_000123 3300053131 Bacteria 29418
1060 Ga0500655_029722 3300053133 Bacteria 1049
1061 Ga0500658_0231582 3300053134 Bacteria 848
1062 Ga0500568_0034417 3300053139 Bacteria 2072
1063 Ga0500577_0203503 3300053142 Bacteria 854
1064 Ga0500590_061939 3300053148 Bacteria 1877
1065 Ga0500619_001758 3300053154 Bacteria 3954
1066 Ga0500622_0000799 3300053156 Bacteria 27135
1067 Ga0500622_0017005 3300053156 Bacteria 3878
1068 Ga0500587_015923 3300053739 Bacteria 958
1069 Ga0500587_020173 3300053739 Bacteria 867
1070 Ga0590071_000444 3300059421 Bacteria 12023
1071 Ga0466962_0071571 3300061719 Bacteria 1656

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035170 Ga0373943_0239789 Ga0373943_0239789_11_583 184
2 3300041509 Ga0451843_1165301 Ga0451843_1165301_110_727 194
3 3300033180 Ga0307510_10029238 Ga0307510_100292386 201
4 3300037471 Ga0395905_0066847 Ga0395905_0066847_1195_1854 202
5 3300038443 Ga0395901_0036278 Ga0395901_0036278_342_1001 202
6 3300046542 Ga0495597_0000054 Ga0495597_0000054_60177_60848 202
7 3300042015 Ga0439462_0005393 Ga0439462_0005393_1427_2095 208
8 iso_pu_bacteria 2831864461 2831869167 210
9 iso_pu_bacteria 2886848708 2886849339 210
10 3300038735 Ga0400485_22416 Ga0400485_22416_421_1092 211
11 3300038742 Ga0400486_16027 Ga0400486_16027_3176_3847 211
12 iso_pu_bacteria 2547132374 2548499270 211
13 iso_pu_bacteria 2585428062 2587759478 211
14 iso_pu_bacteria 2643221570 2643866104 211
15 iso_pu_bacteria 2643221592 2643972902 211
16 iso_pu_bacteria 2643221596 2643994090 211
17 iso_pu_bacteria 2643221625 2644139721 211
18 iso_pu_bacteria 2643221644 2644243428 211
19 iso_pu_bacteria 2643221644 2644245860 211
20 iso_pu_bacteria 2643221648 2644274524 211
21 iso_pu_bacteria 2643221652 2644292918 211
22 iso_pu_bacteria 2643221717 2644647933 211
23 iso_pu_bacteria 2738541337 2739056138 211
24 3300006195 Ga0075366_10005007 Ga0075366_100050075 212
25 3300050493 nmdc:mga0k408_2384_c2 nmdc:mga0k408_2384_c2_2656_3318 212
26 iso_pu_bacteria 2643221544 2643743263 212
27 iso_pu_bacteria 2643221585 2643932710 212
28 iso_pu_bacteria 2643221639 2644218315 212
29 iso_pu_bacteria 2643221646 2644260204 212
30 iso_pu_bacteria 2643221654 2644303181 212
31 iso_pu_bacteria 2643221656 2644313960 212
32 iso_pu_bacteria 2643221660 2644340804 212
33 iso_pu_bacteria 2881101125 2881103494 212
34 3300005535 Ga0070684_100934981 Ga0070684_1009349811 213
35 3300048090 Ga0495615_0042239 Ga0495615_0042239_185_844 213
36 3300048927 Ga0496124_0091374 Ga0496124_0091374_1229_1891 213
37 3300049679 Ga0501249_050390 Ga0501249_050390_172_831 213
38 iso_pu_bacteria 2585428057 2587725214 213
39 iso_pu_bacteria 2585428058 2587731429 213
40 iso_pu_bacteria 2588253510 2588294150 213
41 iso_pu_bacteria 2721755523 2722885779 213
42 iso_pu_bacteria 2839138175 2839144101 213
43 iso_pu_bacteria 2894023352 2894023968 213
44 iso_pu_bacteria 2932422444 2932424436 213
45 3300003322 rootL2_10001084 rootL2_100010842 214
46 3300003323 rootH1_10003132 rootH1_100031323 214
47 3300003771 Ga0055526_1003078 Ga0055526_10030785 214
48 3300003775 Ga0055524_1000613 Ga0055524_100061326 214
49 3300003794 Ga0055531_10000001 Ga0055531_10000001127 214
50 3300003794 Ga0055531_10001994 Ga0055531_1000199412 214
51 3300003794 Ga0055531_10019012 Ga0055531_100190124 214
52 3300004625 Ga0055543_1001394 Ga0055543_10013943 214
53 3300005262 Ga0065165_1000101 Ga0065165_100010181 214
54 3300005262 Ga0065165_1002234 Ga0065165_100223412 214
55 3300005439 Ga0070711_100136160 Ga0070711_1001361602 214
56 3300006195 Ga0075366_10199471 Ga0075366_101994712 214
57 3300006353 Ga0075370_10005505 Ga0075370_100055054 214
58 3300006353 Ga0075370_10061589 Ga0075370_100615893 214
59 3300006944 Ga0099823_1000575 Ga0099823_100057515 214
60 3300012497 Ga0157319_1000008 Ga0157319_1000008139 214
61 3300013306 Ga0163162_10582091 Ga0163162_105820912 214
62 3300025273 Ga0209673_1007465 Ga0209673_10074652 214
63 3300025273 Ga0209673_1036811 Ga0209673_10368112 214
64 3300025295 Ga0209564_1000008 Ga0209564_1000008609 214
65 3300025298 Ga0209050_1002331 Ga0209050_100233110 214
66 3300025298 Ga0209050_1008998 Ga0209050_10089983 214
67 3300025299 Ga0209256_1000837 Ga0209256_100083737 214
68 3300025299 Ga0209256_1017155 Ga0209256_10171553 214
69 3300025303 Ga0209051_1005729 Ga0209051_10057295 214
70 3300025303 Ga0209051_1010724 Ga0209051_10107242 214
71 3300025304 Ga0209257_1000033 Ga0209257_1000033214 214
72 3300025304 Ga0209257_1000952 Ga0209257_100095234 214
73 3300025304 Ga0209257_1002605 Ga0209257_10026053 214
74 3300027296 Ga0209389_1003489 Ga0209389_10034897 214
75 3300027312 Ga0209371_1008466 Ga0209371_10084663 214
76 3300030500 Ga0268256_1012730 Ga0268256_10127302 214
77 3300041512 Ga0451853_3333348 Ga0451853_3333348_244_909 214
78 3300042000 Ga0439437_018286 Ga0439437_018286_27_692 214
79 3300042127 Ga0450890_000665 Ga0450890_000665_936_1601 214
80 3300042438 Ga0439459_0002426 Ga0439459_0002426_357_1022 214
81 3300046460 Ga0495638_0186073 Ga0495638_0186073_320_985 214
82 3300050493 nmdc:mga0k408_245217_c1 nmdc:mga0k408_245217_c1_203_868 214
83 3300050496 nmdc:mga07m45_321939_c1 nmdc:mga07m45_321939_c1_188_865 214
84 3300053156 Ga0500622_0017005 Ga0500622_0017005_776_1456 214
85 3300003775 Ga0055524_1000052 Ga0055524_100005235 215
86 3300003791 Ga0055530_10004318 Ga0055530_100043185 215
87 3300003792 Ga0055540_1000123 Ga0055540_100012334 215
88 3300003794 Ga0055531_10001336 Ga0055531_100013369 215
89 3300005262 Ga0065165_1006644 Ga0065165_10066442 215
90 3300005293 Ga0065715_10261108 Ga0065715_102611081 215
91 3300005328 Ga0070676_10001171 Ga0070676_1000117110 215
92 3300005328 Ga0070676_10005365 Ga0070676_100053656 215
93 3300005328 Ga0070676_10262193 Ga0070676_102621932 215
94 3300005330 Ga0070690_100053100 Ga0070690_1000531002 215
95 3300005331 Ga0070670_100082638 Ga0070670_1000826381 215
96 3300005331 Ga0070670_100092938 Ga0070670_1000929382 215
97 3300005331 Ga0070670_100300347 Ga0070670_1003003471 215
98 3300005331 Ga0070670_100431867 Ga0070670_1004318672 215
99 3300005331 Ga0070670_100445109 Ga0070670_1004451092 215
100 3300005334 Ga0068869_100002262 Ga0068869_1000022629 215
101 3300005334 Ga0068869_100011174 Ga0068869_1000111744 215
102 3300005335 Ga0070666_10004330 Ga0070666_1000433011 215
103 3300005335 Ga0070666_10085745 Ga0070666_100857451 215
104 3300005338 Ga0068868_100005809 Ga0068868_1000058099 215
105 3300005338 Ga0068868_100016664 Ga0068868_1000166642 215
106 3300005339 Ga0070660_100134630 Ga0070660_1001346303 215
107 3300005343 Ga0070687_100014496 Ga0070687_1000144964 215
108 3300005344 Ga0070661_100018747 Ga0070661_1000187472 215
109 3300005344 Ga0070661_100256290 Ga0070661_1002562902 215
110 3300005347 Ga0070668_100004485 Ga0070668_10000448512 215
111 3300005347 Ga0070668_100008931 Ga0070668_1000089312 215
112 3300005347 Ga0070668_100034404 Ga0070668_1000344044 215
113 3300005353 Ga0070669_100017742 Ga0070669_1000177422 215
114 3300005353 Ga0070669_100034486 Ga0070669_1000344864 215
115 3300005354 Ga0070675_100017177 Ga0070675_1000171774 215
116 3300005354 Ga0070675_100024262 Ga0070675_1000242624 215
117 3300005354 Ga0070675_100033082 Ga0070675_1000330824 215
118 3300005355 Ga0070671_100023610 Ga0070671_1000236102 215
119 3300005355 Ga0070671_100038539 Ga0070671_1000385392 215
120 3300005355 Ga0070671_100041716 Ga0070671_1000417163 215
121 3300005355 Ga0070671_100075476 Ga0070671_1000754761 215
122 3300005355 Ga0070671_100511445 Ga0070671_1005114451 215
123 3300005356 Ga0070674_100004070 Ga0070674_1000040705 215
124 3300005364 Ga0070673_100020171 Ga0070673_1000201713 215
125 3300005364 Ga0070673_100059646 Ga0070673_1000596462 215
126 3300005364 Ga0070673_100268124 Ga0070673_1002681242 215
127 3300005366 Ga0070659_100003529 Ga0070659_10000352910 215
128 3300005366 Ga0070659_100020575 Ga0070659_1000205752 215
129 3300005367 Ga0070667_100010597 Ga0070667_1000105973 215
130 3300005367 Ga0070667_100027316 Ga0070667_1000273162 215
131 3300005367 Ga0070667_100041760 Ga0070667_1000417602 215
132 3300005367 Ga0070667_100098630 Ga0070667_1000986303 215
133 3300005367 Ga0070667_100363153 Ga0070667_1003631532 215
134 3300005438 Ga0070701_10042915 Ga0070701_100429152 215
135 3300005441 Ga0070700_100113059 Ga0070700_1001130592 215
136 3300005445 Ga0070708_100003939 Ga0070708_10000393914 215
137 3300005455 Ga0070663_100013585 Ga0070663_1000135856 215
138 3300005455 Ga0070663_100381095 Ga0070663_1003810952 215
139 3300005455 Ga0070663_100527668 Ga0070663_1005276682 215
140 3300005456 Ga0070678_100015061 Ga0070678_1000150613 215
141 3300005456 Ga0070678_100775331 Ga0070678_1007753311 215
142 3300005457 Ga0070662_100020801 Ga0070662_1000208015 215
143 3300005457 Ga0070662_100027883 Ga0070662_1000278832 215
144 3300005459 Ga0068867_100007790 Ga0068867_10000779010 215
145 3300005459 Ga0068867_100009088 Ga0068867_1000090885 215
146 3300005459 Ga0068867_100043951 Ga0068867_1000439514 215
147 3300005466 Ga0070685_10097104 Ga0070685_100971042 215
148 3300005530 Ga0070679_100651821 Ga0070679_1006518212 215
149 3300005539 Ga0068853_100111889 Ga0068853_1001118892 215
150 3300005539 Ga0068853_100654112 Ga0068853_1006541121 215
151 3300005543 Ga0070672_100017161 Ga0070672_1000171614 215
152 3300005543 Ga0070672_100030952 Ga0070672_1000309524 215
153 3300005543 Ga0070672_100532641 Ga0070672_1005326412 215
154 3300005543 Ga0070672_100740067 Ga0070672_1007400672 215
155 3300005545 Ga0070695_100237705 Ga0070695_1002377052 215
156 3300005548 Ga0070665_100012971 Ga0070665_1000129715 215
157 3300005548 Ga0070665_100043173 Ga0070665_1000431734 215
158 3300005548 Ga0070665_100078283 Ga0070665_1000782833 215
159 3300005548 Ga0070665_100735545 Ga0070665_1007355452 215
160 3300005563 Ga0068855_100033424 Ga0068855_1000334246 215
161 3300005564 Ga0070664_100003987 Ga0070664_1000039872 215
162 3300005564 Ga0070664_100029484 Ga0070664_1000294844 215
163 3300005564 Ga0070664_100573149 Ga0070664_1005731491 215
164 3300005577 Ga0068857_100063167 Ga0068857_1000631672 215
165 3300005578 Ga0068854_100101606 Ga0068854_1001016062 215
166 3300005578 Ga0068854_100252561 Ga0068854_1002525612 215
167 3300005578 Ga0068854_100493575 Ga0068854_1004935752 215
168 3300005615 Ga0070702_100244495 Ga0070702_1002444952 215
169 3300005616 Ga0068852_100077623 Ga0068852_1000776232 215
170 3300005616 Ga0068852_100575561 Ga0068852_1005755612 215
171 3300005617 Ga0068859_100012908 Ga0068859_10001290811 215
172 3300005617 Ga0068859_100025566 Ga0068859_1000255664 215
173 3300005617 Ga0068859_100538143 Ga0068859_1005381432 215
174 3300005617 Ga0068859_100701667 Ga0068859_1007016672 215
175 3300005617 Ga0068859_100821069 Ga0068859_1008210692 215
176 3300005618 Ga0068864_100003990 Ga0068864_10000399010 215
177 3300005618 Ga0068864_100011575 Ga0068864_1000115756 215
178 3300005618 Ga0068864_100021989 Ga0068864_1000219894 215
179 3300005618 Ga0068864_100547990 Ga0068864_1005479902 215
180 3300005618 Ga0068864_100851120 Ga0068864_1008511202 215
181 3300005718 Ga0068866_10011662 Ga0068866_100116624 215
182 3300005719 Ga0068861_100001035 Ga0068861_10000103512 215
183 3300005719 Ga0068861_100018432 Ga0068861_1000184324 215
184 3300005719 Ga0068861_100259191 Ga0068861_1002591912 215
185 3300005834 Ga0068851_10067504 Ga0068851_100675042 215
186 3300005834 Ga0068851_10139938 Ga0068851_101399382 215
187 3300005840 Ga0068870_10014716 Ga0068870_100147164 215
188 3300005841 Ga0068863_100003394 Ga0068863_10000339420 215
189 3300005841 Ga0068863_100009320 Ga0068863_1000093203 215
190 3300005841 Ga0068863_100035196 Ga0068863_1000351962 215
191 3300005841 Ga0068863_100338571 Ga0068863_1003385712 215
192 3300005841 Ga0068863_100617843 Ga0068863_1006178432 215
193 3300005842 Ga0068858_100005065 Ga0068858_10000506517 215
194 3300005842 Ga0068858_100008747 Ga0068858_10000874711 215
195 3300005842 Ga0068858_100361779 Ga0068858_1003617791 215
196 3300005843 Ga0068860_100036079 Ga0068860_1000360794 215
197 3300005843 Ga0068860_100050308 Ga0068860_1000503084 215
198 3300005843 Ga0068860_100067173 Ga0068860_1000671734 215
199 3300005844 Ga0068862_100006554 Ga0068862_1000065545 215
200 3300005844 Ga0068862_100034516 Ga0068862_1000345165 215
201 3300005844 Ga0068862_100072269 Ga0068862_1000722693 215
202 3300005844 Ga0068862_100470833 Ga0068862_1004708332 215
203 3300006048 Ga0075363_100293429 Ga0075363_1002934292 215
204 3300006163 Ga0070715_10238949 Ga0070715_102389492 215
205 3300006178 Ga0075367_10172170 Ga0075367_101721702 215
206 3300006237 Ga0097621_100006535 Ga0097621_1000065352 215
207 3300006237 Ga0097621_100419739 Ga0097621_1004197391 215
208 3300006358 Ga0068871_100006033 Ga0068871_1000060331 215
209 3300006358 Ga0068871_100007867 Ga0068871_1000078673 215
210 3300006358 Ga0068871_100179548 Ga0068871_1001795483 215
211 3300006871 Ga0075434_100760382 Ga0075434_1007603822 215
212 3300006881 Ga0068865_100008020 Ga0068865_1000080204 215
213 3300006881 Ga0068865_100019560 Ga0068865_1000195603 215
214 3300006914 Ga0075436_100095176 Ga0075436_1000951762 215
215 3300006931 Ga0097620_100012908 Ga0097620_10001290811 215
216 3300006931 Ga0097620_100025566 Ga0097620_1000255664 215
217 3300006931 Ga0097620_100538151 Ga0097620_1005381512 215
218 3300006931 Ga0097620_100701629 Ga0097620_1007016292 215
219 3300006931 Ga0097620_100821036 Ga0097620_1008210362 215
220 3300006946 Ga0079104_1000073 Ga0079104_1000073134 215
221 3300009036 Ga0105244_10318349 Ga0105244_103183491 215
222 3300009093 Ga0105240_10006593 Ga0105240_1000659319 215
223 3300009098 Ga0105245_10614544 Ga0105245_106145442 215
224 3300009101 Ga0105247_10059115 Ga0105247_100591153 215
225 3300009148 Ga0105243_10095383 Ga0105243_100953833 215
226 3300009174 Ga0105241_10066794 Ga0105241_100667942 215
227 3300009176 Ga0105242_11142359 Ga0105242_111423591 215
228 3300009177 Ga0105248_10027604 Ga0105248_100276045 215
229 3300009177 Ga0105248_10220030 Ga0105248_102200303 215
230 3300009177 Ga0105248_10307005 Ga0105248_103070053 215
231 3300009545 Ga0105237_10000293 Ga0105237_1000029324 215
232 3300009545 Ga0105237_10294543 Ga0105237_102945432 215
233 3300009551 Ga0105238_10117669 Ga0105238_101176692 215
234 3300009553 Ga0105249_10072007 Ga0105249_100720073 215
235 3300009553 Ga0105249_10352834 Ga0105249_103528342 215
236 3300009553 Ga0105249_10443383 Ga0105249_104433832 215
237 3300010375 Ga0105239_10002229 Ga0105239_100022296 215
238 3300010375 Ga0105239_10337352 Ga0105239_103373522 215
239 3300010375 Ga0105239_10403123 Ga0105239_104031232 215
240 3300011119 Ga0105246_10439667 Ga0105246_104396672 215
241 3300013100 Ga0157373_10350048 Ga0157373_103500482 215
242 3300013296 Ga0157374_10007229 Ga0157374_1000722911 215
243 3300013296 Ga0157374_10011240 Ga0157374_100112406 215
244 3300013297 Ga0157378_10030973 Ga0157378_100309734 215
245 3300013297 Ga0157378_10828240 Ga0157378_108282402 215
246 3300013306 Ga0163162_10030548 Ga0163162_100305484 215
247 3300013306 Ga0163162_10043733 Ga0163162_100437333 215
248 3300013307 Ga0157372_10007733 Ga0157372_100077333 215
249 3300013307 Ga0157372_11473804 Ga0157372_114738042 215
250 3300013308 Ga0157375_10018712 Ga0157375_100187122 215
251 3300013308 Ga0157375_10026535 Ga0157375_100265353 215
252 3300013308 Ga0157375_10089867 Ga0157375_100898672 215
253 3300014325 Ga0163163_10065623 Ga0163163_100656234 215
254 3300014968 Ga0157379_10002231 Ga0157379_1000223121 215
255 3300014968 Ga0157379_10006232 Ga0157379_1000623211 215
256 3300014968 Ga0157379_10014708 Ga0157379_100147084 215
257 3300014969 Ga0157376_10020032 Ga0157376_100200323 215
258 3300014969 Ga0157376_10167698 Ga0157376_101676982 215
259 3300017792 Ga0163161_10397812 Ga0163161_103978122 215
260 3300025263 Ga0209565_1008438 Ga0209565_10084381 215
261 3300025271 Ga0207666_1015925 Ga0207666_10159252 215
262 3300025273 Ga0209673_1012217 Ga0209673_10122173 215
263 3300025290 Ga0207673_1015908 Ga0207673_10159081 215
264 3300025298 Ga0209050_1000760 Ga0209050_10007603 215
265 3300025298 Ga0209050_1000873 Ga0209050_100087328 215
266 3300025299 Ga0209256_1000036 Ga0209256_1000036166 215
267 3300025303 Ga0209051_1000068 Ga0209051_100006845 215
268 3300025303 Ga0209051_1005571 Ga0209051_10055716 215
269 3300025304 Ga0209257_1000146 Ga0209257_100014619 215
270 3300025315 Ga0207697_10035213 Ga0207697_100352133 215
271 3300025315 Ga0207697_10035983 Ga0207697_100359833 215
272 3300025321 Ga0207656_10009959 Ga0207656_100099595 215
273 3300025321 Ga0207656_10033692 Ga0207656_100336922 215
274 3300025893 Ga0207682_10011645 Ga0207682_100116453 215
275 3300025893 Ga0207682_10011678 Ga0207682_100116784 215
276 3300025893 Ga0207682_10115488 Ga0207682_101154882 215
277 3300025901 Ga0207688_10018614 Ga0207688_100186143 215
278 3300025901 Ga0207688_10157209 Ga0207688_101572092 215
279 3300025903 Ga0207680_10014034 Ga0207680_100140344 215
280 3300025903 Ga0207680_10080280 Ga0207680_100802803 215
281 3300025904 Ga0207647_10174717 Ga0207647_101747172 215
282 3300025907 Ga0207645_10001049 Ga0207645_1000104918 215
283 3300025907 Ga0207645_10014621 Ga0207645_100146214 215
284 3300025907 Ga0207645_10286726 Ga0207645_102867262 215
285 3300025908 Ga0207643_10009165 Ga0207643_100091652 215
286 3300025911 Ga0207654_10029720 Ga0207654_100297202 215
287 3300025913 Ga0207695_10015331 Ga0207695_100153315 215
288 3300025914 Ga0207671_10038461 Ga0207671_100384611 215
289 3300025918 Ga0207662_10061345 Ga0207662_100613452 215
290 3300025918 Ga0207662_10149484 Ga0207662_101494842 215
291 3300025920 Ga0207649_10001094 Ga0207649_1000109415 215
292 3300025920 Ga0207649_10276875 Ga0207649_102768752 215
293 3300025923 Ga0207681_10008956 Ga0207681_100089566 215
294 3300025923 Ga0207681_10031343 Ga0207681_100313432 215
295 3300025923 Ga0207681_10258025 Ga0207681_102580252 215
296 3300025924 Ga0207694_10052315 Ga0207694_100523153 215
297 3300025925 Ga0207650_10003433 Ga0207650_100034334 215
298 3300025925 Ga0207650_10007340 Ga0207650_100073405 215
299 3300025925 Ga0207650_10031578 Ga0207650_100315783 215
300 3300025925 Ga0207650_10124634 Ga0207650_101246342 215
301 3300025925 Ga0207650_10220740 Ga0207650_102207402 215
302 3300025926 Ga0207659_10003571 Ga0207659_100035713 215
303 3300025926 Ga0207659_10004238 Ga0207659_100042385 215
304 3300025926 Ga0207659_10096854 Ga0207659_100968542 215
305 3300025931 Ga0207644_10021541 Ga0207644_100215413 215
306 3300025931 Ga0207644_10079366 Ga0207644_100793662 215
307 3300025931 Ga0207644_10099426 Ga0207644_100994263 215
308 3300025931 Ga0207644_10141609 Ga0207644_101416093 215
309 3300025931 Ga0207644_10328223 Ga0207644_103282232 215
310 3300025932 Ga0207690_10001490 Ga0207690_1000149010 215
311 3300025933 Ga0207706_10001701 Ga0207706_1000170123 215
312 3300025935 Ga0207709_10032252 Ga0207709_100322523 215
313 3300025936 Ga0207670_10191084 Ga0207670_101910842 215
314 3300025937 Ga0207669_10015012 Ga0207669_100150122 215
315 3300025937 Ga0207669_10331034 Ga0207669_103310342 215
316 3300025938 Ga0207704_10271029 Ga0207704_102710292 215
317 3300025938 Ga0207704_10402878 Ga0207704_104028782 215
318 3300025940 Ga0207691_10000244 Ga0207691_1000024410 215
319 3300025940 Ga0207691_10101817 Ga0207691_101018173 215
320 3300025940 Ga0207691_10151310 Ga0207691_101513101 215
321 3300025940 Ga0207691_10292570 Ga0207691_102925702 215
322 3300025941 Ga0207711_10023382 Ga0207711_100233823 215
323 3300025941 Ga0207711_10067721 Ga0207711_100677212 215
324 3300025941 Ga0207711_10072679 Ga0207711_100726792 215
325 3300025941 Ga0207711_10251874 Ga0207711_102518742 215
326 3300025941 Ga0207711_10671916 Ga0207711_106719161 215
327 3300025942 Ga0207689_10002740 Ga0207689_1000274020 215
328 3300025942 Ga0207689_10005411 Ga0207689_1000541110 215
329 3300025942 Ga0207689_10088018 Ga0207689_100880182 215
330 3300025944 Ga0207661_10185879 Ga0207661_101858792 215
331 3300025945 Ga0207679_10000754 Ga0207679_100007549 215
332 3300025945 Ga0207679_10054821 Ga0207679_100548212 215
333 3300025945 Ga0207679_10090436 Ga0207679_100904362 215
334 3300025945 Ga0207679_10474582 Ga0207679_104745822 215
335 3300025949 Ga0207667_10032208 Ga0207667_100322084 215
336 3300025949 Ga0207667_10045107 Ga0207667_100451072 215
337 3300025960 Ga0207651_10001334 Ga0207651_100013345 215
338 3300025960 Ga0207651_10037660 Ga0207651_100376603 215
339 3300025960 Ga0207651_10049896 Ga0207651_100498962 215
340 3300025960 Ga0207651_11122024 Ga0207651_111220241 215
341 3300025961 Ga0207712_10106376 Ga0207712_101063762 215
342 3300025961 Ga0207712_10376992 Ga0207712_103769922 215
343 3300025961 Ga0207712_10485026 Ga0207712_104850262 215
344 3300025972 Ga0207668_10017895 Ga0207668_100178953 215
345 3300025972 Ga0207668_10044493 Ga0207668_100444934 215
346 3300025972 Ga0207668_10057311 Ga0207668_100573113 215
347 3300025972 Ga0207668_10216369 Ga0207668_102163692 215
348 3300025981 Ga0207640_10034077 Ga0207640_100340773 215
349 3300025981 Ga0207640_10144702 Ga0207640_101447022 215
350 3300025981 Ga0207640_10430997 Ga0207640_104309972 215
351 3300025986 Ga0207658_10001534 Ga0207658_1000153420 215
352 3300025986 Ga0207658_10029554 Ga0207658_100295544 215
353 3300025986 Ga0207658_10087861 Ga0207658_100878613 215
354 3300026023 Ga0207677_10018902 Ga0207677_100189023 215
355 3300026023 Ga0207677_10021149 Ga0207677_100211494 215
356 3300026023 Ga0207677_10102380 Ga0207677_101023803 215
357 3300026035 Ga0207703_10000788 Ga0207703_1000078823 215
358 3300026035 Ga0207703_10001859 Ga0207703_100018597 215
359 3300026035 Ga0207703_10066216 Ga0207703_100662162 215
360 3300026041 Ga0207639_10422897 Ga0207639_104228972 215
361 3300026067 Ga0207678_10004374 Ga0207678_100043743 215
362 3300026067 Ga0207678_10147138 Ga0207678_101471383 215
363 3300026067 Ga0207678_10240781 Ga0207678_102407812 215
364 3300026067 Ga0207678_10308767 Ga0207678_103087672 215
365 3300026067 Ga0207678_10509974 Ga0207678_105099742 215
366 3300026075 Ga0207708_10113562 Ga0207708_101135622 215
367 3300026088 Ga0207641_10009503 Ga0207641_100095032 215
368 3300026088 Ga0207641_10029764 Ga0207641_100297641 215
369 3300026088 Ga0207641_10152557 Ga0207641_101525572 215
370 3300026089 Ga0207648_10000357 Ga0207648_1000035747 215
371 3300026089 Ga0207648_10007655 Ga0207648_100076552 215
372 3300026089 Ga0207648_10059093 Ga0207648_100590932 215
373 3300026095 Ga0207676_10003850 Ga0207676_100038504 215
374 3300026095 Ga0207676_10116185 Ga0207676_101161853 215
375 3300026095 Ga0207676_10130524 Ga0207676_101305241 215
376 3300026095 Ga0207676_10662256 Ga0207676_106622562 215
377 3300026116 Ga0207674_10012770 Ga0207674_1001277010 215
378 3300026116 Ga0207674_10067419 Ga0207674_100674193 215
379 3300026118 Ga0207675_100000579 Ga0207675_10000057923 215
380 3300026118 Ga0207675_100002097 Ga0207675_10000209712 215
381 3300026118 Ga0207675_100044100 Ga0207675_1000441003 215
382 3300026118 Ga0207675_100140161 Ga0207675_1001401612 215
383 3300026121 Ga0207683_10000230 Ga0207683_1000023047 215
384 3300026121 Ga0207683_10117487 Ga0207683_101174872 215
385 3300026121 Ga0207683_10169887 Ga0207683_101698873 215
386 3300026121 Ga0207683_10359578 Ga0207683_103595782 215
387 3300026142 Ga0207698_10066881 Ga0207698_100668813 215
388 3300027111 Ga0209281_1000259 Ga0209281_100025990 215
389 3300027717 Ga0209998_10006352 Ga0209998_100063522 215
390 3300028379 Ga0268266_10053004 Ga0268266_100530044 215
391 3300028379 Ga0268266_10104683 Ga0268266_101046832 215
392 3300028380 Ga0268265_10004979 Ga0268265_100049796 215
393 3300028380 Ga0268265_10019071 Ga0268265_100190714 215
394 3300028380 Ga0268265_10060730 Ga0268265_100607303 215
395 3300028380 Ga0268265_10073330 Ga0268265_100733302 215
396 3300028380 Ga0268265_10303618 Ga0268265_103036182 215
397 3300028381 Ga0268264_10017136 Ga0268264_100171364 215
398 3300028381 Ga0268264_10044282 Ga0268264_100442822 215
399 3300028381 Ga0268264_10061039 Ga0268264_100610393 215
400 3300028381 Ga0268264_10068398 Ga0268264_100683982 215
401 3300028794 Ga0307515_10000011 Ga0307515_10000011221 215
402 3300028794 Ga0307515_10000138 Ga0307515_1000013873 215
403 3300028794 Ga0307515_10000382 Ga0307515_1000038277 215
404 3300028794 Ga0307515_10038069 Ga0307515_100380694 215
405 3300028794 Ga0307515_10112976 Ga0307515_101129762 215
406 3300028794 Ga0307515_10118360 Ga0307515_101183602 215
407 3300030522 Ga0307512_10015605 Ga0307512_100156055 215
408 3300031238 Ga0265332_10000035 Ga0265332_1000003578 215
409 3300031456 Ga0307513_10011084 Ga0307513_100110845 215
410 3300031456 Ga0307513_10018983 Ga0307513_100189832 215
411 3300031456 Ga0307513_10275851 Ga0307513_102758511 215
412 3300031507 Ga0307509_10455111 Ga0307509_104551112 215
413 3300031548 Ga0307408_100065288 Ga0307408_1000652882 215
414 3300031548 Ga0307408_100097632 Ga0307408_1000976322 215
415 3300031616 Ga0307508_10000509 Ga0307508_100005094 215
416 3300031649 Ga0307514_10003857 Ga0307514_100038576 215
417 3300031649 Ga0307514_10028654 Ga0307514_100286544 215
418 3300031730 Ga0307516_10015487 Ga0307516_100154873 215
419 3300031731 Ga0307405_10050195 Ga0307405_100501951 215
420 3300031911 Ga0307412_10315321 Ga0307412_103153212 215
421 3300031995 Ga0307409_100011369 Ga0307409_1000113696 215
422 3300032002 Ga0307416_100229461 Ga0307416_1002294612 215
423 3300032004 Ga0307414_10012084 Ga0307414_100120842 215
424 3300032004 Ga0307414_10335133 Ga0307414_103351332 215
425 3300035088 Ga0373940_0025148 Ga0373940_0025148_351_1016 215
426 3300035116 Ga0373945_0008855 Ga0373945_0008855_843_1508 215
427 3300035117 Ga0373953_0151115 Ga0373953_0151115_255_920 215
428 3300035172 Ga0373955_0179207 Ga0373955_0179207_219_884 215
429 3300035242 Ga0373962_0054560 Ga0373962_0054560_279_944 215
430 3300035692 Ga0373935_0211397 Ga0373935_0211397_306_971 215
431 3300035695 Ga0373927_0272917 Ga0373927_0272917_348_1013 215
432 3300036401 Ga0373937_1067607 Ga0373937_1067607_38_703 215
433 3300037068 Ga0373925_0246724 Ga0373925_0246724_152_817 215
434 3300037471 Ga0395905_0004162 Ga0395905_0004162_9295_9960 215
435 3300041413 Ga0439465_0055229 Ga0439465_0055229_121_786 215
436 3300041443 Ga0451789_0549618 Ga0451789_0549618_814_1479 215
437 3300041451 Ga0451791_1199651 Ga0451791_1199651_228_893 215
438 3300041452 Ga0451793_1860797 Ga0451793_1860797_123_788 215
439 3300041456 Ga0451795_1118135 Ga0451795_1118135_207_872 215
440 3300041460 Ga0451802_1397458 Ga0451802_1397458_1001_1666 215
441 3300041486 Ga0451807_0616347 Ga0451807_0616347_1208_1873 215
442 3300041491 Ga0451833_0175603 Ga0451833_0175603_59_724 215
443 3300041512 Ga0451853_1221463 Ga0451853_1221463_121_786 215
444 3300042435 Ga0439434_0017826 Ga0439434_0017826_1299_1964 215
445 3300042435 Ga0439434_0058814 Ga0439434_0058814_347_1012 215
446 3300042531 Ga0450918_000028 Ga0450918_000028_2621_3286 215
447 3300042531 Ga0450918_000411 Ga0450918_000411_6391_7056 215
448 3300042876 Ga0451577_0000190 Ga0451577_0000190_42663_43328 215
449 3300042876 Ga0451577_0001771 Ga0451577_0001771_10711_11376 215
450 3300042876 Ga0451577_0301272 Ga0451577_0301272_194_859 215
451 3300042876 Ga0451577_0650865 Ga0451577_0650865_113_778 215
452 3300044712 Ga0453684_0000618 Ga0453684_0000618_86986_87651 215
453 3300044712 Ga0453684_0004127 Ga0453684_0004127_8477_9142 215
454 3300044712 Ga0453684_0148014 Ga0453684_0148014_1817_2482 215
455 3300044712 Ga0453684_0811333 Ga0453684_0811333_47_712 215
456 3300045051 Ga0451576_0001041 Ga0451576_0001041_49624_50289 215
457 3300045051 Ga0451576_0327579 Ga0451576_0327579_261_926 215
458 3300046455 Ga0495603_0093066 Ga0495603_0093066_40_705 215
459 3300046512 Ga0495610_0034200 Ga0495610_0034200_1942_2607 215
460 3300046519 Ga0495632_0101155 Ga0495632_0101155_340_1005 215
461 3300046522 Ga0495643_0048403 Ga0495643_0048403_533_1198 215
462 3300046660 Ga0495625_0010664 Ga0495625_0010664_6592_7257 215
463 3300046680 Ga0495646_0165703 Ga0495646_0165703_176_841 215
464 3300046683 Ga0495658_0131962 Ga0495658_0131962_225_890 215
465 3300046683 Ga0495658_0149731 Ga0495658_0149731_56_721 215
466 3300046689 Ga0495613_0158493 Ga0495613_0158493_817_1482 215
467 3300047322 Ga0495680_0131173 Ga0495680_0131173_294_959 215
468 3300047472 Ga0495686_0004723 Ga0495686_0004723_10051_10716 215
469 3300048904 Ga0496101_0125389 Ga0496101_0125389_471_1136 215
470 3300048905 Ga0496102_0043616 Ga0496102_0043616_147_836 215
471 3300048905 Ga0496102_0060102 Ga0496102_0060102_2529_3194 215
472 3300048905 Ga0496102_0103468 Ga0496102_0103468_1547_2212 215
473 3300048906 Ga0496103_0041991 Ga0496103_0041991_276_941 215
474 3300048907 Ga0496104_0389550 Ga0496104_0389550_360_1025 215
475 3300048908 Ga0496105_0069971 Ga0496105_0069971_273_938 215
476 3300048909 Ga0496106_0005982 Ga0496106_0005982_4063_4728 215
477 3300048909 Ga0496106_0130283 Ga0496106_0130283_975_1640 215
478 3300048911 Ga0496108_0502915 Ga0496108_0502915_95_760 215
479 3300048912 Ga0496109_0044683 Ga0496109_0044683_697_1362 215
480 3300048912 Ga0496109_0116759 Ga0496109_0116759_1164_1829 215
481 3300048912 Ga0496109_0238290 Ga0496109_0238290_52_717 215
482 3300048912 Ga0496109_0275498 Ga0496109_0275498_139_804 215
483 3300048914 Ga0496111_0429065 Ga0496111_0429065_73_738 215
484 3300048915 Ga0496112_0118412 Ga0496112_0118412_1191_1856 215
485 3300048916 Ga0496113_0431245 Ga0496113_0431245_194_859 215
486 3300048917 Ga0496114_0011787 Ga0496114_0011787_1889_2554 215
487 3300048917 Ga0496114_0093290 Ga0496114_0093290_233_898 215
488 3300048917 Ga0496114_0178924 Ga0496114_0178924_1016_1681 215
489 3300048917 Ga0496114_0419899 Ga0496114_0419899_456_1121 215
490 3300049650 Ga0501199_016520 Ga0501199_016520_91_756 215
491 3300049682 Ga0501252_002008 Ga0501252_002008_501_1166 215
492 3300049853 Ga0501226_011824 Ga0501226_011824_102_767 215
493 3300050493 nmdc:mga0k408_121117_c1 nmdc:mga0k408_121117_c1_47_712 215
494 3300050507 nmdc:mga05p37_400143_c1 nmdc:mga05p37_400143_c1_197_862 215
495 3300050512 nmdc:mga0n895_236806_c1 nmdc:mga0n895_236806_c1_138_803 215
496 3300050514 nmdc:mga08x19_269422_c1 nmdc:mga08x19_269422_c1_29_694 215
497 3300053077 Ga0495601_0282789 Ga0495601_0282789_288_953 215
498 3300053086 Ga0500578_0000673 Ga0500578_0000673_36879_37544 215
499 3300053090 Ga0500646_0059832 Ga0500646_0059832_136_801 215
500 3300053093 Ga0500651_0011330 Ga0500651_0011330_1380_2045 215
501 3300053117 Ga0500593_009764 Ga0500593_009764_1099_1764 215
502 3300053130 Ga0500642_0039768 Ga0500642_0039768_476_1141 215
503 3300053131 Ga0500652_000123 Ga0500652_000123_22462_23127 215
504 3300053134 Ga0500658_0231582 Ga0500658_0231582_173_838 215
505 3300053156 Ga0500622_0000799 Ga0500622_0000799_23450_24115 215
506 3300053739 Ga0500587_015923 Ga0500587_015923_262_927 215
507 3300002773 JGI25152J39213_1001492 JGI25152J39213_10014925 216
508 3300002774 JGI25150J39212_1003621 JGI25150J39212_10036213 216
509 3300003215 JGI25153J46596_10008443 JGI25153J46596_100084434 216
510 3300003215 JGI25153J46596_10011154 JGI25153J46596_100111543 216
511 3300003347 JGI26128J50194_1001179 JGI26128J50194_10011793 216
512 3300003771 Ga0055526_1003022 Ga0055526_10030225 216
513 3300005328 Ga0070676_10138536 Ga0070676_101385362 216
514 3300005329 Ga0070683_100055546 Ga0070683_1000555464 216
515 3300005329 Ga0070683_100163651 Ga0070683_1001636511 216
516 3300005334 Ga0068869_100354530 Ga0068869_1003545302 216
517 3300005337 Ga0070682_100089300 Ga0070682_1000893003 216
518 3300005338 Ga0068868_100483719 Ga0068868_1004837192 216
519 3300005339 Ga0070660_100025818 Ga0070660_1000258184 216
520 3300005339 Ga0070660_100045007 Ga0070660_1000450073 216
521 3300005344 Ga0070661_100022405 Ga0070661_1000224054 216
522 3300005353 Ga0070669_100169213 Ga0070669_1001692133 216
523 3300005354 Ga0070675_100182993 Ga0070675_1001829932 216
524 3300005355 Ga0070671_100005377 Ga0070671_1000053776 216
525 3300005355 Ga0070671_100017573 Ga0070671_1000175734 216
526 3300005364 Ga0070673_100066127 Ga0070673_1000661271 216
527 3300005366 Ga0070659_100077321 Ga0070659_1000773212 216
528 3300005366 Ga0070659_100111224 Ga0070659_1001112243 216
529 3300005366 Ga0070659_100326992 Ga0070659_1003269922 216
530 3300005367 Ga0070667_100007643 Ga0070667_10000764312 216
531 3300005445 Ga0070708_100437423 Ga0070708_1004374232 216
532 3300005445 Ga0070708_100458971 Ga0070708_1004589712 216
533 3300005455 Ga0070663_100021948 Ga0070663_1000219483 216
534 3300005456 Ga0070678_100288352 Ga0070678_1002883522 216
535 3300005458 Ga0070681_10074021 Ga0070681_100740212 216
536 3300005459 Ga0068867_100000042 Ga0068867_10000004213 216
537 3300005459 Ga0068867_100181287 Ga0068867_1001812872 216
538 3300005459 Ga0068867_100646294 Ga0068867_1006462941 216
539 3300005467 Ga0070706_100001024 Ga0070706_10000102417 216
540 3300005468 Ga0070707_100080121 Ga0070707_1000801213 216
541 3300005471 Ga0070698_100143500 Ga0070698_1001435002 216
542 3300005530 Ga0070679_100002789 Ga0070679_10000278912 216
543 3300005535 Ga0070684_100042630 Ga0070684_1000426303 216
544 3300005543 Ga0070672_100082242 Ga0070672_1000822423 216
545 3300005543 Ga0070672_100176791 Ga0070672_1001767912 216
546 3300005543 Ga0070672_100207649 Ga0070672_1002076492 216
547 3300005547 Ga0070693_100041469 Ga0070693_1000414693 216
548 3300005548 Ga0070665_100315467 Ga0070665_1003154671 216
549 3300005563 Ga0068855_100055466 Ga0068855_1000554661 216
550 3300005564 Ga0070664_100028913 Ga0070664_1000289134 216
551 3300005564 Ga0070664_100060295 Ga0070664_1000602953 216
552 3300005577 Ga0068857_100312648 Ga0068857_1003126482 216
553 3300005577 Ga0068857_100678862 Ga0068857_1006788622 216
554 3300005577 Ga0068857_100847265 Ga0068857_1008472652 216
555 3300005578 Ga0068854_100026974 Ga0068854_1000269742 216
556 3300005614 Ga0068856_100012973 Ga0068856_1000129738 216
557 3300005614 Ga0068856_100226542 Ga0068856_1002265422 216
558 3300005616 Ga0068852_100004800 Ga0068852_1000048009 216
559 3300005616 Ga0068852_100575734 Ga0068852_1005757342 216
560 3300005616 Ga0068852_100678148 Ga0068852_1006781482 216
561 3300005618 Ga0068864_100014825 Ga0068864_1000148255 216
562 3300005834 Ga0068851_10009516 Ga0068851_100095164 216
563 3300005834 Ga0068851_10373858 Ga0068851_103738581 216
564 3300005841 Ga0068863_100185189 Ga0068863_1001851892 216
565 3300005841 Ga0068863_100522278 Ga0068863_1005222782 216
566 3300005841 Ga0068863_100588660 Ga0068863_1005886602 216
567 3300005843 Ga0068860_100010520 Ga0068860_1000105202 216
568 3300005843 Ga0068860_100176830 Ga0068860_1001768302 216
569 3300005843 Ga0068860_100286533 Ga0068860_1002865332 216
570 3300006042 Ga0075368_10021285 Ga0075368_100212853 216
571 3300006042 Ga0075368_10099428 Ga0075368_100994282 216
572 3300006048 Ga0075363_100048410 Ga0075363_1000484102 216
573 3300006048 Ga0075363_100096713 Ga0075363_1000967132 216
574 3300006048 Ga0075363_100113676 Ga0075363_1001136762 216
575 3300006048 Ga0075363_100131718 Ga0075363_1001317182 216
576 3300006048 Ga0075363_100162519 Ga0075363_1001625192 216
577 3300006048 Ga0075363_100186231 Ga0075363_1001862311 216
578 3300006058 Ga0075432_10004434 Ga0075432_100044345 216
579 3300006177 Ga0075362_10038402 Ga0075362_100384023 216
580 3300006177 Ga0075362_10052360 Ga0075362_100523602 216
581 3300006178 Ga0075367_10013717 Ga0075367_100137172 216
582 3300006178 Ga0075367_10037267 Ga0075367_100372673 216
583 3300006178 Ga0075367_10065933 Ga0075367_100659332 216
584 3300006178 Ga0075367_10184114 Ga0075367_101841142 216
585 3300006195 Ga0075366_10007659 Ga0075366_100076597 216
586 3300006195 Ga0075366_10032208 Ga0075366_100322085 216
587 3300006195 Ga0075366_10124789 Ga0075366_101247892 216
588 3300006195 Ga0075366_10140053 Ga0075366_101400531 216
589 3300006195 Ga0075366_10140054 Ga0075366_101400541 216
590 3300006195 Ga0075366_10163871 Ga0075366_101638712 216
591 3300006195 Ga0075366_10220139 Ga0075366_102201392 216
592 3300006195 Ga0075366_10230087 Ga0075366_102300872 216
593 3300006195 Ga0075366_10241016 Ga0075366_102410162 216
594 3300006195 Ga0075366_10297252 Ga0075366_102972521 216
595 3300006237 Ga0097621_100278890 Ga0097621_1002788902 216
596 3300006353 Ga0075370_10018576 Ga0075370_100185764 216
597 3300006353 Ga0075370_10027322 Ga0075370_100273222 216
598 3300006353 Ga0075370_10034483 Ga0075370_100344833 216
599 3300006353 Ga0075370_10114036 Ga0075370_101140362 216
600 3300006353 Ga0075370_10137912 Ga0075370_101379122 216
601 3300006353 Ga0075370_10165131 Ga0075370_101651311 216
602 3300006353 Ga0075370_10186134 Ga0075370_101861342 216
603 3300006358 Ga0068871_100188729 Ga0068871_1001887292 216
604 3300006358 Ga0068871_100240874 Ga0068871_1002408742 216
605 3300006358 Ga0068871_100459457 Ga0068871_1004594571 216
606 3300006358 Ga0068871_100689766 Ga0068871_1006897662 216
607 3300006852 Ga0075433_10333281 Ga0075433_103332812 216
608 3300006881 Ga0068865_100185989 Ga0068865_1001859892 216
609 3300006946 Ga0079104_1000020 Ga0079104_10000209 216
610 3300009092 Ga0105250_10003253 Ga0105250_100032535 216
611 3300009093 Ga0105240_10027286 Ga0105240_100272862 216
612 3300009093 Ga0105240_10324621 Ga0105240_103246212 216
613 3300009098 Ga0105245_10044557 Ga0105245_100445572 216
614 3300009098 Ga0105245_10450233 Ga0105245_104502332 216
615 3300009101 Ga0105247_10311279 Ga0105247_103112792 216
616 3300009101 Ga0105247_10506642 Ga0105247_105066422 216
617 3300009147 Ga0114129_10230337 Ga0114129_102303371 216
618 3300009148 Ga0105243_10000525 Ga0105243_1000052526 216
619 3300009148 Ga0105243_10014258 Ga0105243_100142584 216
620 3300009148 Ga0105243_10639524 Ga0105243_106395242 216
621 3300009174 Ga0105241_10183250 Ga0105241_101832502 216
622 3300009174 Ga0105241_10555148 Ga0105241_105551482 216
623 3300009176 Ga0105242_10344714 Ga0105242_103447142 216
624 3300009177 Ga0105248_10171516 Ga0105248_101715162 216
625 3300009177 Ga0105248_10659570 Ga0105248_106595702 216
626 3300009545 Ga0105237_10069489 Ga0105237_100694894 216
627 3300009551 Ga0105238_10017388 Ga0105238_100173887 216
628 3300009551 Ga0105238_10341123 Ga0105238_103411232 216
629 3300010375 Ga0105239_10082739 Ga0105239_100827394 216
630 3300010375 Ga0105239_10270740 Ga0105239_102707402 216
631 3300012475 Ga0157317_1006061 Ga0157317_10060611 216
632 3300013100 Ga0157373_10015813 Ga0157373_100158137 216
633 3300013102 Ga0157371_10061369 Ga0157371_100613692 216
634 3300013102 Ga0157371_10184203 Ga0157371_101842032 216
635 3300013104 Ga0157370_10123429 Ga0157370_101234293 216
636 3300013105 Ga0157369_10005006 Ga0157369_1000500618 216
637 3300013105 Ga0157369_10074950 Ga0157369_100749503 216
638 3300013296 Ga0157374_10086592 Ga0157374_100865922 216
639 3300013296 Ga0157374_10745745 Ga0157374_107457452 216
640 3300013297 Ga0157378_10081670 Ga0157378_100816703 216
641 3300013307 Ga0157372_10021336 Ga0157372_100213366 216
642 3300013307 Ga0157372_10256101 Ga0157372_102561012 216
643 3300013308 Ga0157375_10017197 Ga0157375_100171977 216
644 3300013308 Ga0157375_10193985 Ga0157375_101939852 216
645 3300014326 Ga0157380_10241252 Ga0157380_102412522 216
646 3300014745 Ga0157377_10000038 Ga0157377_1000003812 216
647 3300014968 Ga0157379_10019318 Ga0157379_100193186 216
648 3300014968 Ga0157379_10071903 Ga0157379_100719034 216
649 3300014968 Ga0157379_10190746 Ga0157379_101907463 216
650 3300014968 Ga0157379_10553521 Ga0157379_105535212 216
651 3300015262 Ga0182007_10039395 Ga0182007_100393952 216
652 3300021384 Ga0213876_10065823 Ga0213876_100658232 216
653 3300025245 Ga0207425_1000121 Ga0207425_100012114 216
654 3300025258 Ga0209129_1000012 Ga0209129_1000012290 216
655 3300025295 Ga0209564_1000022 Ga0209564_1000022224 216
656 3300025297 Ga0209758_1000099 Ga0209758_100009925 216
657 3300025297 Ga0209758_1000358 Ga0209758_100035817 216
658 3300025299 Ga0209256_1011749 Ga0209256_10117494 216
659 3300025299 Ga0209256_1037305 Ga0209256_10373052 216
660 3300025304 Ga0209257_1024468 Ga0209257_10244683 216
661 3300025321 Ga0207656_10003251 Ga0207656_100032515 216
662 3300025711 Ga0207696_1003921 Ga0207696_10039215 216
663 3300025893 Ga0207682_10061091 Ga0207682_100610912 216
664 3300025901 Ga0207688_10041077 Ga0207688_100410772 216
665 3300025907 Ga0207645_10140455 Ga0207645_101404552 216
666 3300025907 Ga0207645_10277788 Ga0207645_102777882 216
667 3300025910 Ga0207684_10003630 Ga0207684_100036304 216
668 3300025911 Ga0207654_10128747 Ga0207654_101287472 216
669 3300025911 Ga0207654_10141798 Ga0207654_101417982 216
670 3300025912 Ga0207707_10156697 Ga0207707_101566973 216
671 3300025913 Ga0207695_10223980 Ga0207695_102239802 216
672 3300025913 Ga0207695_10746672 Ga0207695_107466722 216
673 3300025914 Ga0207671_10449855 Ga0207671_104498552 216
674 3300025917 Ga0207660_10029033 Ga0207660_100290332 216
675 3300025919 Ga0207657_10028264 Ga0207657_100282644 216
676 3300025919 Ga0207657_10037698 Ga0207657_100376985 216
677 3300025920 Ga0207649_10003313 Ga0207649_100033132 216
678 3300025921 Ga0207652_10014128 Ga0207652_100141288 216
679 3300025922 Ga0207646_10147629 Ga0207646_101476292 216
680 3300025924 Ga0207694_10045161 Ga0207694_100451614 216
681 3300025926 Ga0207659_10187546 Ga0207659_101875462 216
682 3300025927 Ga0207687_10101895 Ga0207687_101018953 216
683 3300025927 Ga0207687_10744315 Ga0207687_107443152 216
684 3300025931 Ga0207644_10016193 Ga0207644_100161933 216
685 3300025931 Ga0207644_10017481 Ga0207644_100174813 216
686 3300025931 Ga0207644_10177035 Ga0207644_101770352 216
687 3300025932 Ga0207690_10012303 Ga0207690_100123034 216
688 3300025932 Ga0207690_10046545 Ga0207690_100465453 216
689 3300025932 Ga0207690_10696238 Ga0207690_106962381 216
690 3300025933 Ga0207706_10439737 Ga0207706_104397372 216
691 3300025934 Ga0207686_10004472 Ga0207686_100044722 216
692 3300025935 Ga0207709_10000198 Ga0207709_1000019824 216
693 3300025935 Ga0207709_10001602 Ga0207709_100016023 216
694 3300025940 Ga0207691_10114250 Ga0207691_101142503 216
695 3300025940 Ga0207691_10181620 Ga0207691_101816202 216
696 3300025940 Ga0207691_10380863 Ga0207691_103808632 216
697 3300025941 Ga0207711_10016975 Ga0207711_100169753 216
698 3300025941 Ga0207711_10632905 Ga0207711_106329052 216
699 3300025942 Ga0207689_10424385 Ga0207689_104243852 216
700 3300025944 Ga0207661_10548966 Ga0207661_105489662 216
701 3300025945 Ga0207679_10020679 Ga0207679_100206794 216
702 3300025945 Ga0207679_10082538 Ga0207679_100825383 216
703 3300025949 Ga0207667_10618836 Ga0207667_106188362 216
704 3300025981 Ga0207640_10045926 Ga0207640_100459262 216
705 3300025981 Ga0207640_10945762 Ga0207640_109457621 216
706 3300025986 Ga0207658_10009608 Ga0207658_100096087 216
707 3300026023 Ga0207677_10204230 Ga0207677_102042302 216
708 3300026041 Ga0207639_10254434 Ga0207639_102544342 216
709 3300026067 Ga0207678_10020588 Ga0207678_100205884 216
710 3300026078 Ga0207702_10011118 Ga0207702_100111187 216
711 3300026078 Ga0207702_10192364 Ga0207702_101923642 216
712 3300026078 Ga0207702_10360811 Ga0207702_103608112 216
713 3300026088 Ga0207641_10033219 Ga0207641_100332195 216
714 3300026088 Ga0207641_10113692 Ga0207641_101136922 216
715 3300026089 Ga0207648_10000118 Ga0207648_1000011812 216
716 3300026089 Ga0207648_10296358 Ga0207648_102963582 216
717 3300026095 Ga0207676_10069368 Ga0207676_100693682 216
718 3300026116 Ga0207674_10042583 Ga0207674_100425834 216
719 3300026116 Ga0207674_10079812 Ga0207674_100798124 216
720 3300026116 Ga0207674_10282240 Ga0207674_102822402 216
721 3300026121 Ga0207683_10029469 Ga0207683_100294692 216
722 3300026142 Ga0207698_10017285 Ga0207698_100172854 216
723 3300026142 Ga0207698_10237181 Ga0207698_102371812 216
724 3300027111 Ga0209281_1000002 Ga0209281_1000002735 216
725 3300027360 Ga0209969_1016405 Ga0209969_10164052 216
726 3300027378 Ga0209981_1003564 Ga0209981_10035642 216
727 3300027395 Ga0209996_1004592 Ga0209996_10045922 216
728 3300027526 Ga0209968_1000430 Ga0209968_10004304 216
729 3300027543 Ga0209999_1052357 Ga0209999_10523571 216
730 3300027617 Ga0210002_1019689 Ga0210002_10196892 216
731 3300027682 Ga0209971_1000610 Ga0209971_10006106 216
732 3300027695 Ga0209966_1000118 Ga0209966_100011836 216
733 3300027866 Ga0209813_10010910 Ga0209813_100109102 216
734 3300027866 Ga0209813_10014474 Ga0209813_100144742 216
735 3300027876 Ga0209974_10021685 Ga0209974_100216852 216
736 3300027907 Ga0207428_10109477 Ga0207428_101094773 216
737 3300028379 Ga0268266_10019382 Ga0268266_100193825 216
738 3300028381 Ga0268264_10034520 Ga0268264_100345205 216
739 3300028381 Ga0268264_10038813 Ga0268264_100388133 216
740 3300028381 Ga0268264_10365416 Ga0268264_103654162 216
741 3300028786 Ga0307517_10000131 Ga0307517_1000013154 216
742 3300028786 Ga0307517_10196499 Ga0307517_101964992 216
743 3300028786 Ga0307517_10218271 Ga0307517_102182712 216
744 3300028794 Ga0307515_10162149 Ga0307515_101621493 216
745 3300028794 Ga0307515_10255090 Ga0307515_102550901 216
746 3300028794 Ga0307515_10278285 Ga0307515_102782852 216
747 3300030522 Ga0307512_10043490 Ga0307512_100434903 216
748 3300031235 Ga0265330_10045911 Ga0265330_100459111 216
749 3300031238 Ga0265332_10013777 Ga0265332_100137773 216
750 3300031239 Ga0265328_10012101 Ga0265328_100121012 216
751 3300031242 Ga0265329_10081142 Ga0265329_100811422 216
752 3300031250 Ga0265331_10007025 Ga0265331_100070256 216
753 3300031251 Ga0265327_10000042 Ga0265327_10000042223 216
754 3300031456 Ga0307513_10054060 Ga0307513_100540602 216
755 3300031456 Ga0307513_10243315 Ga0307513_102433152 216
756 3300031456 Ga0307513_10245325 Ga0307513_102453252 216
757 3300031507 Ga0307509_10004862 Ga0307509_100048626 216
758 3300031507 Ga0307509_10018297 Ga0307509_100182977 216
759 3300031507 Ga0307509_10035960 Ga0307509_100359602 216
760 3300031507 Ga0307509_10136519 Ga0307509_101365193 216
761 3300031548 Ga0307408_100000089 Ga0307408_10000008956 216
762 3300031548 Ga0307408_100138807 Ga0307408_1001388072 216
763 3300031616 Ga0307508_10094825 Ga0307508_100948252 216
764 3300031649 Ga0307514_10090249 Ga0307514_100902492 216
765 3300031711 Ga0265314_10001279 Ga0265314_100012792 216
766 3300031730 Ga0307516_10001343 Ga0307516_1000134310 216
767 3300031730 Ga0307516_10005732 Ga0307516_100057325 216
768 3300031730 Ga0307516_10011470 Ga0307516_100114707 216
769 3300031730 Ga0307516_10101753 Ga0307516_101017533 216
770 3300031730 Ga0307516_10334201 Ga0307516_103342012 216
771 3300031731 Ga0307405_10008322 Ga0307405_100083225 216
772 3300031911 Ga0307412_10224351 Ga0307412_102243511 216
773 3300031911 Ga0307412_10463377 Ga0307412_104633771 216
774 3300031995 Ga0307409_100671679 Ga0307409_1006716792 216
775 3300032004 Ga0307414_10539073 Ga0307414_105390731 216
776 3300032005 Ga0307411_10003956 Ga0307411_100039566 216
777 3300032005 Ga0307411_10028011 Ga0307411_100280113 216
778 3300033180 Ga0307510_10016292 Ga0307510_100162924 216
779 3300033180 Ga0307510_10132423 Ga0307510_101324232 216
780 3300034817 Ga0373948_0004523 Ga0373948_0004523_415_1080 216
781 3300035084 Ga0373928_0011197 Ga0373928_0011197_237_905 216
782 3300035088 Ga0373940_0016601 Ga0373940_0016601_595_1260 216
783 3300035091 Ga0373951_0014557 Ga0373951_0014557_492_1157 216
784 3300035114 Ga0373939_0000041 Ga0373939_0000041_38133_38798 216
785 3300035121 Ga0373960_0003175 Ga0373960_0003175_157_822 216
786 3300035241 Ga0373961_0004703 Ga0373961_0004703_26_691 216
787 3300035691 Ga0373931_0000097 Ga0373931_0000097_28583_29248 216
788 3300035691 Ga0373931_0342992 Ga0373931_0342992_73_768 216
789 3300035695 Ga0373927_0297132 Ga0373927_0297132_210_878 216
790 3300036401 Ga0373937_0484074 Ga0373937_0484074_392_1060 216
791 3300037068 Ga0373925_0031877 Ga0373925_0031877_585_1253 216
792 3300037068 Ga0373925_0198126 Ga0373925_0198126_585_1256 216
793 3300037312 Ga0395899_0039026 Ga0395899_0039026_1481_2152 216
794 3300037418 Ga0395900_0020054 Ga0395900_0020054_3317_3988 216
795 3300037418 Ga0395900_0112977 Ga0395900_0112977_1404_2075 216
796 3300037466 Ga0395898_0016994 Ga0395898_0016994_3415_4086 216
797 3300037466 Ga0395898_0035622 Ga0395898_0035622_206_877 216
798 3300037471 Ga0395905_0012925 Ga0395905_0012925_4396_5067 216
799 3300037471 Ga0395905_0054737 Ga0395905_0054737_1118_1783 216
800 3300038443 Ga0395901_0016216 Ga0395901_0016216_4396_5067 216
801 3300038443 Ga0395901_0101339 Ga0395901_0101339_714_1385 216
802 3300039437 Ga0436365_0041930 Ga0436365_0041930_1764_2432 216
803 3300039437 Ga0436365_0738692 Ga0436365_0738692_95_763 216
804 3300039450 Ga0436363_0737230 Ga0436363_0737230_1097_1765 216
805 3300041404 Ga0439436_0050297 Ga0439436_0050297_290_961 216
806 3300041408 Ga0439453_0017957 Ga0439453_0017957_20_688 216
807 3300041410 Ga0439461_0078468 Ga0439461_0078468_51_764 216
808 3300041460 Ga0451802_1020009 Ga0451802_1020009_253_921 216
809 3300042015 Ga0439462_0013376 Ga0439462_0013376_1010_1681 216
810 3300042125 Ga0450923_015532 Ga0450923_015532_390_1061 216
811 3300042126 Ga0450888_000201 Ga0450888_000201_3208_3876 216
812 3300042127 Ga0450890_001025 Ga0450890_001025_1239_1907 216
813 3300042129 Ga0450891_000553 Ga0450891_000553_825_1493 216
814 3300042130 Ga0450892_000410 Ga0450892_000410_2896_3564 216
815 3300042138 Ga0450903_014731 Ga0450903_014731_448_1116 216
816 3300042144 Ga0450889_001619 Ga0450889_001619_921_1589 216
817 3300042156 Ga0439446_0026929 Ga0439446_0026929_681_1352 216
818 3300042184 Ga0450908_012273 Ga0450908_012273_621_1292 216
819 3300042438 Ga0439459_0025177 Ga0439459_0025177_372_1037 216
820 3300042876 Ga0451577_0003355 Ga0451577_0003355_8543_9211 216
821 3300042876 Ga0451577_0486706 Ga0451577_0486706_293_961 216
822 3300044656 Ga0466969_0000080 Ga0466969_0000080_11128_11799 216
823 3300044656 Ga0466969_0006147 Ga0466969_0006147_2857_3552 216
824 3300044656 Ga0466969_0117422 Ga0466969_0117422_108_776 216
825 3300044683 Ga0466965_0017859 Ga0466965_0017859_2614_3285 216
826 3300044683 Ga0466965_0024821 Ga0466965_0024821_1900_2595 216
827 3300044684 Ga0466966_0001432 Ga0466966_0001432_8348_9043 216
828 3300044684 Ga0466966_0020479 Ga0466966_0020479_2449_3120 216
829 3300044693 Ga0466961_0014860 Ga0466961_0014860_4045_4716 216
830 3300044693 Ga0466961_0042913 Ga0466961_0042913_897_1592 216
831 3300044706 Ga0466964_0004774 Ga0466964_0004774_2943_3638 216
832 3300044719 Ga0466971_0005638 Ga0466971_0005638_2618_3313 216
833 3300044765 Ga0466970_0003670 Ga0466970_0003670_2070_2765 216
834 3300044765 Ga0466970_0038252 Ga0466970_0038252_1308_1979 216
835 3300044842 Ga0466957_0001651 Ga0466957_0001651_6482_7177 216
836 3300044842 Ga0466957_0090287 Ga0466957_0090287_344_1012 216
837 3300044842 Ga0466957_0343767 Ga0466957_0343767_269_937 216
838 3300045049 Ga0466959_0001188 Ga0466959_0001188_13847_14542 216
839 3300045051 Ga0451576_0036128 Ga0451576_0036128_4400_5065 216
840 3300045051 Ga0451576_0144214 Ga0451576_0144214_789_1454 216
841 3300045051 Ga0451576_0227193 Ga0451576_0227193_238_903 216
842 3300045976 Ga0466967_0016964 Ga0466967_0016964_4049_4726 216
843 3300046454 Ga0495592_0000394 Ga0495592_0000394_6650_7321 216
844 3300046454 Ga0495592_0025833 Ga0495592_0025833_1669_2337 216
845 3300046457 Ga0495590_0015716 Ga0495590_0015716_129_797 216
846 3300046460 Ga0495638_0062976 Ga0495638_0062976_269_940 216
847 3300046471 Ga0495650_0018907 Ga0495650_0018907_832_1500 216
848 3300046512 Ga0495610_0103825 Ga0495610_0103825_447_1115 216
849 3300046514 Ga0495618_0157151 Ga0495618_0157151_336_1004 216
850 3300046519 Ga0495632_0021009 Ga0495632_0021009_475_1143 216
851 3300046519 Ga0495632_0040412 Ga0495632_0040412_1303_1974 216
852 3300046524 Ga0495648_0151567 Ga0495648_0151567_191_862 216
853 3300046535 Ga0495586_0244637 Ga0495586_0244637_82_750 216
854 3300046536 Ga0495587_0131100 Ga0495587_0131100_61_729 216
855 3300046539 Ga0495621_0125396 Ga0495621_0125396_305_976 216
856 3300046542 Ga0495597_0052809 Ga0495597_0052809_539_1207 216
857 3300046557 Ga0495622_0236198 Ga0495622_0236198_73_744 216
858 3300046558 Ga0495633_0001440 Ga0495633_0001440_17664_18335 216
859 3300046616 Ga0495668_0040777 Ga0495668_0040777_71_742 216
860 3300046648 Ga0495611_0025417 Ga0495611_0025417_1747_2415 216
861 3300046660 Ga0495625_0082917 Ga0495625_0082917_109_777 216
862 3300046683 Ga0495658_0022366 Ga0495658_0022366_2380_3051 216
863 3300046690 Ga0495624_0073164 Ga0495624_0073164_299_967 216
864 3300046694 Ga0495649_0004929 Ga0495649_0004929_2343_3011 216
865 3300046794 Ga0495589_0151866 Ga0495589_0151866_370_1038 216
866 3300047321 Ga0495676_0070688 Ga0495676_0070688_634_1302 216
867 3300047443 Ga0495687_002015 Ga0495687_002015_4336_5004 216
868 3300047472 Ga0495686_0032152 Ga0495686_0032152_1689_2384 216
869 3300048091 Ga0495626_0173734 Ga0495626_0173734_83_751 216
870 3300048909 Ga0496106_0050471 Ga0496106_0050471_451_1119 216
871 3300048911 Ga0496108_0371178 Ga0496108_0371178_394_1065 216
872 3300048924 Ga0496121_0019826 Ga0496121_0019826_5883_6551 216
873 3300048927 Ga0496124_0000126 Ga0496124_0000126_97074_97742 216
874 3300048928 Ga0496125_0003500 Ga0496125_0003500_13719_14387 216
875 3300049160 Ga0501304_001185 Ga0501304_001185_212_880 216
876 3300049521 Ga0501298_016292 Ga0501298_016292_144_812 216
877 3300049530 Ga0501314_001679 Ga0501314_001679_553_1221 216
878 3300049568 Ga0501031_0008612 Ga0501031_0008612_3405_4073 216
879 3300049579 Ga0501043_0000009 Ga0501043_0000009_93862_94533 216
880 3300049580 Ga0501046_0000022 Ga0501046_0000022_93851_94522 216
881 3300049581 Ga0501047_0000021 Ga0501047_0000021_93909_94580 216
882 3300049582 Ga0501048_0002882 Ga0501048_0002882_11995_12666 216
883 3300049649 Ga0501198_000019 Ga0501198_000019_54815_55486 216
884 3300049651 Ga0501201_005344 Ga0501201_005344_112_780 216
885 3300049653 Ga0501206_010883 Ga0501206_010883_256_924 216
886 3300049658 Ga0501211_000514 Ga0501211_000514_2738_3406 216
887 3300049661 Ga0501217_013658 Ga0501217_013658_580_1248 216
888 3300049662 Ga0501222_000059 Ga0501222_000059_6480_7151 216
889 3300049662 Ga0501222_000866 Ga0501222_000866_2433_3101 216
890 3300049665 Ga0501227_005054 Ga0501227_005054_1647_2315 216
891 3300049668 Ga0501233_005173 Ga0501233_005173_1305_1973 216
892 3300049669 Ga0501235_000554 Ga0501235_000554_1748_2416 216
893 3300049670 Ga0501236_000725 Ga0501236_000725_1611_2279 216
894 3300049679 Ga0501249_004420 Ga0501249_004420_2006_2674 216
895 3300049682 Ga0501252_003132 Ga0501252_003132_47_715 216
896 3300049684 Ga0501255_000139 Ga0501255_000139_2677_3345 216
897 3300049704 Ga0501221_000277 Ga0501221_000277_807_1475 216
898 3300049705 Ga0501225_0013921 Ga0501225_0013921_93_761 216
899 3300049706 Ga0501229_003518 Ga0501229_003518_417_1085 216
900 3300049759 Ga0501262_001465 Ga0501262_001465_1822_2490 216
901 3300049762 Ga0501265_003342 Ga0501265_003342_232_900 216
902 3300049764 Ga0501267_001500 Ga0501267_001500_1042_1710 216
903 3300049769 Ga0501272_005195 Ga0501272_005195_179_847 216
904 3300049778 Ga0501282_002803 Ga0501282_002803_396_1064 216
905 3300049779 Ga0501283_008493 Ga0501283_008493_214_882 216
906 3300049824 Ga0501045_0003093 Ga0501045_0003093_105_776 216
907 3300050489 nmdc:mga03683_8085_c1 nmdc:mga03683_8085_c1_1956_2624 216
908 3300050489 nmdc:mga03683_82589_c1 nmdc:mga03683_82589_c1_256_924 216
909 3300050492 nmdc:mga0yw44_117262_c1 nmdc:mga0yw44_117262_c1_340_1008 216
910 3300050493 nmdc:mga0k408_111655_c1 nmdc:mga0k408_111655_c1_465_1133 216
911 3300050493 nmdc:mga0k408_128999_c1 nmdc:mga0k408_128999_c1_243_911 216
912 3300050493 nmdc:mga0k408_134251_c1 nmdc:mga0k408_134251_c1_43_714 216
913 3300050493 nmdc:mga0k408_14075_c1 nmdc:mga0k408_14075_c1_74_769 216
914 3300050493 nmdc:mga0k408_19526_c1 nmdc:mga0k408_19526_c1_2467_3135 216
915 3300050493 nmdc:mga0k408_196261_c1 nmdc:mga0k408_196261_c1_275_943 216
916 3300050493 nmdc:mga0k408_216774_c1 nmdc:mga0k408_216774_c1_63_731 216
917 3300050493 nmdc:mga0k408_241871_c1 nmdc:mga0k408_241871_c1_11_679 216
918 3300050493 nmdc:mga0k408_4130_c1 nmdc:mga0k408_4130_c1_6851_7519 216
919 3300050493 nmdc:mga0k408_44714_c1 nmdc:mga0k408_44714_c1_145_813 216
920 3300050493 nmdc:mga0k408_9389_c1 nmdc:mga0k408_9389_c1_2798_3466 216
921 3300050493 nmdc:mga0k408_9407_c1 nmdc:mga0k408_9407_c1_4554_5225 216
922 3300050494 nmdc:mga06z11_150973_c1 nmdc:mga06z11_150973_c1_324_992 216
923 3300050495 nmdc:mga04h51_19339_c1 nmdc:mga04h51_19339_c1_187_855 216
924 3300050496 nmdc:mga07m45_141466_c1 nmdc:mga07m45_141466_c1_156_824 216
925 3300050496 nmdc:mga07m45_166674_c1 nmdc:mga07m45_166674_c1_355_1023 216
926 3300050496 nmdc:mga07m45_212_c1 nmdc:mga07m45_212_c1_21500_22165 216
927 3300050496 nmdc:mga07m45_2259_c1 nmdc:mga07m45_2259_c1_3828_4496 216
928 3300050496 nmdc:mga07m45_82439_c1 nmdc:mga07m45_82439_c1_171_839 216
929 3300050516 nmdc:mga0sz30_42262_c1 nmdc:mga0sz30_42262_c1_956_1624 216
930 3300053093 Ga0500651_0177895 Ga0500651_0177895_59_727 216
931 3300053133 Ga0500655_029722 Ga0500655_029722_278_949 216
932 3300053139 Ga0500568_0034417 Ga0500568_0034417_876_1547 216
933 3300053142 Ga0500577_0203503 Ga0500577_0203503_27_698 216
934 3300053148 Ga0500590_061939 Ga0500590_061939_489_1157 216
935 3300053154 Ga0500619_001758 Ga0500619_001758_957_1625 216
936 3300053739 Ga0500587_020173 Ga0500587_020173_135_803 216
937 3300059421 Ga0590071_000444 Ga0590071_000444_5310_5978 216
938 3300061719 Ga0466962_0071571 Ga0466962_0071571_377_1072 216
939 iso_pu_bacteria 2842718218 2842721769 217
940 3300005290 Ga0065712_10075809 Ga0065712_100758092 218
941 3300005293 Ga0065715_10008644 Ga0065715_100086442 218
942 3300005331 Ga0070670_100049214 Ga0070670_1000492142 218
943 3300005333 Ga0070677_10001325 Ga0070677_100013254 218
944 3300005338 Ga0068868_100264828 Ga0068868_1002648282 218
945 3300005347 Ga0070668_100183457 Ga0070668_1001834572 218
946 3300005353 Ga0070669_100013732 Ga0070669_1000137326 218
947 3300005354 Ga0070675_100002401 Ga0070675_10000240112 218
948 3300005355 Ga0070671_100012049 Ga0070671_1000120495 218
949 3300005356 Ga0070674_100001038 Ga0070674_1000010384 218
950 3300005356 Ga0070674_100073006 Ga0070674_1000730063 218
951 3300005364 Ga0070673_100033792 Ga0070673_1000337922 218
952 3300005367 Ga0070667_100047349 Ga0070667_1000473492 218
953 3300005456 Ga0070678_100017251 Ga0070678_1000172513 218
954 3300005530 Ga0070679_100273492 Ga0070679_1002734922 218
955 3300005543 Ga0070672_100114813 Ga0070672_1001148132 218
956 3300005616 Ga0068852_100620795 Ga0068852_1006207952 218
957 3300005840 Ga0068870_10004558 Ga0068870_100045584 218
958 3300006237 Ga0097621_100010322 Ga0097621_1000103225 218
959 3300009177 Ga0105248_11405906 Ga0105248_114059061 218
960 3300013306 Ga0163162_10206635 Ga0163162_102066353 218
961 3300013308 Ga0157375_10051621 Ga0157375_100516213 218
962 3300017792 Ga0163161_10013908 Ga0163161_100139084 218
963 3300025315 Ga0207697_10010273 Ga0207697_100102732 218
964 3300025893 Ga0207682_10000367 Ga0207682_100003678 218
965 3300025901 Ga0207688_10037702 Ga0207688_100377022 218
966 3300025908 Ga0207643_10017376 Ga0207643_100173762 218
967 3300025923 Ga0207681_10134335 Ga0207681_101343353 218
968 3300025923 Ga0207681_10667840 Ga0207681_106678401 218
969 3300025925 Ga0207650_10003357 Ga0207650_100033577 218
970 3300025926 Ga0207659_10013572 Ga0207659_100135723 218
971 3300025931 Ga0207644_10011880 Ga0207644_100118803 218
972 3300025937 Ga0207669_10035931 Ga0207669_100359313 218
973 3300025937 Ga0207669_10053942 Ga0207669_100539422 218
974 3300025940 Ga0207691_10008283 Ga0207691_100082832 218
975 3300025940 Ga0207691_10066141 Ga0207691_100661413 218
976 3300025942 Ga0207689_10159056 Ga0207689_101590561 218
977 3300025960 Ga0207651_10029487 Ga0207651_100294874 218
978 3300026023 Ga0207677_10019193 Ga0207677_100191935 218
979 3300026088 Ga0207641_10351973 Ga0207641_103519732 218
980 3300026089 Ga0207648_10013897 Ga0207648_100138975 218
981 3300026089 Ga0207648_10089580 Ga0207648_100895801 218
982 3300026121 Ga0207683_10007352 Ga0207683_100073528 218
983 3300026142 Ga0207698_10166884 Ga0207698_101668842 218
984 3300028379 Ga0268266_10128406 Ga0268266_101284062 218
985 3300031548 Ga0307408_100052190 Ga0307408_1000521903 218
986 3300031548 Ga0307408_100150749 Ga0307408_1001507492 218
987 3300031731 Ga0307405_10327066 Ga0307405_103270662 218
988 3300031852 Ga0307410_10255603 Ga0307410_102556031 218
989 3300031911 Ga0307412_10270782 Ga0307412_102707822 218
990 3300031995 Ga0307409_100190211 Ga0307409_1001902112 218
991 3300049515 Ga0501292_014570 Ga0501292_014570_281_976 218
992 3300049526 Ga0501303_002235 Ga0501303_002235_23_718 218
993 3300049654 Ga0501207_014275 Ga0501207_014275_230_925 218
994 3300049683 Ga0501253_012725 Ga0501253_012725_119_814 218
995 3300049686 Ga0501257_029830 Ga0501257_029830_470_1165 218
996 3300049705 Ga0501225_0051887 Ga0501225_0051887_403_1098 218
997 3300049759 Ga0501262_000612 Ga0501262_000612_1354_2049 218
998 3300049762 Ga0501265_001107 Ga0501265_001107_827_1522 218
999 3300049777 Ga0501281_01614 Ga0501281_01614_949_1644 218
1000 3300005334 Ga0068869_100019660 Ga0068869_1000196602 219
1001 3300005335 Ga0070666_10023485 Ga0070666_100234854 219
1002 3300005338 Ga0068868_100033067 Ga0068868_1000330674 219
1003 3300005347 Ga0070668_100606094 Ga0070668_1006060942 219
1004 3300005353 Ga0070669_100281987 Ga0070669_1002819872 219
1005 3300005355 Ga0070671_100487498 Ga0070671_1004874982 219
1006 3300005356 Ga0070674_100330793 Ga0070674_1003307932 219
1007 3300005367 Ga0070667_100016131 Ga0070667_1000161314 219
1008 3300005438 Ga0070701_10408804 Ga0070701_104088041 219
1009 3300005455 Ga0070663_100325840 Ga0070663_1003258402 219
1010 3300005456 Ga0070678_100024100 Ga0070678_1000241002 219
1011 3300005456 Ga0070678_100218397 Ga0070678_1002183972 219
1012 3300005459 Ga0068867_100315987 Ga0068867_1003159872 219
1013 3300005539 Ga0068853_100415061 Ga0068853_1004150611 219
1014 3300005543 Ga0070672_100188665 Ga0070672_1001886653 219
1015 3300005544 Ga0070686_100170788 Ga0070686_1001707882 219
1016 3300005617 Ga0068859_100028193 Ga0068859_1000281936 219
1017 3300005618 Ga0068864_100002240 Ga0068864_1000022402 219
1018 3300005719 Ga0068861_100112000 Ga0068861_1001120002 219
1019 3300005834 Ga0068851_10143677 Ga0068851_101436772 219
1020 3300005840 Ga0068870_10090403 Ga0068870_100904032 219
1021 3300005841 Ga0068863_100714410 Ga0068863_1007144102 219
1022 3300005842 Ga0068858_100013579 Ga0068858_1000135798 219
1023 3300005844 Ga0068862_100054762 Ga0068862_1000547623 219
1024 3300006163 Ga0070715_10292073 Ga0070715_102920731 219
1025 3300006353 Ga0075370_10304858 Ga0075370_103048582 219
1026 3300006358 Ga0068871_100032026 Ga0068871_1000320264 219
1027 3300006881 Ga0068865_100340811 Ga0068865_1003408112 219
1028 3300006931 Ga0097620_100028193 Ga0097620_1000281932 219
1029 3300009177 Ga0105248_10083241 Ga0105248_100832412 219
1030 3300009177 Ga0105248_10554814 Ga0105248_105548142 219
1031 3300009553 Ga0105249_10034394 Ga0105249_100343944 219
1032 3300013296 Ga0157374_10097576 Ga0157374_100975762 219
1033 3300013297 Ga0157378_10312446 Ga0157378_103124461 219
1034 3300014326 Ga0157380_10363566 Ga0157380_103635662 219
1035 3300017792 Ga0163161_10111266 Ga0163161_101112663 219
1036 3300017792 Ga0163161_10585733 Ga0163161_105857331 219
1037 3300025315 Ga0207697_10032314 Ga0207697_100323142 219
1038 3300025321 Ga0207656_10014449 Ga0207656_100144493 219
1039 3300025903 Ga0207680_10004392 Ga0207680_100043924 219
1040 3300025905 Ga0207685_10221656 Ga0207685_102216562 219
1041 3300025908 Ga0207643_10034786 Ga0207643_100347863 219
1042 3300025918 Ga0207662_10069806 Ga0207662_100698063 219
1043 3300025923 Ga0207681_10071478 Ga0207681_100714783 219
1044 3300025925 Ga0207650_10418621 Ga0207650_104186212 219
1045 3300025926 Ga0207659_10006704 Ga0207659_100067044 219
1046 3300025933 Ga0207706_10241542 Ga0207706_102415422 219
1047 3300025936 Ga0207670_10023188 Ga0207670_100231884 219
1048 3300025937 Ga0207669_10019944 Ga0207669_100199442 219
1049 3300025940 Ga0207691_10069585 Ga0207691_100695854 219
1050 3300025941 Ga0207711_10565897 Ga0207711_105658972 219
1051 3300025942 Ga0207689_10175351 Ga0207689_101753512 219
1052 3300025972 Ga0207668_10079657 Ga0207668_100796572 219
1053 3300025986 Ga0207658_10028581 Ga0207658_100285812 219
1054 3300026023 Ga0207677_10004562 Ga0207677_100045624 219
1055 3300026035 Ga0207703_10008117 Ga0207703_100081174 219
1056 3300026067 Ga0207678_10180996 Ga0207678_101809962 219
1057 3300026075 Ga0207708_10300276 Ga0207708_103002762 219
1058 3300026095 Ga0207676_10010144 Ga0207676_100101444 219
1059 3300026118 Ga0207675_100001372 Ga0207675_1000013723 219
1060 3300026121 Ga0207683_10537712 Ga0207683_105377122 219
1061 3300028380 Ga0268265_10027331 Ga0268265_100273313 219
1062 3300028794 Ga0307515_10016458 Ga0307515_100164584 219
1063 3300031507 Ga0307509_10004038 Ga0307509_100040385 219
1064 3300031507 Ga0307509_10042328 Ga0307509_100423283 219
1065 3300033180 Ga0307510_10192955 Ga0307510_101929552 219
1066 3300042439 Ga0439464_0001793 Ga0439464_0001793_4010_4705 219
1067 3300046539 Ga0495621_0041723 Ga0495621_0041723_505_1200 219
1068 3300048907 Ga0496104_0192156 Ga0496104_0192156_140_835 219
1069 3300048908 Ga0496105_0036505 Ga0496105_0036505_149_844 219
1070 3300006195 Ga0075366_10020570 Ga0075366_100205703 220
1071 3300037471 Ga0395905_0000088 Ga0395905_0000088_136295_136981 220
1072 3300037471 Ga0395905_0106647 Ga0395905_0106647_1830_2516 220
1073 3300038443 Ga0395901_0060112 Ga0395901_0060112_407_1093 220
1074 3300050493 nmdc:mga0k408_19415_c1 nmdc:mga0k408_19415_c1_212_898 220
1075 3300005334 Ga0068869_100297286 Ga0068869_1002972862 221
1076 3300005338 Ga0068868_100012774 Ga0068868_1000127744 221
1077 3300005339 Ga0070660_100116756 Ga0070660_1001167563 221
1078 3300005458 Ga0070681_10539565 Ga0070681_105395651 221
1079 3300005530 Ga0070679_100059819 Ga0070679_1000598194 221
1080 3300005530 Ga0070679_100141961 Ga0070679_1001419612 221
1081 3300005563 Ga0068855_100012468 Ga0068855_1000124688 221
1082 3300005563 Ga0068855_100228474 Ga0068855_1002284742 221
1083 3300005614 Ga0068856_100231784 Ga0068856_1002317842 221
1084 3300005614 Ga0068856_100699493 Ga0068856_1006994931 221
1085 3300009093 Ga0105240_10052818 Ga0105240_100528185 221
1086 3300009174 Ga0105241_10258217 Ga0105241_102582172 221
1087 3300009551 Ga0105238_10038608 Ga0105238_100386083 221
1088 3300010375 Ga0105239_10080161 Ga0105239_100801614 221
1089 3300025911 Ga0207654_10286426 Ga0207654_102864262 221
1090 3300025912 Ga0207707_10361384 Ga0207707_103613842 221
1091 3300025913 Ga0207695_10242262 Ga0207695_102422622 221
1092 3300025919 Ga0207657_10015678 Ga0207657_100156788 221
1093 3300025921 Ga0207652_10182810 Ga0207652_101828102 221
1094 3300025921 Ga0207652_10189841 Ga0207652_101898412 221
1095 3300025924 Ga0207694_10090569 Ga0207694_100905692 221
1096 3300025949 Ga0207667_10115027 Ga0207667_101150273 221
1097 3300025949 Ga0207667_10291224 Ga0207667_102912242 221
1098 3300026078 Ga0207702_10195115 Ga0207702_101951152 221
1099 3300038443 Ga0395901_0136131 Ga0395901_0136131_1704_2393 221
1100 3300045051 Ga0451576_0530614 Ga0451576_0530614_110_799 221
1101 2010549000 RicEn_C4527 RicEn_80550 222

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

51

235

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.858 2 217
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.8507 2 217
4jbw-assembly2.cif.gz_H crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.8361 13 208
4jbw-assembly1.cif.gz_F crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.8311 14 208
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.8073 9 218
ID Description Score Start End Superfamily
af_P0AER3_18_239_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8892 17 218 1.10.3720.10
af_P52094_1_222_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8883 14 218 1.10.3720.10
af_P0AEU3_9_230_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8872 24 219 1.10.3720.10
af_P45768_144_364_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8857 24 218 1.10.3720.10
af_P0AEQ6_1_218_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8725 2 219 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A7Y6ITF0-F1-model_v4 Amino acid ABC transporter permease 0.9259 10 221 GO:0006865
GO:0022857
GO:0043190
AF-C3KNH7-F1-model_v4 Permease component of ABC transporter 0.925 21 218 GO:0006865
GO:0022857
GO:0043190
AF-A0A7W6EIY8-F1-model_v4 Glutamate/aspartate transport system permease protein 0.9222 1 222 GO:0006865
GO:0022857
GO:0043190
AF-A0A7W6EIY8-F1-model_v4 Glutamate/aspartate transport system permease protein 0.9182 1 222 GO:0006865
GO:0022857
GO:0043190
AF-A0A7W8A2W1-F1-model_v4 Glutamate transport system permease protein 0.9155 10 222 GO:0006865
GO:0022857
GO:0043190

Feature Viewer

pLDDT pTM Quality
82.41 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map