F490100

General Info

Members Datasets Scaffolds Average Seq Length
1103 385 2206 302

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10054794|Ga0075365_100547942
Length 344
Sequence MSLAAQAARVGAPPYFGRDAPAAKTMHGVGRVRQAVAMINVEGLTRRYGNFTAVDDVSFVCQPGRVTGFLGPNGAGKTTTMRVMVGLTPPTKGRVTIGGHVYQDIPNPGTHVGVLLDASAQHAGRTGREILTLGAQTMGLPMSRVDEMLELVSLDKTEAKRRLRNYSLGMKQRLGIAHALLGDPSVLILDEPANGLDPAGIRWMRGLLKGYADRGGTVCLSSHLLNEVEQIADEMILIGHGRIVAEGTKEELLAGAESHTALVTSLDNERLAQALRDKGVTVTTAGSGLRAETAPVQVGRVAAEHSIVLSDLRAAEGGLEELFLTLTADTQREQPVATTQGATA

Samples

Sample ID Description Type Environment
1 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
10 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
74 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
171 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
176 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
177 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
178 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
179 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
180 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
181 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
182 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
183 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
184 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
185 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
186 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
187 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
188 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
189 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
190 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
191 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
192 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
193 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
194 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
195 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
196 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
197 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
198 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
199 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
200 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
201 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
202 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
203 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
204 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
205 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
206 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
207 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
208 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
209 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
210 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
211 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
213 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
214 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
215 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
216 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
217 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
218 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
219 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
220 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
221 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
222 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
223 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
224 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
225 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
226 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
227 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
228 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
229 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
230 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
231 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
232 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
233 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
234 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
235 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
236 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
237 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
238 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
239 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
240 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
241 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
242 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
243 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
244 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
245 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
246 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
247 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
248 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
249 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
250 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
251 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
252 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
253 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
254 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
255 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
256 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
257 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
258 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
259 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
260 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
261 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
262 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
263 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
264 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
265 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
266 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
267 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
268 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
269 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
270 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
271 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
272 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
273 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
274 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
275 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
276 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
277 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
278 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
279 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
280 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
281 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
282 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
283 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
284 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
285 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
286 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
287 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
288 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
289 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
290 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
291 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
293 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
294 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
310 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
311 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
312 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
313 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
314 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
315 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
316 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
317 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
318 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
319 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
320 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
321 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
322 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
323 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
324 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
327 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
328 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
329 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
330 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
331 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
332 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
333 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
334 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
335 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
336 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
337 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
338 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
339 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
340 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
341 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
342 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
343 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
344 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
345 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
346 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
347 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
348 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
349 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
350 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
351 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
352 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
355 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
356 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
357 2643221576 Nocardioides sp. Root614 Isolate Unclassified
358 2643221590 Nocardioides sp. Root682 Isolate Unclassified
359 2643221604 Nocardioides sp. Root190 Isolate Unclassified
360 2643221615 Nocardioides sp. Root224 Isolate Unclassified
361 2643221617 Nocardioides sp. Root79 Isolate Unclassified
362 2643221620 Nocardioides sp. Root240 Isolate Unclassified
363 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
364 2643221641 Nocardioides sp. Root122 Isolate Unclassified
365 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
366 2643221711 Terrabacter sp. Root85 Isolate Unclassified
367 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
368 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
369 2738541305 Nocardioides sp. CF167 Isolate Unclassified
370 2739367653 Kocuria sp. OV113 Isolate Unclassified
371 2739367898 Nocardioides sp. CF479 Isolate Unclassified
372 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
373 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
374 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
375 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
376 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
377 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
378 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
379 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
380 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
381 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
382 2857727296 Kocuria sp. R-72562 Isolate Unclassified
383 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
384 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
385 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.56
Metatranscriptomes 0.82
Isolates 3.63

Biome Distribution

Category Percentage (%)
Aerial Root 0.36
Bulb 0
Endosphere 9.88
Nodule 0.18
Rhizoplane 9.43
Rhizosphere 75.61
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075365_10054794 3300006038 Bacteria 2645
2 JGI24741J21665_1009250 3300001915 Bacteria 1818
3 JGI24752J21851_1003606 3300001976 Bacteria 2039
4 JGI24740J21852_10016912 3300001979 Bacteria 2622
5 JGI24739J22299_10024977 3300001989 Bacteria 2103
6 JGI24737J22298_10002340 3300001990 Bacteria 6758
7 JGI24735J21928_10012866 3300002067 Bacteria 2641
8 JGI24738J21930_10012282 3300002075 Bacteria 1872
9 JGI24738J21930_10013790 3300002075 Bacteria 1741
10 JGI24751J29686_10009083 3300002459 Bacteria 2041
11 Ga0006562J51391_1041093 3300003578 Bacteria 2360
12 Ga0070658_10022845 3300005327 Bacteria 5020
13 Ga0070658_10052400 3300005327 Bacteria 3309
14 Ga0070658_10174949 3300005327 Bacteria 1805
15 Ga0070676_10008718 3300005328 Bacteria 5471
16 Ga0070683_100004272 3300005329 Bacteria 11729
17 Ga0070683_100068068 3300005329 Bacteria 3317
18 Ga0070683_100188442 3300005329 Bacteria 1958
19 Ga0070683_100530843 3300005329 Bacteria 1125
20 Ga0070670_100030720 3300005331 Bacteria 4626
21 Ga0070670_100055693 3300005331 Bacteria 3394
22 Ga0070670_100139943 3300005331 Bacteria 2093
23 Ga0070670_100156954 3300005331 Bacteria 1971
24 Ga0068869_100101416 3300005334 Bacteria 2177
25 Ga0070666_10111673 3300005335 Bacteria 1890
26 Ga0070680_100086487 3300005336 Bacteria 2591
27 Ga0070682_100020935 3300005337 Bacteria 3853
28 Ga0070682_100033181 3300005337 Bacteria 3135
29 Ga0070682_100087180 3300005337 Bacteria 2035
30 Ga0068868_100130078 3300005338 Bacteria 2059
31 Ga0068868_100155424 3300005338 Bacteria 1886
32 Ga0068868_100219377 3300005338 Bacteria 1592
33 Ga0068868_100337182 3300005338 Bacteria 1288
34 Ga0070660_100026821 3300005339 Bacteria 4292
35 Ga0070691_10008438 3300005341 Bacteria 4714
36 Ga0070691_10032720 3300005341 Bacteria 2444
37 Ga0070687_100067500 3300005343 Bacteria 1909
38 Ga0070687_100170331 3300005343 Bacteria 1295
39 Ga0070661_100083997 3300005344 Bacteria 2352
40 Ga0070661_100096484 3300005344 Bacteria 2194
41 Ga0070692_10031200 3300005345 Bacteria 2670
42 Ga0070692_10063357 3300005345 Bacteria 1953
43 Ga0070669_100085049 3300005353 Bacteria 2362
44 Ga0070669_100113295 3300005353 Bacteria 2060
45 Ga0070675_100003729 3300005354 Bacteria 11583
46 Ga0070675_100081721 3300005354 Bacteria 2695
47 Ga0070675_100201298 3300005354 Bacteria 1728
48 Ga0070671_100001796 3300005355 Bacteria 16283
49 Ga0070671_100284606 3300005355 Bacteria 1406
50 Ga0070674_100020561 3300005356 Bacteria 4221
51 Ga0070674_100028612 3300005356 Bacteria 3661
52 Ga0070674_100064123 3300005356 Bacteria 2573
53 Ga0070673_100194741 3300005364 Bacteria 1743
54 Ga0070659_100017443 3300005366 Bacteria 5405
55 Ga0070659_100031226 3300005366 Bacteria 4125
56 Ga0070659_100111701 3300005366 Bacteria 2207
57 Ga0070667_100105794 3300005367 Bacteria 2435
58 Ga0070709_10018818 3300005434 Bacteria 3985
59 Ga0070709_10219397 3300005434 Bacteria 1355
60 Ga0070709_10226601 3300005434 Bacteria 1335
61 Ga0070709_10318096 3300005434 Bacteria 1141
62 Ga0070714_100145978 3300005435 Bacteria 2128
63 Ga0070714_100351591 3300005435 Bacteria 1384
64 Ga0070713_100499694 3300005436 Bacteria 1147
65 Ga0070710_10033092 3300005437 Bacteria 2805
66 Ga0070710_10196074 3300005437 Bacteria 1272
67 Ga0070701_10002525 3300005438 Bacteria 7071
68 Ga0070701_10004513 3300005438 Bacteria 5650
69 Ga0070701_10013161 3300005438 Bacteria 3755
70 Ga0070711_100107191 3300005439 Bacteria 2044
71 Ga0070711_100305484 3300005439 Bacteria 1266
72 Ga0070711_100518832 3300005439 Bacteria 984
73 Ga0070705_100173239 3300005440 Bacteria 1454
74 Ga0070700_100011432 3300005441 Bacteria 4917
75 Ga0070700_100016043 3300005441 Bacteria 4260
76 Ga0070700_100033084 3300005441 Bacteria 3112
77 Ga0070700_100074634 3300005441 Bacteria 2173
78 Ga0070663_100026021 3300005455 Bacteria 3958
79 Ga0070678_100073846 3300005456 Bacteria 2561
80 Ga0070678_100152184 3300005456 Bacteria 1865
81 Ga0070662_100023827 3300005457 Bacteria 4210
82 Ga0070681_10216441 3300005458 Bacteria 1831
83 Ga0068867_100019341 3300005459 Bacteria 4853
84 Ga0068867_100060741 3300005459 Bacteria 2804
85 Ga0070685_10066406 3300005466 Bacteria 2125
86 Ga0070706_100417038 3300005467 Bacteria 1249
87 Ga0070679_100079751 3300005530 Bacteria 3263
88 Ga0070684_100005484 3300005535 Bacteria 9720
89 Ga0070684_100007079 3300005535 Bacteria 8719
90 Ga0070684_100069190 3300005535 Bacteria 3104
91 Ga0070684_100084213 3300005535 Bacteria 2818
92 Ga0070684_100093417 3300005535 Bacteria 2678
93 Ga0070684_100104682 3300005535 Bacteria 2532
94 Ga0070684_100366711 3300005535 Bacteria 1326
95 Ga0068853_100190760 3300005539 Bacteria 1862
96 Ga0068853_100332806 3300005539 Bacteria 1409
97 Ga0068853_100332826 3300005539 Bacteria 1409
98 Ga0070672_100058530 3300005543 Bacteria 3029
99 Ga0070693_100021585 3300005547 Bacteria 3412
100 Ga0070693_100140788 3300005547 Bacteria 1518
101 Ga0070665_100000273 3300005548 Bacteria 84592
102 Ga0070665_100000957 3300005548 Bacteria 36788
103 Ga0070665_100001051 3300005548 Bacteria 34592
104 Ga0070665_100006876 3300005548 Bacteria 11562
105 Ga0070665_100019437 3300005548 Bacteria 6817
106 Ga0068855_100051021 3300005563 Bacteria 4874
107 Ga0068855_100148667 3300005563 Bacteria 2665
108 Ga0068855_100250575 3300005563 Bacteria 1975
109 Ga0068855_100672769 3300005563 Bacteria 1110
110 Ga0068855_100833010 3300005563 Bacteria 979
111 Ga0070664_100006966 3300005564 Bacteria 9112
112 Ga0070664_100073978 3300005564 Bacteria 2924
113 Ga0070664_100282178 3300005564 Bacteria 1498
114 Ga0068857_100022586 3300005577 Bacteria 5533
115 Ga0068857_100047898 3300005577 Bacteria 3796
116 Ga0068857_100067847 3300005577 Bacteria 3175
117 Ga0068857_100108497 3300005577 Bacteria 2494
118 Ga0068857_100315139 3300005577 Bacteria 1444
119 Ga0068854_100380884 3300005578 Bacteria 1162
120 Ga0068854_100441639 3300005578 Bacteria 1085
121 Ga0068854_100470469 3300005578 Bacteria 1053
122 Ga0068856_100007197 3300005614 Bacteria 10853
123 Ga0068856_100191745 3300005614 Bacteria 2057
124 Ga0068856_100274287 3300005614 Bacteria 1703
125 Ga0070702_100007278 3300005615 Bacteria 5292
126 Ga0070702_100040366 3300005615 Bacteria 2610
127 Ga0070702_100092910 3300005615 Bacteria 1833
128 Ga0070702_100139491 3300005615 Bacteria 1542
129 Ga0070702_100236934 3300005615 Bacteria 1229
130 Ga0068852_100017197 3300005616 Bacteria 5668
131 Ga0068852_100027017 3300005616 Bacteria 4672
132 Ga0068852_100055241 3300005616 Bacteria 3426
133 Ga0068852_100349429 3300005616 Bacteria 1443
134 Ga0068859_100205012 3300005617 Bacteria 2057
135 Ga0068859_100355058 3300005617 Bacteria 1561
136 Ga0068859_100612565 3300005617 Bacteria 1181
137 Ga0068864_100021818 3300005618 Bacteria 5366
138 Ga0068864_100107890 3300005618 Bacteria 2477
139 Ga0068861_100027454 3300005719 Bacteria 4145
140 Ga0068861_100029179 3300005719 Bacteria 4033
141 Ga0068861_100116466 3300005719 Bacteria 2149
142 Ga0068861_100127864 3300005719 Bacteria 2058
143 Ga0068861_100158172 3300005719 Bacteria 1866
144 Ga0068870_10033509 3300005840 Bacteria 2621
145 Ga0068863_100380823 3300005841 Bacteria 1377
146 Ga0068858_100042801 3300005842 Bacteria 4199
147 Ga0068858_100094287 3300005842 Bacteria 2788
148 Ga0068858_100191147 3300005842 Bacteria 1934
149 Ga0068860_100000467 3300005843 Bacteria 50515
150 Ga0068860_100012237 3300005843 Bacteria 8456
151 Ga0068862_100216380 3300005844 Bacteria 1733
152 Ga0081455_10000030 3300005937 Bacteria 148346
153 Ga0081455_10071377 3300005937 Bacteria 2879
154 Ga0081455_10195177 3300005937 Bacteria 1521
155 Ga0081455_10221912 3300005937 Bacteria 1400
156 Ga0081538_10000065 3300005981 Bacteria 98948
157 Ga0081540_1025012 3300005983 Bacteria 3450
158 Ga0081539_10033921 3300005985 Bacteria 3098
159 Ga0070717_10098364 3300006028 Bacteria 2480
160 Ga0070717_10375462 3300006028 Bacteria 1274
161 Ga0075365_10008147 3300006038 Bacteria 5923
162 Ga0075365_10024606 3300006038 Bacteria 3801
163 Ga0075365_10031885 3300006038 Bacteria 3384
164 Ga0075365_10043984 3300006038 Bacteria 2924
165 Ga0075365_10046940 3300006038 Bacteria 2838
166 Ga0075365_10071600 3300006038 Bacteria 2334
167 Ga0075365_10075681 3300006038 Bacteria 2272
168 Ga0075365_10096041 3300006038 Bacteria 2025
169 Ga0075365_10101048 3300006038 Bacteria 1974
170 Ga0075365_10112732 3300006038 Bacteria 1870
171 Ga0075365_10156839 3300006038 Bacteria 1584
172 Ga0075365_10159500 3300006038 Bacteria 1571
173 Ga0075365_10166502 3300006038 Bacteria 1538
174 Ga0075368_10000363 3300006042 Bacteria 13338
175 Ga0075368_10000952 3300006042 Bacteria 9008
176 Ga0075368_10017449 3300006042 Bacteria 2687
177 Ga0075368_10031645 3300006042 Bacteria 2052
178 Ga0075363_100000170 3300006048 Bacteria 16868
179 Ga0075363_100000416 3300006048 Bacteria 13204
180 Ga0075363_100001116 3300006048 Bacteria 9747
181 Ga0075363_100002522 3300006048 Bacteria 7508
182 Ga0075363_100020550 3300006048 Bacteria 3313
183 Ga0075363_100061961 3300006048 Bacteria 2017
184 Ga0075363_100063141 3300006048 Bacteria 1998
185 Ga0075363_100072134 3300006048 Bacteria 1877
186 Ga0075363_100079254 3300006048 Bacteria 1794
187 Ga0075364_10006272 3300006051 Bacteria 6978
188 Ga0075364_10008594 3300006051 Bacteria 6108
189 Ga0075364_10014601 3300006051 Bacteria 4855
190 Ga0075364_10042989 3300006051 Bacteria 2937
191 Ga0075364_10057116 3300006051 Bacteria 2556
192 Ga0075364_10062326 3300006051 Bacteria 2447
193 Ga0075364_10073802 3300006051 Bacteria 2249
194 Ga0075364_10086073 3300006051 Bacteria 2082
195 Ga0070715_10011892 3300006163 Bacteria 3148
196 Ga0070716_100192595 3300006173 Bacteria 1348
197 Ga0070712_100069159 3300006175 Bacteria 2518
198 Ga0070712_100111253 3300006175 Bacteria 2044
199 Ga0070712_100169574 3300006175 Bacteria 1692
200 Ga0070712_100500521 3300006175 Bacteria 1018
201 Ga0075362_10015327 3300006177 Bacteria 3115
202 Ga0075367_10000401 3300006178 Bacteria 15899
203 Ga0075367_10010955 3300006178 Bacteria 4778
204 Ga0075367_10018148 3300006178 Bacteria 3876
205 Ga0075367_10019136 3300006178 Bacteria 3792
206 Ga0075367_10053572 3300006178 Bacteria 2391
207 Ga0075367_10080839 3300006178 Bacteria 1966
208 Ga0075367_10090433 3300006178 Bacteria 1862
209 Ga0097621_100086442 3300006237 Bacteria 2617
210 Ga0097621_100167876 3300006237 Bacteria 1890
211 Ga0075370_10001511 3300006353 Bacteria 10168
212 Ga0075370_10001569 3300006353 Bacteria 10038
213 Ga0075370_10003287 3300006353 Bacteria 7669
214 Ga0075370_10032220 3300006353 Bacteria 2929
215 Ga0075370_10065800 3300006353 Bacteria 2067
216 Ga0075428_100016372 3300006844 Bacteria 8192
217 Ga0075428_100021526 3300006844 Bacteria 7137
218 Ga0075428_100800667 3300006844 Bacteria 1002
219 Ga0075430_100003986 3300006846 Bacteria 12447
220 Ga0075431_100022766 3300006847 Bacteria 6404
221 Ga0075431_100141258 3300006847 Bacteria 2482
222 Ga0075433_10088568 3300006852 Bacteria 2735
223 Ga0075429_100048371 3300006880 Bacteria 3698
224 Ga0068865_100019619 3300006881 Bacteria 4376
225 Ga0068865_100035311 3300006881 Bacteria 3360
226 Ga0068865_100217837 3300006881 Bacteria 1491
227 Ga0068865_100228041 3300006881 Bacteria 1460
228 Ga0097620_100205006 3300006931 Bacteria 2057
229 Ga0097620_100355027 3300006931 Bacteria 1561
230 Ga0097620_100612567 3300006931 Bacteria 1181
231 Ga0111539_10006328 3300009094 Bacteria 15264
232 Ga0111539_10012179 3300009094 Bacteria 10790
233 Ga0111539_10046610 3300009094 Bacteria 5184
234 Ga0111539_10048292 3300009094 Bacteria 5083
235 Ga0111539_10373232 3300009094 Bacteria 1660
236 Ga0111539_10460281 3300009094 Bacteria 1481
237 Ga0111539_10490536 3300009094 Bacteria 1431
238 Ga0105245_10001389 3300009098 Bacteria 21921
239 Ga0105245_10163601 3300009098 Bacteria 2113
240 Ga0105245_10187166 3300009098 Bacteria 1981
241 Ga0105245_10219360 3300009098 Bacteria 1834
242 Ga0105245_10465027 3300009098 Bacteria 1276
243 Ga0105245_10516366 3300009098 Bacteria 1212
244 Ga0114129_10010931 3300009147 Bacteria 12935
245 Ga0105243_10014099 3300009148 Bacteria 6047
246 Ga0105243_10016322 3300009148 Bacteria 5618
247 Ga0105243_10209072 3300009148 Bacteria 1717
248 Ga0105243_10224463 3300009148 Bacteria 1662
249 Ga0105242_10058334 3300009176 Bacteria 3164
250 Ga0105242_10235375 3300009176 Bacteria 1643
251 Ga0105242_10451169 3300009176 Bacteria 1212
252 Ga0105248_10031669 3300009177 Bacteria 5908
253 Ga0105248_10200240 3300009177 Bacteria 2250
254 Ga0105248_10279932 3300009177 Bacteria 1878
255 Ga0105237_10033781 3300009545 Bacteria 5182
256 Ga0105237_10393879 3300009545 Bacteria 1390
257 Ga0105238_10044672 3300009551 Bacteria 4478
258 Ga0105238_10268573 3300009551 Bacteria 1686
259 Ga0105238_10384194 3300009551 Bacteria 1396
260 Ga0105238_10392380 3300009551 Bacteria 1380
261 Ga0105238_10522303 3300009551 Bacteria 1190
262 Ga0105249_10004469 3300009553 Bacteria 12090
263 Ga0105249_10031845 3300009553 Bacteria 4771
264 Ga0105249_10198452 3300009553 Bacteria 1962
265 Ga0105249_10347224 3300009553 Bacteria 1502
266 Ga0105239_10003376 3300010375 Bacteria 19591
267 Ga0105239_10010898 3300010375 Bacteria 10156
268 Ga0105239_10097739 3300010375 Bacteria 3245
269 Ga0105239_10156809 3300010375 Bacteria 2542
270 Ga0105239_10503710 3300010375 Bacteria 1377
271 Ga0105246_10010063 3300011119 Bacteria 5836
272 Ga0105246_10090788 3300011119 Bacteria 2200
273 Ga0157346_1000863 3300012480 Bacteria 1360
274 Ga0157371_10089881 3300013102 Bacteria 2175
275 Ga0157370_10195463 3300013104 Bacteria 1877
276 Ga0157370_10441299 3300013104 Bacteria 1197
277 Ga0157369_10010908 3300013105 Bacteria 10347
278 Ga0157369_10040542 3300013105 Bacteria 5083
279 Ga0157369_10215533 3300013105 Bacteria 2011
280 Ga0157369_10338537 3300013105 Bacteria 1563
281 Ga0157369_10387946 3300013105 Bacteria 1449
282 Ga0157369_10838189 3300013105 Bacteria 944
283 Ga0163162_10002716 3300013306 Bacteria 16784
284 Ga0163162_10008332 3300013306 Bacteria 10112
285 Ga0163162_10163280 3300013306 Bacteria 2350
286 Ga0163162_10185897 3300013306 Bacteria 2205
287 Ga0157372_10000025 3300013307 Bacteria 195491
288 Ga0157372_10015861 3300013307 Bacteria 8082
289 Ga0157372_10022009 3300013307 Bacteria 6892
290 Ga0157372_10125591 3300013307 Bacteria 2950
291 Ga0157372_10403120 3300013307 Bacteria 1594
292 Ga0157372_10416507 3300013307 Bacteria 1566
293 Ga0157372_10697150 3300013307 Bacteria 1182
294 Ga0157375_10029705 3300013308 Bacteria 5144
295 Ga0157375_10058354 3300013308 Bacteria 3817
296 Ga0157375_10106735 3300013308 Bacteria 2892
297 Ga0157375_10243685 3300013308 Bacteria 1957
298 Ga0157375_10420163 3300013308 Bacteria 1503
299 Ga0157375_10534980 3300013308 Bacteria 1334
300 Ga0163163_10022365 3300014325 Bacteria 5985
301 Ga0163163_10067546 3300014325 Bacteria 3555
302 Ga0163163_10129195 3300014325 Bacteria 2566
303 Ga0163163_10151041 3300014325 Bacteria 2366
304 Ga0157380_10002258 3300014326 Bacteria 12956
305 Ga0157380_10010387 3300014326 Bacteria 6697
306 Ga0157380_10018962 3300014326 Bacteria 5119
307 Ga0157380_10173312 3300014326 Bacteria 1887
308 Ga0157380_10351377 3300014326 Bacteria 1380
309 Ga0182008_10092587 3300014497 Bacteria 1491
310 Ga0157377_10003131 3300014745 Bacteria 7447
311 Ga0157377_10024322 3300014745 Bacteria 3218
312 Ga0157377_10044772 3300014745 Bacteria 2469
313 Ga0157377_10048662 3300014745 Bacteria 2380
314 Ga0157377_10182038 3300014745 Bacteria 1322
315 Ga0157376_10263359 3300014969 Bacteria 1616
316 Ga0163161_10139886 3300017792 Bacteria 1832
317 Ga0163161_10178144 3300017792 Bacteria 1628
318 Ga0206354_10058287 3300020081 Bacteria 1028
319 Ga0206353_10418635 3300020082 Bacteria 1175
320 Ga0206353_10455544 3300020082 Bacteria 2500
321 Ga0206353_11704839 3300020082 Bacteria 2123
322 Ga0206353_11712015 3300020082 Bacteria 3838
323 Ga0207692_10012583 3300025898 Bacteria 3638
324 Ga0207692_10056314 3300025898 Bacteria 2016
325 Ga0207692_10156153 3300025898 Bacteria 1311
326 Ga0207642_10008017 3300025899 Bacteria 3600
327 Ga0207642_10050616 3300025899 Bacteria 1875
328 Ga0207688_10003017 3300025901 Bacteria 9171
329 Ga0207688_10004230 3300025901 Bacteria 7826
330 Ga0207688_10008819 3300025901 Bacteria 5488
331 Ga0207688_10015048 3300025901 Bacteria 4197
332 Ga0207688_10019250 3300025901 Bacteria 3717
333 Ga0207688_10025699 3300025901 Bacteria 3236
334 Ga0207688_10046663 3300025901 Bacteria 2419
335 Ga0207647_10002481 3300025904 Bacteria 13967
336 Ga0207647_10056181 3300025904 Bacteria 2416
337 Ga0207699_10044113 3300025906 Bacteria 2594
338 Ga0207699_10053763 3300025906 Bacteria 2389
339 Ga0207699_10199098 3300025906 Bacteria 1356
340 Ga0207645_10039887 3300025907 Bacteria 3008
341 Ga0207643_10002197 3300025908 Bacteria 10637
342 Ga0207643_10023134 3300025908 Bacteria 3426
343 Ga0207643_10037108 3300025908 Bacteria 2734
344 Ga0207643_10061829 3300025908 Bacteria 2139
345 Ga0207705_10038483 3300025909 Bacteria 3425
346 Ga0207684_10247373 3300025910 Bacteria 1538
347 Ga0207707_10160407 3300025912 Bacteria 1966
348 Ga0207671_10028511 3300025914 Bacteria 4171
349 Ga0207693_10127068 3300025915 Bacteria 2004
350 Ga0207693_10464635 3300025915 Bacteria 989
351 Ga0207663_10009729 3300025916 Bacteria 5089
352 Ga0207663_10035696 3300025916 Bacteria 2985
353 Ga0207663_10140756 3300025916 Bacteria 1680
354 Ga0207663_10259046 3300025916 Bacteria 1284
355 Ga0207660_10482565 3300025917 Bacteria 1005
356 Ga0207662_10009033 3300025918 Bacteria 5475
357 Ga0207662_10059818 3300025918 Bacteria 2284
358 Ga0207662_10182328 3300025918 Bacteria 1351
359 Ga0207657_10017941 3300025919 Bacteria 6772
360 Ga0207657_10030851 3300025919 Bacteria 4859
361 Ga0207649_10166865 3300025920 Bacteria 1530
362 Ga0207652_10036477 3300025921 Bacteria 4156
363 Ga0207694_10231719 3300025924 Bacteria 1508
364 Ga0207650_10001714 3300025925 Bacteria 15564
365 Ga0207650_10057978 3300025925 Bacteria 2882
366 Ga0207659_10065925 3300025926 Bacteria 2626
367 Ga0207659_10125442 3300025926 Bacteria 1973
368 Ga0207659_10174260 3300025926 Bacteria 1699
369 Ga0207687_10005324 3300025927 Bacteria 8521
370 Ga0207687_10009758 3300025927 Bacteria 6280
371 Ga0207687_10048229 3300025927 Bacteria 2956
372 Ga0207687_10283889 3300025927 Bacteria 1328
373 Ga0207700_10011354 3300025928 Bacteria 5673
374 Ga0207700_10022238 3300025928 Bacteria 4347
375 Ga0207700_10146230 3300025928 Bacteria 1948
376 Ga0207700_10192090 3300025928 Bacteria 1716
377 Ga0207700_10586713 3300025928 Bacteria 991
378 Ga0207664_10047751 3300025929 Bacteria 3364
379 Ga0207664_10122731 3300025929 Bacteria 2176
380 Ga0207664_10169166 3300025929 Bacteria 1869
381 Ga0207664_10181658 3300025929 Bacteria 1806
382 Ga0207664_10292201 3300025929 Bacteria 1432
383 Ga0207644_10027379 3300025931 Bacteria 3937
384 Ga0207644_10043005 3300025931 Bacteria 3204
385 Ga0207690_10023754 3300025932 Bacteria 3831
386 Ga0207690_10040833 3300025932 Bacteria 3036
387 Ga0207690_10069857 3300025932 Bacteria 2417
388 Ga0207690_10107677 3300025932 Bacteria 2002
389 Ga0207706_10017268 3300025933 Bacteria 6503
390 Ga0207706_10111560 3300025933 Bacteria 2406
391 Ga0207686_10057573 3300025934 Bacteria 2447
392 Ga0207709_10025235 3300025935 Bacteria 3402
393 Ga0207709_10065834 3300025935 Bacteria 2280
394 Ga0207709_10105337 3300025935 Bacteria 1874
395 Ga0207669_10011553 3300025937 Bacteria 4302
396 Ga0207669_10058131 3300025937 Bacteria 2358
397 Ga0207704_10007814 3300025938 Bacteria 5074
398 Ga0207704_10010985 3300025938 Bacteria 4441
399 Ga0207704_10029538 3300025938 Bacteria 3059
400 Ga0207704_10112401 3300025938 Bacteria 1845
401 Ga0207665_10071309 3300025939 Bacteria 2372
402 Ga0207691_10018659 3300025940 Bacteria 6571
403 Ga0207691_10019738 3300025940 Bacteria 6373
404 Ga0207691_10059202 3300025940 Bacteria 3483
405 Ga0207691_10062688 3300025940 Bacteria 3373
406 Ga0207711_10220691 3300025941 Bacteria 1734
407 Ga0207689_10079973 3300025942 Bacteria 2686
408 Ga0207689_10088140 3300025942 Bacteria 2549
409 Ga0207689_10101864 3300025942 Bacteria 2359
410 Ga0207689_10183994 3300025942 Bacteria 1723
411 Ga0207661_10007007 3300025944 Bacteria 7998
412 Ga0207661_10011604 3300025944 Bacteria 6392
413 Ga0207661_10013156 3300025944 Bacteria 6040
414 Ga0207661_10071722 3300025944 Bacteria 2832
415 Ga0207661_10103460 3300025944 Bacteria 2396
416 Ga0207661_10163734 3300025944 Bacteria 1931
417 Ga0207661_10215718 3300025944 Bacteria 1693
418 Ga0207661_10324600 3300025944 Bacteria 1384
419 Ga0207661_10385443 3300025944 Bacteria 1269
420 Ga0207661_10390562 3300025944 Bacteria 1261
421 Ga0207679_10015370 3300025945 Bacteria 5056
422 Ga0207679_10090932 3300025945 Bacteria 2361
423 Ga0207667_10085130 3300025949 Bacteria 3273
424 Ga0207712_10018068 3300025961 Bacteria 4587
425 Ga0207712_10214647 3300025961 Bacteria 1534
426 Ga0207668_10078002 3300025972 Bacteria 2391
427 Ga0207640_10120662 3300025981 Bacteria 1877
428 Ga0207677_10039878 3300026023 Bacteria 3091
429 Ga0207677_10099542 3300026023 Bacteria 2135
430 Ga0207677_10245429 3300026023 Bacteria 1451
431 Ga0207677_10273173 3300026023 Bacteria 1384
432 Ga0207677_10493475 3300026023 Bacteria 1057
433 Ga0207703_10081187 3300026035 Bacteria 2702
434 Ga0207703_10100639 3300026035 Bacteria 2449
435 Ga0207639_10089865 3300026041 Bacteria 2455
436 Ga0207678_10000105 3300026067 Bacteria 68804
437 Ga0207678_10041186 3300026067 Bacteria 4005
438 Ga0207678_10109934 3300026067 Bacteria 2351
439 Ga0207708_10000436 3300026075 Bacteria 32496
440 Ga0207708_10001046 3300026075 Bacteria 20715
441 Ga0207708_10004147 3300026075 Bacteria 10661
442 Ga0207708_10004999 3300026075 Bacteria 9768
443 Ga0207708_10057384 3300026075 Bacteria 2970
444 Ga0207702_10062949 3300026078 Bacteria 3170
445 Ga0207702_10068760 3300026078 Bacteria 3043
446 Ga0207702_10496611 3300026078 Bacteria 1189
447 Ga0207641_10055170 3300026088 Bacteria 3373
448 Ga0207641_10100877 3300026088 Bacteria 2543
449 Ga0207641_10371400 3300026088 Bacteria 1368
450 Ga0207648_10003947 3300026089 Bacteria 15429
451 Ga0207648_10004176 3300026089 Bacteria 14929
452 Ga0207648_10057841 3300026089 Bacteria 3382
453 Ga0207676_10002083 3300026095 Bacteria 14516
454 Ga0207676_10016306 3300026095 Bacteria 5380
455 Ga0207676_10503258 3300026095 Bacteria 1151
456 Ga0207674_10019540 3300026116 Bacteria 7337
457 Ga0207674_10042528 3300026116 Bacteria 4692
458 Ga0207674_10120916 3300026116 Bacteria 2586
459 Ga0207674_10135832 3300026116 Bacteria 2421
460 Ga0207674_10305772 3300026116 Bacteria 1539
461 Ga0207675_100004206 3300026118 Bacteria 13928
462 Ga0207675_100004892 3300026118 Bacteria 12913
463 Ga0207675_100082762 3300026118 Bacteria 3010
464 Ga0207675_100526758 3300026118 Bacteria 1179
465 Ga0207683_10021359 3300026121 Bacteria 5541
466 Ga0207683_10043229 3300026121 Bacteria 3937
467 Ga0207683_10053839 3300026121 Bacteria 3529
468 Ga0207683_10098365 3300026121 Bacteria 2610
469 Ga0207683_10308097 3300026121 Bacteria 1449
470 Ga0207698_10129947 3300026142 Bacteria 2150
471 Ga0207698_10176518 3300026142 Bacteria 1887
472 Ga0207698_10239967 3300026142 Bacteria 1651
473 Ga0209813_10003987 3300027866 Bacteria 3499
474 Ga0209813_10004119 3300027866 Bacteria 3451
475 Ga0209813_10007277 3300027866 Bacteria 2754
476 Ga0209813_10061192 3300027866 Bacteria 1202
477 Ga0207428_10030127 3300027907 Bacteria 4489
478 Ga0207428_10051545 3300027907 Bacteria 3289
479 Ga0207428_10335457 3300027907 Bacteria 1114
480 Ga0268266_10051556 3300028379 Bacteria 3532
481 Ga0268266_10111075 3300028379 Bacteria 2428
482 Ga0268266_10144612 3300028379 Bacteria 2136
483 Ga0268265_10179938 3300028380 Bacteria 1816
484 Ga0268264_10000242 3300028381 Bacteria 103492
485 Ga0268264_10001967 3300028381 Bacteria 18458
486 Ga0268264_10004760 3300028381 Bacteria 11523
487 Ga0268264_10039308 3300028381 Bacteria 3908
488 Ga0265340_10000537 3300031247 Bacteria 20931
489 Ga0307513_10015532 3300031456 Bacteria 9229
490 Ga0307513_10092563 3300031456 Bacteria 3077
491 Ga0307408_100407527 3300031548 Bacteria 1169
492 Ga0307408_100427210 3300031548 Bacteria 1144
493 Ga0316578_10001825 3300031728 Bacteria 8960
494 Ga0307405_10142180 3300031731 Bacteria 1675
495 Ga0307405_10245022 3300031731 Bacteria 1330
496 Ga0307405_10350770 3300031731 Bacteria 1138
497 Ga0307405_10360050 3300031731 Bacteria 1125
498 Ga0307413_10041923 3300031824 Bacteria 2685
499 Ga0307413_10057435 3300031824 Bacteria 2380
500 Ga0307413_10139104 3300031824 Bacteria 1675
501 Ga0307413_10149749 3300031824 Bacteria 1624
502 Ga0307413_10170290 3300031824 Bacteria 1541
503 Ga0307410_10006651 3300031852 Bacteria 6259
504 Ga0307410_10010750 3300031852 Bacteria 5204
505 Ga0307410_10018682 3300031852 Bacteria 4194
506 Ga0307410_10087383 3300031852 Bacteria 2205
507 Ga0307410_10116988 3300031852 Bacteria 1938
508 Ga0307410_10250395 3300031852 Bacteria 1377
509 Ga0307410_10342705 3300031852 Bacteria 1192
510 Ga0307410_10388316 3300031852 Bacteria 1125
511 Ga0307406_10031477 3300031901 Bacteria 3231
512 Ga0307406_10048409 3300031901 Bacteria 2685
513 Ga0307406_10084938 3300031901 Bacteria 2115
514 Ga0307406_10104163 3300031901 Bacteria 1939
515 Ga0307406_10145445 3300031901 Bacteria 1684
516 Ga0307406_10221153 3300031901 Bacteria 1407
517 Ga0307406_10288210 3300031901 Bacteria 1256
518 Ga0307407_10004673 3300031903 Bacteria 5847
519 Ga0307407_10010415 3300031903 Bacteria 4384
520 Ga0307407_10015197 3300031903 Bacteria 3795
521 Ga0307407_10016371 3300031903 Bacteria 3692
522 Ga0307407_10017500 3300031903 Bacteria 3598
523 Ga0307407_10062237 3300031903 Bacteria 2185
524 Ga0307407_10244465 3300031903 Bacteria 1226
525 Ga0307412_10345772 3300031911 Bacteria 1192
526 Ga0307412_10498430 3300031911 Bacteria 1013
527 Ga0307409_100009889 3300031995 Bacteria 5887
528 Ga0307409_100011357 3300031995 Bacteria 5608
529 Ga0307409_100016694 3300031995 Bacteria 4868
530 Ga0307409_100030018 3300031995 Bacteria 3900
531 Ga0307409_100034975 3300031995 Bacteria 3677
532 Ga0307409_100038144 3300031995 Bacteria 3550
533 Ga0307409_100046156 3300031995 Bacteria 3296
534 Ga0307409_100060483 3300031995 Bacteria 2954
535 Ga0307409_100063299 3300031995 Bacteria 2900
536 Ga0307409_100071625 3300031995 Bacteria 2757
537 Ga0307409_100097167 3300031995 Bacteria 2432
538 Ga0307409_100108515 3300031995 Bacteria 2322
539 Ga0307409_100128992 3300031995 Bacteria 2157
540 Ga0307409_100151443 3300031995 Bacteria 2014
541 Ga0307409_100215701 3300031995 Bacteria 1728
542 Ga0307409_100240713 3300031995 Bacteria 1647
543 Ga0307409_100254681 3300031995 Bacteria 1607
544 Ga0307409_100329291 3300031995 Bacteria 1433
545 Ga0307409_100437613 3300031995 Bacteria 1259
546 Ga0307409_100440840 3300031995 Bacteria 1254
547 Ga0307409_100492582 3300031995 Bacteria 1192
548 Ga0307416_100002883 3300032002 Bacteria 10017
549 Ga0307416_100002929 3300032002 Bacteria 9946
550 Ga0307416_100012921 3300032002 Bacteria 5651
551 Ga0307416_100048729 3300032002 Bacteria 3363
552 Ga0307416_100051207 3300032002 Bacteria 3297
553 Ga0307416_100065621 3300032002 Bacteria 2984
554 Ga0307416_100102938 3300032002 Bacteria 2491
555 Ga0307416_100186307 3300032002 Bacteria 1951
556 Ga0307416_100299986 3300032002 Bacteria 1596
557 Ga0307416_100395067 3300032002 Bacteria 1418
558 Ga0307411_10068352 3300032005 Bacteria 2394
559 Ga0307411_10076823 3300032005 Bacteria 2284
560 Ga0307411_10095665 3300032005 Bacteria 2086
561 Ga0307411_10221500 3300032005 Bacteria 1468
562 Ga0307415_100007652 3300032126 Bacteria 5927
563 Ga0307415_100009492 3300032126 Bacteria 5459
564 Ga0307415_100021802 3300032126 Bacteria 3945
565 Ga0307415_100026466 3300032126 Bacteria 3660
566 Ga0307415_100038392 3300032126 Bacteria 3155
567 Ga0307415_100089813 3300032126 Bacteria 2220
568 Ga0307415_100089941 3300032126 Bacteria 2219
569 Ga0307415_100107507 3300032126 Bacteria 2061
570 Ga0307415_100118290 3300032126 Bacteria 1981
571 Ga0307415_100283300 3300032126 Bacteria 1364
572 Ga0307415_100620128 3300032126 Bacteria 965
573 Ga0316583_10029656 3300032133 Bacteria 1950
574 Ga0373938_0031409 3300034957 Bacteria 1139
575 Ga0373926_0027830 3300035083 Bacteria 1982
576 Ga0373934_0002754 3300035086 Bacteria 6447
577 Ga0373944_0011334 3300035089 Bacteria 2441
578 Ga0373923_0023500 3300035111 Bacteria 2425
579 Ga0373923_0055474 3300035111 Bacteria 1670
580 Ga0373936_0026431 3300035113 Bacteria 2272
581 Ga0373936_0055578 3300035113 Bacteria 1607
582 Ga0373945_0039542 3300035116 Bacteria 1700
583 Ga0373953_0000821 3300035117 Bacteria 8685
584 Ga0373954_0001563 3300035118 Bacteria 9326
585 Ga0373956_0003221 3300035119 Bacteria 6590
586 Ga0373957_0001428 3300035120 Bacteria 6465
587 Ga0373943_0048468 3300035170 Bacteria 2081
588 Ga0373946_0013175 3300035171 Bacteria 3103
589 Ga0373955_0082888 3300035172 Bacteria 1815
590 Ga0373955_0108511 3300035172 Bacteria 1602
591 Ga0316574_0007917 3300035398 Bacteria 5865
592 Ga0373924_0016500 3300035410 Bacteria 2819
593 Ga0373927_0040940 3300035695 Bacteria 3005
594 Ga0373933_0005000 3300035724 Bacteria 7231
595 Ga0373947_0023550 3300035725 Bacteria 3583
596 Ga0373947_0056553 3300035725 Bacteria 2371
597 Ga0373937_0010654 3300036401 Bacteria 8037
598 Ga0373937_0208215 3300036401 Bacteria 1839
599 Ga0316584_0003766 3300036712 Bacteria 9935
600 Ga0373925_0031453 3300037068 Bacteria 3900
601 Ga0373925_0093661 3300037068 Bacteria 2299
602 Ga0395900_0026320 3300037418 Bacteria 5957
603 Ga0395900_0058762 3300037418 Bacteria 3959
604 Ga0395898_0169591 3300037466 Bacteria 2086
605 Ga0395905_0054291 3300037471 Bacteria 3750
606 Ga0395905_0190772 3300037471 Bacteria 1922
607 Ga0436364_0849504 3300037853 Bacteria 2397
608 Ga0436364_1495084 3300037853 Bacteria 3514
609 Ga0395901_0011948 3300038443 Bacteria 8806
610 Ga0395901_0139889 3300038443 Bacteria 2544
611 Ga0395901_0148039 3300038443 Bacteria 2467
612 Ga0395901_0213971 3300038443 Bacteria 2016
613 Ga0400483_021589 3300039062 Bacteria 5824
614 Ga0400483_095912 3300039062 Bacteria 3768
615 Ga0400483_209527 3300039062 Bacteria 2526
616 Ga0436365_1063556 3300039437 Bacteria 1138
617 Ga0436365_1544034 3300039437 Bacteria 1161
618 Ga0451843_0051158 3300041509 Bacteria 1602
619 Ga0439459_0030276 3300042438 Bacteria 1097
620 Ga0466972_0176165 3300044658 Bacteria 1003
621 Ga0466965_0000459 3300044683 Bacteria 14372
622 Ga0466965_0004751 3300044683 Bacteria 6056
623 Ga0466965_0012067 3300044683 Bacteria 4057
624 Ga0466965_0025243 3300044683 Bacteria 2877
625 Ga0466965_0048241 3300044683 Bacteria 2110
626 Ga0466965_0069717 3300044683 Bacteria 1767
627 Ga0466965_0093393 3300044683 Bacteria 1532
628 Ga0466961_0035163 3300044693 Bacteria 3217
629 Ga0466961_0109053 3300044693 Bacteria 1742
630 Ga0466963_0038739 3300044694 Bacteria 3119
631 Ga0466963_0069680 3300044694 Bacteria 2364
632 Ga0466964_0031608 3300044706 Bacteria 2100
633 Ga0466964_0048533 3300044706 Bacteria 1736
634 Ga0466964_0054265 3300044706 Bacteria 1652
635 Ga0466970_0012324 3300044765 Bacteria 4369
636 Ga0466970_0015359 3300044765 Bacteria 3936
637 Ga0466970_0018226 3300044765 Bacteria 3632
638 Ga0466970_0033313 3300044765 Bacteria 2723
639 Ga0466970_0098294 3300044765 Bacteria 1593
640 Ga0466957_0001115 3300044842 Bacteria 13906
641 Ga0466957_0084176 3300044842 Bacteria 1985
642 Ga0466957_0096568 3300044842 Bacteria 1857
643 Ga0466960_0000350 3300044901 Bacteria 15766
644 Ga0466960_0006974 3300044901 Bacteria 4563
645 Ga0466960_0008191 3300044901 Bacteria 4272
646 Ga0466960_0016237 3300044901 Bacteria 3225
647 Ga0466960_0023651 3300044901 Bacteria 2761
648 Ga0466960_0047414 3300044901 Bacteria 2061
649 Ga0466960_0054466 3300044901 Bacteria 1942
650 Ga0466960_0098125 3300044901 Bacteria 1504
651 Ga0451576_0414424 3300045051 Bacteria 1413
652 Ga0466958_0042983 3300045836 Bacteria 2721
653 Ga0466958_0094123 3300045836 Bacteria 1856
654 Ga0466967_0003975 3300045976 Bacteria 9844
655 Ga0466967_0065708 3300045976 Bacteria 3229
656 Ga0466967_0073531 3300045976 Bacteria 3067
657 Ga0466967_0095098 3300045976 Bacteria 2715
658 Ga0466967_0119523 3300045976 Bacteria 2432
659 Ga0466967_0143725 3300045976 Bacteria 2224
660 Ga0466967_0153107 3300045976 Bacteria 2157
661 Ga0466967_0159795 3300045976 Bacteria 2114
662 Ga0466967_0170963 3300045976 Bacteria 2044
663 Ga0466967_0183525 3300045976 Bacteria 1974
664 Ga0466967_0244570 3300045976 Bacteria 1712
665 Ga0466967_0252036 3300045976 Bacteria 1686
666 Ga0466967_0495608 3300045976 Bacteria 1198
667 Ga0495592_0000397 3300046454 Bacteria 33962
668 Ga0495592_0008095 3300046454 Bacteria 7893
669 Ga0495603_0095528 3300046455 Bacteria 1737
670 Ga0495629_0107549 3300046459 Bacteria 1945
671 Ga0495629_0161015 3300046459 Bacteria 1559
672 Ga0495641_0051291 3300046461 Bacteria 1884
673 Ga0495641_0057979 3300046461 Bacteria 1753
674 Ga0495641_0080767 3300046461 Bacteria 1457
675 Ga0495651_0126575 3300046462 Bacteria 1870
676 Ga0495651_0126576 3300046462 Bacteria 1870
677 Ga0495653_0120545 3300046463 Bacteria 1870
678 Ga0495653_0165079 3300046463 Bacteria 1534
679 Ga0495582_0079567 3300046473 Bacteria 1819
680 Ga0495664_0007931 3300046477 Bacteria 5911
681 Ga0495664_0087709 3300046477 Bacteria 1869
682 Ga0495608_0089230 3300046511 Bacteria 1995
683 Ga0495608_0089231 3300046511 Bacteria 1995
684 Ga0495608_0105594 3300046511 Bacteria 1813
685 Ga0495618_0009751 3300046514 Bacteria 5802
686 Ga0495628_0005043 3300046516 Bacteria 11605
687 Ga0495628_0122322 3300046516 Bacteria 1995
688 Ga0495630_0055169 3300046517 Bacteria 2977
689 Ga0495630_0152328 3300046517 Bacteria 1759
690 Ga0495652_0002110 3300046529 Bacteria 20949
691 Ga0495652_0049416 3300046529 Bacteria 3601
692 Ga0495652_0108948 3300046529 Bacteria 2231
693 Ga0495665_0093433 3300046531 Bacteria 1580
694 Ga0495640_0067173 3300046533 Bacteria 2415
695 Ga0495586_0015106 3300046535 Bacteria 4108
696 Ga0495587_0029133 3300046536 Bacteria 3353
697 Ga0495587_0099998 3300046536 Bacteria 1671
698 Ga0495645_0003234 3300046543 Bacteria 11048
699 Ga0495645_0010242 3300046543 Bacteria 6569
700 Ga0495667_0011880 3300046559 Bacteria 5898
701 Ga0495667_0114499 3300046559 Bacteria 1742
702 Ga0495634_0021736 3300046642 Bacteria 4529
703 Ga0495635_0074934 3300046663 Bacteria 2318
704 Ga0495635_0111827 3300046663 Bacteria 1865
705 Ga0495657_0192128 3300046675 Bacteria 1247
706 Ga0495599_0017017 3300046678 Bacteria 4516
707 Ga0495599_0084661 3300046678 Bacteria 1980
708 Ga0495623_0019997 3300046679 Bacteria 4328
709 Ga0495623_0100901 3300046679 Bacteria 1758
710 Ga0495646_0002659 3300046680 Bacteria 11047
711 Ga0495646_0004480 3300046680 Bacteria 8799
712 Ga0495658_0086658 3300046683 Bacteria 1848
713 Ga0495613_0039703 3300046689 Bacteria 3489
714 Ga0495624_0137472 3300046690 Bacteria 1497
715 Ga0495600_0009608 3300046809 Bacteria 5979
716 Ga0495600_0056669 3300046809 Bacteria 2560
717 Ga0495604_0004132 3300047317 Bacteria 11524
718 Ga0495604_0042757 3300047317 Bacteria 3549
719 Ga0495674_0088829 3300047319 Bacteria 2642
720 Ga0495676_0085788 3300047321 Bacteria 2371
721 Ga0495676_0124145 3300047321 Bacteria 1873
722 Ga0495680_0001602 3300047322 Bacteria 24122
723 Ga0495680_0096739 3300047322 Bacteria 2204
724 Ga0495680_0120073 3300047322 Bacteria 1941
725 Ga0495675_0034575 3300047444 Bacteria 3226
726 Ga0495675_0225124 3300047444 Bacteria 1133
727 Ga0495684_0000603 3300047471 Bacteria 28888
728 Ga0495684_0138994 3300047471 Bacteria 1821
729 Ga0495602_0017251 3300048088 Bacteria 7239
730 Ga0495602_0018432 3300048088 Bacteria 6970
731 Ga0496100_0003839 3300048903 Bacteria 7879
732 Ga0496100_0032129 3300048903 Bacteria 3269
733 Ga0496100_0252908 3300048903 Bacteria 1304
734 Ga0496101_0013820 3300048904 Bacteria 5419
735 Ga0496101_0134755 3300048904 Bacteria 1878
736 Ga0496102_0002619 3300048905 Bacteria 15298
737 Ga0496102_0008782 3300048905 Bacteria 8665
738 Ga0496102_0013364 3300048905 Bacteria 7111
739 Ga0496102_0015121 3300048905 Bacteria 6719
740 Ga0496102_0033772 3300048905 Bacteria 4600
741 Ga0496102_0051165 3300048905 Bacteria 3763
742 Ga0496102_0079766 3300048905 Bacteria 3014
743 Ga0496102_0136298 3300048905 Bacteria 2300
744 Ga0496102_0154518 3300048905 Bacteria 2157
745 Ga0496102_0177590 3300048905 Bacteria 2005
746 Ga0496102_0601730 3300048905 Bacteria 1022
747 Ga0496103_0009545 3300048906 Bacteria 5745
748 Ga0496103_0018415 3300048906 Bacteria 4189
749 Ga0496103_0048923 3300048906 Bacteria 2613
750 Ga0496103_0085930 3300048906 Bacteria 1982
751 Ga0496103_0160825 3300048906 Bacteria 1440
752 Ga0496103_0246457 3300048906 Bacteria 1150
753 Ga0496104_0030323 3300048907 Bacteria 5024
754 Ga0496104_0072786 3300048907 Bacteria 3268
755 Ga0496104_0103668 3300048907 Bacteria 2725
756 Ga0496104_0222010 3300048907 Bacteria 1802
757 Ga0496104_0234198 3300048907 Bacteria 1748
758 Ga0496104_0260922 3300048907 Bacteria 1645
759 Ga0496105_0004639 3300048908 Bacteria 10358
760 Ga0496105_0010601 3300048908 Bacteria 7251
761 Ga0496105_0013044 3300048908 Bacteria 6586
762 Ga0496105_0046910 3300048908 Bacteria 3566
763 Ga0496105_0071322 3300048908 Bacteria 2871
764 Ga0496105_0112375 3300048908 Bacteria 2248
765 Ga0496105_0134554 3300048908 Bacteria 2037
766 Ga0496105_0151400 3300048908 Bacteria 1906
767 Ga0496105_0163927 3300048908 Bacteria 1824
768 Ga0496105_0233606 3300048908 Bacteria 1494
769 Ga0496105_0465742 3300048908 Bacteria 996
770 Ga0496106_0055833 3300048909 Bacteria 2985
771 Ga0496107_0028957 3300048910 Bacteria 3938
772 Ga0496107_0038148 3300048910 Bacteria 3447
773 Ga0496107_0071877 3300048910 Bacteria 2514
774 Ga0496107_0130879 3300048910 Bacteria 1852
775 Ga0496107_0144379 3300048910 Bacteria 1759
776 Ga0496107_0264463 3300048910 Bacteria 1280
777 Ga0496107_0317528 3300048910 Bacteria 1159
778 Ga0496107_0438783 3300048910 Bacteria 970
779 Ga0496107_0487344 3300048910 Bacteria 915
780 Ga0496108_0008499 3300048911 Bacteria 8329
781 Ga0496108_0019824 3300048911 Bacteria 5526
782 Ga0496108_0055934 3300048911 Bacteria 3314
783 Ga0496108_0057158 3300048911 Bacteria 3278
784 Ga0496108_0170747 3300048911 Bacteria 1881
785 Ga0496108_0251142 3300048911 Bacteria 1539
786 Ga0496108_0279324 3300048911 Bacteria 1454
787 Ga0496108_0327330 3300048911 Bacteria 1336
788 Ga0496109_0014295 3300048912 Bacteria 6907
789 Ga0496109_0015913 3300048912 Bacteria 6569
790 Ga0496109_0058785 3300048912 Bacteria 3512
791 Ga0496109_0061158 3300048912 Bacteria 3442
792 Ga0496109_0088079 3300048912 Bacteria 2868
793 Ga0496109_0095372 3300048912 Bacteria 2754
794 Ga0496109_0195072 3300048912 Bacteria 1903
795 Ga0496109_0195396 3300048912 Bacteria 1901
796 Ga0496109_0214230 3300048912 Bacteria 1811
797 Ga0496109_0224563 3300048912 Bacteria 1767
798 Ga0496109_0242584 3300048912 Bacteria 1696
799 Ga0496109_0550688 3300048912 Bacteria 1088
800 Ga0496109_0583580 3300048912 Bacteria 1053
801 Ga0496110_0006612 3300048913 Bacteria 9209
802 Ga0496110_0012958 3300048913 Bacteria 6875
803 Ga0496110_0022918 3300048913 Bacteria 5306
804 Ga0496110_0079099 3300048913 Bacteria 2927
805 Ga0496110_0082241 3300048913 Bacteria 2872
806 Ga0496110_0083440 3300048913 Bacteria 2851
807 Ga0496110_0088856 3300048913 Bacteria 2760
808 Ga0496110_0138698 3300048913 Bacteria 2198
809 Ga0496110_0296797 3300048913 Bacteria 1472
810 Ga0496110_0310798 3300048913 Bacteria 1435
811 Ga0496110_0369646 3300048913 Bacteria 1307
812 Ga0496111_0000863 3300048914 Bacteria 16436
813 Ga0496111_0012659 3300048914 Bacteria 5717
814 Ga0496112_0154324 3300048915 Bacteria 2263
815 Ga0496112_0206213 3300048915 Bacteria 1924
816 Ga0496112_0639119 3300048915 Bacteria 994
817 Ga0496113_0036543 3300048916 Bacteria 3599
818 Ga0496113_0038091 3300048916 Bacteria 3533
819 Ga0496113_0358369 3300048916 Bacteria 1170
820 Ga0496114_0002152 3300048917 Bacteria 14991
821 Ga0496114_0003522 3300048917 Bacteria 12014
822 Ga0496114_0005765 3300048917 Bacteria 9725
823 Ga0496114_0008014 3300048917 Bacteria 8359
824 Ga0496114_0033141 3300048917 Bacteria 4255
825 Ga0496114_0074275 3300048917 Bacteria 2862
826 Ga0496114_0090983 3300048917 Bacteria 2590
827 Ga0496114_0107067 3300048917 Bacteria 2392
828 Ga0496114_0160447 3300048917 Bacteria 1954
829 Ga0496114_0216338 3300048917 Bacteria 1681
830 Ga0496114_0303922 3300048917 Bacteria 1408
831 Ga0496114_0353064 3300048917 Bacteria 1301
832 Ga0496114_0463582 3300048917 Bacteria 1121
833 Ga0496115_0029443 3300048918 Bacteria 4312
834 Ga0496115_0091212 3300048918 Bacteria 2490
835 Ga0496118_0173804 3300048921 Bacteria 1312
836 Ga0496119_0014608 3300048922 Bacteria 6124
837 Ga0496120_0006161 3300048923 Bacteria 9285
838 Ga0496121_0035843 3300048924 Bacteria 4434
839 Ga0496121_0169453 3300048924 Bacteria 1588
840 Ga0496123_0078694 3300048926 Bacteria 2018
841 Ga0496124_0228974 3300048927 Bacteria 1391
842 Ga0496126_0000039 3300048929 Bacteria 347353
843 Ga0501309_002015 3300049129 Bacteria 2123
844 Ga0501291_020713 3300049514 Bacteria 1043
845 Ga0501298_023437 3300049521 Bacteria 1170
846 Ga0501031_0001569 3300049568 Bacteria 14236
847 Ga0501031_0019479 3300049568 Bacteria 4421
848 Ga0501031_0056192 3300049568 Bacteria 2564
849 Ga0501031_0060482 3300049568 Bacteria 2468
850 Ga0501031_0091406 3300049568 Bacteria 1985
851 Ga0501031_0104827 3300049568 Bacteria 1845
852 Ga0501032_0059829 3300049569 Bacteria 2556
853 Ga0501032_0066357 3300049569 Bacteria 2411
854 Ga0501032_0077745 3300049569 Bacteria 2209
855 Ga0501033_0003386 3300049570 Bacteria 13153
856 Ga0501034_0051347 3300049571 Bacteria 4158
857 Ga0501034_0054748 3300049571 Bacteria 4016
858 Ga0501034_0064361 3300049571 Bacteria 3681
859 Ga0501036_0001694 3300049572 Bacteria 17122
860 Ga0501036_0006122 3300049572 Bacteria 9765
861 Ga0501036_0017266 3300049572 Bacteria 6031
862 Ga0501036_0033743 3300049572 Bacteria 4328
863 Ga0501036_0072369 3300049572 Bacteria 2914
864 Ga0501036_0121489 3300049572 Bacteria 2206
865 Ga0501036_0207628 3300049572 Bacteria 1646
866 Ga0501037_0023454 3300049573 Bacteria 4562
867 Ga0501037_0087179 3300049573 Bacteria 2259
868 Ga0501037_0091380 3300049573 Bacteria 2201
869 Ga0501037_0105898 3300049573 Bacteria 2027
870 Ga0501037_0114203 3300049573 Bacteria 1944
871 Ga0501038_0004008 3300049574 Bacteria 13683
872 Ga0501038_0013769 3300049574 Bacteria 7371
873 Ga0501039_0007037 3300049575 Bacteria 8560
874 Ga0501040_0001709 3300049576 Bacteria 14063
875 Ga0501040_0011354 3300049576 Bacteria 5830
876 Ga0501040_0054839 3300049576 Bacteria 2733
877 Ga0501040_0232480 3300049576 Bacteria 1313
878 Ga0501040_0357141 3300049576 Bacteria 1047
879 Ga0501041_0021998 3300049577 Bacteria 3818
880 Ga0501041_0069015 3300049577 Bacteria 2167
881 Ga0501041_0140093 3300049577 Bacteria 1508
882 Ga0501042_0003027 3300049578 Bacteria 10455
883 Ga0501042_0006792 3300049578 Bacteria 7460
884 Ga0501042_0046751 3300049578 Bacteria 3085
885 Ga0501043_0134861 3300049579 Bacteria 1934
886 Ga0501046_0010342 3300049580 Bacteria 8021
887 Ga0501046_0057893 3300049580 Bacteria 3039
888 Ga0501046_0073585 3300049580 Bacteria 2651
889 Ga0501047_0033893 3300049581 Bacteria 4928
890 Ga0501048_0007035 3300049582 Bacteria 8544
891 Ga0501048_0040541 3300049582 Bacteria 3336
892 Ga0501067_0004112 3300049583 Bacteria 8022
893 Ga0501067_0009441 3300049583 Bacteria 5406
894 Ga0501067_0060698 3300049583 Bacteria 2093
895 Ga0501067_0104913 3300049583 Bacteria 1570
896 Ga0501067_0166254 3300049583 Bacteria 1228
897 Ga0501068_0056147 3300049584 Bacteria 2387
898 Ga0501068_0130005 3300049584 Bacteria 1574
899 Ga0501069_0004130 3300049585 Bacteria 7498
900 Ga0501069_0007837 3300049585 Bacteria 5607
901 Ga0501069_0009384 3300049585 Bacteria 5165
902 Ga0501069_0017089 3300049585 Bacteria 3901
903 Ga0501069_0035271 3300049585 Bacteria 2755
904 Ga0501069_0095019 3300049585 Bacteria 1688
905 Ga0501069_0137160 3300049585 Bacteria 1402
906 Ga0501070_0003855 3300049586 Bacteria 12939
907 Ga0501070_0004279 3300049586 Bacteria 12279
908 Ga0501070_0021270 3300049586 Bacteria 5444
909 Ga0501070_0032937 3300049586 Bacteria 4335
910 Ga0501070_0035442 3300049586 Bacteria 4169
911 Ga0501070_0042917 3300049586 Bacteria 3765
912 Ga0501070_0097933 3300049586 Bacteria 2426
913 Ga0501070_0222332 3300049586 Bacteria 1548
914 Ga0501070_0442156 3300049586 Bacteria 1049
915 Ga0501071_0005666 3300049587 Bacteria 8054
916 Ga0501071_0005962 3300049587 Bacteria 7890
917 Ga0501071_0053300 3300049587 Bacteria 2917
918 Ga0501071_0222462 3300049587 Bacteria 1421
919 Ga0501072_0006084 3300049588 Bacteria 9211
920 Ga0501072_0009890 3300049588 Bacteria 7253
921 Ga0501072_0035834 3300049588 Bacteria 3888
922 Ga0501072_0052339 3300049588 Bacteria 3215
923 Ga0501072_0054608 3300049588 Bacteria 3147
924 Ga0501072_0070974 3300049588 Bacteria 2751
925 Ga0501072_0082701 3300049588 Bacteria 2545
926 Ga0501072_0111824 3300049588 Bacteria 2174
927 Ga0501073_0004693 3300049589 Bacteria 10261
928 Ga0501073_0019457 3300049589 Bacteria 4901
929 Ga0501073_0056459 3300049589 Bacteria 2746
930 Ga0501073_0063282 3300049589 Bacteria 2581
931 Ga0501073_0251170 3300049589 Bacteria 1221
932 Ga0501073_0454919 3300049589 Bacteria 885
933 Ga0501074_0007589 3300049590 Bacteria 7849
934 Ga0501074_0008026 3300049590 Bacteria 7644
935 Ga0501074_0016168 3300049590 Bacteria 5422
936 Ga0501074_0035660 3300049590 Bacteria 3604
937 Ga0501074_0049798 3300049590 Bacteria 3024
938 Ga0501074_0093115 3300049590 Bacteria 2158
939 Ga0501074_0106098 3300049590 Bacteria 2011
940 Ga0501074_0108479 3300049590 Bacteria 1987
941 Ga0501075_0009610 3300049591 Bacteria 6769
942 Ga0501075_0067091 3300049591 Bacteria 2709
943 Ga0501075_0138846 3300049591 Bacteria 1851
944 Ga0501076_0011478 3300049592 Bacteria 6600
945 Ga0501076_0049489 3300049592 Bacteria 3324
946 Ga0501076_0086503 3300049592 Bacteria 2519
947 Ga0501076_0086562 3300049592 Bacteria 2519
948 Ga0501077_0007878 3300049593 Bacteria 6579
949 Ga0501077_0009576 3300049593 Bacteria 6023
950 Ga0501077_0011162 3300049593 Bacteria 5604
951 Ga0501077_0022311 3300049593 Bacteria 4009
952 Ga0501079_0058312 3300049741 Bacteria 2979
953 Ga0501079_0079143 3300049741 Bacteria 2542
954 Ga0501079_0093028 3300049741 Bacteria 2336
955 Ga0501080_0000857 3300049742 Bacteria 24883
956 Ga0501080_0013574 3300049742 Bacteria 7500
957 Ga0501080_0029465 3300049742 Bacteria 5110
958 Ga0501080_0039249 3300049742 Bacteria 4419
959 Ga0501080_0157491 3300049742 Bacteria 2098
960 Ga0501080_0292281 3300049742 Bacteria 1479
961 Ga0501081_0017918 3300049743 Bacteria 4697
962 Ga0501081_0329002 3300049743 Bacteria 1124
963 Ga0501083_0020109 3300049744 Bacteria 4645
964 Ga0501083_0112653 3300049744 Bacteria 1788
965 Ga0501035_0021194 3300049822 Bacteria 5973
966 Ga0501035_0032558 3300049822 Bacteria 4742
967 Ga0501044_0040033 3300049823 Bacteria 4886
968 Ga0501045_0002747 3300049824 Bacteria 12022
969 Ga0501045_0019867 3300049824 Bacteria 4795
970 Ga0501045_0070494 3300049824 Bacteria 2572
971 Ga0501045_0074104 3300049824 Bacteria 2507
972 Ga0501045_0114517 3300049824 Bacteria 2000
973 Ga0501045_0134072 3300049824 Bacteria 1841
974 Ga0501045_0380013 3300049824 Bacteria 1051
975 nmdc:mga03683_108033_c1 3300050489 Bacteria 1228
976 nmdc:mga03n38_131271_c1 3300050490 Bacteria 1242
977 nmdc:mga03n38_15364_c1 3300050490 Bacteria 2955
978 nmdc:mga03n38_1536_c1 3300050490 Bacteria 6688
979 nmdc:mga03n38_16936_c1 3300050490 Bacteria 2845
980 nmdc:mga03n38_31013_c1 3300050490 Bacteria 2252
981 nmdc:mga03n38_51853_c1 3300050490 Bacteria 1834
982 nmdc:mga03n38_87017_c1 3300050490 Bacteria 1480
983 nmdc:mga03n38_92194_c1 3300050490 Bacteria 1445
984 nmdc:mga03n38_92387_c1 3300050490 Bacteria 1443
985 nmdc:mga03n38_9497_c1 3300050490 Bacteria 3543
986 nmdc:mga00v17_101428_c1 3300050491 Bacteria 1817
987 nmdc:mga00v17_12728_c1 3300050491 Bacteria 4647
988 nmdc:mga00v17_13995_c1 3300050491 Bacteria 4468
989 nmdc:mga00v17_167026_c1 3300050491 Bacteria 1418
990 nmdc:mga00v17_18892_c1 3300050491 Bacteria 3924
991 nmdc:mga00v17_199295_c1 3300050491 Bacteria 1294
992 nmdc:mga00v17_22363_c1 3300050491 Bacteria 3648
993 nmdc:mga00v17_30291_c1 3300050491 Bacteria 3183
994 nmdc:mga00v17_32669_c1 3300050491 Bacteria 3078
995 nmdc:mga00v17_49842_c1 3300050491 Bacteria 2542
996 nmdc:mga00v17_89878_c1 3300050491 Bacteria 1927
997 nmdc:mga0yw44_100306_c1 3300050492 Bacteria 1843
998 nmdc:mga0yw44_105970_c1 3300050492 Bacteria 1796
999 nmdc:mga0yw44_119425_c1 3300050492 Bacteria 1697
1000 nmdc:mga0yw44_146689_c1 3300050492 Bacteria 1537
1001 nmdc:mga0yw44_18098_c1 3300050492 Bacteria 3852
1002 nmdc:mga0yw44_18114_c1 3300050492 Bacteria 3850
1003 nmdc:mga0yw44_36814_c1 3300050492 Bacteria 2886
1004 nmdc:mga0yw44_38807_c1 3300050492 Bacteria 2820
1005 nmdc:mga0yw44_51998_c1 3300050492 Bacteria 2483
1006 nmdc:mga0yw44_56569_c1 3300050492 Bacteria 2390
1007 nmdc:mga0yw44_7733_c1 3300050492 Bacteria 5309
1008 nmdc:mga0yw44_98052_c1 3300050492 Bacteria 1863
1009 nmdc:mga06z11_26368_c1 3300050494 Bacteria 2765
1010 nmdc:mga06z11_56530_c1 3300050494 Bacteria 2030
1011 nmdc:mga06z11_69554_c1 3300050494 Bacteria 1859
1012 nmdc:mga06z11_8413_c1 3300050494 Bacteria 4301
1013 nmdc:mga04h51_102509_c1 3300050495 Bacteria 1045
1014 nmdc:mga04h51_23893_c1 3300050495 Bacteria 1866
1015 nmdc:mga07m45_101514_c1 3300050496 Bacteria 1652
1016 nmdc:mga07m45_2647_c1 3300050496 Bacteria 8434
1017 nmdc:mga07m45_44396_c1 3300050496 Bacteria 2495
1018 nmdc:mga07m45_80186_c1 3300050496 Bacteria 1864
1019 nmdc:mga07m45_9130_c1 3300050496 Bacteria 5123
1020 nmdc:mga07m45_97695_c1 3300050496 Bacteria 1685
1021 nmdc:mga05p37_147426_c1 3300050507 Bacteria 2880
1022 nmdc:mga09592_291569_c1 3300050508 Bacteria 1415
1023 nmdc:mga06r32_15209_c1 3300050510 Bacteria 6991
1024 nmdc:mga06r32_191537_c1 3300050510 Bacteria 2032
1025 nmdc:mga08y16_101083_c1 3300050511 Bacteria 3002
1026 nmdc:mga08y16_201480_c1 3300050511 Bacteria 2063
1027 nmdc:mga08y16_426063_c1 3300050511 Bacteria 1356
1028 nmdc:mga08y16_4414_c1 3300050511 Bacteria 14702
1029 nmdc:mga08y16_62979_c1 3300050511 Bacteria 3874
1030 nmdc:mga08y16_692626_c1 3300050511 Bacteria 1020
1031 nmdc:mga0rr50_403682_c1 3300050513 Bacteria 1155
1032 nmdc:mga0a205_124922_c1 3300050515 Bacteria 2473
1033 Ga0495601_0209487 3300053077 Bacteria 1273
1034 Ga0495612_0013400 3300053078 Bacteria 3302
1035 Ga0495595_0123021 3300053084 Bacteria 1264
1036 Ga0495619_0023815 3300053085 Bacteria 3924
1037 Ga0495619_0340286 3300053085 Bacteria 1038
1038 Ga0500643_000239 3300053087 Bacteria 51005
1039 Ga0500644_0000050 3300053088 Bacteria 71907
1040 Ga0500644_0000104 3300053088 Bacteria 53398
1041 Ga0500644_0081935 3300053088 Bacteria 1188
1042 Ga0500554_008044 3300053102 Bacteria 2458
1043 Ga0500554_078163 3300053102 Bacteria 1086
1044 Ga0500556_0001058 3300053104 Bacteria 14153
1045 Ga0500593_000179 3300053117 Bacteria 25713
1046 Ga0500573_0018977 3300053140 Bacteria 3931
1047 Ga0500616_0000060 3300053153 Bacteria 252252
1048 Ga0500616_0000792 3300053153 Bacteria 36236
1049 Ga0501084_0021438 3300054114 Bacteria 5384
1050 Ga0501084_0158009 3300054114 Bacteria 1912
1051 Ga0501084_0331367 3300054114 Bacteria 1285
1052 Ga0501084_0350322 3300054114 Bacteria 1248
1053 Ga0587073_0015132 3300059492 Bacteria 1385
1054 Ga0587111_0020289 3300060346 Bacteria 1270
1055 Ga0501082_0019122 3300060353 Bacteria 5902
1056 Ga0501082_0046676 3300060353 Bacteria 3733
1057 Ga0501082_0083012 3300060353 Bacteria 2764
1058 Ga0501082_0134419 3300060353 Bacteria 2146
1059 Ga0501082_0160522 3300060353 Bacteria 1953
1060 Ga0501082_0237345 3300060353 Bacteria 1587
1061 Ga0501082_0392189 3300060353 Bacteria 1211
1062 Ga0530510_0029698 3300061734 Bacteria 3925
1063 Ga0530510_0030715 3300061734 Bacteria 3860
1064 2643850090 2643221567 Bacteria 4163945
1065 2643853500 2643221567 Bacteria 4163945
1066 2643889890 2643221576 Bacteria 5214352
1067 2643893244 2643221576 Bacteria 5214352
1068 2643958946 2643221590 Bacteria 5214697
1069 2643961697 2643221590 Bacteria 5214697
1070 2644033896 2643221604 Bacteria 5014917
1071 2644034027 2643221604 Bacteria 5014917
1072 2644091769 2643221615 Bacteria 5487866
1073 2644102586 2643221617 Bacteria 5139111
1074 2644118248 2643221620 Bacteria 5134593
1075 2644136092 2643221624 Bacteria 4384879
1076 2644137461 2643221624 Bacteria 4384879
1077 2644228333 2643221641 Bacteria 4490190
1078 2644321572 2643221657 Bacteria 5490246
1079 2644609995 2643221711 Bacteria 4865335
1080 2645720479 2643221961 Bacteria 3919167
1081 2645723438 2643221962 Bacteria 3874254
1082 2738871640 2738541305 Bacteria 4910150
1083 2739603387 2739367653 Bacteria 2780952
1084 2740165843 2739367898 Bacteria 4367674
1085 2774393828 2773857762 Bacteria 5971770
1086 2784470931 2784132109 Bacteria 3141763
1087 2812331744 2811994874 Bacteria 5367947
1088 2812333915 2811994874 Bacteria 5367947
1089 2812350174 2811994878 Bacteria 5992952
1090 2819425474 2818991318 Bacteria 5266538
1091 2819667844 2818991458 Bacteria 4794049
1092 2819690251 2818991462 Bacteria 4320267
1093 2819726201 2818991469 Bacteria 4644110
1094 2855388905 2855386786 Bacteria 4752232
1095 2857483235 2857481737 Bacteria 4761446
1096 2857483533 2857481737 Bacteria 4761446
1097 2857727350 2857727296 Bacteria 2745552
1098 2984577222 2984576629 Bacteria 4248407
1099 2984579189 2984576629 Bacteria 4248407
1100 2990259918 2990256926 Bacteria 4252839
1101 2990260633 2990256926 Bacteria 4252839
1102 8054609651 8054609563 Bacteria 5170090
1103 8054611362 8054609563 Bacteria 5170090
1104 Ga0075365_10054794
1105 JGI24741J21665_1009250
1106 JGI24752J21851_1003606
1107 JGI24740J21852_10016912
1108 JGI24739J22299_10024977
1109 JGI24737J22298_10002340
1110 JGI24735J21928_10012866
1111 JGI24738J21930_10012282
1112 JGI24738J21930_10013790
1113 JGI24751J29686_10009083
1114 Ga0006562J51391_1041093
1115 Ga0070658_10022845
1116 Ga0070658_10052400
1117 Ga0070658_10174949
1118 Ga0070676_10008718
1119 Ga0070683_100004272
1120 Ga0070683_100068068
1121 Ga0070683_100188442
1122 Ga0070683_100530843
1123 Ga0070670_100030720
1124 Ga0070670_100055693
1125 Ga0070670_100139943
1126 Ga0070670_100156954
1127 Ga0068869_100101416
1128 Ga0070666_10111673
1129 Ga0070680_100086487
1130 Ga0070682_100020935
1131 Ga0070682_100033181
1132 Ga0070682_100087180
1133 Ga0068868_100130078
1134 Ga0068868_100155424
1135 Ga0068868_100219377
1136 Ga0068868_100337182
1137 Ga0070660_100026821
1138 Ga0070691_10008438
1139 Ga0070691_10032720
1140 Ga0070687_100067500
1141 Ga0070687_100170331
1142 Ga0070661_100083997
1143 Ga0070661_100096484
1144 Ga0070692_10031200
1145 Ga0070692_10063357
1146 Ga0070669_100085049
1147 Ga0070669_100113295
1148 Ga0070675_100003729
1149 Ga0070675_100081721
1150 Ga0070675_100201298
1151 Ga0070671_100001796
1152 Ga0070671_100284606
1153 Ga0070674_100020561
1154 Ga0070674_100028612
1155 Ga0070674_100064123
1156 Ga0070673_100194741
1157 Ga0070659_100017443
1158 Ga0070659_100031226
1159 Ga0070659_100111701
1160 Ga0070667_100105794
1161 Ga0070709_10018818
1162 Ga0070709_10219397
1163 Ga0070709_10226601
1164 Ga0070709_10318096
1165 Ga0070714_100145978
1166 Ga0070714_100351591
1167 Ga0070713_100499694
1168 Ga0070710_10033092
1169 Ga0070710_10196074
1170 Ga0070701_10002525
1171 Ga0070701_10004513
1172 Ga0070701_10013161
1173 Ga0070711_100107191
1174 Ga0070711_100305484
1175 Ga0070711_100518832
1176 Ga0070705_100173239
1177 Ga0070700_100011432
1178 Ga0070700_100016043
1179 Ga0070700_100033084
1180 Ga0070700_100074634
1181 Ga0070663_100026021
1182 Ga0070678_100073846
1183 Ga0070678_100152184
1184 Ga0070662_100023827
1185 Ga0070681_10216441
1186 Ga0068867_100019341
1187 Ga0068867_100060741
1188 Ga0070685_10066406
1189 Ga0070706_100417038
1190 Ga0070679_100079751
1191 Ga0070684_100005484
1192 Ga0070684_100007079
1193 Ga0070684_100069190
1194 Ga0070684_100084213
1195 Ga0070684_100093417
1196 Ga0070684_100104682
1197 Ga0070684_100366711
1198 Ga0068853_100190760
1199 Ga0068853_100332806
1200 Ga0068853_100332826
1201 Ga0070672_100058530
1202 Ga0070693_100021585
1203 Ga0070693_100140788
1204 Ga0070665_100000273
1205 Ga0070665_100000957
1206 Ga0070665_100001051
1207 Ga0070665_100006876
1208 Ga0070665_100019437
1209 Ga0068855_100051021
1210 Ga0068855_100148667
1211 Ga0068855_100250575
1212 Ga0068855_100672769
1213 Ga0068855_100833010
1214 Ga0070664_100006966
1215 Ga0070664_100073978
1216 Ga0070664_100282178
1217 Ga0068857_100022586
1218 Ga0068857_100047898
1219 Ga0068857_100067847
1220 Ga0068857_100108497
1221 Ga0068857_100315139
1222 Ga0068854_100380884
1223 Ga0068854_100441639
1224 Ga0068854_100470469
1225 Ga0068856_100007197
1226 Ga0068856_100191745
1227 Ga0068856_100274287
1228 Ga0070702_100007278
1229 Ga0070702_100040366
1230 Ga0070702_100092910
1231 Ga0070702_100139491
1232 Ga0070702_100236934
1233 Ga0068852_100017197
1234 Ga0068852_100027017
1235 Ga0068852_100055241
1236 Ga0068852_100349429
1237 Ga0068859_100205012
1238 Ga0068859_100355058
1239 Ga0068859_100612565
1240 Ga0068864_100021818
1241 Ga0068864_100107890
1242 Ga0068861_100027454
1243 Ga0068861_100029179
1244 Ga0068861_100116466
1245 Ga0068861_100127864
1246 Ga0068861_100158172
1247 Ga0068870_10033509
1248 Ga0068863_100380823
1249 Ga0068858_100042801
1250 Ga0068858_100094287
1251 Ga0068858_100191147
1252 Ga0068860_100000467
1253 Ga0068860_100012237
1254 Ga0068862_100216380
1255 Ga0081455_10000030
1256 Ga0081455_10071377
1257 Ga0081455_10195177
1258 Ga0081455_10221912
1259 Ga0081538_10000065
1260 Ga0081540_1025012
1261 Ga0081539_10033921
1262 Ga0070717_10098364
1263 Ga0070717_10375462
1264 Ga0075365_10008147
1265 Ga0075365_10024606
1266 Ga0075365_10031885
1267 Ga0075365_10043984
1268 Ga0075365_10046940
1269 Ga0075365_10071600
1270 Ga0075365_10075681
1271 Ga0075365_10096041
1272 Ga0075365_10101048
1273 Ga0075365_10112732
1274 Ga0075365_10156839
1275 Ga0075365_10159500
1276 Ga0075365_10166502
1277 Ga0075368_10000363
1278 Ga0075368_10000952
1279 Ga0075368_10017449
1280 Ga0075368_10031645
1281 Ga0075363_100000170
1282 Ga0075363_100000416
1283 Ga0075363_100001116
1284 Ga0075363_100002522
1285 Ga0075363_100020550
1286 Ga0075363_100061961
1287 Ga0075363_100063141
1288 Ga0075363_100072134
1289 Ga0075363_100079254
1290 Ga0075364_10006272
1291 Ga0075364_10008594
1292 Ga0075364_10014601
1293 Ga0075364_10042989
1294 Ga0075364_10057116
1295 Ga0075364_10062326
1296 Ga0075364_10073802
1297 Ga0075364_10086073
1298 Ga0070715_10011892
1299 Ga0070716_100192595
1300 Ga0070712_100069159
1301 Ga0070712_100111253
1302 Ga0070712_100169574
1303 Ga0070712_100500521
1304 Ga0075362_10015327
1305 Ga0075367_10000401
1306 Ga0075367_10010955
1307 Ga0075367_10018148
1308 Ga0075367_10019136
1309 Ga0075367_10053572
1310 Ga0075367_10080839
1311 Ga0075367_10090433
1312 Ga0097621_100086442
1313 Ga0097621_100167876
1314 Ga0075370_10001511
1315 Ga0075370_10001569
1316 Ga0075370_10003287
1317 Ga0075370_10032220
1318 Ga0075370_10065800
1319 Ga0075428_100016372
1320 Ga0075428_100021526
1321 Ga0075428_100800667
1322 Ga0075430_100003986
1323 Ga0075431_100022766
1324 Ga0075431_100141258
1325 Ga0075433_10088568
1326 Ga0075429_100048371
1327 Ga0068865_100019619
1328 Ga0068865_100035311
1329 Ga0068865_100217837
1330 Ga0068865_100228041
1331 Ga0097620_100205006
1332 Ga0097620_100355027
1333 Ga0097620_100612567
1334 Ga0111539_10006328
1335 Ga0111539_10012179
1336 Ga0111539_10046610
1337 Ga0111539_10048292
1338 Ga0111539_10373232
1339 Ga0111539_10460281
1340 Ga0111539_10490536
1341 Ga0105245_10001389
1342 Ga0105245_10163601
1343 Ga0105245_10187166
1344 Ga0105245_10219360
1345 Ga0105245_10465027
1346 Ga0105245_10516366
1347 Ga0114129_10010931
1348 Ga0105243_10014099
1349 Ga0105243_10016322
1350 Ga0105243_10209072
1351 Ga0105243_10224463
1352 Ga0105242_10058334
1353 Ga0105242_10235375
1354 Ga0105242_10451169
1355 Ga0105248_10031669
1356 Ga0105248_10200240
1357 Ga0105248_10279932
1358 Ga0105237_10033781
1359 Ga0105237_10393879
1360 Ga0105238_10044672
1361 Ga0105238_10268573
1362 Ga0105238_10384194
1363 Ga0105238_10392380
1364 Ga0105238_10522303
1365 Ga0105249_10004469
1366 Ga0105249_10031845
1367 Ga0105249_10198452
1368 Ga0105249_10347224
1369 Ga0105239_10003376
1370 Ga0105239_10010898
1371 Ga0105239_10097739
1372 Ga0105239_10156809
1373 Ga0105239_10503710
1374 Ga0105246_10010063
1375 Ga0105246_10090788
1376 Ga0157346_1000863
1377 Ga0157371_10089881
1378 Ga0157370_10195463
1379 Ga0157370_10441299
1380 Ga0157369_10010908
1381 Ga0157369_10040542
1382 Ga0157369_10215533
1383 Ga0157369_10338537
1384 Ga0157369_10387946
1385 Ga0157369_10838189
1386 Ga0163162_10002716
1387 Ga0163162_10008332
1388 Ga0163162_10163280
1389 Ga0163162_10185897
1390 Ga0157372_10000025
1391 Ga0157372_10015861
1392 Ga0157372_10022009
1393 Ga0157372_10125591
1394 Ga0157372_10403120
1395 Ga0157372_10416507
1396 Ga0157372_10697150
1397 Ga0157375_10029705
1398 Ga0157375_10058354
1399 Ga0157375_10106735
1400 Ga0157375_10243685
1401 Ga0157375_10420163
1402 Ga0157375_10534980
1403 Ga0163163_10022365
1404 Ga0163163_10067546
1405 Ga0163163_10129195
1406 Ga0163163_10151041
1407 Ga0157380_10002258
1408 Ga0157380_10010387
1409 Ga0157380_10018962
1410 Ga0157380_10173312
1411 Ga0157380_10351377
1412 Ga0182008_10092587
1413 Ga0157377_10003131
1414 Ga0157377_10024322
1415 Ga0157377_10044772
1416 Ga0157377_10048662
1417 Ga0157377_10182038
1418 Ga0157376_10263359
1419 Ga0163161_10139886
1420 Ga0163161_10178144
1421 Ga0206354_10058287
1422 Ga0206353_10418635
1423 Ga0206353_10455544
1424 Ga0206353_11704839
1425 Ga0206353_11712015
1426 Ga0207692_10012583
1427 Ga0207692_10056314
1428 Ga0207692_10156153
1429 Ga0207642_10008017
1430 Ga0207642_10050616
1431 Ga0207688_10003017
1432 Ga0207688_10004230
1433 Ga0207688_10008819
1434 Ga0207688_10015048
1435 Ga0207688_10019250
1436 Ga0207688_10025699
1437 Ga0207688_10046663
1438 Ga0207647_10002481
1439 Ga0207647_10056181
1440 Ga0207699_10044113
1441 Ga0207699_10053763
1442 Ga0207699_10199098
1443 Ga0207645_10039887
1444 Ga0207643_10002197
1445 Ga0207643_10023134
1446 Ga0207643_10037108
1447 Ga0207643_10061829
1448 Ga0207705_10038483
1449 Ga0207684_10247373
1450 Ga0207707_10160407
1451 Ga0207671_10028511
1452 Ga0207693_10127068
1453 Ga0207693_10464635
1454 Ga0207663_10009729
1455 Ga0207663_10035696
1456 Ga0207663_10140756
1457 Ga0207663_10259046
1458 Ga0207660_10482565
1459 Ga0207662_10009033
1460 Ga0207662_10059818
1461 Ga0207662_10182328
1462 Ga0207657_10017941
1463 Ga0207657_10030851
1464 Ga0207649_10166865
1465 Ga0207652_10036477
1466 Ga0207694_10231719
1467 Ga0207650_10001714
1468 Ga0207650_10057978
1469 Ga0207659_10065925
1470 Ga0207659_10125442
1471 Ga0207659_10174260
1472 Ga0207687_10005324
1473 Ga0207687_10009758
1474 Ga0207687_10048229
1475 Ga0207687_10283889
1476 Ga0207700_10011354
1477 Ga0207700_10022238
1478 Ga0207700_10146230
1479 Ga0207700_10192090
1480 Ga0207700_10586713
1481 Ga0207664_10047751
1482 Ga0207664_10122731
1483 Ga0207664_10169166
1484 Ga0207664_10181658
1485 Ga0207664_10292201
1486 Ga0207644_10027379
1487 Ga0207644_10043005
1488 Ga0207690_10023754
1489 Ga0207690_10040833
1490 Ga0207690_10069857
1491 Ga0207690_10107677
1492 Ga0207706_10017268
1493 Ga0207706_10111560
1494 Ga0207686_10057573
1495 Ga0207709_10025235
1496 Ga0207709_10065834
1497 Ga0207709_10105337
1498 Ga0207669_10011553
1499 Ga0207669_10058131
1500 Ga0207704_10007814
1501 Ga0207704_10010985
1502 Ga0207704_10029538
1503 Ga0207704_10112401
1504 Ga0207665_10071309
1505 Ga0207691_10018659
1506 Ga0207691_10019738
1507 Ga0207691_10059202
1508 Ga0207691_10062688
1509 Ga0207711_10220691
1510 Ga0207689_10079973
1511 Ga0207689_10088140
1512 Ga0207689_10101864
1513 Ga0207689_10183994
1514 Ga0207661_10007007
1515 Ga0207661_10011604
1516 Ga0207661_10013156
1517 Ga0207661_10071722
1518 Ga0207661_10103460
1519 Ga0207661_10163734
1520 Ga0207661_10215718
1521 Ga0207661_10324600
1522 Ga0207661_10385443
1523 Ga0207661_10390562
1524 Ga0207679_10015370
1525 Ga0207679_10090932
1526 Ga0207667_10085130
1527 Ga0207712_10018068
1528 Ga0207712_10214647
1529 Ga0207668_10078002
1530 Ga0207640_10120662
1531 Ga0207677_10039878
1532 Ga0207677_10099542
1533 Ga0207677_10245429
1534 Ga0207677_10273173
1535 Ga0207677_10493475
1536 Ga0207703_10081187
1537 Ga0207703_10100639
1538 Ga0207639_10089865
1539 Ga0207678_10000105
1540 Ga0207678_10041186
1541 Ga0207678_10109934
1542 Ga0207708_10000436
1543 Ga0207708_10001046
1544 Ga0207708_10004147
1545 Ga0207708_10004999
1546 Ga0207708_10057384
1547 Ga0207702_10062949
1548 Ga0207702_10068760
1549 Ga0207702_10496611
1550 Ga0207641_10055170
1551 Ga0207641_10100877
1552 Ga0207641_10371400
1553 Ga0207648_10003947
1554 Ga0207648_10004176
1555 Ga0207648_10057841
1556 Ga0207676_10002083
1557 Ga0207676_10016306
1558 Ga0207676_10503258
1559 Ga0207674_10019540
1560 Ga0207674_10042528
1561 Ga0207674_10120916
1562 Ga0207674_10135832
1563 Ga0207674_10305772
1564 Ga0207675_100004206
1565 Ga0207675_100004892
1566 Ga0207675_100082762
1567 Ga0207675_100526758
1568 Ga0207683_10021359
1569 Ga0207683_10043229
1570 Ga0207683_10053839
1571 Ga0207683_10098365
1572 Ga0207683_10308097
1573 Ga0207698_10129947
1574 Ga0207698_10176518
1575 Ga0207698_10239967
1576 Ga0209813_10003987
1577 Ga0209813_10004119
1578 Ga0209813_10007277
1579 Ga0209813_10061192
1580 Ga0207428_10030127
1581 Ga0207428_10051545
1582 Ga0207428_10335457
1583 Ga0268266_10051556
1584 Ga0268266_10111075
1585 Ga0268266_10144612
1586 Ga0268265_10179938
1587 Ga0268264_10000242
1588 Ga0268264_10001967
1589 Ga0268264_10004760
1590 Ga0268264_10039308
1591 Ga0265340_10000537
1592 Ga0307513_10015532
1593 Ga0307513_10092563
1594 Ga0307408_100407527
1595 Ga0307408_100427210
1596 Ga0316578_10001825
1597 Ga0307405_10142180
1598 Ga0307405_10245022
1599 Ga0307405_10350770
1600 Ga0307405_10360050
1601 Ga0307413_10041923
1602 Ga0307413_10057435
1603 Ga0307413_10139104
1604 Ga0307413_10149749
1605 Ga0307413_10170290
1606 Ga0307410_10006651
1607 Ga0307410_10010750
1608 Ga0307410_10018682
1609 Ga0307410_10087383
1610 Ga0307410_10116988
1611 Ga0307410_10250395
1612 Ga0307410_10342705
1613 Ga0307410_10388316
1614 Ga0307406_10031477
1615 Ga0307406_10048409
1616 Ga0307406_10084938
1617 Ga0307406_10104163
1618 Ga0307406_10145445
1619 Ga0307406_10221153
1620 Ga0307406_10288210
1621 Ga0307407_10004673
1622 Ga0307407_10010415
1623 Ga0307407_10015197
1624 Ga0307407_10016371
1625 Ga0307407_10017500
1626 Ga0307407_10062237
1627 Ga0307407_10244465
1628 Ga0307412_10345772
1629 Ga0307412_10498430
1630 Ga0307409_100009889
1631 Ga0307409_100011357
1632 Ga0307409_100016694
1633 Ga0307409_100030018
1634 Ga0307409_100034975
1635 Ga0307409_100038144
1636 Ga0307409_100046156
1637 Ga0307409_100060483
1638 Ga0307409_100063299
1639 Ga0307409_100071625
1640 Ga0307409_100097167
1641 Ga0307409_100108515
1642 Ga0307409_100128992
1643 Ga0307409_100151443
1644 Ga0307409_100215701
1645 Ga0307409_100240713
1646 Ga0307409_100254681
1647 Ga0307409_100329291
1648 Ga0307409_100437613
1649 Ga0307409_100440840
1650 Ga0307409_100492582
1651 Ga0307416_100002883
1652 Ga0307416_100002929
1653 Ga0307416_100012921
1654 Ga0307416_100048729
1655 Ga0307416_100051207
1656 Ga0307416_100065621
1657 Ga0307416_100102938
1658 Ga0307416_100186307
1659 Ga0307416_100299986
1660 Ga0307416_100395067
1661 Ga0307411_10068352
1662 Ga0307411_10076823
1663 Ga0307411_10095665
1664 Ga0307411_10221500
1665 Ga0307415_100007652
1666 Ga0307415_100009492
1667 Ga0307415_100021802
1668 Ga0307415_100026466
1669 Ga0307415_100038392
1670 Ga0307415_100089813
1671 Ga0307415_100089941
1672 Ga0307415_100107507
1673 Ga0307415_100118290
1674 Ga0307415_100283300
1675 Ga0307415_100620128
1676 Ga0316583_10029656
1677 Ga0373938_0031409
1678 Ga0373926_0027830
1679 Ga0373934_0002754
1680 Ga0373944_0011334
1681 Ga0373923_0023500
1682 Ga0373923_0055474
1683 Ga0373936_0026431
1684 Ga0373936_0055578
1685 Ga0373945_0039542
1686 Ga0373953_0000821
1687 Ga0373954_0001563
1688 Ga0373956_0003221
1689 Ga0373957_0001428
1690 Ga0373943_0048468
1691 Ga0373946_0013175
1692 Ga0373955_0082888
1693 Ga0373955_0108511
1694 Ga0316574_0007917
1695 Ga0373924_0016500
1696 Ga0373927_0040940
1697 Ga0373933_0005000
1698 Ga0373947_0023550
1699 Ga0373947_0056553
1700 Ga0373937_0010654
1701 Ga0373937_0208215
1702 Ga0316584_0003766
1703 Ga0373925_0031453
1704 Ga0373925_0093661
1705 Ga0395900_0026320
1706 Ga0395900_0058762
1707 Ga0395898_0169591
1708 Ga0395905_0054291
1709 Ga0395905_0190772
1710 Ga0436364_0849504
1711 Ga0436364_1495084
1712 Ga0395901_0011948
1713 Ga0395901_0139889
1714 Ga0395901_0148039
1715 Ga0395901_0213971
1716 Ga0400483_021589
1717 Ga0400483_095912
1718 Ga0400483_209527
1719 Ga0436365_1063556
1720 Ga0436365_1544034
1721 Ga0451843_0051158
1722 Ga0439459_0030276
1723 Ga0466972_0176165
1724 Ga0466965_0000459
1725 Ga0466965_0004751
1726 Ga0466965_0012067
1727 Ga0466965_0025243
1728 Ga0466965_0048241
1729 Ga0466965_0069717
1730 Ga0466965_0093393
1731 Ga0466961_0035163
1732 Ga0466961_0109053
1733 Ga0466963_0038739
1734 Ga0466963_0069680
1735 Ga0466964_0031608
1736 Ga0466964_0048533
1737 Ga0466964_0054265
1738 Ga0466970_0012324
1739 Ga0466970_0015359
1740 Ga0466970_0018226
1741 Ga0466970_0033313
1742 Ga0466970_0098294
1743 Ga0466957_0001115
1744 Ga0466957_0084176
1745 Ga0466957_0096568
1746 Ga0466960_0000350
1747 Ga0466960_0006974
1748 Ga0466960_0008191
1749 Ga0466960_0016237
1750 Ga0466960_0023651
1751 Ga0466960_0047414
1752 Ga0466960_0054466
1753 Ga0466960_0098125
1754 Ga0451576_0414424
1755 Ga0466958_0042983
1756 Ga0466958_0094123
1757 Ga0466967_0003975
1758 Ga0466967_0065708
1759 Ga0466967_0073531
1760 Ga0466967_0095098
1761 Ga0466967_0119523
1762 Ga0466967_0143725
1763 Ga0466967_0153107
1764 Ga0466967_0159795
1765 Ga0466967_0170963
1766 Ga0466967_0183525
1767 Ga0466967_0244570
1768 Ga0466967_0252036
1769 Ga0466967_0495608
1770 Ga0495592_0000397
1771 Ga0495592_0008095
1772 Ga0495603_0095528
1773 Ga0495629_0107549
1774 Ga0495629_0161015
1775 Ga0495641_0051291
1776 Ga0495641_0057979
1777 Ga0495641_0080767
1778 Ga0495651_0126575
1779 Ga0495651_0126576
1780 Ga0495653_0120545
1781 Ga0495653_0165079
1782 Ga0495582_0079567
1783 Ga0495664_0007931
1784 Ga0495664_0087709
1785 Ga0495608_0089230
1786 Ga0495608_0089231
1787 Ga0495608_0105594
1788 Ga0495618_0009751
1789 Ga0495628_0005043
1790 Ga0495628_0122322
1791 Ga0495630_0055169
1792 Ga0495630_0152328
1793 Ga0495652_0002110
1794 Ga0495652_0049416
1795 Ga0495652_0108948
1796 Ga0495665_0093433
1797 Ga0495640_0067173
1798 Ga0495586_0015106
1799 Ga0495587_0029133
1800 Ga0495587_0099998
1801 Ga0495645_0003234
1802 Ga0495645_0010242
1803 Ga0495667_0011880
1804 Ga0495667_0114499
1805 Ga0495634_0021736
1806 Ga0495635_0074934
1807 Ga0495635_0111827
1808 Ga0495657_0192128
1809 Ga0495599_0017017
1810 Ga0495599_0084661
1811 Ga0495623_0019997
1812 Ga0495623_0100901
1813 Ga0495646_0002659
1814 Ga0495646_0004480
1815 Ga0495658_0086658
1816 Ga0495613_0039703
1817 Ga0495624_0137472
1818 Ga0495600_0009608
1819 Ga0495600_0056669
1820 Ga0495604_0004132
1821 Ga0495604_0042757
1822 Ga0495674_0088829
1823 Ga0495676_0085788
1824 Ga0495676_0124145
1825 Ga0495680_0001602
1826 Ga0495680_0096739
1827 Ga0495680_0120073
1828 Ga0495675_0034575
1829 Ga0495675_0225124
1830 Ga0495684_0000603
1831 Ga0495684_0138994
1832 Ga0495602_0017251
1833 Ga0495602_0018432
1834 Ga0496100_0003839
1835 Ga0496100_0032129
1836 Ga0496100_0252908
1837 Ga0496101_0013820
1838 Ga0496101_0134755
1839 Ga0496102_0002619
1840 Ga0496102_0008782
1841 Ga0496102_0013364
1842 Ga0496102_0015121
1843 Ga0496102_0033772
1844 Ga0496102_0051165
1845 Ga0496102_0079766
1846 Ga0496102_0136298
1847 Ga0496102_0154518
1848 Ga0496102_0177590
1849 Ga0496102_0601730
1850 Ga0496103_0009545
1851 Ga0496103_0018415
1852 Ga0496103_0048923
1853 Ga0496103_0085930
1854 Ga0496103_0160825
1855 Ga0496103_0246457
1856 Ga0496104_0030323
1857 Ga0496104_0072786
1858 Ga0496104_0103668
1859 Ga0496104_0222010
1860 Ga0496104_0234198
1861 Ga0496104_0260922
1862 Ga0496105_0004639
1863 Ga0496105_0010601
1864 Ga0496105_0013044
1865 Ga0496105_0046910
1866 Ga0496105_0071322
1867 Ga0496105_0112375
1868 Ga0496105_0134554
1869 Ga0496105_0151400
1870 Ga0496105_0163927
1871 Ga0496105_0233606
1872 Ga0496105_0465742
1873 Ga0496106_0055833
1874 Ga0496107_0028957
1875 Ga0496107_0038148
1876 Ga0496107_0071877
1877 Ga0496107_0130879
1878 Ga0496107_0144379
1879 Ga0496107_0264463
1880 Ga0496107_0317528
1881 Ga0496107_0438783
1882 Ga0496107_0487344
1883 Ga0496108_0008499
1884 Ga0496108_0019824
1885 Ga0496108_0055934
1886 Ga0496108_0057158
1887 Ga0496108_0170747
1888 Ga0496108_0251142
1889 Ga0496108_0279324
1890 Ga0496108_0327330
1891 Ga0496109_0014295
1892 Ga0496109_0015913
1893 Ga0496109_0058785
1894 Ga0496109_0061158
1895 Ga0496109_0088079
1896 Ga0496109_0095372
1897 Ga0496109_0195072
1898 Ga0496109_0195396
1899 Ga0496109_0214230
1900 Ga0496109_0224563
1901 Ga0496109_0242584
1902 Ga0496109_0550688
1903 Ga0496109_0583580
1904 Ga0496110_0006612
1905 Ga0496110_0012958
1906 Ga0496110_0022918
1907 Ga0496110_0079099
1908 Ga0496110_0082241
1909 Ga0496110_0083440
1910 Ga0496110_0088856
1911 Ga0496110_0138698
1912 Ga0496110_0296797
1913 Ga0496110_0310798
1914 Ga0496110_0369646
1915 Ga0496111_0000863
1916 Ga0496111_0012659
1917 Ga0496112_0154324
1918 Ga0496112_0206213
1919 Ga0496112_0639119
1920 Ga0496113_0036543
1921 Ga0496113_0038091
1922 Ga0496113_0358369
1923 Ga0496114_0002152
1924 Ga0496114_0003522
1925 Ga0496114_0005765
1926 Ga0496114_0008014
1927 Ga0496114_0033141
1928 Ga0496114_0074275
1929 Ga0496114_0090983
1930 Ga0496114_0107067
1931 Ga0496114_0160447
1932 Ga0496114_0216338
1933 Ga0496114_0303922
1934 Ga0496114_0353064
1935 Ga0496114_0463582
1936 Ga0496115_0029443
1937 Ga0496115_0091212
1938 Ga0496118_0173804
1939 Ga0496119_0014608
1940 Ga0496120_0006161
1941 Ga0496121_0035843
1942 Ga0496121_0169453
1943 Ga0496123_0078694
1944 Ga0496124_0228974
1945 Ga0496126_0000039
1946 Ga0501309_002015
1947 Ga0501291_020713
1948 Ga0501298_023437
1949 Ga0501031_0001569
1950 Ga0501031_0019479
1951 Ga0501031_0056192
1952 Ga0501031_0060482
1953 Ga0501031_0091406
1954 Ga0501031_0104827
1955 Ga0501032_0059829
1956 Ga0501032_0066357
1957 Ga0501032_0077745
1958 Ga0501033_0003386
1959 Ga0501034_0051347
1960 Ga0501034_0054748
1961 Ga0501034_0064361
1962 Ga0501036_0001694
1963 Ga0501036_0006122
1964 Ga0501036_0017266
1965 Ga0501036_0033743
1966 Ga0501036_0072369
1967 Ga0501036_0121489
1968 Ga0501036_0207628
1969 Ga0501037_0023454
1970 Ga0501037_0087179
1971 Ga0501037_0091380
1972 Ga0501037_0105898
1973 Ga0501037_0114203
1974 Ga0501038_0004008
1975 Ga0501038_0013769
1976 Ga0501039_0007037
1977 Ga0501040_0001709
1978 Ga0501040_0011354
1979 Ga0501040_0054839
1980 Ga0501040_0232480
1981 Ga0501040_0357141
1982 Ga0501041_0021998
1983 Ga0501041_0069015
1984 Ga0501041_0140093
1985 Ga0501042_0003027
1986 Ga0501042_0006792
1987 Ga0501042_0046751
1988 Ga0501043_0134861
1989 Ga0501046_0010342
1990 Ga0501046_0057893
1991 Ga0501046_0073585
1992 Ga0501047_0033893
1993 Ga0501048_0007035
1994 Ga0501048_0040541
1995 Ga0501067_0004112
1996 Ga0501067_0009441
1997 Ga0501067_0060698
1998 Ga0501067_0104913
1999 Ga0501067_0166254
2000 Ga0501068_0056147
2001 Ga0501068_0130005
2002 Ga0501069_0004130
2003 Ga0501069_0007837
2004 Ga0501069_0009384
2005 Ga0501069_0017089
2006 Ga0501069_0035271
2007 Ga0501069_0095019
2008 Ga0501069_0137160
2009 Ga0501070_0003855
2010 Ga0501070_0004279
2011 Ga0501070_0021270
2012 Ga0501070_0032937
2013 Ga0501070_0035442
2014 Ga0501070_0042917
2015 Ga0501070_0097933
2016 Ga0501070_0222332
2017 Ga0501070_0442156
2018 Ga0501071_0005666
2019 Ga0501071_0005962
2020 Ga0501071_0053300
2021 Ga0501071_0222462
2022 Ga0501072_0006084
2023 Ga0501072_0009890
2024 Ga0501072_0035834
2025 Ga0501072_0052339
2026 Ga0501072_0054608
2027 Ga0501072_0070974
2028 Ga0501072_0082701
2029 Ga0501072_0111824
2030 Ga0501073_0004693
2031 Ga0501073_0019457
2032 Ga0501073_0056459
2033 Ga0501073_0063282
2034 Ga0501073_0251170
2035 Ga0501073_0454919
2036 Ga0501074_0007589
2037 Ga0501074_0008026
2038 Ga0501074_0016168
2039 Ga0501074_0035660
2040 Ga0501074_0049798
2041 Ga0501074_0093115
2042 Ga0501074_0106098
2043 Ga0501074_0108479
2044 Ga0501075_0009610
2045 Ga0501075_0067091
2046 Ga0501075_0138846
2047 Ga0501076_0011478
2048 Ga0501076_0049489
2049 Ga0501076_0086503
2050 Ga0501076_0086562
2051 Ga0501077_0007878
2052 Ga0501077_0009576
2053 Ga0501077_0011162
2054 Ga0501077_0022311
2055 Ga0501079_0058312
2056 Ga0501079_0079143
2057 Ga0501079_0093028
2058 Ga0501080_0000857
2059 Ga0501080_0013574
2060 Ga0501080_0029465
2061 Ga0501080_0039249
2062 Ga0501080_0157491
2063 Ga0501080_0292281
2064 Ga0501081_0017918
2065 Ga0501081_0329002
2066 Ga0501083_0020109
2067 Ga0501083_0112653
2068 Ga0501035_0021194
2069 Ga0501035_0032558
2070 Ga0501044_0040033
2071 Ga0501045_0002747
2072 Ga0501045_0019867
2073 Ga0501045_0070494
2074 Ga0501045_0074104
2075 Ga0501045_0114517
2076 Ga0501045_0134072
2077 Ga0501045_0380013
2078 nmdc:mga03683_108033_c1
2079 nmdc:mga03n38_131271_c1
2080 nmdc:mga03n38_15364_c1
2081 nmdc:mga03n38_1536_c1
2082 nmdc:mga03n38_16936_c1
2083 nmdc:mga03n38_31013_c1
2084 nmdc:mga03n38_51853_c1
2085 nmdc:mga03n38_87017_c1
2086 nmdc:mga03n38_92194_c1
2087 nmdc:mga03n38_92387_c1
2088 nmdc:mga03n38_9497_c1
2089 nmdc:mga00v17_101428_c1
2090 nmdc:mga00v17_12728_c1
2091 nmdc:mga00v17_13995_c1
2092 nmdc:mga00v17_167026_c1
2093 nmdc:mga00v17_18892_c1
2094 nmdc:mga00v17_199295_c1
2095 nmdc:mga00v17_22363_c1
2096 nmdc:mga00v17_30291_c1
2097 nmdc:mga00v17_32669_c1
2098 nmdc:mga00v17_49842_c1
2099 nmdc:mga00v17_89878_c1
2100 nmdc:mga0yw44_100306_c1
2101 nmdc:mga0yw44_105970_c1
2102 nmdc:mga0yw44_119425_c1
2103 nmdc:mga0yw44_146689_c1
2104 nmdc:mga0yw44_18098_c1
2105 nmdc:mga0yw44_18114_c1
2106 nmdc:mga0yw44_36814_c1
2107 nmdc:mga0yw44_38807_c1
2108 nmdc:mga0yw44_51998_c1
2109 nmdc:mga0yw44_56569_c1
2110 nmdc:mga0yw44_7733_c1
2111 nmdc:mga0yw44_98052_c1
2112 nmdc:mga06z11_26368_c1
2113 nmdc:mga06z11_56530_c1
2114 nmdc:mga06z11_69554_c1
2115 nmdc:mga06z11_8413_c1
2116 nmdc:mga04h51_102509_c1
2117 nmdc:mga04h51_23893_c1
2118 nmdc:mga07m45_101514_c1
2119 nmdc:mga07m45_2647_c1
2120 nmdc:mga07m45_44396_c1
2121 nmdc:mga07m45_80186_c1
2122 nmdc:mga07m45_9130_c1
2123 nmdc:mga07m45_97695_c1
2124 nmdc:mga05p37_147426_c1
2125 nmdc:mga09592_291569_c1
2126 nmdc:mga06r32_15209_c1
2127 nmdc:mga06r32_191537_c1
2128 nmdc:mga08y16_101083_c1
2129 nmdc:mga08y16_201480_c1
2130 nmdc:mga08y16_426063_c1
2131 nmdc:mga08y16_4414_c1
2132 nmdc:mga08y16_62979_c1
2133 nmdc:mga08y16_692626_c1
2134 nmdc:mga0rr50_403682_c1
2135 nmdc:mga0a205_124922_c1
2136 Ga0495601_0209487
2137 Ga0495612_0013400
2138 Ga0495595_0123021
2139 Ga0495619_0023815
2140 Ga0495619_0340286
2141 Ga0500643_000239
2142 Ga0500644_0000050
2143 Ga0500644_0000104
2144 Ga0500644_0081935
2145 Ga0500554_008044
2146 Ga0500554_078163
2147 Ga0500556_0001058
2148 Ga0500593_000179
2149 Ga0500573_0018977
2150 Ga0500616_0000060
2151 Ga0500616_0000792
2152 Ga0501084_0021438
2153 Ga0501084_0158009
2154 Ga0501084_0331367
2155 Ga0501084_0350322
2156 Ga0587073_0015132
2157 Ga0587111_0020289
2158 Ga0501082_0019122
2159 Ga0501082_0046676
2160 Ga0501082_0083012
2161 Ga0501082_0134419
2162 Ga0501082_0160522
2163 Ga0501082_0237345
2164 Ga0501082_0392189
2165 Ga0530510_0029698
2166 Ga0530510_0030715
2167 2643850090
2168 2643853500
2169 2643889890
2170 2643893244
2171 2643958946
2172 2643961697
2173 2644033896
2174 2644034027
2175 2644091769
2176 2644102586
2177 2644118248
2178 2644136092
2179 2644137461
2180 2644228333
2181 2644321572
2182 2644609995
2183 2645720479
2184 2645723438
2185 2738871640
2186 2739603387
2187 2740165843
2188 2774393828
2189 2784470931
2190 2812331744
2191 2812333915
2192 2812350174
2193 2819425474
2194 2819667844
2195 2819690251
2196 2819726201
2197 2855388905
2198 2857483235
2199 2857483533
2200 2857727350
2201 2984577222
2202 2984579189
2203 2990259918
2204 2990260633
2205 8054609651
2206 8054611362

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

54

194

0.9

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

150

229

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
1l2t-assembly1.cif.gz_B dimeric structure of mj0796, a bacterial abc transporter cassette 0.9173 1 211
3tif-assembly1.cif.gz_B dimeric structure of a post-hydrolysis state of the atp-binding cassette mj0796 bound to adp and pi 0.9074 1 211
4p33-assembly1.cif.gz_A crystal structure of e. coli lptb-e163q in complex with atp-sodium 0.9036 2 216
7ahd-assembly1.cif.gz_D opua (e190q) occluded 0.9006 2 216
7v8i-assembly1.cif.gz_F lolcd(e171q)e with bound amppnp in nanodiscs 0.8993 1 211
ID Description Score Start End Superfamily
af_O33189_10_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9471 2 219 3.40.50.300
af_Q2FXB7_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9427 2 211 3.40.50.300
af_P0A9U1_321_563_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9395 2 220 3.40.50.300
af_Q9VRG3_1356_1574_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.932 2 206 3.40.50.300
af_P37624_268_530_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9288 2 218 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3L7J281-F1-model_v4 ATP-binding cassette domain-containing protein 0.9929 1 215 GO:0005524
GO:0016887
AF-A0A3N0DQ34-F1-model_v4 ATP-binding cassette domain-containing protein 0.9841 2 216 GO:0005524
GO:0016887
AF-A0A0S9DLE0-F1-model_v4 ABC transporter domain-containing protein 0.947 2 216 GO:0005524
GO:0016887
GO:0046677
AF-A0A6G8KU53-F1-model_v4 ATP-binding cassette domain-containing protein 0.9468 2 215 GO:0005524
GO:0016887
AF-A0A7H2BMT5-F1-model_v4 ABC transporter ATP-binding protein 0.9461 2 216 GO:0005524
GO:0016887

Map