F490100
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1103 | 385 | 2206 | 302 |
Family's Representative Sequence
| Representative Sequence | 3300006038|Ga0075365_10054794|Ga0075365_100547942 |
| Length | 344 |
| Sequence | MSLAAQAARVGAPPYFGRDAPAAKTMHGVGRVRQAVAMINVEGLTRRYGNFTAVDDVSFVCQPGRVTGFLGPNGAGKTTTMRVMVGLTPPTKGRVTIGGHVYQDIPNPGTHVGVLLDASAQHAGRTGREILTLGAQTMGLPMSRVDEMLELVSLDKTEAKRRLRNYSLGMKQRLGIAHALLGDPSVLILDEPANGLDPAGIRWMRGLLKGYADRGGTVCLSSHLLNEVEQIADEMILIGHGRIVAEGTKEELLAGAESHTALVTSLDNERLAQALRDKGVTVTTAGSGLRAETAPVQVGRVAAEHSIVLSDLRAAEGGLEELFLTLTADTQREQPVATTQGATA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 8 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 9 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 10 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 69 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 70 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 71 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 72 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 74 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 75 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 76 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 80 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 85 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 86 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 87 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Metagenome | Rhizosphere |
| 102 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 111 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 172 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 176 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 177 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 178 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 179 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 180 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 181 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 182 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 183 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 184 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 185 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 186 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 187 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 188 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 189 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 190 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 191 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 192 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 193 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 194 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 195 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 196 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 197 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 198 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 199 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 200 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 201 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 202 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 203 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 204 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 205 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 206 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 207 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 208 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 209 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 211 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 212 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 213 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 214 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 215 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 216 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 217 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 218 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 219 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 220 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 221 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 222 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 223 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 224 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 225 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 226 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 227 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 228 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 229 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 230 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 231 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 232 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 271 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 272 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 273 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 274 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 275 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 276 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 279 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 280 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 281 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 282 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 283 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 284 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 285 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 286 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 287 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 288 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 289 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 290 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 291 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 292 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 293 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 294 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 328 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 329 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 330 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 331 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 332 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 333 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 334 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 345 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 346 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 347 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 348 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 349 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 350 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 351 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 353 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 354 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 356 | 2643221567 | Phycicoccus sp. Root563 | Isolate | Unclassified |
| 357 | 2643221576 | Nocardioides sp. Root614 | Isolate | Unclassified |
| 358 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 359 | 2643221604 | Nocardioides sp. Root190 | Isolate | Unclassified |
| 360 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 361 | 2643221617 | Nocardioides sp. Root79 | Isolate | Unclassified |
| 362 | 2643221620 | Nocardioides sp. Root240 | Isolate | Unclassified |
| 363 | 2643221624 | Phycicoccus sp. Root101 | Isolate | Unclassified |
| 364 | 2643221641 | Nocardioides sp. Root122 | Isolate | Unclassified |
| 365 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 366 | 2643221711 | Terrabacter sp. Root85 | Isolate | Unclassified |
| 367 | 2643221961 | Aeromicrobium sp. Root236 | Isolate | Unclassified |
| 368 | 2643221962 | Aeromicrobium sp. Root344 | Isolate | Unclassified |
| 369 | 2738541305 | Nocardioides sp. CF167 | Isolate | Unclassified |
| 370 | 2739367653 | Kocuria sp. OV113 | Isolate | Unclassified |
| 371 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 372 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 373 | 2784132109 | Dermacoccus sp. DS28 SAI-028 | Isolate | Unclassified |
| 374 | 2811994874 | Nocardioides sp. SLBN-35 | Isolate | Unclassified |
| 375 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 376 | 2818991318 | Humibacillus xanthopallidus SLBN-155 | Isolate | Unclassified |
| 377 | 2818991458 | Terrabacter sp. 3211 | Isolate | Rhizosphere |
| 378 | 2818991462 | Terrabacter sp. 3264 | Isolate | Rhizosphere |
| 379 | 2818991469 | Terrabacter lapilli 3265 | Isolate | Rhizosphere |
| 380 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 381 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 382 | 2857727296 | Kocuria sp. R-72562 | Isolate | Unclassified |
| 383 | 2984576629 | Nocardioides zeae SORGH_AS913 | Isolate | Aerial Root |
| 384 | 2990256926 | Nocardioides zeae SORGH_AS885 | Isolate | Aerial Root |
| 385 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.56 |
| Metatranscriptomes | 0.82 |
| Isolates | 3.63 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.36 |
| Bulb | 0 |
| Endosphere | 9.88 |
| Nodule | 0.18 |
| Rhizoplane | 9.43 |
| Rhizosphere | 75.61 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0075365_10054794 | 3300006038 | Bacteria | 2645 |
| 2 | JGI24741J21665_1009250 | 3300001915 | Bacteria | 1818 |
| 3 | JGI24752J21851_1003606 | 3300001976 | Bacteria | 2039 |
| 4 | JGI24740J21852_10016912 | 3300001979 | Bacteria | 2622 |
| 5 | JGI24739J22299_10024977 | 3300001989 | Bacteria | 2103 |
| 6 | JGI24737J22298_10002340 | 3300001990 | Bacteria | 6758 |
| 7 | JGI24735J21928_10012866 | 3300002067 | Bacteria | 2641 |
| 8 | JGI24738J21930_10012282 | 3300002075 | Bacteria | 1872 |
| 9 | JGI24738J21930_10013790 | 3300002075 | Bacteria | 1741 |
| 10 | JGI24751J29686_10009083 | 3300002459 | Bacteria | 2041 |
| 11 | Ga0006562J51391_1041093 | 3300003578 | Bacteria | 2360 |
| 12 | Ga0070658_10022845 | 3300005327 | Bacteria | 5020 |
| 13 | Ga0070658_10052400 | 3300005327 | Bacteria | 3309 |
| 14 | Ga0070658_10174949 | 3300005327 | Bacteria | 1805 |
| 15 | Ga0070676_10008718 | 3300005328 | Bacteria | 5471 |
| 16 | Ga0070683_100004272 | 3300005329 | Bacteria | 11729 |
| 17 | Ga0070683_100068068 | 3300005329 | Bacteria | 3317 |
| 18 | Ga0070683_100188442 | 3300005329 | Bacteria | 1958 |
| 19 | Ga0070683_100530843 | 3300005329 | Bacteria | 1125 |
| 20 | Ga0070670_100030720 | 3300005331 | Bacteria | 4626 |
| 21 | Ga0070670_100055693 | 3300005331 | Bacteria | 3394 |
| 22 | Ga0070670_100139943 | 3300005331 | Bacteria | 2093 |
| 23 | Ga0070670_100156954 | 3300005331 | Bacteria | 1971 |
| 24 | Ga0068869_100101416 | 3300005334 | Bacteria | 2177 |
| 25 | Ga0070666_10111673 | 3300005335 | Bacteria | 1890 |
| 26 | Ga0070680_100086487 | 3300005336 | Bacteria | 2591 |
| 27 | Ga0070682_100020935 | 3300005337 | Bacteria | 3853 |
| 28 | Ga0070682_100033181 | 3300005337 | Bacteria | 3135 |
| 29 | Ga0070682_100087180 | 3300005337 | Bacteria | 2035 |
| 30 | Ga0068868_100130078 | 3300005338 | Bacteria | 2059 |
| 31 | Ga0068868_100155424 | 3300005338 | Bacteria | 1886 |
| 32 | Ga0068868_100219377 | 3300005338 | Bacteria | 1592 |
| 33 | Ga0068868_100337182 | 3300005338 | Bacteria | 1288 |
| 34 | Ga0070660_100026821 | 3300005339 | Bacteria | 4292 |
| 35 | Ga0070691_10008438 | 3300005341 | Bacteria | 4714 |
| 36 | Ga0070691_10032720 | 3300005341 | Bacteria | 2444 |
| 37 | Ga0070687_100067500 | 3300005343 | Bacteria | 1909 |
| 38 | Ga0070687_100170331 | 3300005343 | Bacteria | 1295 |
| 39 | Ga0070661_100083997 | 3300005344 | Bacteria | 2352 |
| 40 | Ga0070661_100096484 | 3300005344 | Bacteria | 2194 |
| 41 | Ga0070692_10031200 | 3300005345 | Bacteria | 2670 |
| 42 | Ga0070692_10063357 | 3300005345 | Bacteria | 1953 |
| 43 | Ga0070669_100085049 | 3300005353 | Bacteria | 2362 |
| 44 | Ga0070669_100113295 | 3300005353 | Bacteria | 2060 |
| 45 | Ga0070675_100003729 | 3300005354 | Bacteria | 11583 |
| 46 | Ga0070675_100081721 | 3300005354 | Bacteria | 2695 |
| 47 | Ga0070675_100201298 | 3300005354 | Bacteria | 1728 |
| 48 | Ga0070671_100001796 | 3300005355 | Bacteria | 16283 |
| 49 | Ga0070671_100284606 | 3300005355 | Bacteria | 1406 |
| 50 | Ga0070674_100020561 | 3300005356 | Bacteria | 4221 |
| 51 | Ga0070674_100028612 | 3300005356 | Bacteria | 3661 |
| 52 | Ga0070674_100064123 | 3300005356 | Bacteria | 2573 |
| 53 | Ga0070673_100194741 | 3300005364 | Bacteria | 1743 |
| 54 | Ga0070659_100017443 | 3300005366 | Bacteria | 5405 |
| 55 | Ga0070659_100031226 | 3300005366 | Bacteria | 4125 |
| 56 | Ga0070659_100111701 | 3300005366 | Bacteria | 2207 |
| 57 | Ga0070667_100105794 | 3300005367 | Bacteria | 2435 |
| 58 | Ga0070709_10018818 | 3300005434 | Bacteria | 3985 |
| 59 | Ga0070709_10219397 | 3300005434 | Bacteria | 1355 |
| 60 | Ga0070709_10226601 | 3300005434 | Bacteria | 1335 |
| 61 | Ga0070709_10318096 | 3300005434 | Bacteria | 1141 |
| 62 | Ga0070714_100145978 | 3300005435 | Bacteria | 2128 |
| 63 | Ga0070714_100351591 | 3300005435 | Bacteria | 1384 |
| 64 | Ga0070713_100499694 | 3300005436 | Bacteria | 1147 |
| 65 | Ga0070710_10033092 | 3300005437 | Bacteria | 2805 |
| 66 | Ga0070710_10196074 | 3300005437 | Bacteria | 1272 |
| 67 | Ga0070701_10002525 | 3300005438 | Bacteria | 7071 |
| 68 | Ga0070701_10004513 | 3300005438 | Bacteria | 5650 |
| 69 | Ga0070701_10013161 | 3300005438 | Bacteria | 3755 |
| 70 | Ga0070711_100107191 | 3300005439 | Bacteria | 2044 |
| 71 | Ga0070711_100305484 | 3300005439 | Bacteria | 1266 |
| 72 | Ga0070711_100518832 | 3300005439 | Bacteria | 984 |
| 73 | Ga0070705_100173239 | 3300005440 | Bacteria | 1454 |
| 74 | Ga0070700_100011432 | 3300005441 | Bacteria | 4917 |
| 75 | Ga0070700_100016043 | 3300005441 | Bacteria | 4260 |
| 76 | Ga0070700_100033084 | 3300005441 | Bacteria | 3112 |
| 77 | Ga0070700_100074634 | 3300005441 | Bacteria | 2173 |
| 78 | Ga0070663_100026021 | 3300005455 | Bacteria | 3958 |
| 79 | Ga0070678_100073846 | 3300005456 | Bacteria | 2561 |
| 80 | Ga0070678_100152184 | 3300005456 | Bacteria | 1865 |
| 81 | Ga0070662_100023827 | 3300005457 | Bacteria | 4210 |
| 82 | Ga0070681_10216441 | 3300005458 | Bacteria | 1831 |
| 83 | Ga0068867_100019341 | 3300005459 | Bacteria | 4853 |
| 84 | Ga0068867_100060741 | 3300005459 | Bacteria | 2804 |
| 85 | Ga0070685_10066406 | 3300005466 | Bacteria | 2125 |
| 86 | Ga0070706_100417038 | 3300005467 | Bacteria | 1249 |
| 87 | Ga0070679_100079751 | 3300005530 | Bacteria | 3263 |
| 88 | Ga0070684_100005484 | 3300005535 | Bacteria | 9720 |
| 89 | Ga0070684_100007079 | 3300005535 | Bacteria | 8719 |
| 90 | Ga0070684_100069190 | 3300005535 | Bacteria | 3104 |
| 91 | Ga0070684_100084213 | 3300005535 | Bacteria | 2818 |
| 92 | Ga0070684_100093417 | 3300005535 | Bacteria | 2678 |
| 93 | Ga0070684_100104682 | 3300005535 | Bacteria | 2532 |
| 94 | Ga0070684_100366711 | 3300005535 | Bacteria | 1326 |
| 95 | Ga0068853_100190760 | 3300005539 | Bacteria | 1862 |
| 96 | Ga0068853_100332806 | 3300005539 | Bacteria | 1409 |
| 97 | Ga0068853_100332826 | 3300005539 | Bacteria | 1409 |
| 98 | Ga0070672_100058530 | 3300005543 | Bacteria | 3029 |
| 99 | Ga0070693_100021585 | 3300005547 | Bacteria | 3412 |
| 100 | Ga0070693_100140788 | 3300005547 | Bacteria | 1518 |
| 101 | Ga0070665_100000273 | 3300005548 | Bacteria | 84592 |
| 102 | Ga0070665_100000957 | 3300005548 | Bacteria | 36788 |
| 103 | Ga0070665_100001051 | 3300005548 | Bacteria | 34592 |
| 104 | Ga0070665_100006876 | 3300005548 | Bacteria | 11562 |
| 105 | Ga0070665_100019437 | 3300005548 | Bacteria | 6817 |
| 106 | Ga0068855_100051021 | 3300005563 | Bacteria | 4874 |
| 107 | Ga0068855_100148667 | 3300005563 | Bacteria | 2665 |
| 108 | Ga0068855_100250575 | 3300005563 | Bacteria | 1975 |
| 109 | Ga0068855_100672769 | 3300005563 | Bacteria | 1110 |
| 110 | Ga0068855_100833010 | 3300005563 | Bacteria | 979 |
| 111 | Ga0070664_100006966 | 3300005564 | Bacteria | 9112 |
| 112 | Ga0070664_100073978 | 3300005564 | Bacteria | 2924 |
| 113 | Ga0070664_100282178 | 3300005564 | Bacteria | 1498 |
| 114 | Ga0068857_100022586 | 3300005577 | Bacteria | 5533 |
| 115 | Ga0068857_100047898 | 3300005577 | Bacteria | 3796 |
| 116 | Ga0068857_100067847 | 3300005577 | Bacteria | 3175 |
| 117 | Ga0068857_100108497 | 3300005577 | Bacteria | 2494 |
| 118 | Ga0068857_100315139 | 3300005577 | Bacteria | 1444 |
| 119 | Ga0068854_100380884 | 3300005578 | Bacteria | 1162 |
| 120 | Ga0068854_100441639 | 3300005578 | Bacteria | 1085 |
| 121 | Ga0068854_100470469 | 3300005578 | Bacteria | 1053 |
| 122 | Ga0068856_100007197 | 3300005614 | Bacteria | 10853 |
| 123 | Ga0068856_100191745 | 3300005614 | Bacteria | 2057 |
| 124 | Ga0068856_100274287 | 3300005614 | Bacteria | 1703 |
| 125 | Ga0070702_100007278 | 3300005615 | Bacteria | 5292 |
| 126 | Ga0070702_100040366 | 3300005615 | Bacteria | 2610 |
| 127 | Ga0070702_100092910 | 3300005615 | Bacteria | 1833 |
| 128 | Ga0070702_100139491 | 3300005615 | Bacteria | 1542 |
| 129 | Ga0070702_100236934 | 3300005615 | Bacteria | 1229 |
| 130 | Ga0068852_100017197 | 3300005616 | Bacteria | 5668 |
| 131 | Ga0068852_100027017 | 3300005616 | Bacteria | 4672 |
| 132 | Ga0068852_100055241 | 3300005616 | Bacteria | 3426 |
| 133 | Ga0068852_100349429 | 3300005616 | Bacteria | 1443 |
| 134 | Ga0068859_100205012 | 3300005617 | Bacteria | 2057 |
| 135 | Ga0068859_100355058 | 3300005617 | Bacteria | 1561 |
| 136 | Ga0068859_100612565 | 3300005617 | Bacteria | 1181 |
| 137 | Ga0068864_100021818 | 3300005618 | Bacteria | 5366 |
| 138 | Ga0068864_100107890 | 3300005618 | Bacteria | 2477 |
| 139 | Ga0068861_100027454 | 3300005719 | Bacteria | 4145 |
| 140 | Ga0068861_100029179 | 3300005719 | Bacteria | 4033 |
| 141 | Ga0068861_100116466 | 3300005719 | Bacteria | 2149 |
| 142 | Ga0068861_100127864 | 3300005719 | Bacteria | 2058 |
| 143 | Ga0068861_100158172 | 3300005719 | Bacteria | 1866 |
| 144 | Ga0068870_10033509 | 3300005840 | Bacteria | 2621 |
| 145 | Ga0068863_100380823 | 3300005841 | Bacteria | 1377 |
| 146 | Ga0068858_100042801 | 3300005842 | Bacteria | 4199 |
| 147 | Ga0068858_100094287 | 3300005842 | Bacteria | 2788 |
| 148 | Ga0068858_100191147 | 3300005842 | Bacteria | 1934 |
| 149 | Ga0068860_100000467 | 3300005843 | Bacteria | 50515 |
| 150 | Ga0068860_100012237 | 3300005843 | Bacteria | 8456 |
| 151 | Ga0068862_100216380 | 3300005844 | Bacteria | 1733 |
| 152 | Ga0081455_10000030 | 3300005937 | Bacteria | 148346 |
| 153 | Ga0081455_10071377 | 3300005937 | Bacteria | 2879 |
| 154 | Ga0081455_10195177 | 3300005937 | Bacteria | 1521 |
| 155 | Ga0081455_10221912 | 3300005937 | Bacteria | 1400 |
| 156 | Ga0081538_10000065 | 3300005981 | Bacteria | 98948 |
| 157 | Ga0081540_1025012 | 3300005983 | Bacteria | 3450 |
| 158 | Ga0081539_10033921 | 3300005985 | Bacteria | 3098 |
| 159 | Ga0070717_10098364 | 3300006028 | Bacteria | 2480 |
| 160 | Ga0070717_10375462 | 3300006028 | Bacteria | 1274 |
| 161 | Ga0075365_10008147 | 3300006038 | Bacteria | 5923 |
| 162 | Ga0075365_10024606 | 3300006038 | Bacteria | 3801 |
| 163 | Ga0075365_10031885 | 3300006038 | Bacteria | 3384 |
| 164 | Ga0075365_10043984 | 3300006038 | Bacteria | 2924 |
| 165 | Ga0075365_10046940 | 3300006038 | Bacteria | 2838 |
| 166 | Ga0075365_10071600 | 3300006038 | Bacteria | 2334 |
| 167 | Ga0075365_10075681 | 3300006038 | Bacteria | 2272 |
| 168 | Ga0075365_10096041 | 3300006038 | Bacteria | 2025 |
| 169 | Ga0075365_10101048 | 3300006038 | Bacteria | 1974 |
| 170 | Ga0075365_10112732 | 3300006038 | Bacteria | 1870 |
| 171 | Ga0075365_10156839 | 3300006038 | Bacteria | 1584 |
| 172 | Ga0075365_10159500 | 3300006038 | Bacteria | 1571 |
| 173 | Ga0075365_10166502 | 3300006038 | Bacteria | 1538 |
| 174 | Ga0075368_10000363 | 3300006042 | Bacteria | 13338 |
| 175 | Ga0075368_10000952 | 3300006042 | Bacteria | 9008 |
| 176 | Ga0075368_10017449 | 3300006042 | Bacteria | 2687 |
| 177 | Ga0075368_10031645 | 3300006042 | Bacteria | 2052 |
| 178 | Ga0075363_100000170 | 3300006048 | Bacteria | 16868 |
| 179 | Ga0075363_100000416 | 3300006048 | Bacteria | 13204 |
| 180 | Ga0075363_100001116 | 3300006048 | Bacteria | 9747 |
| 181 | Ga0075363_100002522 | 3300006048 | Bacteria | 7508 |
| 182 | Ga0075363_100020550 | 3300006048 | Bacteria | 3313 |
| 183 | Ga0075363_100061961 | 3300006048 | Bacteria | 2017 |
| 184 | Ga0075363_100063141 | 3300006048 | Bacteria | 1998 |
| 185 | Ga0075363_100072134 | 3300006048 | Bacteria | 1877 |
| 186 | Ga0075363_100079254 | 3300006048 | Bacteria | 1794 |
| 187 | Ga0075364_10006272 | 3300006051 | Bacteria | 6978 |
| 188 | Ga0075364_10008594 | 3300006051 | Bacteria | 6108 |
| 189 | Ga0075364_10014601 | 3300006051 | Bacteria | 4855 |
| 190 | Ga0075364_10042989 | 3300006051 | Bacteria | 2937 |
| 191 | Ga0075364_10057116 | 3300006051 | Bacteria | 2556 |
| 192 | Ga0075364_10062326 | 3300006051 | Bacteria | 2447 |
| 193 | Ga0075364_10073802 | 3300006051 | Bacteria | 2249 |
| 194 | Ga0075364_10086073 | 3300006051 | Bacteria | 2082 |
| 195 | Ga0070715_10011892 | 3300006163 | Bacteria | 3148 |
| 196 | Ga0070716_100192595 | 3300006173 | Bacteria | 1348 |
| 197 | Ga0070712_100069159 | 3300006175 | Bacteria | 2518 |
| 198 | Ga0070712_100111253 | 3300006175 | Bacteria | 2044 |
| 199 | Ga0070712_100169574 | 3300006175 | Bacteria | 1692 |
| 200 | Ga0070712_100500521 | 3300006175 | Bacteria | 1018 |
| 201 | Ga0075362_10015327 | 3300006177 | Bacteria | 3115 |
| 202 | Ga0075367_10000401 | 3300006178 | Bacteria | 15899 |
| 203 | Ga0075367_10010955 | 3300006178 | Bacteria | 4778 |
| 204 | Ga0075367_10018148 | 3300006178 | Bacteria | 3876 |
| 205 | Ga0075367_10019136 | 3300006178 | Bacteria | 3792 |
| 206 | Ga0075367_10053572 | 3300006178 | Bacteria | 2391 |
| 207 | Ga0075367_10080839 | 3300006178 | Bacteria | 1966 |
| 208 | Ga0075367_10090433 | 3300006178 | Bacteria | 1862 |
| 209 | Ga0097621_100086442 | 3300006237 | Bacteria | 2617 |
| 210 | Ga0097621_100167876 | 3300006237 | Bacteria | 1890 |
| 211 | Ga0075370_10001511 | 3300006353 | Bacteria | 10168 |
| 212 | Ga0075370_10001569 | 3300006353 | Bacteria | 10038 |
| 213 | Ga0075370_10003287 | 3300006353 | Bacteria | 7669 |
| 214 | Ga0075370_10032220 | 3300006353 | Bacteria | 2929 |
| 215 | Ga0075370_10065800 | 3300006353 | Bacteria | 2067 |
| 216 | Ga0075428_100016372 | 3300006844 | Bacteria | 8192 |
| 217 | Ga0075428_100021526 | 3300006844 | Bacteria | 7137 |
| 218 | Ga0075428_100800667 | 3300006844 | Bacteria | 1002 |
| 219 | Ga0075430_100003986 | 3300006846 | Bacteria | 12447 |
| 220 | Ga0075431_100022766 | 3300006847 | Bacteria | 6404 |
| 221 | Ga0075431_100141258 | 3300006847 | Bacteria | 2482 |
| 222 | Ga0075433_10088568 | 3300006852 | Bacteria | 2735 |
| 223 | Ga0075429_100048371 | 3300006880 | Bacteria | 3698 |
| 224 | Ga0068865_100019619 | 3300006881 | Bacteria | 4376 |
| 225 | Ga0068865_100035311 | 3300006881 | Bacteria | 3360 |
| 226 | Ga0068865_100217837 | 3300006881 | Bacteria | 1491 |
| 227 | Ga0068865_100228041 | 3300006881 | Bacteria | 1460 |
| 228 | Ga0097620_100205006 | 3300006931 | Bacteria | 2057 |
| 229 | Ga0097620_100355027 | 3300006931 | Bacteria | 1561 |
| 230 | Ga0097620_100612567 | 3300006931 | Bacteria | 1181 |
| 231 | Ga0111539_10006328 | 3300009094 | Bacteria | 15264 |
| 232 | Ga0111539_10012179 | 3300009094 | Bacteria | 10790 |
| 233 | Ga0111539_10046610 | 3300009094 | Bacteria | 5184 |
| 234 | Ga0111539_10048292 | 3300009094 | Bacteria | 5083 |
| 235 | Ga0111539_10373232 | 3300009094 | Bacteria | 1660 |
| 236 | Ga0111539_10460281 | 3300009094 | Bacteria | 1481 |
| 237 | Ga0111539_10490536 | 3300009094 | Bacteria | 1431 |
| 238 | Ga0105245_10001389 | 3300009098 | Bacteria | 21921 |
| 239 | Ga0105245_10163601 | 3300009098 | Bacteria | 2113 |
| 240 | Ga0105245_10187166 | 3300009098 | Bacteria | 1981 |
| 241 | Ga0105245_10219360 | 3300009098 | Bacteria | 1834 |
| 242 | Ga0105245_10465027 | 3300009098 | Bacteria | 1276 |
| 243 | Ga0105245_10516366 | 3300009098 | Bacteria | 1212 |
| 244 | Ga0114129_10010931 | 3300009147 | Bacteria | 12935 |
| 245 | Ga0105243_10014099 | 3300009148 | Bacteria | 6047 |
| 246 | Ga0105243_10016322 | 3300009148 | Bacteria | 5618 |
| 247 | Ga0105243_10209072 | 3300009148 | Bacteria | 1717 |
| 248 | Ga0105243_10224463 | 3300009148 | Bacteria | 1662 |
| 249 | Ga0105242_10058334 | 3300009176 | Bacteria | 3164 |
| 250 | Ga0105242_10235375 | 3300009176 | Bacteria | 1643 |
| 251 | Ga0105242_10451169 | 3300009176 | Bacteria | 1212 |
| 252 | Ga0105248_10031669 | 3300009177 | Bacteria | 5908 |
| 253 | Ga0105248_10200240 | 3300009177 | Bacteria | 2250 |
| 254 | Ga0105248_10279932 | 3300009177 | Bacteria | 1878 |
| 255 | Ga0105237_10033781 | 3300009545 | Bacteria | 5182 |
| 256 | Ga0105237_10393879 | 3300009545 | Bacteria | 1390 |
| 257 | Ga0105238_10044672 | 3300009551 | Bacteria | 4478 |
| 258 | Ga0105238_10268573 | 3300009551 | Bacteria | 1686 |
| 259 | Ga0105238_10384194 | 3300009551 | Bacteria | 1396 |
| 260 | Ga0105238_10392380 | 3300009551 | Bacteria | 1380 |
| 261 | Ga0105238_10522303 | 3300009551 | Bacteria | 1190 |
| 262 | Ga0105249_10004469 | 3300009553 | Bacteria | 12090 |
| 263 | Ga0105249_10031845 | 3300009553 | Bacteria | 4771 |
| 264 | Ga0105249_10198452 | 3300009553 | Bacteria | 1962 |
| 265 | Ga0105249_10347224 | 3300009553 | Bacteria | 1502 |
| 266 | Ga0105239_10003376 | 3300010375 | Bacteria | 19591 |
| 267 | Ga0105239_10010898 | 3300010375 | Bacteria | 10156 |
| 268 | Ga0105239_10097739 | 3300010375 | Bacteria | 3245 |
| 269 | Ga0105239_10156809 | 3300010375 | Bacteria | 2542 |
| 270 | Ga0105239_10503710 | 3300010375 | Bacteria | 1377 |
| 271 | Ga0105246_10010063 | 3300011119 | Bacteria | 5836 |
| 272 | Ga0105246_10090788 | 3300011119 | Bacteria | 2200 |
| 273 | Ga0157346_1000863 | 3300012480 | Bacteria | 1360 |
| 274 | Ga0157371_10089881 | 3300013102 | Bacteria | 2175 |
| 275 | Ga0157370_10195463 | 3300013104 | Bacteria | 1877 |
| 276 | Ga0157370_10441299 | 3300013104 | Bacteria | 1197 |
| 277 | Ga0157369_10010908 | 3300013105 | Bacteria | 10347 |
| 278 | Ga0157369_10040542 | 3300013105 | Bacteria | 5083 |
| 279 | Ga0157369_10215533 | 3300013105 | Bacteria | 2011 |
| 280 | Ga0157369_10338537 | 3300013105 | Bacteria | 1563 |
| 281 | Ga0157369_10387946 | 3300013105 | Bacteria | 1449 |
| 282 | Ga0157369_10838189 | 3300013105 | Bacteria | 944 |
| 283 | Ga0163162_10002716 | 3300013306 | Bacteria | 16784 |
| 284 | Ga0163162_10008332 | 3300013306 | Bacteria | 10112 |
| 285 | Ga0163162_10163280 | 3300013306 | Bacteria | 2350 |
| 286 | Ga0163162_10185897 | 3300013306 | Bacteria | 2205 |
| 287 | Ga0157372_10000025 | 3300013307 | Bacteria | 195491 |
| 288 | Ga0157372_10015861 | 3300013307 | Bacteria | 8082 |
| 289 | Ga0157372_10022009 | 3300013307 | Bacteria | 6892 |
| 290 | Ga0157372_10125591 | 3300013307 | Bacteria | 2950 |
| 291 | Ga0157372_10403120 | 3300013307 | Bacteria | 1594 |
| 292 | Ga0157372_10416507 | 3300013307 | Bacteria | 1566 |
| 293 | Ga0157372_10697150 | 3300013307 | Bacteria | 1182 |
| 294 | Ga0157375_10029705 | 3300013308 | Bacteria | 5144 |
| 295 | Ga0157375_10058354 | 3300013308 | Bacteria | 3817 |
| 296 | Ga0157375_10106735 | 3300013308 | Bacteria | 2892 |
| 297 | Ga0157375_10243685 | 3300013308 | Bacteria | 1957 |
| 298 | Ga0157375_10420163 | 3300013308 | Bacteria | 1503 |
| 299 | Ga0157375_10534980 | 3300013308 | Bacteria | 1334 |
| 300 | Ga0163163_10022365 | 3300014325 | Bacteria | 5985 |
| 301 | Ga0163163_10067546 | 3300014325 | Bacteria | 3555 |
| 302 | Ga0163163_10129195 | 3300014325 | Bacteria | 2566 |
| 303 | Ga0163163_10151041 | 3300014325 | Bacteria | 2366 |
| 304 | Ga0157380_10002258 | 3300014326 | Bacteria | 12956 |
| 305 | Ga0157380_10010387 | 3300014326 | Bacteria | 6697 |
| 306 | Ga0157380_10018962 | 3300014326 | Bacteria | 5119 |
| 307 | Ga0157380_10173312 | 3300014326 | Bacteria | 1887 |
| 308 | Ga0157380_10351377 | 3300014326 | Bacteria | 1380 |
| 309 | Ga0182008_10092587 | 3300014497 | Bacteria | 1491 |
| 310 | Ga0157377_10003131 | 3300014745 | Bacteria | 7447 |
| 311 | Ga0157377_10024322 | 3300014745 | Bacteria | 3218 |
| 312 | Ga0157377_10044772 | 3300014745 | Bacteria | 2469 |
| 313 | Ga0157377_10048662 | 3300014745 | Bacteria | 2380 |
| 314 | Ga0157377_10182038 | 3300014745 | Bacteria | 1322 |
| 315 | Ga0157376_10263359 | 3300014969 | Bacteria | 1616 |
| 316 | Ga0163161_10139886 | 3300017792 | Bacteria | 1832 |
| 317 | Ga0163161_10178144 | 3300017792 | Bacteria | 1628 |
| 318 | Ga0206354_10058287 | 3300020081 | Bacteria | 1028 |
| 319 | Ga0206353_10418635 | 3300020082 | Bacteria | 1175 |
| 320 | Ga0206353_10455544 | 3300020082 | Bacteria | 2500 |
| 321 | Ga0206353_11704839 | 3300020082 | Bacteria | 2123 |
| 322 | Ga0206353_11712015 | 3300020082 | Bacteria | 3838 |
| 323 | Ga0207692_10012583 | 3300025898 | Bacteria | 3638 |
| 324 | Ga0207692_10056314 | 3300025898 | Bacteria | 2016 |
| 325 | Ga0207692_10156153 | 3300025898 | Bacteria | 1311 |
| 326 | Ga0207642_10008017 | 3300025899 | Bacteria | 3600 |
| 327 | Ga0207642_10050616 | 3300025899 | Bacteria | 1875 |
| 328 | Ga0207688_10003017 | 3300025901 | Bacteria | 9171 |
| 329 | Ga0207688_10004230 | 3300025901 | Bacteria | 7826 |
| 330 | Ga0207688_10008819 | 3300025901 | Bacteria | 5488 |
| 331 | Ga0207688_10015048 | 3300025901 | Bacteria | 4197 |
| 332 | Ga0207688_10019250 | 3300025901 | Bacteria | 3717 |
| 333 | Ga0207688_10025699 | 3300025901 | Bacteria | 3236 |
| 334 | Ga0207688_10046663 | 3300025901 | Bacteria | 2419 |
| 335 | Ga0207647_10002481 | 3300025904 | Bacteria | 13967 |
| 336 | Ga0207647_10056181 | 3300025904 | Bacteria | 2416 |
| 337 | Ga0207699_10044113 | 3300025906 | Bacteria | 2594 |
| 338 | Ga0207699_10053763 | 3300025906 | Bacteria | 2389 |
| 339 | Ga0207699_10199098 | 3300025906 | Bacteria | 1356 |
| 340 | Ga0207645_10039887 | 3300025907 | Bacteria | 3008 |
| 341 | Ga0207643_10002197 | 3300025908 | Bacteria | 10637 |
| 342 | Ga0207643_10023134 | 3300025908 | Bacteria | 3426 |
| 343 | Ga0207643_10037108 | 3300025908 | Bacteria | 2734 |
| 344 | Ga0207643_10061829 | 3300025908 | Bacteria | 2139 |
| 345 | Ga0207705_10038483 | 3300025909 | Bacteria | 3425 |
| 346 | Ga0207684_10247373 | 3300025910 | Bacteria | 1538 |
| 347 | Ga0207707_10160407 | 3300025912 | Bacteria | 1966 |
| 348 | Ga0207671_10028511 | 3300025914 | Bacteria | 4171 |
| 349 | Ga0207693_10127068 | 3300025915 | Bacteria | 2004 |
| 350 | Ga0207693_10464635 | 3300025915 | Bacteria | 989 |
| 351 | Ga0207663_10009729 | 3300025916 | Bacteria | 5089 |
| 352 | Ga0207663_10035696 | 3300025916 | Bacteria | 2985 |
| 353 | Ga0207663_10140756 | 3300025916 | Bacteria | 1680 |
| 354 | Ga0207663_10259046 | 3300025916 | Bacteria | 1284 |
| 355 | Ga0207660_10482565 | 3300025917 | Bacteria | 1005 |
| 356 | Ga0207662_10009033 | 3300025918 | Bacteria | 5475 |
| 357 | Ga0207662_10059818 | 3300025918 | Bacteria | 2284 |
| 358 | Ga0207662_10182328 | 3300025918 | Bacteria | 1351 |
| 359 | Ga0207657_10017941 | 3300025919 | Bacteria | 6772 |
| 360 | Ga0207657_10030851 | 3300025919 | Bacteria | 4859 |
| 361 | Ga0207649_10166865 | 3300025920 | Bacteria | 1530 |
| 362 | Ga0207652_10036477 | 3300025921 | Bacteria | 4156 |
| 363 | Ga0207694_10231719 | 3300025924 | Bacteria | 1508 |
| 364 | Ga0207650_10001714 | 3300025925 | Bacteria | 15564 |
| 365 | Ga0207650_10057978 | 3300025925 | Bacteria | 2882 |
| 366 | Ga0207659_10065925 | 3300025926 | Bacteria | 2626 |
| 367 | Ga0207659_10125442 | 3300025926 | Bacteria | 1973 |
| 368 | Ga0207659_10174260 | 3300025926 | Bacteria | 1699 |
| 369 | Ga0207687_10005324 | 3300025927 | Bacteria | 8521 |
| 370 | Ga0207687_10009758 | 3300025927 | Bacteria | 6280 |
| 371 | Ga0207687_10048229 | 3300025927 | Bacteria | 2956 |
| 372 | Ga0207687_10283889 | 3300025927 | Bacteria | 1328 |
| 373 | Ga0207700_10011354 | 3300025928 | Bacteria | 5673 |
| 374 | Ga0207700_10022238 | 3300025928 | Bacteria | 4347 |
| 375 | Ga0207700_10146230 | 3300025928 | Bacteria | 1948 |
| 376 | Ga0207700_10192090 | 3300025928 | Bacteria | 1716 |
| 377 | Ga0207700_10586713 | 3300025928 | Bacteria | 991 |
| 378 | Ga0207664_10047751 | 3300025929 | Bacteria | 3364 |
| 379 | Ga0207664_10122731 | 3300025929 | Bacteria | 2176 |
| 380 | Ga0207664_10169166 | 3300025929 | Bacteria | 1869 |
| 381 | Ga0207664_10181658 | 3300025929 | Bacteria | 1806 |
| 382 | Ga0207664_10292201 | 3300025929 | Bacteria | 1432 |
| 383 | Ga0207644_10027379 | 3300025931 | Bacteria | 3937 |
| 384 | Ga0207644_10043005 | 3300025931 | Bacteria | 3204 |
| 385 | Ga0207690_10023754 | 3300025932 | Bacteria | 3831 |
| 386 | Ga0207690_10040833 | 3300025932 | Bacteria | 3036 |
| 387 | Ga0207690_10069857 | 3300025932 | Bacteria | 2417 |
| 388 | Ga0207690_10107677 | 3300025932 | Bacteria | 2002 |
| 389 | Ga0207706_10017268 | 3300025933 | Bacteria | 6503 |
| 390 | Ga0207706_10111560 | 3300025933 | Bacteria | 2406 |
| 391 | Ga0207686_10057573 | 3300025934 | Bacteria | 2447 |
| 392 | Ga0207709_10025235 | 3300025935 | Bacteria | 3402 |
| 393 | Ga0207709_10065834 | 3300025935 | Bacteria | 2280 |
| 394 | Ga0207709_10105337 | 3300025935 | Bacteria | 1874 |
| 395 | Ga0207669_10011553 | 3300025937 | Bacteria | 4302 |
| 396 | Ga0207669_10058131 | 3300025937 | Bacteria | 2358 |
| 397 | Ga0207704_10007814 | 3300025938 | Bacteria | 5074 |
| 398 | Ga0207704_10010985 | 3300025938 | Bacteria | 4441 |
| 399 | Ga0207704_10029538 | 3300025938 | Bacteria | 3059 |
| 400 | Ga0207704_10112401 | 3300025938 | Bacteria | 1845 |
| 401 | Ga0207665_10071309 | 3300025939 | Bacteria | 2372 |
| 402 | Ga0207691_10018659 | 3300025940 | Bacteria | 6571 |
| 403 | Ga0207691_10019738 | 3300025940 | Bacteria | 6373 |
| 404 | Ga0207691_10059202 | 3300025940 | Bacteria | 3483 |
| 405 | Ga0207691_10062688 | 3300025940 | Bacteria | 3373 |
| 406 | Ga0207711_10220691 | 3300025941 | Bacteria | 1734 |
| 407 | Ga0207689_10079973 | 3300025942 | Bacteria | 2686 |
| 408 | Ga0207689_10088140 | 3300025942 | Bacteria | 2549 |
| 409 | Ga0207689_10101864 | 3300025942 | Bacteria | 2359 |
| 410 | Ga0207689_10183994 | 3300025942 | Bacteria | 1723 |
| 411 | Ga0207661_10007007 | 3300025944 | Bacteria | 7998 |
| 412 | Ga0207661_10011604 | 3300025944 | Bacteria | 6392 |
| 413 | Ga0207661_10013156 | 3300025944 | Bacteria | 6040 |
| 414 | Ga0207661_10071722 | 3300025944 | Bacteria | 2832 |
| 415 | Ga0207661_10103460 | 3300025944 | Bacteria | 2396 |
| 416 | Ga0207661_10163734 | 3300025944 | Bacteria | 1931 |
| 417 | Ga0207661_10215718 | 3300025944 | Bacteria | 1693 |
| 418 | Ga0207661_10324600 | 3300025944 | Bacteria | 1384 |
| 419 | Ga0207661_10385443 | 3300025944 | Bacteria | 1269 |
| 420 | Ga0207661_10390562 | 3300025944 | Bacteria | 1261 |
| 421 | Ga0207679_10015370 | 3300025945 | Bacteria | 5056 |
| 422 | Ga0207679_10090932 | 3300025945 | Bacteria | 2361 |
| 423 | Ga0207667_10085130 | 3300025949 | Bacteria | 3273 |
| 424 | Ga0207712_10018068 | 3300025961 | Bacteria | 4587 |
| 425 | Ga0207712_10214647 | 3300025961 | Bacteria | 1534 |
| 426 | Ga0207668_10078002 | 3300025972 | Bacteria | 2391 |
| 427 | Ga0207640_10120662 | 3300025981 | Bacteria | 1877 |
| 428 | Ga0207677_10039878 | 3300026023 | Bacteria | 3091 |
| 429 | Ga0207677_10099542 | 3300026023 | Bacteria | 2135 |
| 430 | Ga0207677_10245429 | 3300026023 | Bacteria | 1451 |
| 431 | Ga0207677_10273173 | 3300026023 | Bacteria | 1384 |
| 432 | Ga0207677_10493475 | 3300026023 | Bacteria | 1057 |
| 433 | Ga0207703_10081187 | 3300026035 | Bacteria | 2702 |
| 434 | Ga0207703_10100639 | 3300026035 | Bacteria | 2449 |
| 435 | Ga0207639_10089865 | 3300026041 | Bacteria | 2455 |
| 436 | Ga0207678_10000105 | 3300026067 | Bacteria | 68804 |
| 437 | Ga0207678_10041186 | 3300026067 | Bacteria | 4005 |
| 438 | Ga0207678_10109934 | 3300026067 | Bacteria | 2351 |
| 439 | Ga0207708_10000436 | 3300026075 | Bacteria | 32496 |
| 440 | Ga0207708_10001046 | 3300026075 | Bacteria | 20715 |
| 441 | Ga0207708_10004147 | 3300026075 | Bacteria | 10661 |
| 442 | Ga0207708_10004999 | 3300026075 | Bacteria | 9768 |
| 443 | Ga0207708_10057384 | 3300026075 | Bacteria | 2970 |
| 444 | Ga0207702_10062949 | 3300026078 | Bacteria | 3170 |
| 445 | Ga0207702_10068760 | 3300026078 | Bacteria | 3043 |
| 446 | Ga0207702_10496611 | 3300026078 | Bacteria | 1189 |
| 447 | Ga0207641_10055170 | 3300026088 | Bacteria | 3373 |
| 448 | Ga0207641_10100877 | 3300026088 | Bacteria | 2543 |
| 449 | Ga0207641_10371400 | 3300026088 | Bacteria | 1368 |
| 450 | Ga0207648_10003947 | 3300026089 | Bacteria | 15429 |
| 451 | Ga0207648_10004176 | 3300026089 | Bacteria | 14929 |
| 452 | Ga0207648_10057841 | 3300026089 | Bacteria | 3382 |
| 453 | Ga0207676_10002083 | 3300026095 | Bacteria | 14516 |
| 454 | Ga0207676_10016306 | 3300026095 | Bacteria | 5380 |
| 455 | Ga0207676_10503258 | 3300026095 | Bacteria | 1151 |
| 456 | Ga0207674_10019540 | 3300026116 | Bacteria | 7337 |
| 457 | Ga0207674_10042528 | 3300026116 | Bacteria | 4692 |
| 458 | Ga0207674_10120916 | 3300026116 | Bacteria | 2586 |
| 459 | Ga0207674_10135832 | 3300026116 | Bacteria | 2421 |
| 460 | Ga0207674_10305772 | 3300026116 | Bacteria | 1539 |
| 461 | Ga0207675_100004206 | 3300026118 | Bacteria | 13928 |
| 462 | Ga0207675_100004892 | 3300026118 | Bacteria | 12913 |
| 463 | Ga0207675_100082762 | 3300026118 | Bacteria | 3010 |
| 464 | Ga0207675_100526758 | 3300026118 | Bacteria | 1179 |
| 465 | Ga0207683_10021359 | 3300026121 | Bacteria | 5541 |
| 466 | Ga0207683_10043229 | 3300026121 | Bacteria | 3937 |
| 467 | Ga0207683_10053839 | 3300026121 | Bacteria | 3529 |
| 468 | Ga0207683_10098365 | 3300026121 | Bacteria | 2610 |
| 469 | Ga0207683_10308097 | 3300026121 | Bacteria | 1449 |
| 470 | Ga0207698_10129947 | 3300026142 | Bacteria | 2150 |
| 471 | Ga0207698_10176518 | 3300026142 | Bacteria | 1887 |
| 472 | Ga0207698_10239967 | 3300026142 | Bacteria | 1651 |
| 473 | Ga0209813_10003987 | 3300027866 | Bacteria | 3499 |
| 474 | Ga0209813_10004119 | 3300027866 | Bacteria | 3451 |
| 475 | Ga0209813_10007277 | 3300027866 | Bacteria | 2754 |
| 476 | Ga0209813_10061192 | 3300027866 | Bacteria | 1202 |
| 477 | Ga0207428_10030127 | 3300027907 | Bacteria | 4489 |
| 478 | Ga0207428_10051545 | 3300027907 | Bacteria | 3289 |
| 479 | Ga0207428_10335457 | 3300027907 | Bacteria | 1114 |
| 480 | Ga0268266_10051556 | 3300028379 | Bacteria | 3532 |
| 481 | Ga0268266_10111075 | 3300028379 | Bacteria | 2428 |
| 482 | Ga0268266_10144612 | 3300028379 | Bacteria | 2136 |
| 483 | Ga0268265_10179938 | 3300028380 | Bacteria | 1816 |
| 484 | Ga0268264_10000242 | 3300028381 | Bacteria | 103492 |
| 485 | Ga0268264_10001967 | 3300028381 | Bacteria | 18458 |
| 486 | Ga0268264_10004760 | 3300028381 | Bacteria | 11523 |
| 487 | Ga0268264_10039308 | 3300028381 | Bacteria | 3908 |
| 488 | Ga0265340_10000537 | 3300031247 | Bacteria | 20931 |
| 489 | Ga0307513_10015532 | 3300031456 | Bacteria | 9229 |
| 490 | Ga0307513_10092563 | 3300031456 | Bacteria | 3077 |
| 491 | Ga0307408_100407527 | 3300031548 | Bacteria | 1169 |
| 492 | Ga0307408_100427210 | 3300031548 | Bacteria | 1144 |
| 493 | Ga0316578_10001825 | 3300031728 | Bacteria | 8960 |
| 494 | Ga0307405_10142180 | 3300031731 | Bacteria | 1675 |
| 495 | Ga0307405_10245022 | 3300031731 | Bacteria | 1330 |
| 496 | Ga0307405_10350770 | 3300031731 | Bacteria | 1138 |
| 497 | Ga0307405_10360050 | 3300031731 | Bacteria | 1125 |
| 498 | Ga0307413_10041923 | 3300031824 | Bacteria | 2685 |
| 499 | Ga0307413_10057435 | 3300031824 | Bacteria | 2380 |
| 500 | Ga0307413_10139104 | 3300031824 | Bacteria | 1675 |
| 501 | Ga0307413_10149749 | 3300031824 | Bacteria | 1624 |
| 502 | Ga0307413_10170290 | 3300031824 | Bacteria | 1541 |
| 503 | Ga0307410_10006651 | 3300031852 | Bacteria | 6259 |
| 504 | Ga0307410_10010750 | 3300031852 | Bacteria | 5204 |
| 505 | Ga0307410_10018682 | 3300031852 | Bacteria | 4194 |
| 506 | Ga0307410_10087383 | 3300031852 | Bacteria | 2205 |
| 507 | Ga0307410_10116988 | 3300031852 | Bacteria | 1938 |
| 508 | Ga0307410_10250395 | 3300031852 | Bacteria | 1377 |
| 509 | Ga0307410_10342705 | 3300031852 | Bacteria | 1192 |
| 510 | Ga0307410_10388316 | 3300031852 | Bacteria | 1125 |
| 511 | Ga0307406_10031477 | 3300031901 | Bacteria | 3231 |
| 512 | Ga0307406_10048409 | 3300031901 | Bacteria | 2685 |
| 513 | Ga0307406_10084938 | 3300031901 | Bacteria | 2115 |
| 514 | Ga0307406_10104163 | 3300031901 | Bacteria | 1939 |
| 515 | Ga0307406_10145445 | 3300031901 | Bacteria | 1684 |
| 516 | Ga0307406_10221153 | 3300031901 | Bacteria | 1407 |
| 517 | Ga0307406_10288210 | 3300031901 | Bacteria | 1256 |
| 518 | Ga0307407_10004673 | 3300031903 | Bacteria | 5847 |
| 519 | Ga0307407_10010415 | 3300031903 | Bacteria | 4384 |
| 520 | Ga0307407_10015197 | 3300031903 | Bacteria | 3795 |
| 521 | Ga0307407_10016371 | 3300031903 | Bacteria | 3692 |
| 522 | Ga0307407_10017500 | 3300031903 | Bacteria | 3598 |
| 523 | Ga0307407_10062237 | 3300031903 | Bacteria | 2185 |
| 524 | Ga0307407_10244465 | 3300031903 | Bacteria | 1226 |
| 525 | Ga0307412_10345772 | 3300031911 | Bacteria | 1192 |
| 526 | Ga0307412_10498430 | 3300031911 | Bacteria | 1013 |
| 527 | Ga0307409_100009889 | 3300031995 | Bacteria | 5887 |
| 528 | Ga0307409_100011357 | 3300031995 | Bacteria | 5608 |
| 529 | Ga0307409_100016694 | 3300031995 | Bacteria | 4868 |
| 530 | Ga0307409_100030018 | 3300031995 | Bacteria | 3900 |
| 531 | Ga0307409_100034975 | 3300031995 | Bacteria | 3677 |
| 532 | Ga0307409_100038144 | 3300031995 | Bacteria | 3550 |
| 533 | Ga0307409_100046156 | 3300031995 | Bacteria | 3296 |
| 534 | Ga0307409_100060483 | 3300031995 | Bacteria | 2954 |
| 535 | Ga0307409_100063299 | 3300031995 | Bacteria | 2900 |
| 536 | Ga0307409_100071625 | 3300031995 | Bacteria | 2757 |
| 537 | Ga0307409_100097167 | 3300031995 | Bacteria | 2432 |
| 538 | Ga0307409_100108515 | 3300031995 | Bacteria | 2322 |
| 539 | Ga0307409_100128992 | 3300031995 | Bacteria | 2157 |
| 540 | Ga0307409_100151443 | 3300031995 | Bacteria | 2014 |
| 541 | Ga0307409_100215701 | 3300031995 | Bacteria | 1728 |
| 542 | Ga0307409_100240713 | 3300031995 | Bacteria | 1647 |
| 543 | Ga0307409_100254681 | 3300031995 | Bacteria | 1607 |
| 544 | Ga0307409_100329291 | 3300031995 | Bacteria | 1433 |
| 545 | Ga0307409_100437613 | 3300031995 | Bacteria | 1259 |
| 546 | Ga0307409_100440840 | 3300031995 | Bacteria | 1254 |
| 547 | Ga0307409_100492582 | 3300031995 | Bacteria | 1192 |
| 548 | Ga0307416_100002883 | 3300032002 | Bacteria | 10017 |
| 549 | Ga0307416_100002929 | 3300032002 | Bacteria | 9946 |
| 550 | Ga0307416_100012921 | 3300032002 | Bacteria | 5651 |
| 551 | Ga0307416_100048729 | 3300032002 | Bacteria | 3363 |
| 552 | Ga0307416_100051207 | 3300032002 | Bacteria | 3297 |
| 553 | Ga0307416_100065621 | 3300032002 | Bacteria | 2984 |
| 554 | Ga0307416_100102938 | 3300032002 | Bacteria | 2491 |
| 555 | Ga0307416_100186307 | 3300032002 | Bacteria | 1951 |
| 556 | Ga0307416_100299986 | 3300032002 | Bacteria | 1596 |
| 557 | Ga0307416_100395067 | 3300032002 | Bacteria | 1418 |
| 558 | Ga0307411_10068352 | 3300032005 | Bacteria | 2394 |
| 559 | Ga0307411_10076823 | 3300032005 | Bacteria | 2284 |
| 560 | Ga0307411_10095665 | 3300032005 | Bacteria | 2086 |
| 561 | Ga0307411_10221500 | 3300032005 | Bacteria | 1468 |
| 562 | Ga0307415_100007652 | 3300032126 | Bacteria | 5927 |
| 563 | Ga0307415_100009492 | 3300032126 | Bacteria | 5459 |
| 564 | Ga0307415_100021802 | 3300032126 | Bacteria | 3945 |
| 565 | Ga0307415_100026466 | 3300032126 | Bacteria | 3660 |
| 566 | Ga0307415_100038392 | 3300032126 | Bacteria | 3155 |
| 567 | Ga0307415_100089813 | 3300032126 | Bacteria | 2220 |
| 568 | Ga0307415_100089941 | 3300032126 | Bacteria | 2219 |
| 569 | Ga0307415_100107507 | 3300032126 | Bacteria | 2061 |
| 570 | Ga0307415_100118290 | 3300032126 | Bacteria | 1981 |
| 571 | Ga0307415_100283300 | 3300032126 | Bacteria | 1364 |
| 572 | Ga0307415_100620128 | 3300032126 | Bacteria | 965 |
| 573 | Ga0316583_10029656 | 3300032133 | Bacteria | 1950 |
| 574 | Ga0373938_0031409 | 3300034957 | Bacteria | 1139 |
| 575 | Ga0373926_0027830 | 3300035083 | Bacteria | 1982 |
| 576 | Ga0373934_0002754 | 3300035086 | Bacteria | 6447 |
| 577 | Ga0373944_0011334 | 3300035089 | Bacteria | 2441 |
| 578 | Ga0373923_0023500 | 3300035111 | Bacteria | 2425 |
| 579 | Ga0373923_0055474 | 3300035111 | Bacteria | 1670 |
| 580 | Ga0373936_0026431 | 3300035113 | Bacteria | 2272 |
| 581 | Ga0373936_0055578 | 3300035113 | Bacteria | 1607 |
| 582 | Ga0373945_0039542 | 3300035116 | Bacteria | 1700 |
| 583 | Ga0373953_0000821 | 3300035117 | Bacteria | 8685 |
| 584 | Ga0373954_0001563 | 3300035118 | Bacteria | 9326 |
| 585 | Ga0373956_0003221 | 3300035119 | Bacteria | 6590 |
| 586 | Ga0373957_0001428 | 3300035120 | Bacteria | 6465 |
| 587 | Ga0373943_0048468 | 3300035170 | Bacteria | 2081 |
| 588 | Ga0373946_0013175 | 3300035171 | Bacteria | 3103 |
| 589 | Ga0373955_0082888 | 3300035172 | Bacteria | 1815 |
| 590 | Ga0373955_0108511 | 3300035172 | Bacteria | 1602 |
| 591 | Ga0316574_0007917 | 3300035398 | Bacteria | 5865 |
| 592 | Ga0373924_0016500 | 3300035410 | Bacteria | 2819 |
| 593 | Ga0373927_0040940 | 3300035695 | Bacteria | 3005 |
| 594 | Ga0373933_0005000 | 3300035724 | Bacteria | 7231 |
| 595 | Ga0373947_0023550 | 3300035725 | Bacteria | 3583 |
| 596 | Ga0373947_0056553 | 3300035725 | Bacteria | 2371 |
| 597 | Ga0373937_0010654 | 3300036401 | Bacteria | 8037 |
| 598 | Ga0373937_0208215 | 3300036401 | Bacteria | 1839 |
| 599 | Ga0316584_0003766 | 3300036712 | Bacteria | 9935 |
| 600 | Ga0373925_0031453 | 3300037068 | Bacteria | 3900 |
| 601 | Ga0373925_0093661 | 3300037068 | Bacteria | 2299 |
| 602 | Ga0395900_0026320 | 3300037418 | Bacteria | 5957 |
| 603 | Ga0395900_0058762 | 3300037418 | Bacteria | 3959 |
| 604 | Ga0395898_0169591 | 3300037466 | Bacteria | 2086 |
| 605 | Ga0395905_0054291 | 3300037471 | Bacteria | 3750 |
| 606 | Ga0395905_0190772 | 3300037471 | Bacteria | 1922 |
| 607 | Ga0436364_0849504 | 3300037853 | Bacteria | 2397 |
| 608 | Ga0436364_1495084 | 3300037853 | Bacteria | 3514 |
| 609 | Ga0395901_0011948 | 3300038443 | Bacteria | 8806 |
| 610 | Ga0395901_0139889 | 3300038443 | Bacteria | 2544 |
| 611 | Ga0395901_0148039 | 3300038443 | Bacteria | 2467 |
| 612 | Ga0395901_0213971 | 3300038443 | Bacteria | 2016 |
| 613 | Ga0400483_021589 | 3300039062 | Bacteria | 5824 |
| 614 | Ga0400483_095912 | 3300039062 | Bacteria | 3768 |
| 615 | Ga0400483_209527 | 3300039062 | Bacteria | 2526 |
| 616 | Ga0436365_1063556 | 3300039437 | Bacteria | 1138 |
| 617 | Ga0436365_1544034 | 3300039437 | Bacteria | 1161 |
| 618 | Ga0451843_0051158 | 3300041509 | Bacteria | 1602 |
| 619 | Ga0439459_0030276 | 3300042438 | Bacteria | 1097 |
| 620 | Ga0466972_0176165 | 3300044658 | Bacteria | 1003 |
| 621 | Ga0466965_0000459 | 3300044683 | Bacteria | 14372 |
| 622 | Ga0466965_0004751 | 3300044683 | Bacteria | 6056 |
| 623 | Ga0466965_0012067 | 3300044683 | Bacteria | 4057 |
| 624 | Ga0466965_0025243 | 3300044683 | Bacteria | 2877 |
| 625 | Ga0466965_0048241 | 3300044683 | Bacteria | 2110 |
| 626 | Ga0466965_0069717 | 3300044683 | Bacteria | 1767 |
| 627 | Ga0466965_0093393 | 3300044683 | Bacteria | 1532 |
| 628 | Ga0466961_0035163 | 3300044693 | Bacteria | 3217 |
| 629 | Ga0466961_0109053 | 3300044693 | Bacteria | 1742 |
| 630 | Ga0466963_0038739 | 3300044694 | Bacteria | 3119 |
| 631 | Ga0466963_0069680 | 3300044694 | Bacteria | 2364 |
| 632 | Ga0466964_0031608 | 3300044706 | Bacteria | 2100 |
| 633 | Ga0466964_0048533 | 3300044706 | Bacteria | 1736 |
| 634 | Ga0466964_0054265 | 3300044706 | Bacteria | 1652 |
| 635 | Ga0466970_0012324 | 3300044765 | Bacteria | 4369 |
| 636 | Ga0466970_0015359 | 3300044765 | Bacteria | 3936 |
| 637 | Ga0466970_0018226 | 3300044765 | Bacteria | 3632 |
| 638 | Ga0466970_0033313 | 3300044765 | Bacteria | 2723 |
| 639 | Ga0466970_0098294 | 3300044765 | Bacteria | 1593 |
| 640 | Ga0466957_0001115 | 3300044842 | Bacteria | 13906 |
| 641 | Ga0466957_0084176 | 3300044842 | Bacteria | 1985 |
| 642 | Ga0466957_0096568 | 3300044842 | Bacteria | 1857 |
| 643 | Ga0466960_0000350 | 3300044901 | Bacteria | 15766 |
| 644 | Ga0466960_0006974 | 3300044901 | Bacteria | 4563 |
| 645 | Ga0466960_0008191 | 3300044901 | Bacteria | 4272 |
| 646 | Ga0466960_0016237 | 3300044901 | Bacteria | 3225 |
| 647 | Ga0466960_0023651 | 3300044901 | Bacteria | 2761 |
| 648 | Ga0466960_0047414 | 3300044901 | Bacteria | 2061 |
| 649 | Ga0466960_0054466 | 3300044901 | Bacteria | 1942 |
| 650 | Ga0466960_0098125 | 3300044901 | Bacteria | 1504 |
| 651 | Ga0451576_0414424 | 3300045051 | Bacteria | 1413 |
| 652 | Ga0466958_0042983 | 3300045836 | Bacteria | 2721 |
| 653 | Ga0466958_0094123 | 3300045836 | Bacteria | 1856 |
| 654 | Ga0466967_0003975 | 3300045976 | Bacteria | 9844 |
| 655 | Ga0466967_0065708 | 3300045976 | Bacteria | 3229 |
| 656 | Ga0466967_0073531 | 3300045976 | Bacteria | 3067 |
| 657 | Ga0466967_0095098 | 3300045976 | Bacteria | 2715 |
| 658 | Ga0466967_0119523 | 3300045976 | Bacteria | 2432 |
| 659 | Ga0466967_0143725 | 3300045976 | Bacteria | 2224 |
| 660 | Ga0466967_0153107 | 3300045976 | Bacteria | 2157 |
| 661 | Ga0466967_0159795 | 3300045976 | Bacteria | 2114 |
| 662 | Ga0466967_0170963 | 3300045976 | Bacteria | 2044 |
| 663 | Ga0466967_0183525 | 3300045976 | Bacteria | 1974 |
| 664 | Ga0466967_0244570 | 3300045976 | Bacteria | 1712 |
| 665 | Ga0466967_0252036 | 3300045976 | Bacteria | 1686 |
| 666 | Ga0466967_0495608 | 3300045976 | Bacteria | 1198 |
| 667 | Ga0495592_0000397 | 3300046454 | Bacteria | 33962 |
| 668 | Ga0495592_0008095 | 3300046454 | Bacteria | 7893 |
| 669 | Ga0495603_0095528 | 3300046455 | Bacteria | 1737 |
| 670 | Ga0495629_0107549 | 3300046459 | Bacteria | 1945 |
| 671 | Ga0495629_0161015 | 3300046459 | Bacteria | 1559 |
| 672 | Ga0495641_0051291 | 3300046461 | Bacteria | 1884 |
| 673 | Ga0495641_0057979 | 3300046461 | Bacteria | 1753 |
| 674 | Ga0495641_0080767 | 3300046461 | Bacteria | 1457 |
| 675 | Ga0495651_0126575 | 3300046462 | Bacteria | 1870 |
| 676 | Ga0495651_0126576 | 3300046462 | Bacteria | 1870 |
| 677 | Ga0495653_0120545 | 3300046463 | Bacteria | 1870 |
| 678 | Ga0495653_0165079 | 3300046463 | Bacteria | 1534 |
| 679 | Ga0495582_0079567 | 3300046473 | Bacteria | 1819 |
| 680 | Ga0495664_0007931 | 3300046477 | Bacteria | 5911 |
| 681 | Ga0495664_0087709 | 3300046477 | Bacteria | 1869 |
| 682 | Ga0495608_0089230 | 3300046511 | Bacteria | 1995 |
| 683 | Ga0495608_0089231 | 3300046511 | Bacteria | 1995 |
| 684 | Ga0495608_0105594 | 3300046511 | Bacteria | 1813 |
| 685 | Ga0495618_0009751 | 3300046514 | Bacteria | 5802 |
| 686 | Ga0495628_0005043 | 3300046516 | Bacteria | 11605 |
| 687 | Ga0495628_0122322 | 3300046516 | Bacteria | 1995 |
| 688 | Ga0495630_0055169 | 3300046517 | Bacteria | 2977 |
| 689 | Ga0495630_0152328 | 3300046517 | Bacteria | 1759 |
| 690 | Ga0495652_0002110 | 3300046529 | Bacteria | 20949 |
| 691 | Ga0495652_0049416 | 3300046529 | Bacteria | 3601 |
| 692 | Ga0495652_0108948 | 3300046529 | Bacteria | 2231 |
| 693 | Ga0495665_0093433 | 3300046531 | Bacteria | 1580 |
| 694 | Ga0495640_0067173 | 3300046533 | Bacteria | 2415 |
| 695 | Ga0495586_0015106 | 3300046535 | Bacteria | 4108 |
| 696 | Ga0495587_0029133 | 3300046536 | Bacteria | 3353 |
| 697 | Ga0495587_0099998 | 3300046536 | Bacteria | 1671 |
| 698 | Ga0495645_0003234 | 3300046543 | Bacteria | 11048 |
| 699 | Ga0495645_0010242 | 3300046543 | Bacteria | 6569 |
| 700 | Ga0495667_0011880 | 3300046559 | Bacteria | 5898 |
| 701 | Ga0495667_0114499 | 3300046559 | Bacteria | 1742 |
| 702 | Ga0495634_0021736 | 3300046642 | Bacteria | 4529 |
| 703 | Ga0495635_0074934 | 3300046663 | Bacteria | 2318 |
| 704 | Ga0495635_0111827 | 3300046663 | Bacteria | 1865 |
| 705 | Ga0495657_0192128 | 3300046675 | Bacteria | 1247 |
| 706 | Ga0495599_0017017 | 3300046678 | Bacteria | 4516 |
| 707 | Ga0495599_0084661 | 3300046678 | Bacteria | 1980 |
| 708 | Ga0495623_0019997 | 3300046679 | Bacteria | 4328 |
| 709 | Ga0495623_0100901 | 3300046679 | Bacteria | 1758 |
| 710 | Ga0495646_0002659 | 3300046680 | Bacteria | 11047 |
| 711 | Ga0495646_0004480 | 3300046680 | Bacteria | 8799 |
| 712 | Ga0495658_0086658 | 3300046683 | Bacteria | 1848 |
| 713 | Ga0495613_0039703 | 3300046689 | Bacteria | 3489 |
| 714 | Ga0495624_0137472 | 3300046690 | Bacteria | 1497 |
| 715 | Ga0495600_0009608 | 3300046809 | Bacteria | 5979 |
| 716 | Ga0495600_0056669 | 3300046809 | Bacteria | 2560 |
| 717 | Ga0495604_0004132 | 3300047317 | Bacteria | 11524 |
| 718 | Ga0495604_0042757 | 3300047317 | Bacteria | 3549 |
| 719 | Ga0495674_0088829 | 3300047319 | Bacteria | 2642 |
| 720 | Ga0495676_0085788 | 3300047321 | Bacteria | 2371 |
| 721 | Ga0495676_0124145 | 3300047321 | Bacteria | 1873 |
| 722 | Ga0495680_0001602 | 3300047322 | Bacteria | 24122 |
| 723 | Ga0495680_0096739 | 3300047322 | Bacteria | 2204 |
| 724 | Ga0495680_0120073 | 3300047322 | Bacteria | 1941 |
| 725 | Ga0495675_0034575 | 3300047444 | Bacteria | 3226 |
| 726 | Ga0495675_0225124 | 3300047444 | Bacteria | 1133 |
| 727 | Ga0495684_0000603 | 3300047471 | Bacteria | 28888 |
| 728 | Ga0495684_0138994 | 3300047471 | Bacteria | 1821 |
| 729 | Ga0495602_0017251 | 3300048088 | Bacteria | 7239 |
| 730 | Ga0495602_0018432 | 3300048088 | Bacteria | 6970 |
| 731 | Ga0496100_0003839 | 3300048903 | Bacteria | 7879 |
| 732 | Ga0496100_0032129 | 3300048903 | Bacteria | 3269 |
| 733 | Ga0496100_0252908 | 3300048903 | Bacteria | 1304 |
| 734 | Ga0496101_0013820 | 3300048904 | Bacteria | 5419 |
| 735 | Ga0496101_0134755 | 3300048904 | Bacteria | 1878 |
| 736 | Ga0496102_0002619 | 3300048905 | Bacteria | 15298 |
| 737 | Ga0496102_0008782 | 3300048905 | Bacteria | 8665 |
| 738 | Ga0496102_0013364 | 3300048905 | Bacteria | 7111 |
| 739 | Ga0496102_0015121 | 3300048905 | Bacteria | 6719 |
| 740 | Ga0496102_0033772 | 3300048905 | Bacteria | 4600 |
| 741 | Ga0496102_0051165 | 3300048905 | Bacteria | 3763 |
| 742 | Ga0496102_0079766 | 3300048905 | Bacteria | 3014 |
| 743 | Ga0496102_0136298 | 3300048905 | Bacteria | 2300 |
| 744 | Ga0496102_0154518 | 3300048905 | Bacteria | 2157 |
| 745 | Ga0496102_0177590 | 3300048905 | Bacteria | 2005 |
| 746 | Ga0496102_0601730 | 3300048905 | Bacteria | 1022 |
| 747 | Ga0496103_0009545 | 3300048906 | Bacteria | 5745 |
| 748 | Ga0496103_0018415 | 3300048906 | Bacteria | 4189 |
| 749 | Ga0496103_0048923 | 3300048906 | Bacteria | 2613 |
| 750 | Ga0496103_0085930 | 3300048906 | Bacteria | 1982 |
| 751 | Ga0496103_0160825 | 3300048906 | Bacteria | 1440 |
| 752 | Ga0496103_0246457 | 3300048906 | Bacteria | 1150 |
| 753 | Ga0496104_0030323 | 3300048907 | Bacteria | 5024 |
| 754 | Ga0496104_0072786 | 3300048907 | Bacteria | 3268 |
| 755 | Ga0496104_0103668 | 3300048907 | Bacteria | 2725 |
| 756 | Ga0496104_0222010 | 3300048907 | Bacteria | 1802 |
| 757 | Ga0496104_0234198 | 3300048907 | Bacteria | 1748 |
| 758 | Ga0496104_0260922 | 3300048907 | Bacteria | 1645 |
| 759 | Ga0496105_0004639 | 3300048908 | Bacteria | 10358 |
| 760 | Ga0496105_0010601 | 3300048908 | Bacteria | 7251 |
| 761 | Ga0496105_0013044 | 3300048908 | Bacteria | 6586 |
| 762 | Ga0496105_0046910 | 3300048908 | Bacteria | 3566 |
| 763 | Ga0496105_0071322 | 3300048908 | Bacteria | 2871 |
| 764 | Ga0496105_0112375 | 3300048908 | Bacteria | 2248 |
| 765 | Ga0496105_0134554 | 3300048908 | Bacteria | 2037 |
| 766 | Ga0496105_0151400 | 3300048908 | Bacteria | 1906 |
| 767 | Ga0496105_0163927 | 3300048908 | Bacteria | 1824 |
| 768 | Ga0496105_0233606 | 3300048908 | Bacteria | 1494 |
| 769 | Ga0496105_0465742 | 3300048908 | Bacteria | 996 |
| 770 | Ga0496106_0055833 | 3300048909 | Bacteria | 2985 |
| 771 | Ga0496107_0028957 | 3300048910 | Bacteria | 3938 |
| 772 | Ga0496107_0038148 | 3300048910 | Bacteria | 3447 |
| 773 | Ga0496107_0071877 | 3300048910 | Bacteria | 2514 |
| 774 | Ga0496107_0130879 | 3300048910 | Bacteria | 1852 |
| 775 | Ga0496107_0144379 | 3300048910 | Bacteria | 1759 |
| 776 | Ga0496107_0264463 | 3300048910 | Bacteria | 1280 |
| 777 | Ga0496107_0317528 | 3300048910 | Bacteria | 1159 |
| 778 | Ga0496107_0438783 | 3300048910 | Bacteria | 970 |
| 779 | Ga0496107_0487344 | 3300048910 | Bacteria | 915 |
| 780 | Ga0496108_0008499 | 3300048911 | Bacteria | 8329 |
| 781 | Ga0496108_0019824 | 3300048911 | Bacteria | 5526 |
| 782 | Ga0496108_0055934 | 3300048911 | Bacteria | 3314 |
| 783 | Ga0496108_0057158 | 3300048911 | Bacteria | 3278 |
| 784 | Ga0496108_0170747 | 3300048911 | Bacteria | 1881 |
| 785 | Ga0496108_0251142 | 3300048911 | Bacteria | 1539 |
| 786 | Ga0496108_0279324 | 3300048911 | Bacteria | 1454 |
| 787 | Ga0496108_0327330 | 3300048911 | Bacteria | 1336 |
| 788 | Ga0496109_0014295 | 3300048912 | Bacteria | 6907 |
| 789 | Ga0496109_0015913 | 3300048912 | Bacteria | 6569 |
| 790 | Ga0496109_0058785 | 3300048912 | Bacteria | 3512 |
| 791 | Ga0496109_0061158 | 3300048912 | Bacteria | 3442 |
| 792 | Ga0496109_0088079 | 3300048912 | Bacteria | 2868 |
| 793 | Ga0496109_0095372 | 3300048912 | Bacteria | 2754 |
| 794 | Ga0496109_0195072 | 3300048912 | Bacteria | 1903 |
| 795 | Ga0496109_0195396 | 3300048912 | Bacteria | 1901 |
| 796 | Ga0496109_0214230 | 3300048912 | Bacteria | 1811 |
| 797 | Ga0496109_0224563 | 3300048912 | Bacteria | 1767 |
| 798 | Ga0496109_0242584 | 3300048912 | Bacteria | 1696 |
| 799 | Ga0496109_0550688 | 3300048912 | Bacteria | 1088 |
| 800 | Ga0496109_0583580 | 3300048912 | Bacteria | 1053 |
| 801 | Ga0496110_0006612 | 3300048913 | Bacteria | 9209 |
| 802 | Ga0496110_0012958 | 3300048913 | Bacteria | 6875 |
| 803 | Ga0496110_0022918 | 3300048913 | Bacteria | 5306 |
| 804 | Ga0496110_0079099 | 3300048913 | Bacteria | 2927 |
| 805 | Ga0496110_0082241 | 3300048913 | Bacteria | 2872 |
| 806 | Ga0496110_0083440 | 3300048913 | Bacteria | 2851 |
| 807 | Ga0496110_0088856 | 3300048913 | Bacteria | 2760 |
| 808 | Ga0496110_0138698 | 3300048913 | Bacteria | 2198 |
| 809 | Ga0496110_0296797 | 3300048913 | Bacteria | 1472 |
| 810 | Ga0496110_0310798 | 3300048913 | Bacteria | 1435 |
| 811 | Ga0496110_0369646 | 3300048913 | Bacteria | 1307 |
| 812 | Ga0496111_0000863 | 3300048914 | Bacteria | 16436 |
| 813 | Ga0496111_0012659 | 3300048914 | Bacteria | 5717 |
| 814 | Ga0496112_0154324 | 3300048915 | Bacteria | 2263 |
| 815 | Ga0496112_0206213 | 3300048915 | Bacteria | 1924 |
| 816 | Ga0496112_0639119 | 3300048915 | Bacteria | 994 |
| 817 | Ga0496113_0036543 | 3300048916 | Bacteria | 3599 |
| 818 | Ga0496113_0038091 | 3300048916 | Bacteria | 3533 |
| 819 | Ga0496113_0358369 | 3300048916 | Bacteria | 1170 |
| 820 | Ga0496114_0002152 | 3300048917 | Bacteria | 14991 |
| 821 | Ga0496114_0003522 | 3300048917 | Bacteria | 12014 |
| 822 | Ga0496114_0005765 | 3300048917 | Bacteria | 9725 |
| 823 | Ga0496114_0008014 | 3300048917 | Bacteria | 8359 |
| 824 | Ga0496114_0033141 | 3300048917 | Bacteria | 4255 |
| 825 | Ga0496114_0074275 | 3300048917 | Bacteria | 2862 |
| 826 | Ga0496114_0090983 | 3300048917 | Bacteria | 2590 |
| 827 | Ga0496114_0107067 | 3300048917 | Bacteria | 2392 |
| 828 | Ga0496114_0160447 | 3300048917 | Bacteria | 1954 |
| 829 | Ga0496114_0216338 | 3300048917 | Bacteria | 1681 |
| 830 | Ga0496114_0303922 | 3300048917 | Bacteria | 1408 |
| 831 | Ga0496114_0353064 | 3300048917 | Bacteria | 1301 |
| 832 | Ga0496114_0463582 | 3300048917 | Bacteria | 1121 |
| 833 | Ga0496115_0029443 | 3300048918 | Bacteria | 4312 |
| 834 | Ga0496115_0091212 | 3300048918 | Bacteria | 2490 |
| 835 | Ga0496118_0173804 | 3300048921 | Bacteria | 1312 |
| 836 | Ga0496119_0014608 | 3300048922 | Bacteria | 6124 |
| 837 | Ga0496120_0006161 | 3300048923 | Bacteria | 9285 |
| 838 | Ga0496121_0035843 | 3300048924 | Bacteria | 4434 |
| 839 | Ga0496121_0169453 | 3300048924 | Bacteria | 1588 |
| 840 | Ga0496123_0078694 | 3300048926 | Bacteria | 2018 |
| 841 | Ga0496124_0228974 | 3300048927 | Bacteria | 1391 |
| 842 | Ga0496126_0000039 | 3300048929 | Bacteria | 347353 |
| 843 | Ga0501309_002015 | 3300049129 | Bacteria | 2123 |
| 844 | Ga0501291_020713 | 3300049514 | Bacteria | 1043 |
| 845 | Ga0501298_023437 | 3300049521 | Bacteria | 1170 |
| 846 | Ga0501031_0001569 | 3300049568 | Bacteria | 14236 |
| 847 | Ga0501031_0019479 | 3300049568 | Bacteria | 4421 |
| 848 | Ga0501031_0056192 | 3300049568 | Bacteria | 2564 |
| 849 | Ga0501031_0060482 | 3300049568 | Bacteria | 2468 |
| 850 | Ga0501031_0091406 | 3300049568 | Bacteria | 1985 |
| 851 | Ga0501031_0104827 | 3300049568 | Bacteria | 1845 |
| 852 | Ga0501032_0059829 | 3300049569 | Bacteria | 2556 |
| 853 | Ga0501032_0066357 | 3300049569 | Bacteria | 2411 |
| 854 | Ga0501032_0077745 | 3300049569 | Bacteria | 2209 |
| 855 | Ga0501033_0003386 | 3300049570 | Bacteria | 13153 |
| 856 | Ga0501034_0051347 | 3300049571 | Bacteria | 4158 |
| 857 | Ga0501034_0054748 | 3300049571 | Bacteria | 4016 |
| 858 | Ga0501034_0064361 | 3300049571 | Bacteria | 3681 |
| 859 | Ga0501036_0001694 | 3300049572 | Bacteria | 17122 |
| 860 | Ga0501036_0006122 | 3300049572 | Bacteria | 9765 |
| 861 | Ga0501036_0017266 | 3300049572 | Bacteria | 6031 |
| 862 | Ga0501036_0033743 | 3300049572 | Bacteria | 4328 |
| 863 | Ga0501036_0072369 | 3300049572 | Bacteria | 2914 |
| 864 | Ga0501036_0121489 | 3300049572 | Bacteria | 2206 |
| 865 | Ga0501036_0207628 | 3300049572 | Bacteria | 1646 |
| 866 | Ga0501037_0023454 | 3300049573 | Bacteria | 4562 |
| 867 | Ga0501037_0087179 | 3300049573 | Bacteria | 2259 |
| 868 | Ga0501037_0091380 | 3300049573 | Bacteria | 2201 |
| 869 | Ga0501037_0105898 | 3300049573 | Bacteria | 2027 |
| 870 | Ga0501037_0114203 | 3300049573 | Bacteria | 1944 |
| 871 | Ga0501038_0004008 | 3300049574 | Bacteria | 13683 |
| 872 | Ga0501038_0013769 | 3300049574 | Bacteria | 7371 |
| 873 | Ga0501039_0007037 | 3300049575 | Bacteria | 8560 |
| 874 | Ga0501040_0001709 | 3300049576 | Bacteria | 14063 |
| 875 | Ga0501040_0011354 | 3300049576 | Bacteria | 5830 |
| 876 | Ga0501040_0054839 | 3300049576 | Bacteria | 2733 |
| 877 | Ga0501040_0232480 | 3300049576 | Bacteria | 1313 |
| 878 | Ga0501040_0357141 | 3300049576 | Bacteria | 1047 |
| 879 | Ga0501041_0021998 | 3300049577 | Bacteria | 3818 |
| 880 | Ga0501041_0069015 | 3300049577 | Bacteria | 2167 |
| 881 | Ga0501041_0140093 | 3300049577 | Bacteria | 1508 |
| 882 | Ga0501042_0003027 | 3300049578 | Bacteria | 10455 |
| 883 | Ga0501042_0006792 | 3300049578 | Bacteria | 7460 |
| 884 | Ga0501042_0046751 | 3300049578 | Bacteria | 3085 |
| 885 | Ga0501043_0134861 | 3300049579 | Bacteria | 1934 |
| 886 | Ga0501046_0010342 | 3300049580 | Bacteria | 8021 |
| 887 | Ga0501046_0057893 | 3300049580 | Bacteria | 3039 |
| 888 | Ga0501046_0073585 | 3300049580 | Bacteria | 2651 |
| 889 | Ga0501047_0033893 | 3300049581 | Bacteria | 4928 |
| 890 | Ga0501048_0007035 | 3300049582 | Bacteria | 8544 |
| 891 | Ga0501048_0040541 | 3300049582 | Bacteria | 3336 |
| 892 | Ga0501067_0004112 | 3300049583 | Bacteria | 8022 |
| 893 | Ga0501067_0009441 | 3300049583 | Bacteria | 5406 |
| 894 | Ga0501067_0060698 | 3300049583 | Bacteria | 2093 |
| 895 | Ga0501067_0104913 | 3300049583 | Bacteria | 1570 |
| 896 | Ga0501067_0166254 | 3300049583 | Bacteria | 1228 |
| 897 | Ga0501068_0056147 | 3300049584 | Bacteria | 2387 |
| 898 | Ga0501068_0130005 | 3300049584 | Bacteria | 1574 |
| 899 | Ga0501069_0004130 | 3300049585 | Bacteria | 7498 |
| 900 | Ga0501069_0007837 | 3300049585 | Bacteria | 5607 |
| 901 | Ga0501069_0009384 | 3300049585 | Bacteria | 5165 |
| 902 | Ga0501069_0017089 | 3300049585 | Bacteria | 3901 |
| 903 | Ga0501069_0035271 | 3300049585 | Bacteria | 2755 |
| 904 | Ga0501069_0095019 | 3300049585 | Bacteria | 1688 |
| 905 | Ga0501069_0137160 | 3300049585 | Bacteria | 1402 |
| 906 | Ga0501070_0003855 | 3300049586 | Bacteria | 12939 |
| 907 | Ga0501070_0004279 | 3300049586 | Bacteria | 12279 |
| 908 | Ga0501070_0021270 | 3300049586 | Bacteria | 5444 |
| 909 | Ga0501070_0032937 | 3300049586 | Bacteria | 4335 |
| 910 | Ga0501070_0035442 | 3300049586 | Bacteria | 4169 |
| 911 | Ga0501070_0042917 | 3300049586 | Bacteria | 3765 |
| 912 | Ga0501070_0097933 | 3300049586 | Bacteria | 2426 |
| 913 | Ga0501070_0222332 | 3300049586 | Bacteria | 1548 |
| 914 | Ga0501070_0442156 | 3300049586 | Bacteria | 1049 |
| 915 | Ga0501071_0005666 | 3300049587 | Bacteria | 8054 |
| 916 | Ga0501071_0005962 | 3300049587 | Bacteria | 7890 |
| 917 | Ga0501071_0053300 | 3300049587 | Bacteria | 2917 |
| 918 | Ga0501071_0222462 | 3300049587 | Bacteria | 1421 |
| 919 | Ga0501072_0006084 | 3300049588 | Bacteria | 9211 |
| 920 | Ga0501072_0009890 | 3300049588 | Bacteria | 7253 |
| 921 | Ga0501072_0035834 | 3300049588 | Bacteria | 3888 |
| 922 | Ga0501072_0052339 | 3300049588 | Bacteria | 3215 |
| 923 | Ga0501072_0054608 | 3300049588 | Bacteria | 3147 |
| 924 | Ga0501072_0070974 | 3300049588 | Bacteria | 2751 |
| 925 | Ga0501072_0082701 | 3300049588 | Bacteria | 2545 |
| 926 | Ga0501072_0111824 | 3300049588 | Bacteria | 2174 |
| 927 | Ga0501073_0004693 | 3300049589 | Bacteria | 10261 |
| 928 | Ga0501073_0019457 | 3300049589 | Bacteria | 4901 |
| 929 | Ga0501073_0056459 | 3300049589 | Bacteria | 2746 |
| 930 | Ga0501073_0063282 | 3300049589 | Bacteria | 2581 |
| 931 | Ga0501073_0251170 | 3300049589 | Bacteria | 1221 |
| 932 | Ga0501073_0454919 | 3300049589 | Bacteria | 885 |
| 933 | Ga0501074_0007589 | 3300049590 | Bacteria | 7849 |
| 934 | Ga0501074_0008026 | 3300049590 | Bacteria | 7644 |
| 935 | Ga0501074_0016168 | 3300049590 | Bacteria | 5422 |
| 936 | Ga0501074_0035660 | 3300049590 | Bacteria | 3604 |
| 937 | Ga0501074_0049798 | 3300049590 | Bacteria | 3024 |
| 938 | Ga0501074_0093115 | 3300049590 | Bacteria | 2158 |
| 939 | Ga0501074_0106098 | 3300049590 | Bacteria | 2011 |
| 940 | Ga0501074_0108479 | 3300049590 | Bacteria | 1987 |
| 941 | Ga0501075_0009610 | 3300049591 | Bacteria | 6769 |
| 942 | Ga0501075_0067091 | 3300049591 | Bacteria | 2709 |
| 943 | Ga0501075_0138846 | 3300049591 | Bacteria | 1851 |
| 944 | Ga0501076_0011478 | 3300049592 | Bacteria | 6600 |
| 945 | Ga0501076_0049489 | 3300049592 | Bacteria | 3324 |
| 946 | Ga0501076_0086503 | 3300049592 | Bacteria | 2519 |
| 947 | Ga0501076_0086562 | 3300049592 | Bacteria | 2519 |
| 948 | Ga0501077_0007878 | 3300049593 | Bacteria | 6579 |
| 949 | Ga0501077_0009576 | 3300049593 | Bacteria | 6023 |
| 950 | Ga0501077_0011162 | 3300049593 | Bacteria | 5604 |
| 951 | Ga0501077_0022311 | 3300049593 | Bacteria | 4009 |
| 952 | Ga0501079_0058312 | 3300049741 | Bacteria | 2979 |
| 953 | Ga0501079_0079143 | 3300049741 | Bacteria | 2542 |
| 954 | Ga0501079_0093028 | 3300049741 | Bacteria | 2336 |
| 955 | Ga0501080_0000857 | 3300049742 | Bacteria | 24883 |
| 956 | Ga0501080_0013574 | 3300049742 | Bacteria | 7500 |
| 957 | Ga0501080_0029465 | 3300049742 | Bacteria | 5110 |
| 958 | Ga0501080_0039249 | 3300049742 | Bacteria | 4419 |
| 959 | Ga0501080_0157491 | 3300049742 | Bacteria | 2098 |
| 960 | Ga0501080_0292281 | 3300049742 | Bacteria | 1479 |
| 961 | Ga0501081_0017918 | 3300049743 | Bacteria | 4697 |
| 962 | Ga0501081_0329002 | 3300049743 | Bacteria | 1124 |
| 963 | Ga0501083_0020109 | 3300049744 | Bacteria | 4645 |
| 964 | Ga0501083_0112653 | 3300049744 | Bacteria | 1788 |
| 965 | Ga0501035_0021194 | 3300049822 | Bacteria | 5973 |
| 966 | Ga0501035_0032558 | 3300049822 | Bacteria | 4742 |
| 967 | Ga0501044_0040033 | 3300049823 | Bacteria | 4886 |
| 968 | Ga0501045_0002747 | 3300049824 | Bacteria | 12022 |
| 969 | Ga0501045_0019867 | 3300049824 | Bacteria | 4795 |
| 970 | Ga0501045_0070494 | 3300049824 | Bacteria | 2572 |
| 971 | Ga0501045_0074104 | 3300049824 | Bacteria | 2507 |
| 972 | Ga0501045_0114517 | 3300049824 | Bacteria | 2000 |
| 973 | Ga0501045_0134072 | 3300049824 | Bacteria | 1841 |
| 974 | Ga0501045_0380013 | 3300049824 | Bacteria | 1051 |
| 975 | nmdc:mga03683_108033_c1 | 3300050489 | Bacteria | 1228 |
| 976 | nmdc:mga03n38_131271_c1 | 3300050490 | Bacteria | 1242 |
| 977 | nmdc:mga03n38_15364_c1 | 3300050490 | Bacteria | 2955 |
| 978 | nmdc:mga03n38_1536_c1 | 3300050490 | Bacteria | 6688 |
| 979 | nmdc:mga03n38_16936_c1 | 3300050490 | Bacteria | 2845 |
| 980 | nmdc:mga03n38_31013_c1 | 3300050490 | Bacteria | 2252 |
| 981 | nmdc:mga03n38_51853_c1 | 3300050490 | Bacteria | 1834 |
| 982 | nmdc:mga03n38_87017_c1 | 3300050490 | Bacteria | 1480 |
| 983 | nmdc:mga03n38_92194_c1 | 3300050490 | Bacteria | 1445 |
| 984 | nmdc:mga03n38_92387_c1 | 3300050490 | Bacteria | 1443 |
| 985 | nmdc:mga03n38_9497_c1 | 3300050490 | Bacteria | 3543 |
| 986 | nmdc:mga00v17_101428_c1 | 3300050491 | Bacteria | 1817 |
| 987 | nmdc:mga00v17_12728_c1 | 3300050491 | Bacteria | 4647 |
| 988 | nmdc:mga00v17_13995_c1 | 3300050491 | Bacteria | 4468 |
| 989 | nmdc:mga00v17_167026_c1 | 3300050491 | Bacteria | 1418 |
| 990 | nmdc:mga00v17_18892_c1 | 3300050491 | Bacteria | 3924 |
| 991 | nmdc:mga00v17_199295_c1 | 3300050491 | Bacteria | 1294 |
| 992 | nmdc:mga00v17_22363_c1 | 3300050491 | Bacteria | 3648 |
| 993 | nmdc:mga00v17_30291_c1 | 3300050491 | Bacteria | 3183 |
| 994 | nmdc:mga00v17_32669_c1 | 3300050491 | Bacteria | 3078 |
| 995 | nmdc:mga00v17_49842_c1 | 3300050491 | Bacteria | 2542 |
| 996 | nmdc:mga00v17_89878_c1 | 3300050491 | Bacteria | 1927 |
| 997 | nmdc:mga0yw44_100306_c1 | 3300050492 | Bacteria | 1843 |
| 998 | nmdc:mga0yw44_105970_c1 | 3300050492 | Bacteria | 1796 |
| 999 | nmdc:mga0yw44_119425_c1 | 3300050492 | Bacteria | 1697 |
| 1000 | nmdc:mga0yw44_146689_c1 | 3300050492 | Bacteria | 1537 |
| 1001 | nmdc:mga0yw44_18098_c1 | 3300050492 | Bacteria | 3852 |
| 1002 | nmdc:mga0yw44_18114_c1 | 3300050492 | Bacteria | 3850 |
| 1003 | nmdc:mga0yw44_36814_c1 | 3300050492 | Bacteria | 2886 |
| 1004 | nmdc:mga0yw44_38807_c1 | 3300050492 | Bacteria | 2820 |
| 1005 | nmdc:mga0yw44_51998_c1 | 3300050492 | Bacteria | 2483 |
| 1006 | nmdc:mga0yw44_56569_c1 | 3300050492 | Bacteria | 2390 |
| 1007 | nmdc:mga0yw44_7733_c1 | 3300050492 | Bacteria | 5309 |
| 1008 | nmdc:mga0yw44_98052_c1 | 3300050492 | Bacteria | 1863 |
| 1009 | nmdc:mga06z11_26368_c1 | 3300050494 | Bacteria | 2765 |
| 1010 | nmdc:mga06z11_56530_c1 | 3300050494 | Bacteria | 2030 |
| 1011 | nmdc:mga06z11_69554_c1 | 3300050494 | Bacteria | 1859 |
| 1012 | nmdc:mga06z11_8413_c1 | 3300050494 | Bacteria | 4301 |
| 1013 | nmdc:mga04h51_102509_c1 | 3300050495 | Bacteria | 1045 |
| 1014 | nmdc:mga04h51_23893_c1 | 3300050495 | Bacteria | 1866 |
| 1015 | nmdc:mga07m45_101514_c1 | 3300050496 | Bacteria | 1652 |
| 1016 | nmdc:mga07m45_2647_c1 | 3300050496 | Bacteria | 8434 |
| 1017 | nmdc:mga07m45_44396_c1 | 3300050496 | Bacteria | 2495 |
| 1018 | nmdc:mga07m45_80186_c1 | 3300050496 | Bacteria | 1864 |
| 1019 | nmdc:mga07m45_9130_c1 | 3300050496 | Bacteria | 5123 |
| 1020 | nmdc:mga07m45_97695_c1 | 3300050496 | Bacteria | 1685 |
| 1021 | nmdc:mga05p37_147426_c1 | 3300050507 | Bacteria | 2880 |
| 1022 | nmdc:mga09592_291569_c1 | 3300050508 | Bacteria | 1415 |
| 1023 | nmdc:mga06r32_15209_c1 | 3300050510 | Bacteria | 6991 |
| 1024 | nmdc:mga06r32_191537_c1 | 3300050510 | Bacteria | 2032 |
| 1025 | nmdc:mga08y16_101083_c1 | 3300050511 | Bacteria | 3002 |
| 1026 | nmdc:mga08y16_201480_c1 | 3300050511 | Bacteria | 2063 |
| 1027 | nmdc:mga08y16_426063_c1 | 3300050511 | Bacteria | 1356 |
| 1028 | nmdc:mga08y16_4414_c1 | 3300050511 | Bacteria | 14702 |
| 1029 | nmdc:mga08y16_62979_c1 | 3300050511 | Bacteria | 3874 |
| 1030 | nmdc:mga08y16_692626_c1 | 3300050511 | Bacteria | 1020 |
| 1031 | nmdc:mga0rr50_403682_c1 | 3300050513 | Bacteria | 1155 |
| 1032 | nmdc:mga0a205_124922_c1 | 3300050515 | Bacteria | 2473 |
| 1033 | Ga0495601_0209487 | 3300053077 | Bacteria | 1273 |
| 1034 | Ga0495612_0013400 | 3300053078 | Bacteria | 3302 |
| 1035 | Ga0495595_0123021 | 3300053084 | Bacteria | 1264 |
| 1036 | Ga0495619_0023815 | 3300053085 | Bacteria | 3924 |
| 1037 | Ga0495619_0340286 | 3300053085 | Bacteria | 1038 |
| 1038 | Ga0500643_000239 | 3300053087 | Bacteria | 51005 |
| 1039 | Ga0500644_0000050 | 3300053088 | Bacteria | 71907 |
| 1040 | Ga0500644_0000104 | 3300053088 | Bacteria | 53398 |
| 1041 | Ga0500644_0081935 | 3300053088 | Bacteria | 1188 |
| 1042 | Ga0500554_008044 | 3300053102 | Bacteria | 2458 |
| 1043 | Ga0500554_078163 | 3300053102 | Bacteria | 1086 |
| 1044 | Ga0500556_0001058 | 3300053104 | Bacteria | 14153 |
| 1045 | Ga0500593_000179 | 3300053117 | Bacteria | 25713 |
| 1046 | Ga0500573_0018977 | 3300053140 | Bacteria | 3931 |
| 1047 | Ga0500616_0000060 | 3300053153 | Bacteria | 252252 |
| 1048 | Ga0500616_0000792 | 3300053153 | Bacteria | 36236 |
| 1049 | Ga0501084_0021438 | 3300054114 | Bacteria | 5384 |
| 1050 | Ga0501084_0158009 | 3300054114 | Bacteria | 1912 |
| 1051 | Ga0501084_0331367 | 3300054114 | Bacteria | 1285 |
| 1052 | Ga0501084_0350322 | 3300054114 | Bacteria | 1248 |
| 1053 | Ga0587073_0015132 | 3300059492 | Bacteria | 1385 |
| 1054 | Ga0587111_0020289 | 3300060346 | Bacteria | 1270 |
| 1055 | Ga0501082_0019122 | 3300060353 | Bacteria | 5902 |
| 1056 | Ga0501082_0046676 | 3300060353 | Bacteria | 3733 |
| 1057 | Ga0501082_0083012 | 3300060353 | Bacteria | 2764 |
| 1058 | Ga0501082_0134419 | 3300060353 | Bacteria | 2146 |
| 1059 | Ga0501082_0160522 | 3300060353 | Bacteria | 1953 |
| 1060 | Ga0501082_0237345 | 3300060353 | Bacteria | 1587 |
| 1061 | Ga0501082_0392189 | 3300060353 | Bacteria | 1211 |
| 1062 | Ga0530510_0029698 | 3300061734 | Bacteria | 3925 |
| 1063 | Ga0530510_0030715 | 3300061734 | Bacteria | 3860 |
| 1064 | 2643850090 | 2643221567 | Bacteria | 4163945 |
| 1065 | 2643853500 | 2643221567 | Bacteria | 4163945 |
| 1066 | 2643889890 | 2643221576 | Bacteria | 5214352 |
| 1067 | 2643893244 | 2643221576 | Bacteria | 5214352 |
| 1068 | 2643958946 | 2643221590 | Bacteria | 5214697 |
| 1069 | 2643961697 | 2643221590 | Bacteria | 5214697 |
| 1070 | 2644033896 | 2643221604 | Bacteria | 5014917 |
| 1071 | 2644034027 | 2643221604 | Bacteria | 5014917 |
| 1072 | 2644091769 | 2643221615 | Bacteria | 5487866 |
| 1073 | 2644102586 | 2643221617 | Bacteria | 5139111 |
| 1074 | 2644118248 | 2643221620 | Bacteria | 5134593 |
| 1075 | 2644136092 | 2643221624 | Bacteria | 4384879 |
| 1076 | 2644137461 | 2643221624 | Bacteria | 4384879 |
| 1077 | 2644228333 | 2643221641 | Bacteria | 4490190 |
| 1078 | 2644321572 | 2643221657 | Bacteria | 5490246 |
| 1079 | 2644609995 | 2643221711 | Bacteria | 4865335 |
| 1080 | 2645720479 | 2643221961 | Bacteria | 3919167 |
| 1081 | 2645723438 | 2643221962 | Bacteria | 3874254 |
| 1082 | 2738871640 | 2738541305 | Bacteria | 4910150 |
| 1083 | 2739603387 | 2739367653 | Bacteria | 2780952 |
| 1084 | 2740165843 | 2739367898 | Bacteria | 4367674 |
| 1085 | 2774393828 | 2773857762 | Bacteria | 5971770 |
| 1086 | 2784470931 | 2784132109 | Bacteria | 3141763 |
| 1087 | 2812331744 | 2811994874 | Bacteria | 5367947 |
| 1088 | 2812333915 | 2811994874 | Bacteria | 5367947 |
| 1089 | 2812350174 | 2811994878 | Bacteria | 5992952 |
| 1090 | 2819425474 | 2818991318 | Bacteria | 5266538 |
| 1091 | 2819667844 | 2818991458 | Bacteria | 4794049 |
| 1092 | 2819690251 | 2818991462 | Bacteria | 4320267 |
| 1093 | 2819726201 | 2818991469 | Bacteria | 4644110 |
| 1094 | 2855388905 | 2855386786 | Bacteria | 4752232 |
| 1095 | 2857483235 | 2857481737 | Bacteria | 4761446 |
| 1096 | 2857483533 | 2857481737 | Bacteria | 4761446 |
| 1097 | 2857727350 | 2857727296 | Bacteria | 2745552 |
| 1098 | 2984577222 | 2984576629 | Bacteria | 4248407 |
| 1099 | 2984579189 | 2984576629 | Bacteria | 4248407 |
| 1100 | 2990259918 | 2990256926 | Bacteria | 4252839 |
| 1101 | 2990260633 | 2990256926 | Bacteria | 4252839 |
| 1102 | 8054609651 | 8054609563 | Bacteria | 5170090 |
| 1103 | 8054611362 | 8054609563 | Bacteria | 5170090 |
| 1104 | Ga0075365_10054794 | |||
| 1105 | JGI24741J21665_1009250 | |||
| 1106 | JGI24752J21851_1003606 | |||
| 1107 | JGI24740J21852_10016912 | |||
| 1108 | JGI24739J22299_10024977 | |||
| 1109 | JGI24737J22298_10002340 | |||
| 1110 | JGI24735J21928_10012866 | |||
| 1111 | JGI24738J21930_10012282 | |||
| 1112 | JGI24738J21930_10013790 | |||
| 1113 | JGI24751J29686_10009083 | |||
| 1114 | Ga0006562J51391_1041093 | |||
| 1115 | Ga0070658_10022845 | |||
| 1116 | Ga0070658_10052400 | |||
| 1117 | Ga0070658_10174949 | |||
| 1118 | Ga0070676_10008718 | |||
| 1119 | Ga0070683_100004272 | |||
| 1120 | Ga0070683_100068068 | |||
| 1121 | Ga0070683_100188442 | |||
| 1122 | Ga0070683_100530843 | |||
| 1123 | Ga0070670_100030720 | |||
| 1124 | Ga0070670_100055693 | |||
| 1125 | Ga0070670_100139943 | |||
| 1126 | Ga0070670_100156954 | |||
| 1127 | Ga0068869_100101416 | |||
| 1128 | Ga0070666_10111673 | |||
| 1129 | Ga0070680_100086487 | |||
| 1130 | Ga0070682_100020935 | |||
| 1131 | Ga0070682_100033181 | |||
| 1132 | Ga0070682_100087180 | |||
| 1133 | Ga0068868_100130078 | |||
| 1134 | Ga0068868_100155424 | |||
| 1135 | Ga0068868_100219377 | |||
| 1136 | Ga0068868_100337182 | |||
| 1137 | Ga0070660_100026821 | |||
| 1138 | Ga0070691_10008438 | |||
| 1139 | Ga0070691_10032720 | |||
| 1140 | Ga0070687_100067500 | |||
| 1141 | Ga0070687_100170331 | |||
| 1142 | Ga0070661_100083997 | |||
| 1143 | Ga0070661_100096484 | |||
| 1144 | Ga0070692_10031200 | |||
| 1145 | Ga0070692_10063357 | |||
| 1146 | Ga0070669_100085049 | |||
| 1147 | Ga0070669_100113295 | |||
| 1148 | Ga0070675_100003729 | |||
| 1149 | Ga0070675_100081721 | |||
| 1150 | Ga0070675_100201298 | |||
| 1151 | Ga0070671_100001796 | |||
| 1152 | Ga0070671_100284606 | |||
| 1153 | Ga0070674_100020561 | |||
| 1154 | Ga0070674_100028612 | |||
| 1155 | Ga0070674_100064123 | |||
| 1156 | Ga0070673_100194741 | |||
| 1157 | Ga0070659_100017443 | |||
| 1158 | Ga0070659_100031226 | |||
| 1159 | Ga0070659_100111701 | |||
| 1160 | Ga0070667_100105794 | |||
| 1161 | Ga0070709_10018818 | |||
| 1162 | Ga0070709_10219397 | |||
| 1163 | Ga0070709_10226601 | |||
| 1164 | Ga0070709_10318096 | |||
| 1165 | Ga0070714_100145978 | |||
| 1166 | Ga0070714_100351591 | |||
| 1167 | Ga0070713_100499694 | |||
| 1168 | Ga0070710_10033092 | |||
| 1169 | Ga0070710_10196074 | |||
| 1170 | Ga0070701_10002525 | |||
| 1171 | Ga0070701_10004513 | |||
| 1172 | Ga0070701_10013161 | |||
| 1173 | Ga0070711_100107191 | |||
| 1174 | Ga0070711_100305484 | |||
| 1175 | Ga0070711_100518832 | |||
| 1176 | Ga0070705_100173239 | |||
| 1177 | Ga0070700_100011432 | |||
| 1178 | Ga0070700_100016043 | |||
| 1179 | Ga0070700_100033084 | |||
| 1180 | Ga0070700_100074634 | |||
| 1181 | Ga0070663_100026021 | |||
| 1182 | Ga0070678_100073846 | |||
| 1183 | Ga0070678_100152184 | |||
| 1184 | Ga0070662_100023827 | |||
| 1185 | Ga0070681_10216441 | |||
| 1186 | Ga0068867_100019341 | |||
| 1187 | Ga0068867_100060741 | |||
| 1188 | Ga0070685_10066406 | |||
| 1189 | Ga0070706_100417038 | |||
| 1190 | Ga0070679_100079751 | |||
| 1191 | Ga0070684_100005484 | |||
| 1192 | Ga0070684_100007079 | |||
| 1193 | Ga0070684_100069190 | |||
| 1194 | Ga0070684_100084213 | |||
| 1195 | Ga0070684_100093417 | |||
| 1196 | Ga0070684_100104682 | |||
| 1197 | Ga0070684_100366711 | |||
| 1198 | Ga0068853_100190760 | |||
| 1199 | Ga0068853_100332806 | |||
| 1200 | Ga0068853_100332826 | |||
| 1201 | Ga0070672_100058530 | |||
| 1202 | Ga0070693_100021585 | |||
| 1203 | Ga0070693_100140788 | |||
| 1204 | Ga0070665_100000273 | |||
| 1205 | Ga0070665_100000957 | |||
| 1206 | Ga0070665_100001051 | |||
| 1207 | Ga0070665_100006876 | |||
| 1208 | Ga0070665_100019437 | |||
| 1209 | Ga0068855_100051021 | |||
| 1210 | Ga0068855_100148667 | |||
| 1211 | Ga0068855_100250575 | |||
| 1212 | Ga0068855_100672769 | |||
| 1213 | Ga0068855_100833010 | |||
| 1214 | Ga0070664_100006966 | |||
| 1215 | Ga0070664_100073978 | |||
| 1216 | Ga0070664_100282178 | |||
| 1217 | Ga0068857_100022586 | |||
| 1218 | Ga0068857_100047898 | |||
| 1219 | Ga0068857_100067847 | |||
| 1220 | Ga0068857_100108497 | |||
| 1221 | Ga0068857_100315139 | |||
| 1222 | Ga0068854_100380884 | |||
| 1223 | Ga0068854_100441639 | |||
| 1224 | Ga0068854_100470469 | |||
| 1225 | Ga0068856_100007197 | |||
| 1226 | Ga0068856_100191745 | |||
| 1227 | Ga0068856_100274287 | |||
| 1228 | Ga0070702_100007278 | |||
| 1229 | Ga0070702_100040366 | |||
| 1230 | Ga0070702_100092910 | |||
| 1231 | Ga0070702_100139491 | |||
| 1232 | Ga0070702_100236934 | |||
| 1233 | Ga0068852_100017197 | |||
| 1234 | Ga0068852_100027017 | |||
| 1235 | Ga0068852_100055241 | |||
| 1236 | Ga0068852_100349429 | |||
| 1237 | Ga0068859_100205012 | |||
| 1238 | Ga0068859_100355058 | |||
| 1239 | Ga0068859_100612565 | |||
| 1240 | Ga0068864_100021818 | |||
| 1241 | Ga0068864_100107890 | |||
| 1242 | Ga0068861_100027454 | |||
| 1243 | Ga0068861_100029179 | |||
| 1244 | Ga0068861_100116466 | |||
| 1245 | Ga0068861_100127864 | |||
| 1246 | Ga0068861_100158172 | |||
| 1247 | Ga0068870_10033509 | |||
| 1248 | Ga0068863_100380823 | |||
| 1249 | Ga0068858_100042801 | |||
| 1250 | Ga0068858_100094287 | |||
| 1251 | Ga0068858_100191147 | |||
| 1252 | Ga0068860_100000467 | |||
| 1253 | Ga0068860_100012237 | |||
| 1254 | Ga0068862_100216380 | |||
| 1255 | Ga0081455_10000030 | |||
| 1256 | Ga0081455_10071377 | |||
| 1257 | Ga0081455_10195177 | |||
| 1258 | Ga0081455_10221912 | |||
| 1259 | Ga0081538_10000065 | |||
| 1260 | Ga0081540_1025012 | |||
| 1261 | Ga0081539_10033921 | |||
| 1262 | Ga0070717_10098364 | |||
| 1263 | Ga0070717_10375462 | |||
| 1264 | Ga0075365_10008147 | |||
| 1265 | Ga0075365_10024606 | |||
| 1266 | Ga0075365_10031885 | |||
| 1267 | Ga0075365_10043984 | |||
| 1268 | Ga0075365_10046940 | |||
| 1269 | Ga0075365_10071600 | |||
| 1270 | Ga0075365_10075681 | |||
| 1271 | Ga0075365_10096041 | |||
| 1272 | Ga0075365_10101048 | |||
| 1273 | Ga0075365_10112732 | |||
| 1274 | Ga0075365_10156839 | |||
| 1275 | Ga0075365_10159500 | |||
| 1276 | Ga0075365_10166502 | |||
| 1277 | Ga0075368_10000363 | |||
| 1278 | Ga0075368_10000952 | |||
| 1279 | Ga0075368_10017449 | |||
| 1280 | Ga0075368_10031645 | |||
| 1281 | Ga0075363_100000170 | |||
| 1282 | Ga0075363_100000416 | |||
| 1283 | Ga0075363_100001116 | |||
| 1284 | Ga0075363_100002522 | |||
| 1285 | Ga0075363_100020550 | |||
| 1286 | Ga0075363_100061961 | |||
| 1287 | Ga0075363_100063141 | |||
| 1288 | Ga0075363_100072134 | |||
| 1289 | Ga0075363_100079254 | |||
| 1290 | Ga0075364_10006272 | |||
| 1291 | Ga0075364_10008594 | |||
| 1292 | Ga0075364_10014601 | |||
| 1293 | Ga0075364_10042989 | |||
| 1294 | Ga0075364_10057116 | |||
| 1295 | Ga0075364_10062326 | |||
| 1296 | Ga0075364_10073802 | |||
| 1297 | Ga0075364_10086073 | |||
| 1298 | Ga0070715_10011892 | |||
| 1299 | Ga0070716_100192595 | |||
| 1300 | Ga0070712_100069159 | |||
| 1301 | Ga0070712_100111253 | |||
| 1302 | Ga0070712_100169574 | |||
| 1303 | Ga0070712_100500521 | |||
| 1304 | Ga0075362_10015327 | |||
| 1305 | Ga0075367_10000401 | |||
| 1306 | Ga0075367_10010955 | |||
| 1307 | Ga0075367_10018148 | |||
| 1308 | Ga0075367_10019136 | |||
| 1309 | Ga0075367_10053572 | |||
| 1310 | Ga0075367_10080839 | |||
| 1311 | Ga0075367_10090433 | |||
| 1312 | Ga0097621_100086442 | |||
| 1313 | Ga0097621_100167876 | |||
| 1314 | Ga0075370_10001511 | |||
| 1315 | Ga0075370_10001569 | |||
| 1316 | Ga0075370_10003287 | |||
| 1317 | Ga0075370_10032220 | |||
| 1318 | Ga0075370_10065800 | |||
| 1319 | Ga0075428_100016372 | |||
| 1320 | Ga0075428_100021526 | |||
| 1321 | Ga0075428_100800667 | |||
| 1322 | Ga0075430_100003986 | |||
| 1323 | Ga0075431_100022766 | |||
| 1324 | Ga0075431_100141258 | |||
| 1325 | Ga0075433_10088568 | |||
| 1326 | Ga0075429_100048371 | |||
| 1327 | Ga0068865_100019619 | |||
| 1328 | Ga0068865_100035311 | |||
| 1329 | Ga0068865_100217837 | |||
| 1330 | Ga0068865_100228041 | |||
| 1331 | Ga0097620_100205006 | |||
| 1332 | Ga0097620_100355027 | |||
| 1333 | Ga0097620_100612567 | |||
| 1334 | Ga0111539_10006328 | |||
| 1335 | Ga0111539_10012179 | |||
| 1336 | Ga0111539_10046610 | |||
| 1337 | Ga0111539_10048292 | |||
| 1338 | Ga0111539_10373232 | |||
| 1339 | Ga0111539_10460281 | |||
| 1340 | Ga0111539_10490536 | |||
| 1341 | Ga0105245_10001389 | |||
| 1342 | Ga0105245_10163601 | |||
| 1343 | Ga0105245_10187166 | |||
| 1344 | Ga0105245_10219360 | |||
| 1345 | Ga0105245_10465027 | |||
| 1346 | Ga0105245_10516366 | |||
| 1347 | Ga0114129_10010931 | |||
| 1348 | Ga0105243_10014099 | |||
| 1349 | Ga0105243_10016322 | |||
| 1350 | Ga0105243_10209072 | |||
| 1351 | Ga0105243_10224463 | |||
| 1352 | Ga0105242_10058334 | |||
| 1353 | Ga0105242_10235375 | |||
| 1354 | Ga0105242_10451169 | |||
| 1355 | Ga0105248_10031669 | |||
| 1356 | Ga0105248_10200240 | |||
| 1357 | Ga0105248_10279932 | |||
| 1358 | Ga0105237_10033781 | |||
| 1359 | Ga0105237_10393879 | |||
| 1360 | Ga0105238_10044672 | |||
| 1361 | Ga0105238_10268573 | |||
| 1362 | Ga0105238_10384194 | |||
| 1363 | Ga0105238_10392380 | |||
| 1364 | Ga0105238_10522303 | |||
| 1365 | Ga0105249_10004469 | |||
| 1366 | Ga0105249_10031845 | |||
| 1367 | Ga0105249_10198452 | |||
| 1368 | Ga0105249_10347224 | |||
| 1369 | Ga0105239_10003376 | |||
| 1370 | Ga0105239_10010898 | |||
| 1371 | Ga0105239_10097739 | |||
| 1372 | Ga0105239_10156809 | |||
| 1373 | Ga0105239_10503710 | |||
| 1374 | Ga0105246_10010063 | |||
| 1375 | Ga0105246_10090788 | |||
| 1376 | Ga0157346_1000863 | |||
| 1377 | Ga0157371_10089881 | |||
| 1378 | Ga0157370_10195463 | |||
| 1379 | Ga0157370_10441299 | |||
| 1380 | Ga0157369_10010908 | |||
| 1381 | Ga0157369_10040542 | |||
| 1382 | Ga0157369_10215533 | |||
| 1383 | Ga0157369_10338537 | |||
| 1384 | Ga0157369_10387946 | |||
| 1385 | Ga0157369_10838189 | |||
| 1386 | Ga0163162_10002716 | |||
| 1387 | Ga0163162_10008332 | |||
| 1388 | Ga0163162_10163280 | |||
| 1389 | Ga0163162_10185897 | |||
| 1390 | Ga0157372_10000025 | |||
| 1391 | Ga0157372_10015861 | |||
| 1392 | Ga0157372_10022009 | |||
| 1393 | Ga0157372_10125591 | |||
| 1394 | Ga0157372_10403120 | |||
| 1395 | Ga0157372_10416507 | |||
| 1396 | Ga0157372_10697150 | |||
| 1397 | Ga0157375_10029705 | |||
| 1398 | Ga0157375_10058354 | |||
| 1399 | Ga0157375_10106735 | |||
| 1400 | Ga0157375_10243685 | |||
| 1401 | Ga0157375_10420163 | |||
| 1402 | Ga0157375_10534980 | |||
| 1403 | Ga0163163_10022365 | |||
| 1404 | Ga0163163_10067546 | |||
| 1405 | Ga0163163_10129195 | |||
| 1406 | Ga0163163_10151041 | |||
| 1407 | Ga0157380_10002258 | |||
| 1408 | Ga0157380_10010387 | |||
| 1409 | Ga0157380_10018962 | |||
| 1410 | Ga0157380_10173312 | |||
| 1411 | Ga0157380_10351377 | |||
| 1412 | Ga0182008_10092587 | |||
| 1413 | Ga0157377_10003131 | |||
| 1414 | Ga0157377_10024322 | |||
| 1415 | Ga0157377_10044772 | |||
| 1416 | Ga0157377_10048662 | |||
| 1417 | Ga0157377_10182038 | |||
| 1418 | Ga0157376_10263359 | |||
| 1419 | Ga0163161_10139886 | |||
| 1420 | Ga0163161_10178144 | |||
| 1421 | Ga0206354_10058287 | |||
| 1422 | Ga0206353_10418635 | |||
| 1423 | Ga0206353_10455544 | |||
| 1424 | Ga0206353_11704839 | |||
| 1425 | Ga0206353_11712015 | |||
| 1426 | Ga0207692_10012583 | |||
| 1427 | Ga0207692_10056314 | |||
| 1428 | Ga0207692_10156153 | |||
| 1429 | Ga0207642_10008017 | |||
| 1430 | Ga0207642_10050616 | |||
| 1431 | Ga0207688_10003017 | |||
| 1432 | Ga0207688_10004230 | |||
| 1433 | Ga0207688_10008819 | |||
| 1434 | Ga0207688_10015048 | |||
| 1435 | Ga0207688_10019250 | |||
| 1436 | Ga0207688_10025699 | |||
| 1437 | Ga0207688_10046663 | |||
| 1438 | Ga0207647_10002481 | |||
| 1439 | Ga0207647_10056181 | |||
| 1440 | Ga0207699_10044113 | |||
| 1441 | Ga0207699_10053763 | |||
| 1442 | Ga0207699_10199098 | |||
| 1443 | Ga0207645_10039887 | |||
| 1444 | Ga0207643_10002197 | |||
| 1445 | Ga0207643_10023134 | |||
| 1446 | Ga0207643_10037108 | |||
| 1447 | Ga0207643_10061829 | |||
| 1448 | Ga0207705_10038483 | |||
| 1449 | Ga0207684_10247373 | |||
| 1450 | Ga0207707_10160407 | |||
| 1451 | Ga0207671_10028511 | |||
| 1452 | Ga0207693_10127068 | |||
| 1453 | Ga0207693_10464635 | |||
| 1454 | Ga0207663_10009729 | |||
| 1455 | Ga0207663_10035696 | |||
| 1456 | Ga0207663_10140756 | |||
| 1457 | Ga0207663_10259046 | |||
| 1458 | Ga0207660_10482565 | |||
| 1459 | Ga0207662_10009033 | |||
| 1460 | Ga0207662_10059818 | |||
| 1461 | Ga0207662_10182328 | |||
| 1462 | Ga0207657_10017941 | |||
| 1463 | Ga0207657_10030851 | |||
| 1464 | Ga0207649_10166865 | |||
| 1465 | Ga0207652_10036477 | |||
| 1466 | Ga0207694_10231719 | |||
| 1467 | Ga0207650_10001714 | |||
| 1468 | Ga0207650_10057978 | |||
| 1469 | Ga0207659_10065925 | |||
| 1470 | Ga0207659_10125442 | |||
| 1471 | Ga0207659_10174260 | |||
| 1472 | Ga0207687_10005324 | |||
| 1473 | Ga0207687_10009758 | |||
| 1474 | Ga0207687_10048229 | |||
| 1475 | Ga0207687_10283889 | |||
| 1476 | Ga0207700_10011354 | |||
| 1477 | Ga0207700_10022238 | |||
| 1478 | Ga0207700_10146230 | |||
| 1479 | Ga0207700_10192090 | |||
| 1480 | Ga0207700_10586713 | |||
| 1481 | Ga0207664_10047751 | |||
| 1482 | Ga0207664_10122731 | |||
| 1483 | Ga0207664_10169166 | |||
| 1484 | Ga0207664_10181658 | |||
| 1485 | Ga0207664_10292201 | |||
| 1486 | Ga0207644_10027379 | |||
| 1487 | Ga0207644_10043005 | |||
| 1488 | Ga0207690_10023754 | |||
| 1489 | Ga0207690_10040833 | |||
| 1490 | Ga0207690_10069857 | |||
| 1491 | Ga0207690_10107677 | |||
| 1492 | Ga0207706_10017268 | |||
| 1493 | Ga0207706_10111560 | |||
| 1494 | Ga0207686_10057573 | |||
| 1495 | Ga0207709_10025235 | |||
| 1496 | Ga0207709_10065834 | |||
| 1497 | Ga0207709_10105337 | |||
| 1498 | Ga0207669_10011553 | |||
| 1499 | Ga0207669_10058131 | |||
| 1500 | Ga0207704_10007814 | |||
| 1501 | Ga0207704_10010985 | |||
| 1502 | Ga0207704_10029538 | |||
| 1503 | Ga0207704_10112401 | |||
| 1504 | Ga0207665_10071309 | |||
| 1505 | Ga0207691_10018659 | |||
| 1506 | Ga0207691_10019738 | |||
| 1507 | Ga0207691_10059202 | |||
| 1508 | Ga0207691_10062688 | |||
| 1509 | Ga0207711_10220691 | |||
| 1510 | Ga0207689_10079973 | |||
| 1511 | Ga0207689_10088140 | |||
| 1512 | Ga0207689_10101864 | |||
| 1513 | Ga0207689_10183994 | |||
| 1514 | Ga0207661_10007007 | |||
| 1515 | Ga0207661_10011604 | |||
| 1516 | Ga0207661_10013156 | |||
| 1517 | Ga0207661_10071722 | |||
| 1518 | Ga0207661_10103460 | |||
| 1519 | Ga0207661_10163734 | |||
| 1520 | Ga0207661_10215718 | |||
| 1521 | Ga0207661_10324600 | |||
| 1522 | Ga0207661_10385443 | |||
| 1523 | Ga0207661_10390562 | |||
| 1524 | Ga0207679_10015370 | |||
| 1525 | Ga0207679_10090932 | |||
| 1526 | Ga0207667_10085130 | |||
| 1527 | Ga0207712_10018068 | |||
| 1528 | Ga0207712_10214647 | |||
| 1529 | Ga0207668_10078002 | |||
| 1530 | Ga0207640_10120662 | |||
| 1531 | Ga0207677_10039878 | |||
| 1532 | Ga0207677_10099542 | |||
| 1533 | Ga0207677_10245429 | |||
| 1534 | Ga0207677_10273173 | |||
| 1535 | Ga0207677_10493475 | |||
| 1536 | Ga0207703_10081187 | |||
| 1537 | Ga0207703_10100639 | |||
| 1538 | Ga0207639_10089865 | |||
| 1539 | Ga0207678_10000105 | |||
| 1540 | Ga0207678_10041186 | |||
| 1541 | Ga0207678_10109934 | |||
| 1542 | Ga0207708_10000436 | |||
| 1543 | Ga0207708_10001046 | |||
| 1544 | Ga0207708_10004147 | |||
| 1545 | Ga0207708_10004999 | |||
| 1546 | Ga0207708_10057384 | |||
| 1547 | Ga0207702_10062949 | |||
| 1548 | Ga0207702_10068760 | |||
| 1549 | Ga0207702_10496611 | |||
| 1550 | Ga0207641_10055170 | |||
| 1551 | Ga0207641_10100877 | |||
| 1552 | Ga0207641_10371400 | |||
| 1553 | Ga0207648_10003947 | |||
| 1554 | Ga0207648_10004176 | |||
| 1555 | Ga0207648_10057841 | |||
| 1556 | Ga0207676_10002083 | |||
| 1557 | Ga0207676_10016306 | |||
| 1558 | Ga0207676_10503258 | |||
| 1559 | Ga0207674_10019540 | |||
| 1560 | Ga0207674_10042528 | |||
| 1561 | Ga0207674_10120916 | |||
| 1562 | Ga0207674_10135832 | |||
| 1563 | Ga0207674_10305772 | |||
| 1564 | Ga0207675_100004206 | |||
| 1565 | Ga0207675_100004892 | |||
| 1566 | Ga0207675_100082762 | |||
| 1567 | Ga0207675_100526758 | |||
| 1568 | Ga0207683_10021359 | |||
| 1569 | Ga0207683_10043229 | |||
| 1570 | Ga0207683_10053839 | |||
| 1571 | Ga0207683_10098365 | |||
| 1572 | Ga0207683_10308097 | |||
| 1573 | Ga0207698_10129947 | |||
| 1574 | Ga0207698_10176518 | |||
| 1575 | Ga0207698_10239967 | |||
| 1576 | Ga0209813_10003987 | |||
| 1577 | Ga0209813_10004119 | |||
| 1578 | Ga0209813_10007277 | |||
| 1579 | Ga0209813_10061192 | |||
| 1580 | Ga0207428_10030127 | |||
| 1581 | Ga0207428_10051545 | |||
| 1582 | Ga0207428_10335457 | |||
| 1583 | Ga0268266_10051556 | |||
| 1584 | Ga0268266_10111075 | |||
| 1585 | Ga0268266_10144612 | |||
| 1586 | Ga0268265_10179938 | |||
| 1587 | Ga0268264_10000242 | |||
| 1588 | Ga0268264_10001967 | |||
| 1589 | Ga0268264_10004760 | |||
| 1590 | Ga0268264_10039308 | |||
| 1591 | Ga0265340_10000537 | |||
| 1592 | Ga0307513_10015532 | |||
| 1593 | Ga0307513_10092563 | |||
| 1594 | Ga0307408_100407527 | |||
| 1595 | Ga0307408_100427210 | |||
| 1596 | Ga0316578_10001825 | |||
| 1597 | Ga0307405_10142180 | |||
| 1598 | Ga0307405_10245022 | |||
| 1599 | Ga0307405_10350770 | |||
| 1600 | Ga0307405_10360050 | |||
| 1601 | Ga0307413_10041923 | |||
| 1602 | Ga0307413_10057435 | |||
| 1603 | Ga0307413_10139104 | |||
| 1604 | Ga0307413_10149749 | |||
| 1605 | Ga0307413_10170290 | |||
| 1606 | Ga0307410_10006651 | |||
| 1607 | Ga0307410_10010750 | |||
| 1608 | Ga0307410_10018682 | |||
| 1609 | Ga0307410_10087383 | |||
| 1610 | Ga0307410_10116988 | |||
| 1611 | Ga0307410_10250395 | |||
| 1612 | Ga0307410_10342705 | |||
| 1613 | Ga0307410_10388316 | |||
| 1614 | Ga0307406_10031477 | |||
| 1615 | Ga0307406_10048409 | |||
| 1616 | Ga0307406_10084938 | |||
| 1617 | Ga0307406_10104163 | |||
| 1618 | Ga0307406_10145445 | |||
| 1619 | Ga0307406_10221153 | |||
| 1620 | Ga0307406_10288210 | |||
| 1621 | Ga0307407_10004673 | |||
| 1622 | Ga0307407_10010415 | |||
| 1623 | Ga0307407_10015197 | |||
| 1624 | Ga0307407_10016371 | |||
| 1625 | Ga0307407_10017500 | |||
| 1626 | Ga0307407_10062237 | |||
| 1627 | Ga0307407_10244465 | |||
| 1628 | Ga0307412_10345772 | |||
| 1629 | Ga0307412_10498430 | |||
| 1630 | Ga0307409_100009889 | |||
| 1631 | Ga0307409_100011357 | |||
| 1632 | Ga0307409_100016694 | |||
| 1633 | Ga0307409_100030018 | |||
| 1634 | Ga0307409_100034975 | |||
| 1635 | Ga0307409_100038144 | |||
| 1636 | Ga0307409_100046156 | |||
| 1637 | Ga0307409_100060483 | |||
| 1638 | Ga0307409_100063299 | |||
| 1639 | Ga0307409_100071625 | |||
| 1640 | Ga0307409_100097167 | |||
| 1641 | Ga0307409_100108515 | |||
| 1642 | Ga0307409_100128992 | |||
| 1643 | Ga0307409_100151443 | |||
| 1644 | Ga0307409_100215701 | |||
| 1645 | Ga0307409_100240713 | |||
| 1646 | Ga0307409_100254681 | |||
| 1647 | Ga0307409_100329291 | |||
| 1648 | Ga0307409_100437613 | |||
| 1649 | Ga0307409_100440840 | |||
| 1650 | Ga0307409_100492582 | |||
| 1651 | Ga0307416_100002883 | |||
| 1652 | Ga0307416_100002929 | |||
| 1653 | Ga0307416_100012921 | |||
| 1654 | Ga0307416_100048729 | |||
| 1655 | Ga0307416_100051207 | |||
| 1656 | Ga0307416_100065621 | |||
| 1657 | Ga0307416_100102938 | |||
| 1658 | Ga0307416_100186307 | |||
| 1659 | Ga0307416_100299986 | |||
| 1660 | Ga0307416_100395067 | |||
| 1661 | Ga0307411_10068352 | |||
| 1662 | Ga0307411_10076823 | |||
| 1663 | Ga0307411_10095665 | |||
| 1664 | Ga0307411_10221500 | |||
| 1665 | Ga0307415_100007652 | |||
| 1666 | Ga0307415_100009492 | |||
| 1667 | Ga0307415_100021802 | |||
| 1668 | Ga0307415_100026466 | |||
| 1669 | Ga0307415_100038392 | |||
| 1670 | Ga0307415_100089813 | |||
| 1671 | Ga0307415_100089941 | |||
| 1672 | Ga0307415_100107507 | |||
| 1673 | Ga0307415_100118290 | |||
| 1674 | Ga0307415_100283300 | |||
| 1675 | Ga0307415_100620128 | |||
| 1676 | Ga0316583_10029656 | |||
| 1677 | Ga0373938_0031409 | |||
| 1678 | Ga0373926_0027830 | |||
| 1679 | Ga0373934_0002754 | |||
| 1680 | Ga0373944_0011334 | |||
| 1681 | Ga0373923_0023500 | |||
| 1682 | Ga0373923_0055474 | |||
| 1683 | Ga0373936_0026431 | |||
| 1684 | Ga0373936_0055578 | |||
| 1685 | Ga0373945_0039542 | |||
| 1686 | Ga0373953_0000821 | |||
| 1687 | Ga0373954_0001563 | |||
| 1688 | Ga0373956_0003221 | |||
| 1689 | Ga0373957_0001428 | |||
| 1690 | Ga0373943_0048468 | |||
| 1691 | Ga0373946_0013175 | |||
| 1692 | Ga0373955_0082888 | |||
| 1693 | Ga0373955_0108511 | |||
| 1694 | Ga0316574_0007917 | |||
| 1695 | Ga0373924_0016500 | |||
| 1696 | Ga0373927_0040940 | |||
| 1697 | Ga0373933_0005000 | |||
| 1698 | Ga0373947_0023550 | |||
| 1699 | Ga0373947_0056553 | |||
| 1700 | Ga0373937_0010654 | |||
| 1701 | Ga0373937_0208215 | |||
| 1702 | Ga0316584_0003766 | |||
| 1703 | Ga0373925_0031453 | |||
| 1704 | Ga0373925_0093661 | |||
| 1705 | Ga0395900_0026320 | |||
| 1706 | Ga0395900_0058762 | |||
| 1707 | Ga0395898_0169591 | |||
| 1708 | Ga0395905_0054291 | |||
| 1709 | Ga0395905_0190772 | |||
| 1710 | Ga0436364_0849504 | |||
| 1711 | Ga0436364_1495084 | |||
| 1712 | Ga0395901_0011948 | |||
| 1713 | Ga0395901_0139889 | |||
| 1714 | Ga0395901_0148039 | |||
| 1715 | Ga0395901_0213971 | |||
| 1716 | Ga0400483_021589 | |||
| 1717 | Ga0400483_095912 | |||
| 1718 | Ga0400483_209527 | |||
| 1719 | Ga0436365_1063556 | |||
| 1720 | Ga0436365_1544034 | |||
| 1721 | Ga0451843_0051158 | |||
| 1722 | Ga0439459_0030276 | |||
| 1723 | Ga0466972_0176165 | |||
| 1724 | Ga0466965_0000459 | |||
| 1725 | Ga0466965_0004751 | |||
| 1726 | Ga0466965_0012067 | |||
| 1727 | Ga0466965_0025243 | |||
| 1728 | Ga0466965_0048241 | |||
| 1729 | Ga0466965_0069717 | |||
| 1730 | Ga0466965_0093393 | |||
| 1731 | Ga0466961_0035163 | |||
| 1732 | Ga0466961_0109053 | |||
| 1733 | Ga0466963_0038739 | |||
| 1734 | Ga0466963_0069680 | |||
| 1735 | Ga0466964_0031608 | |||
| 1736 | Ga0466964_0048533 | |||
| 1737 | Ga0466964_0054265 | |||
| 1738 | Ga0466970_0012324 | |||
| 1739 | Ga0466970_0015359 | |||
| 1740 | Ga0466970_0018226 | |||
| 1741 | Ga0466970_0033313 | |||
| 1742 | Ga0466970_0098294 | |||
| 1743 | Ga0466957_0001115 | |||
| 1744 | Ga0466957_0084176 | |||
| 1745 | Ga0466957_0096568 | |||
| 1746 | Ga0466960_0000350 | |||
| 1747 | Ga0466960_0006974 | |||
| 1748 | Ga0466960_0008191 | |||
| 1749 | Ga0466960_0016237 | |||
| 1750 | Ga0466960_0023651 | |||
| 1751 | Ga0466960_0047414 | |||
| 1752 | Ga0466960_0054466 | |||
| 1753 | Ga0466960_0098125 | |||
| 1754 | Ga0451576_0414424 | |||
| 1755 | Ga0466958_0042983 | |||
| 1756 | Ga0466958_0094123 | |||
| 1757 | Ga0466967_0003975 | |||
| 1758 | Ga0466967_0065708 | |||
| 1759 | Ga0466967_0073531 | |||
| 1760 | Ga0466967_0095098 | |||
| 1761 | Ga0466967_0119523 | |||
| 1762 | Ga0466967_0143725 | |||
| 1763 | Ga0466967_0153107 | |||
| 1764 | Ga0466967_0159795 | |||
| 1765 | Ga0466967_0170963 | |||
| 1766 | Ga0466967_0183525 | |||
| 1767 | Ga0466967_0244570 | |||
| 1768 | Ga0466967_0252036 | |||
| 1769 | Ga0466967_0495608 | |||
| 1770 | Ga0495592_0000397 | |||
| 1771 | Ga0495592_0008095 | |||
| 1772 | Ga0495603_0095528 | |||
| 1773 | Ga0495629_0107549 | |||
| 1774 | Ga0495629_0161015 | |||
| 1775 | Ga0495641_0051291 | |||
| 1776 | Ga0495641_0057979 | |||
| 1777 | Ga0495641_0080767 | |||
| 1778 | Ga0495651_0126575 | |||
| 1779 | Ga0495651_0126576 | |||
| 1780 | Ga0495653_0120545 | |||
| 1781 | Ga0495653_0165079 | |||
| 1782 | Ga0495582_0079567 | |||
| 1783 | Ga0495664_0007931 | |||
| 1784 | Ga0495664_0087709 | |||
| 1785 | Ga0495608_0089230 | |||
| 1786 | Ga0495608_0089231 | |||
| 1787 | Ga0495608_0105594 | |||
| 1788 | Ga0495618_0009751 | |||
| 1789 | Ga0495628_0005043 | |||
| 1790 | Ga0495628_0122322 | |||
| 1791 | Ga0495630_0055169 | |||
| 1792 | Ga0495630_0152328 | |||
| 1793 | Ga0495652_0002110 | |||
| 1794 | Ga0495652_0049416 | |||
| 1795 | Ga0495652_0108948 | |||
| 1796 | Ga0495665_0093433 | |||
| 1797 | Ga0495640_0067173 | |||
| 1798 | Ga0495586_0015106 | |||
| 1799 | Ga0495587_0029133 | |||
| 1800 | Ga0495587_0099998 | |||
| 1801 | Ga0495645_0003234 | |||
| 1802 | Ga0495645_0010242 | |||
| 1803 | Ga0495667_0011880 | |||
| 1804 | Ga0495667_0114499 | |||
| 1805 | Ga0495634_0021736 | |||
| 1806 | Ga0495635_0074934 | |||
| 1807 | Ga0495635_0111827 | |||
| 1808 | Ga0495657_0192128 | |||
| 1809 | Ga0495599_0017017 | |||
| 1810 | Ga0495599_0084661 | |||
| 1811 | Ga0495623_0019997 | |||
| 1812 | Ga0495623_0100901 | |||
| 1813 | Ga0495646_0002659 | |||
| 1814 | Ga0495646_0004480 | |||
| 1815 | Ga0495658_0086658 | |||
| 1816 | Ga0495613_0039703 | |||
| 1817 | Ga0495624_0137472 | |||
| 1818 | Ga0495600_0009608 | |||
| 1819 | Ga0495600_0056669 | |||
| 1820 | Ga0495604_0004132 | |||
| 1821 | Ga0495604_0042757 | |||
| 1822 | Ga0495674_0088829 | |||
| 1823 | Ga0495676_0085788 | |||
| 1824 | Ga0495676_0124145 | |||
| 1825 | Ga0495680_0001602 | |||
| 1826 | Ga0495680_0096739 | |||
| 1827 | Ga0495680_0120073 | |||
| 1828 | Ga0495675_0034575 | |||
| 1829 | Ga0495675_0225124 | |||
| 1830 | Ga0495684_0000603 | |||
| 1831 | Ga0495684_0138994 | |||
| 1832 | Ga0495602_0017251 | |||
| 1833 | Ga0495602_0018432 | |||
| 1834 | Ga0496100_0003839 | |||
| 1835 | Ga0496100_0032129 | |||
| 1836 | Ga0496100_0252908 | |||
| 1837 | Ga0496101_0013820 | |||
| 1838 | Ga0496101_0134755 | |||
| 1839 | Ga0496102_0002619 | |||
| 1840 | Ga0496102_0008782 | |||
| 1841 | Ga0496102_0013364 | |||
| 1842 | Ga0496102_0015121 | |||
| 1843 | Ga0496102_0033772 | |||
| 1844 | Ga0496102_0051165 | |||
| 1845 | Ga0496102_0079766 | |||
| 1846 | Ga0496102_0136298 | |||
| 1847 | Ga0496102_0154518 | |||
| 1848 | Ga0496102_0177590 | |||
| 1849 | Ga0496102_0601730 | |||
| 1850 | Ga0496103_0009545 | |||
| 1851 | Ga0496103_0018415 | |||
| 1852 | Ga0496103_0048923 | |||
| 1853 | Ga0496103_0085930 | |||
| 1854 | Ga0496103_0160825 | |||
| 1855 | Ga0496103_0246457 | |||
| 1856 | Ga0496104_0030323 | |||
| 1857 | Ga0496104_0072786 | |||
| 1858 | Ga0496104_0103668 | |||
| 1859 | Ga0496104_0222010 | |||
| 1860 | Ga0496104_0234198 | |||
| 1861 | Ga0496104_0260922 | |||
| 1862 | Ga0496105_0004639 | |||
| 1863 | Ga0496105_0010601 | |||
| 1864 | Ga0496105_0013044 | |||
| 1865 | Ga0496105_0046910 | |||
| 1866 | Ga0496105_0071322 | |||
| 1867 | Ga0496105_0112375 | |||
| 1868 | Ga0496105_0134554 | |||
| 1869 | Ga0496105_0151400 | |||
| 1870 | Ga0496105_0163927 | |||
| 1871 | Ga0496105_0233606 | |||
| 1872 | Ga0496105_0465742 | |||
| 1873 | Ga0496106_0055833 | |||
| 1874 | Ga0496107_0028957 | |||
| 1875 | Ga0496107_0038148 | |||
| 1876 | Ga0496107_0071877 | |||
| 1877 | Ga0496107_0130879 | |||
| 1878 | Ga0496107_0144379 | |||
| 1879 | Ga0496107_0264463 | |||
| 1880 | Ga0496107_0317528 | |||
| 1881 | Ga0496107_0438783 | |||
| 1882 | Ga0496107_0487344 | |||
| 1883 | Ga0496108_0008499 | |||
| 1884 | Ga0496108_0019824 | |||
| 1885 | Ga0496108_0055934 | |||
| 1886 | Ga0496108_0057158 | |||
| 1887 | Ga0496108_0170747 | |||
| 1888 | Ga0496108_0251142 | |||
| 1889 | Ga0496108_0279324 | |||
| 1890 | Ga0496108_0327330 | |||
| 1891 | Ga0496109_0014295 | |||
| 1892 | Ga0496109_0015913 | |||
| 1893 | Ga0496109_0058785 | |||
| 1894 | Ga0496109_0061158 | |||
| 1895 | Ga0496109_0088079 | |||
| 1896 | Ga0496109_0095372 | |||
| 1897 | Ga0496109_0195072 | |||
| 1898 | Ga0496109_0195396 | |||
| 1899 | Ga0496109_0214230 | |||
| 1900 | Ga0496109_0224563 | |||
| 1901 | Ga0496109_0242584 | |||
| 1902 | Ga0496109_0550688 | |||
| 1903 | Ga0496109_0583580 | |||
| 1904 | Ga0496110_0006612 | |||
| 1905 | Ga0496110_0012958 | |||
| 1906 | Ga0496110_0022918 | |||
| 1907 | Ga0496110_0079099 | |||
| 1908 | Ga0496110_0082241 | |||
| 1909 | Ga0496110_0083440 | |||
| 1910 | Ga0496110_0088856 | |||
| 1911 | Ga0496110_0138698 | |||
| 1912 | Ga0496110_0296797 | |||
| 1913 | Ga0496110_0310798 | |||
| 1914 | Ga0496110_0369646 | |||
| 1915 | Ga0496111_0000863 | |||
| 1916 | Ga0496111_0012659 | |||
| 1917 | Ga0496112_0154324 | |||
| 1918 | Ga0496112_0206213 | |||
| 1919 | Ga0496112_0639119 | |||
| 1920 | Ga0496113_0036543 | |||
| 1921 | Ga0496113_0038091 | |||
| 1922 | Ga0496113_0358369 | |||
| 1923 | Ga0496114_0002152 | |||
| 1924 | Ga0496114_0003522 | |||
| 1925 | Ga0496114_0005765 | |||
| 1926 | Ga0496114_0008014 | |||
| 1927 | Ga0496114_0033141 | |||
| 1928 | Ga0496114_0074275 | |||
| 1929 | Ga0496114_0090983 | |||
| 1930 | Ga0496114_0107067 | |||
| 1931 | Ga0496114_0160447 | |||
| 1932 | Ga0496114_0216338 | |||
| 1933 | Ga0496114_0303922 | |||
| 1934 | Ga0496114_0353064 | |||
| 1935 | Ga0496114_0463582 | |||
| 1936 | Ga0496115_0029443 | |||
| 1937 | Ga0496115_0091212 | |||
| 1938 | Ga0496118_0173804 | |||
| 1939 | Ga0496119_0014608 | |||
| 1940 | Ga0496120_0006161 | |||
| 1941 | Ga0496121_0035843 | |||
| 1942 | Ga0496121_0169453 | |||
| 1943 | Ga0496123_0078694 | |||
| 1944 | Ga0496124_0228974 | |||
| 1945 | Ga0496126_0000039 | |||
| 1946 | Ga0501309_002015 | |||
| 1947 | Ga0501291_020713 | |||
| 1948 | Ga0501298_023437 | |||
| 1949 | Ga0501031_0001569 | |||
| 1950 | Ga0501031_0019479 | |||
| 1951 | Ga0501031_0056192 | |||
| 1952 | Ga0501031_0060482 | |||
| 1953 | Ga0501031_0091406 | |||
| 1954 | Ga0501031_0104827 | |||
| 1955 | Ga0501032_0059829 | |||
| 1956 | Ga0501032_0066357 | |||
| 1957 | Ga0501032_0077745 | |||
| 1958 | Ga0501033_0003386 | |||
| 1959 | Ga0501034_0051347 | |||
| 1960 | Ga0501034_0054748 | |||
| 1961 | Ga0501034_0064361 | |||
| 1962 | Ga0501036_0001694 | |||
| 1963 | Ga0501036_0006122 | |||
| 1964 | Ga0501036_0017266 | |||
| 1965 | Ga0501036_0033743 | |||
| 1966 | Ga0501036_0072369 | |||
| 1967 | Ga0501036_0121489 | |||
| 1968 | Ga0501036_0207628 | |||
| 1969 | Ga0501037_0023454 | |||
| 1970 | Ga0501037_0087179 | |||
| 1971 | Ga0501037_0091380 | |||
| 1972 | Ga0501037_0105898 | |||
| 1973 | Ga0501037_0114203 | |||
| 1974 | Ga0501038_0004008 | |||
| 1975 | Ga0501038_0013769 | |||
| 1976 | Ga0501039_0007037 | |||
| 1977 | Ga0501040_0001709 | |||
| 1978 | Ga0501040_0011354 | |||
| 1979 | Ga0501040_0054839 | |||
| 1980 | Ga0501040_0232480 | |||
| 1981 | Ga0501040_0357141 | |||
| 1982 | Ga0501041_0021998 | |||
| 1983 | Ga0501041_0069015 | |||
| 1984 | Ga0501041_0140093 | |||
| 1985 | Ga0501042_0003027 | |||
| 1986 | Ga0501042_0006792 | |||
| 1987 | Ga0501042_0046751 | |||
| 1988 | Ga0501043_0134861 | |||
| 1989 | Ga0501046_0010342 | |||
| 1990 | Ga0501046_0057893 | |||
| 1991 | Ga0501046_0073585 | |||
| 1992 | Ga0501047_0033893 | |||
| 1993 | Ga0501048_0007035 | |||
| 1994 | Ga0501048_0040541 | |||
| 1995 | Ga0501067_0004112 | |||
| 1996 | Ga0501067_0009441 | |||
| 1997 | Ga0501067_0060698 | |||
| 1998 | Ga0501067_0104913 | |||
| 1999 | Ga0501067_0166254 | |||
| 2000 | Ga0501068_0056147 | |||
| 2001 | Ga0501068_0130005 | |||
| 2002 | Ga0501069_0004130 | |||
| 2003 | Ga0501069_0007837 | |||
| 2004 | Ga0501069_0009384 | |||
| 2005 | Ga0501069_0017089 | |||
| 2006 | Ga0501069_0035271 | |||
| 2007 | Ga0501069_0095019 | |||
| 2008 | Ga0501069_0137160 | |||
| 2009 | Ga0501070_0003855 | |||
| 2010 | Ga0501070_0004279 | |||
| 2011 | Ga0501070_0021270 | |||
| 2012 | Ga0501070_0032937 | |||
| 2013 | Ga0501070_0035442 | |||
| 2014 | Ga0501070_0042917 | |||
| 2015 | Ga0501070_0097933 | |||
| 2016 | Ga0501070_0222332 | |||
| 2017 | Ga0501070_0442156 | |||
| 2018 | Ga0501071_0005666 | |||
| 2019 | Ga0501071_0005962 | |||
| 2020 | Ga0501071_0053300 | |||
| 2021 | Ga0501071_0222462 | |||
| 2022 | Ga0501072_0006084 | |||
| 2023 | Ga0501072_0009890 | |||
| 2024 | Ga0501072_0035834 | |||
| 2025 | Ga0501072_0052339 | |||
| 2026 | Ga0501072_0054608 | |||
| 2027 | Ga0501072_0070974 | |||
| 2028 | Ga0501072_0082701 | |||
| 2029 | Ga0501072_0111824 | |||
| 2030 | Ga0501073_0004693 | |||
| 2031 | Ga0501073_0019457 | |||
| 2032 | Ga0501073_0056459 | |||
| 2033 | Ga0501073_0063282 | |||
| 2034 | Ga0501073_0251170 | |||
| 2035 | Ga0501073_0454919 | |||
| 2036 | Ga0501074_0007589 | |||
| 2037 | Ga0501074_0008026 | |||
| 2038 | Ga0501074_0016168 | |||
| 2039 | Ga0501074_0035660 | |||
| 2040 | Ga0501074_0049798 | |||
| 2041 | Ga0501074_0093115 | |||
| 2042 | Ga0501074_0106098 | |||
| 2043 | Ga0501074_0108479 | |||
| 2044 | Ga0501075_0009610 | |||
| 2045 | Ga0501075_0067091 | |||
| 2046 | Ga0501075_0138846 | |||
| 2047 | Ga0501076_0011478 | |||
| 2048 | Ga0501076_0049489 | |||
| 2049 | Ga0501076_0086503 | |||
| 2050 | Ga0501076_0086562 | |||
| 2051 | Ga0501077_0007878 | |||
| 2052 | Ga0501077_0009576 | |||
| 2053 | Ga0501077_0011162 | |||
| 2054 | Ga0501077_0022311 | |||
| 2055 | Ga0501079_0058312 | |||
| 2056 | Ga0501079_0079143 | |||
| 2057 | Ga0501079_0093028 | |||
| 2058 | Ga0501080_0000857 | |||
| 2059 | Ga0501080_0013574 | |||
| 2060 | Ga0501080_0029465 | |||
| 2061 | Ga0501080_0039249 | |||
| 2062 | Ga0501080_0157491 | |||
| 2063 | Ga0501080_0292281 | |||
| 2064 | Ga0501081_0017918 | |||
| 2065 | Ga0501081_0329002 | |||
| 2066 | Ga0501083_0020109 | |||
| 2067 | Ga0501083_0112653 | |||
| 2068 | Ga0501035_0021194 | |||
| 2069 | Ga0501035_0032558 | |||
| 2070 | Ga0501044_0040033 | |||
| 2071 | Ga0501045_0002747 | |||
| 2072 | Ga0501045_0019867 | |||
| 2073 | Ga0501045_0070494 | |||
| 2074 | Ga0501045_0074104 | |||
| 2075 | Ga0501045_0114517 | |||
| 2076 | Ga0501045_0134072 | |||
| 2077 | Ga0501045_0380013 | |||
| 2078 | nmdc:mga03683_108033_c1 | |||
| 2079 | nmdc:mga03n38_131271_c1 | |||
| 2080 | nmdc:mga03n38_15364_c1 | |||
| 2081 | nmdc:mga03n38_1536_c1 | |||
| 2082 | nmdc:mga03n38_16936_c1 | |||
| 2083 | nmdc:mga03n38_31013_c1 | |||
| 2084 | nmdc:mga03n38_51853_c1 | |||
| 2085 | nmdc:mga03n38_87017_c1 | |||
| 2086 | nmdc:mga03n38_92194_c1 | |||
| 2087 | nmdc:mga03n38_92387_c1 | |||
| 2088 | nmdc:mga03n38_9497_c1 | |||
| 2089 | nmdc:mga00v17_101428_c1 | |||
| 2090 | nmdc:mga00v17_12728_c1 | |||
| 2091 | nmdc:mga00v17_13995_c1 | |||
| 2092 | nmdc:mga00v17_167026_c1 | |||
| 2093 | nmdc:mga00v17_18892_c1 | |||
| 2094 | nmdc:mga00v17_199295_c1 | |||
| 2095 | nmdc:mga00v17_22363_c1 | |||
| 2096 | nmdc:mga00v17_30291_c1 | |||
| 2097 | nmdc:mga00v17_32669_c1 | |||
| 2098 | nmdc:mga00v17_49842_c1 | |||
| 2099 | nmdc:mga00v17_89878_c1 | |||
| 2100 | nmdc:mga0yw44_100306_c1 | |||
| 2101 | nmdc:mga0yw44_105970_c1 | |||
| 2102 | nmdc:mga0yw44_119425_c1 | |||
| 2103 | nmdc:mga0yw44_146689_c1 | |||
| 2104 | nmdc:mga0yw44_18098_c1 | |||
| 2105 | nmdc:mga0yw44_18114_c1 | |||
| 2106 | nmdc:mga0yw44_36814_c1 | |||
| 2107 | nmdc:mga0yw44_38807_c1 | |||
| 2108 | nmdc:mga0yw44_51998_c1 | |||
| 2109 | nmdc:mga0yw44_56569_c1 | |||
| 2110 | nmdc:mga0yw44_7733_c1 | |||
| 2111 | nmdc:mga0yw44_98052_c1 | |||
| 2112 | nmdc:mga06z11_26368_c1 | |||
| 2113 | nmdc:mga06z11_56530_c1 | |||
| 2114 | nmdc:mga06z11_69554_c1 | |||
| 2115 | nmdc:mga06z11_8413_c1 | |||
| 2116 | nmdc:mga04h51_102509_c1 | |||
| 2117 | nmdc:mga04h51_23893_c1 | |||
| 2118 | nmdc:mga07m45_101514_c1 | |||
| 2119 | nmdc:mga07m45_2647_c1 | |||
| 2120 | nmdc:mga07m45_44396_c1 | |||
| 2121 | nmdc:mga07m45_80186_c1 | |||
| 2122 | nmdc:mga07m45_9130_c1 | |||
| 2123 | nmdc:mga07m45_97695_c1 | |||
| 2124 | nmdc:mga05p37_147426_c1 | |||
| 2125 | nmdc:mga09592_291569_c1 | |||
| 2126 | nmdc:mga06r32_15209_c1 | |||
| 2127 | nmdc:mga06r32_191537_c1 | |||
| 2128 | nmdc:mga08y16_101083_c1 | |||
| 2129 | nmdc:mga08y16_201480_c1 | |||
| 2130 | nmdc:mga08y16_426063_c1 | |||
| 2131 | nmdc:mga08y16_4414_c1 | |||
| 2132 | nmdc:mga08y16_62979_c1 | |||
| 2133 | nmdc:mga08y16_692626_c1 | |||
| 2134 | nmdc:mga0rr50_403682_c1 | |||
| 2135 | nmdc:mga0a205_124922_c1 | |||
| 2136 | Ga0495601_0209487 | |||
| 2137 | Ga0495612_0013400 | |||
| 2138 | Ga0495595_0123021 | |||
| 2139 | Ga0495619_0023815 | |||
| 2140 | Ga0495619_0340286 | |||
| 2141 | Ga0500643_000239 | |||
| 2142 | Ga0500644_0000050 | |||
| 2143 | Ga0500644_0000104 | |||
| 2144 | Ga0500644_0081935 | |||
| 2145 | Ga0500554_008044 | |||
| 2146 | Ga0500554_078163 | |||
| 2147 | Ga0500556_0001058 | |||
| 2148 | Ga0500593_000179 | |||
| 2149 | Ga0500573_0018977 | |||
| 2150 | Ga0500616_0000060 | |||
| 2151 | Ga0500616_0000792 | |||
| 2152 | Ga0501084_0021438 | |||
| 2153 | Ga0501084_0158009 | |||
| 2154 | Ga0501084_0331367 | |||
| 2155 | Ga0501084_0350322 | |||
| 2156 | Ga0587073_0015132 | |||
| 2157 | Ga0587111_0020289 | |||
| 2158 | Ga0501082_0019122 | |||
| 2159 | Ga0501082_0046676 | |||
| 2160 | Ga0501082_0083012 | |||
| 2161 | Ga0501082_0134419 | |||
| 2162 | Ga0501082_0160522 | |||
| 2163 | Ga0501082_0237345 | |||
| 2164 | Ga0501082_0392189 | |||
| 2165 | Ga0530510_0029698 | |||
| 2166 | Ga0530510_0030715 | |||
| 2167 | 2643850090 | |||
| 2168 | 2643853500 | |||
| 2169 | 2643889890 | |||
| 2170 | 2643893244 | |||
| 2171 | 2643958946 | |||
| 2172 | 2643961697 | |||
| 2173 | 2644033896 | |||
| 2174 | 2644034027 | |||
| 2175 | 2644091769 | |||
| 2176 | 2644102586 | |||
| 2177 | 2644118248 | |||
| 2178 | 2644136092 | |||
| 2179 | 2644137461 | |||
| 2180 | 2644228333 | |||
| 2181 | 2644321572 | |||
| 2182 | 2644609995 | |||
| 2183 | 2645720479 | |||
| 2184 | 2645723438 | |||
| 2185 | 2738871640 | |||
| 2186 | 2739603387 | |||
| 2187 | 2740165843 | |||
| 2188 | 2774393828 | |||
| 2189 | 2784470931 | |||
| 2190 | 2812331744 | |||
| 2191 | 2812333915 | |||
| 2192 | 2812350174 | |||
| 2193 | 2819425474 | |||
| 2194 | 2819667844 | |||
| 2195 | 2819690251 | |||
| 2196 | 2819726201 | |||
| 2197 | 2855388905 | |||
| 2198 | 2857483235 | |||
| 2199 | 2857483533 | |||
| 2200 | 2857727350 | |||
| 2201 | 2984577222 | |||
| 2202 | 2984579189 | |||
| 2203 | 2990259918 | |||
| 2204 | 2990260633 | |||
| 2205 | 8054609651 | |||
| 2206 | 8054611362 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1l2t-assembly1.cif.gz_B | dimeric structure of mj0796, a bacterial abc transporter cassette | 0.9173 | 1 | 211 |
| 3tif-assembly1.cif.gz_B | dimeric structure of a post-hydrolysis state of the atp-binding cassette mj0796 bound to adp and pi | 0.9074 | 1 | 211 |
| 4p33-assembly1.cif.gz_A | crystal structure of e. coli lptb-e163q in complex with atp-sodium | 0.9036 | 2 | 216 |
| 7ahd-assembly1.cif.gz_D | opua (e190q) occluded | 0.9006 | 2 | 216 |
| 7v8i-assembly1.cif.gz_F | lolcd(e171q)e with bound amppnp in nanodiscs | 0.8993 | 1 | 211 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O33189_10_251_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9471 | 2 | 219 | 3.40.50.300 |
| af_Q2FXB7_1_229_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9427 | 2 | 211 | 3.40.50.300 |
| af_P0A9U1_321_563_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9395 | 2 | 220 | 3.40.50.300 |
| af_Q9VRG3_1356_1574_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.932 | 2 | 206 | 3.40.50.300 |
| af_P37624_268_530_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9288 | 2 | 218 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3L7J281-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9929 | 1 | 215 |
GO:0005524
GO:0016887 |
| AF-A0A3N0DQ34-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9841 | 2 | 216 |
GO:0005524
GO:0016887 |
| AF-A0A0S9DLE0-F1-model_v4 | ABC transporter domain-containing protein | 0.947 | 2 | 216 |
GO:0005524
GO:0016887 GO:0046677 |
| AF-A0A6G8KU53-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9468 | 2 | 215 |
GO:0005524
GO:0016887 |
| AF-A0A7H2BMT5-F1-model_v4 | ABC transporter ATP-binding protein | 0.9461 | 2 | 216 |
GO:0005524
GO:0016887 |