F490109

General Info

Members Datasets Scaffolds Average Seq Length
1103 713 2206 332

Family's Representative Sequence

Representative Sequence 3300046692|Ga0495671_0027549|Ga0495671_0027549_1610_2797
Length 395
Sequence MRLFAALPAATLQHVLRIFLTPDFFRHFHAPCQFALGNPGFAVLPLCQLKTLHQTWRSPMKKLLASTILVTGFFIAAGAANSANAAEECGSVTIAEMNWASAGVAAYVDKFIMENGYDCTVNVISGDTMPTFASMNEKGQPDMAPELWVNAVREPLDAAVKEGRMIEASKILTEGGVEGWWIPKFIADEHPDIKTVEDALKHPELFPAPEDARKGAVHNCPSGWNCQVTTTNLYKAREGDKKGFTLVDTGSAAGLDGSIANAFEKKQGWLGYYWSPTAILGKYEMVKLDDGVELDRAHFDDCTAKVDCADPKVNAYPVADVYTVITKDFESKAGVTMDYIKARNWDNKTVAEVLAWMDDNQGTNEDGAEYFLENHEDIWTKWVSPEVAEKIKASI

Samples

Sample ID Description Type Environment
1 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
17 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
22 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
23 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
26 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
41 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
45 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
51 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
52 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
53 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
54 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
55 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
56 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
57 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
58 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
59 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
60 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
61 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
62 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
63 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
65 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
66 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
67 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
70 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
73 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
75 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
78 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
87 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
89 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
92 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
93 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
94 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
95 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
96 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
97 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
98 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
99 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
100 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
101 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
102 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
103 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
104 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
105 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
106 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
107 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
108 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
109 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
110 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
111 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
112 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
113 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
114 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
115 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
116 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
117 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
118 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
119 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
120 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
121 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
122 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
123 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
124 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
125 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
126 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
127 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
128 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
129 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
130 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
131 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
132 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
133 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
134 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
135 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
136 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
137 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
140 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
141 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
142 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
143 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
144 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
145 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
146 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
147 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
148 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
149 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
150 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
157 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
158 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
159 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
160 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
161 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
162 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
163 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
164 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
165 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
166 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
167 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
168 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
169 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
170 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
171 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
172 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
173 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
174 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
175 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
176 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
177 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
178 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
179 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
180 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 2509276019 Ensifer aridi TW10 Isolate Nodule
187 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
188 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
189 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
190 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
191 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
192 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
193 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
194 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
195 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
196 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
197 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
198 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
199 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
200 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
201 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
202 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
203 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
204 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
205 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
206 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
207 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
208 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
209 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
210 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
211 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
212 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
213 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
214 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
215 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
216 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
217 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
218 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
219 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
220 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
221 2516143018 Ensifer sp. BR816 Isolate Nodule
222 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
223 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
224 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
225 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
226 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
227 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
228 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
229 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
230 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
231 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
232 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
233 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
234 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
235 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
236 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
237 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
238 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
239 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
240 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
241 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
242 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
243 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
244 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
245 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
246 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
247 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
248 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
249 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
250 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
251 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
252 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
253 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
254 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
255 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
256 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
257 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
258 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
259 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
260 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
261 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
262 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
263 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
264 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
265 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
266 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
267 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
268 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
269 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
270 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
271 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
272 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
273 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
274 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
275 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
276 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
277 2643221557 Ensifer sp. Root558 Isolate Unclassified
278 2643221558 Rhizobium sp. Root149 Isolate Unclassified
279 2643221582 Rhizobium sp. Root651 Isolate Unclassified
280 2643221599 Rhizobium sp. Root708 Isolate Unclassified
281 2643221607 Rhizobium sp. Root73 Isolate Unclassified
282 2643221610 Ensifer sp. Root74 Isolate Unclassified
283 2643221618 Ensifer sp. Root231 Isolate Unclassified
284 2643221626 Ensifer sp. Root31 Isolate Unclassified
285 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
286 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
287 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
288 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
289 2643221655 Ensifer sp. Root1252 Isolate Unclassified
290 2643221659 Ensifer sp. Root127 Isolate Unclassified
291 2643221668 Ensifer sp. Root423 Isolate Unclassified
292 2643221675 Ensifer sp. Root1298 Isolate Unclassified
293 2643221680 Ensifer sp. Root1312 Isolate Unclassified
294 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
295 2643221688 Rhizobium sp. Root482 Isolate Unclassified
296 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
297 2643221693 Rhizobium sp. Root491 Isolate Unclassified
298 2643221698 Ensifer sp. Root142 Isolate Unclassified
299 2643221712 Ensifer sp. Root258 Isolate Unclassified
300 2643221718 Rhizobium sp. Root268 Isolate Unclassified
301 2643221719 Rhizobium sp. Root274 Isolate Unclassified
302 2643221723 Ensifer sp. Root278 Isolate Unclassified
303 2643221726 Ensifer sp. Root954 Isolate Unclassified
304 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
305 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
306 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
307 2718217927 Rhizobium sp. N324 Isolate Nodule
308 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
309 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
310 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
311 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
312 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
313 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
314 2718218423 Rhizobium sp. N941 Isolate Nodule
315 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
316 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
317 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
318 2721755809 Rhizobium sp. N541 Isolate Nodule
319 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
320 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
321 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
322 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
323 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
324 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
325 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
326 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
327 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
328 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
329 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
330 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
331 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
332 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
333 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
334 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
335 2791355256 Rhizobium sp. M10 Isolate Nodule
336 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
337 2791355260 Rhizobium sp. L9 Isolate Nodule
338 2791355261 Rhizobium sp. J15 Isolate Nodule
339 2791355262 Rhizobium sp. M1 Isolate Nodule
340 2791355263 Rhizobium chutanense C5 Isolate Nodule
341 2791355265 Rhizobium sp. H4 Isolate Nodule
342 2791355266 Rhizobium sp. L43 Isolate Nodule
343 2791355267 Rhizobium sp. L18 Isolate Nodule
344 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
345 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
346 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
347 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
348 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
349 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
350 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
351 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
352 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
353 2802429633 Rhizobium anhuiense J3 Isolate Nodule
354 2802429634 Rhizobium anhuiense S10 Isolate Nodule
355 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
356 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
357 2802429637 Rhizobium anhuiense C15 Isolate Nodule
358 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
359 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
360 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
361 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
362 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
363 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
364 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
365 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
366 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
367 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
368 2838048938 Rhizobium pisi 27/80 Isolate Nodule
369 2838061910 Rhizobium phaseoli L15 Isolate Nodule
370 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
371 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
372 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
373 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
374 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
375 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
376 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
377 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
378 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
379 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
380 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
381 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
382 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
383 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
384 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
385 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
386 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
387 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
388 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
389 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
390 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
391 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
392 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
393 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
394 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
395 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
396 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
397 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
398 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
399 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
400 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
401 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
402 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
403 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
404 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
405 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
406 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
407 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
408 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
409 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
410 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
411 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
412 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
413 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
414 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
415 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
416 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
417 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
418 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
419 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
420 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
421 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
422 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
423 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
424 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
425 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
426 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
427 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
428 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
429 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
430 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
431 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
432 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
433 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
434 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
435 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
436 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
437 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
438 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
439 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
440 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
441 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
442 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
443 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
444 2844163670 Ensifer sp. 1H6 Isolate Unclassified
445 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
446 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
447 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
448 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
449 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
450 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
451 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
452 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
453 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
454 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
455 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
456 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
457 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
458 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
459 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
460 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
461 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
462 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
463 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
464 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
465 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
466 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
467 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
468 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
469 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
470 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
471 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
472 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
473 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
474 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
475 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
476 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
477 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
478 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
479 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
480 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
481 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
482 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
483 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
484 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
485 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
486 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
487 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
488 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
489 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
490 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
491 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
492 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
493 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
494 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
495 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
496 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
497 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
498 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
499 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
500 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
501 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
502 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
503 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
504 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
505 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
506 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
507 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
508 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
509 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
510 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
511 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
512 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
513 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
514 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
515 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
516 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
517 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
518 2933599457 Rhizobium phaseoli M3 Isolate Nodule
519 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
520 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
521 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
522 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
523 2936381700 Rhizobium chutanense C16 Isolate Unclassified
524 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
525 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
526 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
527 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
528 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
529 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
530 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
531 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
532 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
533 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
534 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
535 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
536 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
537 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
538 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
539 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
540 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
541 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
542 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
543 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
544 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
545 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
546 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
547 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
548 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
549 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
550 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
551 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
552 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
553 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
554 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
555 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
556 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
557 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
558 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
559 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
560 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
561 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
562 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
563 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
564 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
565 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
566 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
567 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
568 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
569 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
570 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
571 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
572 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
573 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
574 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
575 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
576 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
577 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
578 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
579 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
580 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
581 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
582 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
583 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
584 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
585 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
586 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
587 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
588 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
589 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
590 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
591 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
592 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
593 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
594 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
595 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
596 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
597 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
598 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
599 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
600 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
601 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
602 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
603 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
604 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
605 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
606 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
607 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
608 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
609 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
610 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
611 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
612 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
613 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
614 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
615 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
616 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
617 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
618 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
619 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
620 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
621 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
622 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
623 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
624 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
625 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
626 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
627 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
628 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
629 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
630 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
631 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
632 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
633 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
634 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
635 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
636 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
637 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
638 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
639 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
640 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
641 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
642 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
643 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
644 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
645 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
646 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
647 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
648 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
649 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
650 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
651 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
652 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
653 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
654 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
655 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
656 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
657 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
658 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
659 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
660 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
661 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
662 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
663 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
664 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
665 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
666 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
667 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
668 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
669 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
670 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
671 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
672 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
673 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
674 8005275841 Rhizobium sp. N4311 Isolate Nodule
675 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
676 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
677 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
678 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
679 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
680 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
681 8005382845 Rhizobium sp. R634 Isolate Nodule
682 8005395548 Rhizobium sp. R339 Isolate Nodule
683 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
684 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
685 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
686 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
687 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
688 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
689 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
690 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
691 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
692 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
693 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
694 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
695 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
696 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
697 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
698 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
699 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
700 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
701 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
702 8018176218 Rhizobium sp. N122 Isolate Nodule
703 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
704 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
705 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
706 8024501048 Rhizobium sp. H4 Isolate Nodule
707 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
708 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
709 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
710 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
711 8056382006 Rhizobium croatiense 13T Isolate Nodule
712 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
713 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 29.83
Metatranscriptomes 0.63
Isolates 69.54

Biome Distribution

Category Percentage (%)
Aerial Root 0.36
Bulb 0
Endosphere 13.78
Nodule 57.12
Rhizoplane 0.91
Rhizosphere 13.33
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495671_0027549 3300046692 Bacteria 2934
2 JGI25155J39150_1000021 3300002704 Bacteria 150730
3 JGI25156J39149_1000001 3300002705 Bacteria 354557
4 JGI25162J39368_1000281 3300002737 Bacteria 48327
5 JGI25154J39366_1000011 3300002738 Bacteria 296007
6 JGI25158J39367_1000306 3300002739 Bacteria 11061
7 JGI25157J39369_1000079 3300002741 Bacteria 86111
8 JGI25152J39213_1006277 3300002773 Bacteria 3281
9 JGI25152J39213_1011367 3300002773 Bacteria 1973
10 JGI25159J45721_1001112 3300002987 Bacteria 11487
11 JGI25151J46595_10003428 3300003187 Bacteria 8764
12 JGI25151J46595_10017710 3300003187 Bacteria 3079
13 JGI25165J46597_1000337 3300003214 Bacteria 55143
14 JGI25165J46597_1000696 3300003214 Bacteria 26810
15 JGI25153J46596_10002434 3300003215 Bacteria 10740
16 JGI25153J46596_10010526 3300003215 Bacteria 4174
17 rootH1_10071641 3300003316 Bacteria 2086
18 rootL2_10012458 3300003322 Bacteria 21837
19 rootH1_10031282 3300003323 Bacteria 3384
20 rootH1_10043892 3300003323 Bacteria 37623
21 JGI25160J50197_1000055 3300003354 Bacteria 124791
22 JGI25160J50197_1000087 3300003354 Bacteria 93379
23 JGI25160J50197_1001447 3300003354 Bacteria 11865
24 JGI25161J50226_1000066 3300003374 Bacteria 94505
25 JGI25161J50226_1000096 3300003374 Bacteria 72203
26 JGI25161J50226_1002875 3300003374 Bacteria 4192
27 Ga0055526_1000570 3300003771 Bacteria 29064
28 Ga0055526_1001292 3300003771 Bacteria 17957
29 Ga0055526_1002700 3300003771 Bacteria 11799
30 Ga0055526_1006322 3300003771 Bacteria 6468
31 Ga0055524_1000319 3300003775 Bacteria 45208
32 Ga0055524_1000689 3300003775 Bacteria 23679
33 Ga0055524_1002647 3300003775 Bacteria 9099
34 Ga0055524_1005474 3300003775 Bacteria 5663
35 Ga0055524_1017865 3300003775 Bacteria 2485
36 Ga0055536_1005165 3300003781 Bacteria 6452
37 Ga0055528_1000293 3300003790 Bacteria 42514
38 Ga0055528_1000935 3300003790 Bacteria 19456
39 Ga0055528_1004785 3300003790 Bacteria 6445
40 Ga0055530_10009879 3300003791 Bacteria 3599
41 Ga0055540_1000095 3300003792 Bacteria 97555
42 Ga0055540_1009376 3300003792 Bacteria 3388
43 Ga0055540_1010857 3300003792 Bacteria 2995
44 Ga0055540_1013872 3300003792 Bacteria 2436
45 Ga0055540_1020561 3300003792 Bacteria 1741
46 Ga0055531_10008588 3300003794 Bacteria 5359
47 Ga0058692_1003189 3300003856 Bacteria 5167
48 Ga0058692_1004412 3300003856 Bacteria 4176
49 Ga0055543_1000045 3300004625 Bacteria 115098
50 Ga0055543_1000068 3300004625 Bacteria 94795
51 Ga0055543_1000140 3300004625 Bacteria 60103
52 Ga0055543_1000624 3300004625 Bacteria 19015
53 Ga0065165_1000218 3300005262 Bacteria 100161
54 Ga0065165_1000265 3300005262 Bacteria 90352
55 Ga0065165_1001569 3300005262 Bacteria 23590
56 Ga0065165_1011466 3300005262 Bacteria 3693
57 Ga0065165_1016015 3300005262 Bacteria 2827
58 Ga0070665_100001300 3300005548 Bacteria 29889
59 Ga0070665_100158716 3300005548 Bacteria 2263
60 Ga0068855_100476380 3300005563 Bacteria 1359
61 Ga0068854_100009281 3300005578 Bacteria 6347
62 Ga0068856_100002641 3300005614 Bacteria 18397
63 Ga0068856_100331526 3300005614 Bacteria 1539
64 Ga0068851_10015857 3300005834 Bacteria 3597
65 Ga0075365_10002812 3300006038 Bacteria 8716
66 Ga0075365_10037992 3300006038 Bacteria 3127
67 Ga0075363_100002963 3300006048 Bacteria 7086
68 Ga0075363_100007355 3300006048 Bacteria 5054
69 Ga0075363_100184600 3300006048 Bacteria 1188
70 Ga0075362_10004095 3300006177 Bacteria 5199
71 Ga0075367_10062338 3300006178 Bacteria 2227
72 Ga0075369_10006499 3300006186 Bacteria 4421
73 Ga0075369_10052235 3300006186 Bacteria 1772
74 Ga0075366_10004559 3300006195 Bacteria 7442
75 Ga0075366_10028972 3300006195 Bacteria 3251
76 Ga0075370_10009992 3300006353 Bacteria 4947
77 Ga0075370_10029168 3300006353 Bacteria 3071
78 Ga0075370_10051930 3300006353 Bacteria 2325
79 Ga0079104_1003101 3300006946 Bacteria 8092
80 Ga0079104_1003833 3300006946 Bacteria 6739
81 Ga0099826_10000030 3300006948 Bacteria 128684
82 Ga0099826_10055392 3300006948 Bacteria 2626
83 Ga0105240_10000076 3300009093 Bacteria 198848
84 Ga0105237_10000766 3300009545 Bacteria 44044
85 Ga0123341_1010765 3300009765 Bacteria 8340
86 Ga0123342_1039039 3300009766 Bacteria 1823
87 Ga0105239_10005364 3300010375 Bacteria 15051
88 Ga0157373_10019544 3300013100 Bacteria 4927
89 Ga0157371_10000294 3300013102 Bacteria 67172
90 Ga0157371_10026804 3300013102 Bacteria 4185
91 Ga0157370_10000046 3300013104 Bacteria 125612
92 Ga0157370_10000090 3300013104 Bacteria 103336
93 Ga0182008_10080525 3300014497 Bacteria 1602
94 Ga0182007_10001917 3300015262 Bacteria 10784
95 Ga0183363_1136 3300015690 Bacteria 18725
96 Ga0214544_1001350 3300021320 Bacteria 50577
97 Ga0214542_1002270 3300021321 Bacteria 39851
98 Ga0214543_1000028 3300021327 Bacteria 214029
99 Ga0228711_1000016 3300022739 Bacteria 126351
100 Ga0228710_1000013 3300022740 Bacteria 145976
101 Ga0228710_1016203 3300022740 Bacteria 7869
102 Ga0209435_100012 3300025206 Bacteria 401621
103 Ga0209436_100004 3300025208 Bacteria 196698
104 Ga0209436_102482 3300025208 Bacteria 5511
105 Ga0209436_110829 3300025208 Bacteria 1641
106 Ga0209437_100047 3300025233 Bacteria 405163
107 Ga0209437_100242 3300025233 Bacteria 89060
108 Ga0209437_103964 3300025233 Bacteria 2630
109 Ga0209646_1000026 3300025246 Bacteria 401621
110 Ga0209026_1000014 3300025250 Bacteria 401621
111 Ga0209677_102178 3300025253 Bacteria 7633
112 Ga0209759_1000012 3300025256 Bacteria 401621
113 Ga0209129_1000462 3300025258 Bacteria 29934
114 Ga0209129_1003461 3300025258 Bacteria 6844
115 Ga0209129_1009641 3300025258 Bacteria 2512
116 Ga0209233_1000048 3300025261 Bacteria 453669
117 Ga0209233_1000069 3300025261 Bacteria 367639
118 Ga0209233_1000257 3300025261 Bacteria 80366
119 Ga0209455_1006251 3300025272 Bacteria 3545
120 Ga0209673_1000022 3300025273 Bacteria 413125
121 Ga0209673_1001049 3300025273 Bacteria 31972
122 Ga0209673_1005240 3300025273 Bacteria 6602
123 Ga0209673_1031132 3300025273 Bacteria 1666
124 Ga0209130_1000001 3300025284 Bacteria 831557
125 Ga0209130_1000021 3300025284 Bacteria 374278
126 Ga0209130_1000026 3300025284 Bacteria 334058
127 Ga0209675_1014525 3300025291 Bacteria 2393
128 Ga0209676_1007418 3300025292 Bacteria 5151
129 Ga0209025_1000074 3300025294 Bacteria 277445
130 Ga0209025_1000080 3300025294 Bacteria 267244
131 Ga0209025_1000119 3300025294 Bacteria 210606
132 Ga0209025_1000767 3300025294 Bacteria 53337
133 Ga0209025_1002405 3300025294 Bacteria 19969
134 Ga0209025_1037675 3300025294 Bacteria 2140
135 Ga0209564_1000208 3300025295 Bacteria 134794
136 Ga0209564_1000571 3300025295 Bacteria 58425
137 Ga0209564_1000720 3300025295 Bacteria 47562
138 Ga0209564_1001831 3300025295 Bacteria 19508
139 Ga0209564_1007386 3300025295 Bacteria 5688
140 Ga0209564_1016386 3300025295 Bacteria 2954
141 Ga0209758_1003250 3300025297 Bacteria 15073
142 Ga0209758_1004485 3300025297 Bacteria 11596
143 Ga0209758_1012395 3300025297 Bacteria 4778
144 Ga0209758_1038229 3300025297 Bacteria 1843
145 Ga0209050_1003275 3300025298 Bacteria 12158
146 Ga0209050_1012448 3300025298 Bacteria 3898
147 Ga0209256_1000042 3300025299 Bacteria 341821
148 Ga0209256_1000520 3300025299 Bacteria 56308
149 Ga0209256_1001980 3300025299 Bacteria 18460
150 Ga0209256_1003309 3300025299 Bacteria 11468
151 Ga0209256_1006860 3300025299 Bacteria 5852
152 Ga0207426_1000005 3300025302 Bacteria 1037188
153 Ga0207426_1000006 3300025302 Bacteria 1025969
154 Ga0207426_1000010 3300025302 Bacteria 796003
155 Ga0207426_1000075 3300025302 Bacteria 321337
156 Ga0209051_1000027 3300025303 Bacteria 412172
157 Ga0209051_1001559 3300025303 Bacteria 18952
158 Ga0209051_1007571 3300025303 Bacteria 5914
159 Ga0209051_1011000 3300025303 Bacteria 4511
160 Ga0209051_1020758 3300025303 Bacteria 2817
161 Ga0209051_1045319 3300025303 Bacteria 1523
162 Ga0209257_1004173 3300025304 Bacteria 11472
163 Ga0209257_1008400 3300025304 Bacteria 5883
164 Ga0209257_1011294 3300025304 Bacteria 4325
165 Ga0207656_10009553 3300025321 Bacteria 3603
166 Ga0207695_10000011 3300025913 Bacteria 910221
167 Ga0207671_10003104 3300025914 Bacteria 16901
168 Ga0207681_10077507 3300025923 Bacteria 2337
169 Ga0207650_10012077 3300025925 Bacteria 5954
170 Ga0207702_10008026 3300026078 Bacteria 8933
171 Ga0209281_1000221 3300027111 Bacteria 122380
172 Ga0209281_1000712 3300027111 Bacteria 33445
173 Ga0209281_1001297 3300027111 Bacteria 15992
174 Ga0209371_1000009 3300027312 Bacteria 963030
175 Ga0209371_1002646 3300027312 Bacteria 9775
176 Ga0209371_1006915 3300027312 Bacteria 4081
177 Ga0209282_1000041 3300027666 Bacteria 122268
178 Ga0209282_1000085 3300027666 Bacteria 69587
179 Ga0209282_1000754 3300027666 Bacteria 16331
180 Ga0209813_10032833 3300027866 Bacteria 1540
181 Ga0268266_10005806 3300028379 Bacteria 11430
182 Ga0268266_10143279 3300028379 Bacteria 2146
183 Ga0307515_10000023 3300028794 Bacteria 400846
184 Ga0307515_10017103 3300028794 Bacteria 13240
185 Ga0307515_10035588 3300028794 Bacteria 8091
186 Ga0268256_1000010 3300030500 Bacteria 963034
187 Ga0268256_1003290 3300030500 Bacteria 7418
188 Ga0268256_1007035 3300030500 Bacteria 4081
189 Ga0307513_10005895 3300031456 Bacteria 16083
190 Ga0307408_100052466 3300031548 Bacteria 2941
191 Ga0307413_10225936 3300031824 Bacteria 1371
192 Ga0307406_10032928 3300031901 Bacteria 3168
193 Ga0307412_10155339 3300031911 Bacteria 1693
194 Ga0315914_1000030 3300031967 Bacteria 102599
195 Ga0315914_1021885 3300031967 Bacteria 4903
196 Ga0307414_10038941 3300032004 Bacteria 3198
197 Ga0315913_1000017 3300033430 Bacteria 102835
198 Ga0315915_1000017 3300033464 Bacteria 148111
199 Ga0315915_1004904 3300033464 Bacteria 16756
200 Ga0439436_0002297 3300041404 Bacteria 5732
201 Ga0439466_0017931 3300041411 Bacteria 2545
202 Ga0439465_0042872 3300041413 Bacteria 1467
203 Ga0451847_0621914 3300041503 Bacteria 1488
204 Ga0451855_1544007 3300041511 Bacteria 1258
205 Ga0451853_2671069 3300041512 Bacteria 2461
206 Ga0439445_0028220 3300042004 Bacteria 1446
207 Ga0439449_0002773 3300042007 Bacteria 6815
208 Ga0439449_0055183 3300042007 Bacteria 1467
209 Ga0439446_0058321 3300042156 Bacteria 1164
210 Ga0450918_003271 3300042531 Bacteria 3025
211 Ga0466970_0022402 3300044765 Bacteria 3297
212 Ga0495638_0000221 3300046460 Bacteria 79300
213 Ga0495605_0061112 3300046474 Bacteria 1804
214 Ga0495585_0009657 3300046492 Bacteria 5777
215 Ga0495585_0021143 3300046492 Bacteria 3738
216 Ga0495585_0031732 3300046492 Bacteria 2998
217 Ga0495607_0026645 3300046501 Bacteria 3585
218 Ga0495583_0001355 3300046506 Bacteria 25382
219 Ga0495606_0001089 3300046507 Bacteria 38890
220 Ga0495606_0026240 3300046507 Bacteria 4154
221 Ga0495610_0011301 3300046512 Bacteria 5468
222 Ga0495620_0000877 3300046515 Bacteria 18558
223 Ga0495631_0003858 3300046518 Bacteria 8120
224 Ga0495643_0074642 3300046522 Bacteria 1775
225 Ga0495643_0131861 3300046522 Bacteria 1254
226 Ga0495648_0166235 3300046524 Bacteria 1135
227 Ga0495609_0062718 3300046538 Bacteria 1641
228 Ga0495597_0015313 3300046542 Bacteria 3632
229 Ga0495656_0019263 3300046615 Bacteria 2633
230 Ga0495656_0192648 3300046615 Bacteria 1008
231 Ga0495668_0041546 3300046616 Bacteria 2561
232 Ga0495668_0058352 3300046616 Bacteria 2130
233 Ga0495668_0062732 3300046616 Bacteria 2047
234 Ga0495625_0014853 3300046660 Bacteria 6195
235 Ga0495625_0034467 3300046660 Bacteria 3736
236 Ga0495588_0005561 3300046674 Bacteria 5616
237 Ga0495588_0024342 3300046674 Bacteria 3007
238 Ga0495670_0160549 3300046691 Bacteria 1181
239 Ga0495671_0000085 3300046692 Bacteria 88500
240 Ga0495649_0013671 3300046694 Bacteria 4678
241 Ga0495649_0026338 3300046694 Bacteria 3234
242 Ga0495672_0012297 3300047320 Bacteria 5983
243 Ga0495687_014545 3300047443 Bacteria 4045
244 Ga0495686_0013314 3300047472 Bacteria 5711
245 Ga0495686_0021230 3300047472 Bacteria 4317
246 Ga0495626_0073364 3300048091 Bacteria 1533
247 Ga0496102_0011685 3300048905 Bacteria 7577
248 Ga0496103_0002275 3300048906 Bacteria 12144
249 Ga0496106_0000075 3300048909 Bacteria 79842
250 Ga0496116_0011074 3300048919 Bacteria 7503
251 Ga0496116_0034693 3300048919 Bacteria 3554
252 Ga0496116_0074732 3300048919 Bacteria 2130
253 Ga0496117_0000002 3300048920 Bacteria 2483758
254 Ga0496117_0005288 3300048920 Bacteria 13676
255 Ga0496117_0011408 3300048920 Bacteria 7958
256 Ga0496118_0000084 3300048921 Bacteria 181733
257 Ga0496118_0000204 3300048921 Bacteria 104260
258 Ga0496118_0038714 3300048921 Bacteria 3817
259 Ga0496118_0044099 3300048921 Bacteria 3496
260 Ga0496118_0105069 3300048921 Bacteria 1894
261 Ga0496119_0007112 3300048922 Bacteria 10170
262 Ga0496119_0019788 3300048922 Bacteria 4937
263 Ga0496119_0113761 3300048922 Bacteria 1498
264 Ga0496120_0000087 3300048923 Bacteria 152857
265 Ga0496120_0006252 3300048923 Bacteria 9196
266 Ga0496121_0001814 3300048924 Bacteria 34456
267 Ga0496121_0024204 3300048924 Bacteria 5816
268 Ga0496121_0028417 3300048924 Bacteria 5205
269 Ga0496122_0000001 3300048925 Bacteria 1827766
270 Ga0496122_0001317 3300048925 Bacteria 40726
271 Ga0496122_0010556 3300048925 Bacteria 9491
272 Ga0496122_0026947 3300048925 Bacteria 4934
273 Ga0496122_0038087 3300048925 Bacteria 3859
274 Ga0496123_0000001 3300048926 Bacteria 1831497
275 Ga0496123_0000448 3300048926 Bacteria 73842
276 Ga0496123_0011211 3300048926 Bacteria 7799
277 Ga0496123_0023750 3300048926 Bacteria 4684
278 Ga0496123_0026862 3300048926 Bacteria 4302
279 Ga0496124_0000187 3300048927 Bacteria 122984
280 Ga0496124_0004677 3300048927 Bacteria 15818
281 Ga0496124_0006035 3300048927 Bacteria 13348
282 Ga0496124_0008032 3300048927 Bacteria 11096
283 Ga0496124_0063255 3300048927 Bacteria 3092
284 Ga0496124_0109319 3300048927 Bacteria 2228
285 Ga0496124_0180274 3300048927 Bacteria 1626
286 Ga0496125_0002129 3300048928 Bacteria 26589
287 Ga0496125_0016411 3300048928 Bacteria 7112
288 Ga0496125_0021597 3300048928 Bacteria 6000
289 Ga0496126_0002636 3300048929 Bacteria 23833
290 Ga0501032_0030312 3300049569 Bacteria 3711
291 Ga0501033_0001601 3300049570 Bacteria 19901
292 Ga0501036_0121331 3300049572 Bacteria 2207
293 Ga0501037_0040185 3300049573 Bacteria 3442
294 Ga0501035_0004471 3300049822 Bacteria 13271
295 Ga0501044_0051622 3300049823 Bacteria 4239
296 Ga0501045_0078244 3300049824 Bacteria 2438
297 nmdc:mga03683_10300_c1 3300050489 Bacteria 3351
298 nmdc:mga03683_21926_c1 3300050489 Bacteria 2470
299 nmdc:mga03n38_24937_c1 3300050490 Bacteria 2450
300 nmdc:mga00v17_64_c1 3300050491 Bacteria 65216
301 nmdc:mga0yw44_281_c1 3300050492 Bacteria 17502
302 nmdc:mga0yw44_80027_c1 3300050492 Bacteria 2046
303 nmdc:mga0yw44_9250_c1 3300050492 Bacteria 4963
304 nmdc:mga0k408_11736_c1 3300050493 Bacteria 3341
305 nmdc:mga0k408_29828_c1 3300050493 Bacteria 3107
306 nmdc:mga0k408_56715_c1 3300050493 Bacteria 2274
307 nmdc:mga06z11_100773_c1 3300050494 Bacteria 1584
308 nmdc:mga04h51_48485_c1 3300050495 Bacteria 1416
309 nmdc:mga07m45_21653_c1 3300050496 Bacteria 3502
310 nmdc:mga0sz30_13729_c1 3300050516 Bacteria 2800
311 nmdc:mga0sz30_1514_c1 3300050516 Bacteria 8277
312 nmdc:mga0sz30_2231_c1 3300050516 Bacteria 6928
313 nmdc:mga0sz30_75765_c1 3300050516 Bacteria 1452
314 nmdc:mga0sz30_97149_c1 3300050516 Bacteria 1285
315 Ga0495619_0042060 3300053085 Bacteria 2991
316 Ga0500557_057981 3300053105 Bacteria 1253
317 Ga0500569_003493 3300053109 Bacteria 3220
318 Ga0500572_027097 3300053111 Bacteria 1567
319 Ga0500618_003087 3300053125 Bacteria 5892
320 Ga0500658_0011057 3300053134 Bacteria 3327
321 Ga0500561_0000019 3300053137 Bacteria 39573
322 Ga0500568_0001666 3300053139 Bacteria 13919
323 Ga0500568_0002168 3300053139 Bacteria 11832
324 Ga0500573_0000901 3300053140 Bacteria 13488
325 Ga0500590_010882 3300053148 Bacteria 4602
326 Ga0500616_0003476 3300053153 Bacteria 12001
327 Ga0500622_0000099 3300053156 Bacteria 86951
328 Ga0500633_0001356 3300053160 Bacteria 4560
329 Ga0500636_0000004 3300053177 Bacteria 202392
330 Ga0587080_000578 3300059503 Bacteria 3271
331 Ga0587080_006544 3300059503 Bacteria 1609
332 Ga0587082_016257 3300059504 Bacteria 1159
333 Ga0587083_0000437 3300059505 Bacteria 3655
334 Ga0587106_001857 3300059605 Bacteria 1969
335 Ga0587072_002235 3300059643 Bacteria 2555
336 Ga0587107_000630 3300059652 Bacteria 2441
337 2509375627 2509276019 Bacteria 6802256
338 2509391373 2509276021 Bacteria 7634384
339 2509445512 2509276033 Bacteria 7180565
340 2510136064 2510065019 Bacteria 6903379
341 2510302862 2510065057 Bacteria 6649661
342 2510303249 2510065057 Bacteria 6649661
343 2510841848 2510461069 Bacteria 5505000
344 2510892266 2510461076 Bacteria 8618824
345 2511134567 2510917022 Bacteria 6504556
346 2511199766 2510917030 Bacteria 7460662
347 2511497920 2511231052 Bacteria 6974333
348 2511502014 2511231052 Bacteria 6974333
349 2512529095 2512047086 Bacteria 6850303
350 2512533384 2512047086 Bacteria 6850303
351 2512969338 2512875026 Bacteria 6861065
352 2512971047 2512875026 Bacteria 6861065
353 2513568358 2513237084 Bacteria 7231967
354 2513581321 2513237085 Bacteria 7695351
355 2513582590 2513237086 Bacteria 7265287
356 2513586996 2513237086 Bacteria 7265287
357 2513594725 2513237088 Bacteria 6927906
358 2513597060 2513237088 Bacteria 6927906
359 2513604595 2513237089 Bacteria 6553624
360 2513605292 2513237089 Bacteria 6553624
361 2513615508 2513237091 Bacteria 6900273
362 2513620413 2513237091 Bacteria 6900273
363 2513630771 2513237093 Bacteria 7545552
364 2513713804 2513237103 Bacteria 7647401
365 2513864795 2513237138 Bacteria 7368160
366 2513881297 2513237140 Bacteria 7076289
367 2513885228 2513237140 Bacteria 7076289
368 2513901875 2513237143 Bacteria 6664116
369 2513902428 2513237143 Bacteria 6664116
370 2513913486 2513237144 Bacteria 7530820
371 2513926032 2513237146 Bacteria 7166346
372 2513929293 2513237146 Bacteria 7166346
373 2513984549 2513237156 Bacteria 6402557
374 2513989283 2513237156 Bacteria 6402557
375 2513997031 2513237159 Bacteria 6810126
376 2514002423 2513237159 Bacteria 6810126
377 2514007206 2513237160 Bacteria 6650282
378 2514007647 2513237160 Bacteria 6650282
379 2514021065 2513237162 Bacteria 7468464
380 2515109016 2515075009 Bacteria 7288508
381 2515608807 2515154107 Bacteria 6795637
382 2515612915 2515154107 Bacteria 6795637
383 2515632182 2515154113 Bacteria 7807172
384 2515643568 2515154114 Bacteria 7848616
385 2515658374 2515154116 Bacteria 7552979
386 2515744362 2515154134 Bacteria 7220242
387 2516205920 2516143018 Bacteria 6951533
388 2516209744 2516143018 Bacteria 6951533
389 2516893310 2516653046 Bacteria 6989037
390 2516896436 2516653046 Bacteria 6989037
391 2517041071 2516653077 Bacteria 7555578
392 2517080570 2516653085 Bacteria 7346596
393 2517097919 2517093000 Bacteria 7412387
394 2517410024 2517287029 Bacteria 6905599
395 2517565931 2517487022 Bacteria 7227575
396 2517570068 2517487022 Bacteria 7227575
397 2524448788 2524023207 Bacteria 6813453
398 2524453875 2524023207 Bacteria 6813453
399 2524459413 2524023209 Bacteria 6679728
400 2530649142 2529292951 Bacteria 6916614
401 2535516641 2534681796 Bacteria 7146037
402 2537875518 2537561587 Bacteria 5425293
403 2551674360 2551306084 Bacteria 8942552
404 2551675112 2551306084 Bacteria 8942552
405 2551680562 2551306084 Bacteria 8942552
406 2551682956 2551306085 Bacteria 7347181
407 2551688094 2551306085 Bacteria 7347181
408 2551691096 2551306086 Bacteria 6843938
409 2551694671 2551306086 Bacteria 6843938
410 2551699886 2551306087 Bacteria 7351905
411 2551700140 2551306087 Bacteria 7351905
412 2551709598 2551306089 Bacteria 7162724
413 2551710860 2551306089 Bacteria 7162724
414 2551719128 2551306090 Bacteria 7953713
415 2551722467 2551306090 Bacteria 7953713
416 2551727328 2551306091 Bacteria 7086830
417 2551728376 2551306091 Bacteria 7086830
418 2551733243 2551306092 Bacteria 6992595
419 2551737606 2551306092 Bacteria 6992595
420 2551741825 2551306093 Bacteria 7064773
421 2551745126 2551306093 Bacteria 7064773
422 2554246918 2554235003 Bacteria 5877155
423 2559294144 2558860242 Bacteria 5568029
424 2561466605 2558860983 Bacteria 4133860
425 2585166171 2582581283 Bacteria 6030556
426 2585200323 2582581294 Bacteria 6626667
427 2585221498 2582581298 Bacteria 7315509
428 2585229858 2582581299 Bacteria 6518058
429 2585267624 2582581306 Bacteria 6450535
430 2585275677 2582581307 Bacteria 6597605
431 2585277336 2582581308 Bacteria 7413247
432 2585323491 2582581315 Bacteria 7318924
433 2585331626 2582581316 Bacteria 7774528
434 2585386683 2582581865 Bacteria 6644329
435 2585393083 2582581866 Bacteria 6859583
436 2585398288 2582581866 Bacteria 6859583
437 2585404359 2582581867 Bacteria 7184437
438 2585529957 2585427526 Bacteria 7258840
439 2585534962 2585427527 Bacteria 7273426
440 2585537713 2585427528 Bacteria 6842387
441 2585541795 2585427528 Bacteria 6842387
442 2585544332 2585427529 Bacteria 7395659
443 2585555810 2585427530 Bacteria 7383882
444 2585562468 2585427531 Bacteria 6992870
445 2585835663 2585427593 Bacteria 7141551
446 2585839988 2585427593 Bacteria 7141551
447 2585898076 2585427608 Bacteria 6544331
448 2585899165 2585427608 Bacteria 6544331
449 2585906366 2585427609 Bacteria 6667127
450 2587981788 2585428125 Bacteria 6662905
451 2599331615 2599185156 Bacteria 5403036
452 2599415482 2599185170 Bacteria 7295545
453 2599417508 2599185170 Bacteria 7295545
454 2599603526 2599185210 Bacteria 5624189
455 2600195681 2599185352 Bacteria 7228948
456 2601608876 2600255279 Bacteria 5605316
457 2601745651 2600255308 Bacteria 5611129
458 2616294985 2615840624 Bacteria 6557588
459 2616308716 2615840626 Bacteria 7921970
460 2616556981 2615840698 Bacteria 7319877
461 2617385812 2617270742 Bacteria 6808054
462 2643803536 2643221557 Bacteria 7184309
463 2643811632 2643221558 Bacteria 5460675
464 2643918515 2643221582 Bacteria 5804683
465 2643921791 2643221582 Bacteria 5804683
466 2644003910 2643221599 Bacteria 6292121
467 2644050695 2643221607 Bacteria 6314006
468 2644065392 2643221610 Bacteria 7480339
469 2644067503 2643221610 Bacteria 7480339
470 2644107650 2643221618 Bacteria 7717186
471 2644148678 2643221626 Bacteria 8069654
472 2644192565 2643221634 Bacteria 6705461
473 2644202840 2643221636 Bacteria 6583769
474 2644205169 2643221636 Bacteria 6583769
475 2644210192 2643221637 Bacteria 5345260
476 2644300610 2643221653 Bacteria 4569637
477 2644309044 2643221655 Bacteria 7722067
478 2644332873 2643221659 Bacteria 7890716
479 2644375183 2643221668 Bacteria 7306521
480 2644418556 2643221675 Bacteria 7473456
481 2644451923 2643221680 Bacteria 7473610
482 2644483613 2643221686 Bacteria 6310811
483 2644496531 2643221688 Bacteria 5260751
484 2644501387 2643221689 Bacteria 6042950
485 2644518940 2643221693 Bacteria 5513853
486 2644545955 2643221698 Bacteria 7756764
487 2644614986 2643221712 Bacteria 7729434
488 2644653744 2643221718 Bacteria 5345506
489 2644658736 2643221719 Bacteria 4568197
490 2644676523 2643221723 Bacteria 7095460
491 2644690685 2643221726 Bacteria 7455827
492 2657681259 2657244999 Bacteria 5946535
493 2657684707 2657244999 Bacteria 5946535
494 2671111586 2667528174 Bacteria 6435400
495 2692315800 2690316117 Bacteria 6800650
496 2692317713 2690316117 Bacteria 6800650
497 2719389583 2718217927 Bacteria 6972593
498 2719668882 2718217997 Bacteria 6740740
499 2720489575 2718218199 Bacteria 6740745
500 2720610264 2718218232 Bacteria 6720332
501 2720617688 2718218233 Bacteria 6662049
502 2720628830 2718218235 Bacteria 6630699
503 2720772779 2718218269 Bacteria 6906114
504 2721402351 2718218423 Bacteria 6438183
505 2723030219 2721755556 Bacteria 6745503
506 2723564610 2721755684 Bacteria 6859907
507 2723569733 2721755685 Bacteria 6704835
508 2724036185 2721755809 Bacteria 6438790
509 2724092808 2721755819 Bacteria 6906405
510 2724101280 2721755822 Bacteria 6726041
511 2724113195 2721755823 Bacteria 6752556
512 2725948279 2724679232 Bacteria 7646494
513 2730110752 2728369352 Bacteria 6745171
514 2738945986 2738541317 Bacteria 5340176
515 2739036686 2738541333 Bacteria 7106503
516 2739039012 2738541333 Bacteria 7106503
517 2753461908 2751185821 Bacteria 6189929
518 2753462540 2751185821 Bacteria 6189929
519 2766069158 2765235942 Bacteria 7445910
520 2776911095 2775507049 Bacteria 6284736
521 2776911101 2775507049 Bacteria 6284736
522 2776913444 2775507049 Bacteria 6284736
523 2778175280 2775507266 Bacteria 7392367
524 2792581092 2791355082 Bacteria 5973319
525 2792581688 2791355082 Bacteria 5973319
526 2792620206 2791355091 Bacteria 6135441
527 2792623794 2791355091 Bacteria 6135441
528 2792626374 2791355092 Bacteria 6248105
529 2792629827 2791355092 Bacteria 6248105
530 2792639321 2791355094 Bacteria 7011481
531 2792642199 2791355094 Bacteria 7011481
532 2793279967 2791355253 Bacteria 5171699
533 2793297187 2791355256 Bacteria 6798008
534 2793317459 2791355259 Bacteria 7254731
535 2793324466 2791355260 Bacteria 6598818
536 2793327904 2791355261 Bacteria 6661293
537 2793337917 2791355262 Bacteria 6774204
538 2793342448 2791355263 Bacteria 6872478
539 2793354460 2791355265 Bacteria 6539969
540 2793362842 2791355266 Bacteria 7116587
541 2793371015 2791355267 Bacteria 7222458
542 2802719562 2802428858 Bacteria 6636079
543 2802720441 2802428858 Bacteria 6636079
544 2802726844 2802428859 Bacteria 6667919
545 2802727719 2802428859 Bacteria 6667919
546 2802732296 2802428860 Bacteria 6525526
547 2802732821 2802428860 Bacteria 6525526
548 2802739899 2802428861 Bacteria 6534206
549 2802739981 2802428861 Bacteria 6534206
550 2802745405 2802428862 Bacteria 6633353
551 2802747694 2802428862 Bacteria 6633353
552 2802752602 2802428863 Bacteria 6410669
553 2802752797 2802428863 Bacteria 6410669
554 2804752456 2802429268 Bacteria 6094027
555 2804755853 2802429268 Bacteria 6094027
556 2805930277 2802429605 Bacteria 6875453
557 2805934675 2802429606 Bacteria 6346811
558 2806043342 2802429633 Bacteria 7341974
559 2806049517 2802429633 Bacteria 7341974
560 2806050723 2802429634 Bacteria 7083200
561 2806052950 2802429634 Bacteria 7083200
562 2806057540 2802429635 Bacteria 7650140
563 2806063669 2802429635 Bacteria 7650140
564 2806064922 2802429636 Bacteria 7597525
565 2806068412 2802429636 Bacteria 7597525
566 2806078008 2802429637 Bacteria 7067217
567 2808986079 2808606387 Bacteria 5697198
568 2819241866 2818991272 Bacteria 4622173
569 2819556203 2818991439 Bacteria 6907412
570 2819608996 2818991448 Bacteria 6772224
571 2819637775 2818991453 Bacteria 7181617
572 2834581117 2834578030 Bacteria 3530182
573 2838020535 2838016132 Bacteria 6577831
574 2838029956 2838029111 Bacteria 6603031
575 2838035595 2838035591 Bacteria 7166484
576 2838038280 2838035591 Bacteria 7166484
577 2838044044 2838042994 Bacteria 6046894
578 2838050279 2838048938 Bacteria 6044578
579 2838062241 2838061910 Bacteria 6794874
580 2838069400 2838068647 Bacteria 6208656
581 2838074717 2838074704 Bacteria 6785777
582 2838079544 2838074704 Bacteria 6785777
583 2838661843 2838661181 Bacteria 7385261
584 2838665357 2838661181 Bacteria 7385261
585 2838673008 2838668709 Bacteria 6671819
586 2838676931 2838675328 Bacteria 4909118
587 2838684771 2838680041 Bacteria 6545511
588 2838693927 2838686498 Bacteria 7807632
589 2838698932 2838694306 Bacteria 6853137
590 2838705788 2838701080 Bacteria 6669771
591 2838712188 2838707686 Bacteria 6619912
592 2838715818 2838714209 Bacteria 5525906
593 2838720381 2838719591 Bacteria 5523910
594 2838726571 2838724970 Bacteria 4908691
595 2838733224 2838729681 Bacteria 7400765
596 2838749334 2838742623 Bacteria 7396178
597 2841847313 2841846520 Bacteria 5345850
598 2841858578 2841851746 Bacteria 7532261
599 2841860151 2841859092 Bacteria 5436171
600 2841868539 2841864319 Bacteria 6742987
601 2842111505 2842110456 Bacteria 7656360
602 2842122587 2842118031 Bacteria 7033875
603 2842126657 2842124991 Bacteria 5346824
604 2842131824 2842130223 Bacteria 4909145
605 2842153006 2842152218 Bacteria 4908957
606 2842163429 2842156927 Bacteria 6894975
607 2842164483 2842163707 Bacteria 6916235
608 2842172062 2842170452 Bacteria 5525737
609 2842176625 2842175837 Bacteria 4908771
610 2842187289 2842180545 Bacteria 6888678
611 2842188927 2842187318 Bacteria 5524014
612 2842196741 2842192696 Bacteria 6147454
613 2842209102 2842205361 Bacteria 6340321
614 2842213239 2842211629 Bacteria 5523832
615 2842223760 2842217011 Bacteria 7497767
616 2842225143 2842224351 Bacteria 5524473
617 2842236651 2842229732 Bacteria 7475766
618 2842241600 2842237096 Bacteria 6620661
619 2842250335 2842243621 Bacteria 7421798
620 2842255468 2842250916 Bacteria 6579627
621 2842264277 2842257432 Bacteria 7401195
622 2842264769 2842264693 Bacteria 6472963
623 2842278375 2842271015 Bacteria 7807131
624 2842282852 2842278818 Bacteria 6340002
625 2842295890 2842291075 Bacteria 7076806
626 2842301192 2842298080 Bacteria 6123127
627 2842307296 2842304105 Bacteria 7023636
628 2842312919 2842311132 Bacteria 6616990
629 2842320354 2842317721 Bacteria 6793725
630 2842342486 2842341865 Bacteria 7003929
631 2842357639 2842357229 Bacteria 6485165
632 2842365740 2842363717 Bacteria 6844742
633 2842374229 2842370503 Bacteria 7038661
634 2842382294 2842377471 Bacteria 7140707
635 2842389135 2842384541 Bacteria 7057858
636 2842400464 2842395702 Bacteria 6780583
637 2842405549 2842402390 Bacteria 6681310
638 2842412132 2842409023 Bacteria 6687331
639 2842418779 2842415677 Bacteria 6596907
640 2842422591 2842422224 Bacteria 6239196
641 2842429178 2842428310 Bacteria 6767288
642 2842435791 2842434925 Bacteria 6502746
643 2842441347 2842441272 Bacteria 6769273
644 2842449753 2842447887 Bacteria 6754142
645 2842463595 2842462802 Bacteria 6588055
646 2842470121 2842469257 Bacteria 6752936
647 2842476759 2842475841 Bacteria 6603183
648 2842484702 2842482326 Bacteria 7212537
649 2842489319 2842489311 Bacteria 6620893
650 2842498025 2842495871 Bacteria 6820686
651 2842503484 2842502639 Bacteria 6604161
652 2842511289 2842509118 Bacteria 6850950
653 2842516936 2842515876 Bacteria 5436280
654 2842522729 2842521101 Bacteria 6569494
655 2842527339 2842521101 Bacteria 6569494
656 2842924015 2842922631 Bacteria 5824079
657 2844167807 2844163670 Bacteria 7266046
658 2844460075 2844454524 Bacteria 7952546
659 2847419137 2847417321 Bacteria 6913799
660 2847421906 2847417321 Bacteria 6913799
661 2848994166 2848992105 Bacteria 6810864
662 2848996670 2848992105 Bacteria 6810864
663 2850081199 2850079185 Bacteria 6848280
664 2852390048 2852387548 Bacteria 8025568
665 2854684880 2854681122 Bacteria 4548679
666 2854899377 2854896431 Bacteria 5869725
667 2854917989 2854916844 Bacteria 5725939
668 2855826034 2855825444 Bacteria 6785811
669 2855828739 2855825444 Bacteria 6785811
670 2855841379 2855839649 Bacteria 7135830
671 2855843863 2855839649 Bacteria 7135830
672 2855873111 2855872281 Bacteria 6964271
673 2855876809 2855872281 Bacteria 6964271
674 2857518315 2857516855 Bacteria 7787325
675 2858802365 2858800743 Bacteria 6603254
676 2858806894 2858800743 Bacteria 6603254
677 2891373204 2891373044 Bacteria 5202277
678 2894656656 2894652903 Bacteria 4587256
679 2896384899 2896384573 Bacteria 7700774
680 2896389309 2896384573 Bacteria 7700774
681 2899792218 2899792073 Bacteria 4926588
682 2899808845 2899803654 Bacteria 5577784
683 2899849084 2899845264 Bacteria 5672268
684 2913300787 2913295892 Bacteria 6333755
685 2913311431 2913308742 Bacteria 5350706
686 2915981843 2915980308 Bacteria 6624279
687 2915986419 2915980308 Bacteria 6624279
688 2915990038 2915986958 Bacteria 6739310
689 2915992321 2915986958 Bacteria 6739310
690 2915994319 2915993759 Bacteria 7016183
691 2915997035 2915993759 Bacteria 7016183
692 2916004340 2916000859 Bacteria 6865702
693 2916006468 2916000859 Bacteria 6865702
694 2916012429 2916007675 Bacteria 6898660
695 2916013248 2916007675 Bacteria 6898660
696 2916017740 2916014648 Bacteria 6946486
697 2916019123 2916014648 Bacteria 6946486
698 2916024189 2916021584 Bacteria 6854472
699 2916026215 2916021584 Bacteria 6854472
700 2916031722 2916028427 Bacteria 6748433
701 2916034965 2916028427 Bacteria 6748433
702 2916036598 2916035215 Bacteria 6755766
703 2916041316 2916035215 Bacteria 6755766
704 2916045249 2916041962 Bacteria 6820487
705 2916047128 2916041962 Bacteria 6820487
706 2916052321 2916048683 Bacteria 6543552
707 2916054651 2916048683 Bacteria 6543552
708 2916056282 2916055098 Bacteria 6758838
709 2916056391 2916055098 Bacteria 6758838
710 2916063163 2916061851 Bacteria 6737736
711 2916067529 2916061851 Bacteria 6737736
712 2916071277 2916068649 Bacteria 6943657
713 2916072225 2916068649 Bacteria 6943657
714 2916078471 2916076590 Bacteria 6596108
715 2916081542 2916076590 Bacteria 6596108
716 2919103596 2919100787 Bacteria 7710546
717 2919116021 2919114240 Bacteria 5700270
718 2919411556 2919408235 Bacteria 6149349
719 2920765742 2920760137 Bacteria 7427611
720 2920824773 2920822456 Bacteria 6897201
721 2921202891 2921201388 Bacteria 6926299
722 2921208127 2921201388 Bacteria 6926299
723 2921213186 2921208531 Bacteria 6745326
724 2921214355 2921208531 Bacteria 6745326
725 2921240769 2921237296 Bacteria 6876710
726 2921242628 2921237296 Bacteria 6876710
727 2921244680 2921244191 Bacteria 6568419
728 2921248688 2921244191 Bacteria 6568419
729 2921251125 2921250672 Bacteria 6677771
730 2921253338 2921250672 Bacteria 6677771
731 2921259523 2921257292 Bacteria 6808382
732 2921263817 2921257292 Bacteria 6808382
733 2921264882 2921263974 Bacteria 6864552
734 2921265070 2921263974 Bacteria 6864552
735 2921283541 2921282425 Bacteria 6826397
736 2921288260 2921282425 Bacteria 6826397
737 2921293693 2921289301 Bacteria 7316391
738 2921296696 2921289301 Bacteria 7316391
739 2921298315 2921296804 Bacteria 7176999
740 2921299322 2921296804 Bacteria 7176999
741 2923558076 2923556063 Bacteria 6793593
742 2924145757 2924144063 Bacteria 6883928
743 2924147144 2924144063 Bacteria 6883928
744 2924153389 2924150972 Bacteria 7169444
745 2924156859 2924150972 Bacteria 7169444
746 2924160811 2924158325 Bacteria 7188855
747 2924165365 2924158325 Bacteria 7188855
748 2924167387 2924165586 Bacteria 7260590
749 2924168275 2924165586 Bacteria 7260590
750 2924173182 2924172951 Bacteria 6749356
751 2924179028 2924172951 Bacteria 6749356
752 2924180822 2924179722 Bacteria 6843264
753 2924185518 2924179722 Bacteria 6843264
754 2924189023 2924186466 Bacteria 6876637
755 2924193383 2924186466 Bacteria 6876637
756 2924194750 2924193448 Bacteria 6955718
757 2924198577 2924193448 Bacteria 6955718
758 2924203402 2924200457 Bacteria 6757188
759 2924205260 2924200457 Bacteria 6757188
760 2924208877 2924207177 Bacteria 6917007
761 2924209077 2924207177 Bacteria 6917007
762 2924216033 2924214083 Bacteria 7080103
763 2924223828 2924221636 Bacteria 7113495
764 2924227225 2924221636 Bacteria 7113495
765 2924229904 2924228884 Bacteria 6633132
766 2924233816 2924228884 Bacteria 6633132
767 2926756974 2926754445 Bacteria 5964435
768 2926761194 2926760298 Bacteria 5505990
769 2933007650 2933006813 Bacteria 4912075
770 2933012421 2933011516 Bacteria 5439334
771 2933017283 2933016740 Bacteria 6355406
772 2933574048 2933570622 Bacteria 7023390
773 2933588059 2933586486 Bacteria 7667493
774 2933594862 2933594066 Bacteria 5594265
775 2933600062 2933599457 Bacteria 5858799
776 2935898850 2935894831 Bacteria 6620579
777 2935906056 2935901341 Bacteria 7341747
778 2936370922 2936367885 Bacteria 7324495
779 2936375823 2936375103 Bacteria 6652732
780 2936383289 2936381700 Bacteria 7006523
781 2936998078 2936996657 Bacteria 6298727
782 2937000612 2936996657 Bacteria 6298727
783 2937004422 2937002841 Bacteria 6934057
784 2937005109 2937002841 Bacteria 6934057
785 2937012163 2937009748 Bacteria 6746052
786 2937013070 2937009748 Bacteria 6746052
787 2937017632 2937016420 Bacteria 6782579
788 2937018678 2937016420 Bacteria 6782579
789 2937028682 2937023124 Bacteria 6815156
790 2937029017 2937023124 Bacteria 6815156
791 2937030669 2937029754 Bacteria 6424026
792 2937031323 2937029754 Bacteria 6424026
793 2937039427 2937036028 Bacteria 6846469
794 2937040286 2937036028 Bacteria 6846469
795 2937048585 2937042894 Bacteria 6741576
796 2937048883 2937042894 Bacteria 6741576
797 2937050141 2937049772 Bacteria 6757901
798 2937050904 2937049772 Bacteria 6757901
799 2937061751 2937056579 Bacteria 7107896
800 2937062043 2937056579 Bacteria 7107896
801 2937064915 2937063883 Bacteria 7199456
802 2937065183 2937063883 Bacteria 7199456
803 2937073093 2937071275 Bacteria 6984483
804 2937077238 2937071275 Bacteria 6984483
805 2937079844 2937078374 Bacteria 6610289
806 2937080984 2937078374 Bacteria 6610289
807 2937085897 2937084907 Bacteria 6618516
808 2937087788 2937084907 Bacteria 6618516
809 2937092239 2937091812 Bacteria 6979387
810 2937096215 2937091812 Bacteria 6979387
811 2937099582 2937098957 Bacteria 7249374
812 2937102694 2937098957 Bacteria 7249374
813 2937112363 2937106411 Bacteria 6947143
814 2937112933 2937106411 Bacteria 6947143
815 2937116224 2937113482 Bacteria 6505872
816 2937119347 2937113482 Bacteria 6505872
817 2937123034 2937119839 Bacteria 6597547
818 2937124756 2937119839 Bacteria 6597547
819 2937128753 2937126314 Bacteria 6771275
820 2937130907 2937126314 Bacteria 6771275
821 2941504921 2941499720 Bacteria 7599444
822 2957376631 2957375807 Bacteria 6425588
823 2957378258 2957375807 Bacteria 6425588
824 2957383079 2957382221 Bacteria 6737050
825 2957384848 2957382221 Bacteria 6737050
826 2957389593 2957388812 Bacteria 6778072
827 2957394891 2957388812 Bacteria 6778072
828 2957400431 2957395598 Bacteria 6822399
829 2957402195 2957395598 Bacteria 6822399
830 2957403160 2957402308 Bacteria 6741770
831 2957404563 2957402308 Bacteria 6741770
832 2957410568 2957408893 Bacteria 6558585
833 2957411553 2957408893 Bacteria 6558585
834 2957418281 2957415311 Bacteria 6991633
835 2957421476 2957415311 Bacteria 6991633
836 2957425258 2957422303 Bacteria 7172205
837 2957426119 2957422303 Bacteria 7172205
838 2957432845 2957430029 Bacteria 7022557
839 2957435063 2957430029 Bacteria 7022557
840 2957439366 2957437181 Bacteria 6568994
841 2957440798 2957437181 Bacteria 6568994
842 2957445034 2957443900 Bacteria 6869977
843 2957448914 2957443900 Bacteria 6869977
844 2957451506 2957450854 Bacteria 6765715
845 2957456015 2957450854 Bacteria 6765715
846 2957459874 2957457609 Bacteria 6967680
847 2957463902 2957457609 Bacteria 6967680
848 2957464689 2957464669 Bacteria 6568877
849 2957466038 2957464669 Bacteria 6568877
850 2957474230 2957471148 Bacteria 6797643
851 2957477580 2957471148 Bacteria 6797643
852 2957478333 2957478035 Bacteria 6756658
853 2957479173 2957478035 Bacteria 6756658
854 2957486302 2957484790 Bacteria 6703082
855 2957490742 2957484790 Bacteria 6703082
856 2957491554 2957491536 Bacteria 6695180
857 2957492447 2957491536 Bacteria 6695180
858 2957499588 2957498199 Bacteria 7126688
859 2957503673 2957498199 Bacteria 7126688
860 2957507612 2957505466 Bacteria 7253085
861 2957511676 2957505466 Bacteria 7253085
862 2960589278 2960584000 Bacteria 6864594
863 2960589648 2960584000 Bacteria 6864594
864 2960592670 2960591022 Bacteria 6622873
865 2960593549 2960591022 Bacteria 6622873
866 2960599060 2960597568 Bacteria 6550735
867 2960602641 2960597568 Bacteria 6550735
868 2960605980 2960603979 Bacteria 6898737
869 2960607100 2960603979 Bacteria 6898737
870 2960612465 2960610863 Bacteria 6691244
871 2960615592 2960610863 Bacteria 6691244
872 2960619968 2960617483 Bacteria 6727748
873 2960623031 2960617483 Bacteria 6727748
874 2960627849 2960624210 Bacteria 6875384
875 2960628738 2960624210 Bacteria 6875384
876 2960632787 2960631154 Bacteria 6732508
877 2960636999 2960631154 Bacteria 6732508
878 2960638210 2960637947 Bacteria 7296468
879 2960641409 2960637947 Bacteria 7296468
880 2960645501 2960645483 Bacteria 7211087
881 2960650550 2960645483 Bacteria 7211087
882 2960659994 2960652885 Bacteria 7083688
883 2960660279 2960652885 Bacteria 7083688
884 2960660804 2960660292 Bacteria 7041660
885 2960664548 2960660292 Bacteria 7041660
886 2960668300 2960667422 Bacteria 6763020
887 2960671012 2960667422 Bacteria 6763020
888 2960678509 2960674078 Bacteria 6609048
889 2960679075 2960674078 Bacteria 6609048
890 2960681906 2960680706 Bacteria 6624464
891 2960683668 2960680706 Bacteria 6624464
892 2960689995 2960687367 Bacteria 6535474
893 2960692132 2960687367 Bacteria 6535474
894 2960694235 2960693952 Bacteria 6749742
895 2960694612 2960693952 Bacteria 6749742
896 2964609941 2964607997 Bacteria 7101408
897 2964614650 2964607997 Bacteria 7101408
898 2964616622 2964615318 Bacteria 6809089
899 2964621793 2964615318 Bacteria 6809089
900 2964622536 2964621998 Bacteria 6834995
901 2964626322 2964621998 Bacteria 6834995
902 2964631748 2964628898 Bacteria 7083044
903 2964635757 2964628898 Bacteria 7083044
904 2964639627 2964636051 Bacteria 7091832
905 2964640993 2964636051 Bacteria 7091832
906 2964644007 2964643177 Bacteria 6820887
907 2964647822 2964643177 Bacteria 6820887
908 2964651740 2964649959 Bacteria 6675118
909 2964652850 2964649959 Bacteria 6675118
910 2964657062 2964656573 Bacteria 7100150
911 2964660568 2964656573 Bacteria 7100150
912 2964665248 2964663802 Bacteria 7019362
913 2964667090 2964663802 Bacteria 7019362
914 2964671316 2964670856 Bacteria 6851364
915 2964674780 2964670856 Bacteria 6851364
916 2964683519 2964678106 Bacteria 6792020
917 2964684624 2964678106 Bacteria 6792020
918 2964686450 2964685014 Bacteria 6839111
919 2964689027 2964685014 Bacteria 6839111
920 2964695703 2964691889 Bacteria 6802758
921 2964697307 2964691889 Bacteria 6802758
922 2964702276 2964698721 Bacteria 6765331
923 2964704394 2964698721 Bacteria 6765331
924 2964711443 2964705432 Bacteria 7114648
925 2964711890 2964705432 Bacteria 7114648
926 2964715524 2964712639 Bacteria 6695970
927 2964715626 2964712639 Bacteria 6695970
928 2964723147 2964719344 Bacteria 7286602
929 2964724745 2964719344 Bacteria 7286602
930 2967664681 2967664464 Bacteria 6948836
931 2967669981 2967664464 Bacteria 6948836
932 2967674485 2967671571 Bacteria 7021409
933 2967677686 2967671571 Bacteria 7021409
934 2967681811 2967678726 Bacteria 7264382
935 2967684080 2967678726 Bacteria 7264382
936 2967687380 2967686174 Bacteria 6678622
937 2967691799 2967686174 Bacteria 6678622
938 2967695208 2967693043 Bacteria 6804451
939 2967697970 2967693043 Bacteria 6804451
940 2967702679 2967699805 Bacteria 6854538
941 2967704045 2967699805 Bacteria 6854538
942 2967713089 2967706974 Bacteria 7186053
943 2967713329 2967706974 Bacteria 7186053
944 2967716707 2967714385 Bacteria 7000047
945 2967720805 2967714385 Bacteria 7000047
946 2967721708 2967721400 Bacteria 7073753
947 2967725742 2967721400 Bacteria 7073753
948 2967732608 2967728569 Bacteria 6641507
949 2967735030 2967728569 Bacteria 6641507
950 2967736906 2967735183 Bacteria 6827012
951 2967741738 2967735183 Bacteria 6827012
952 2967746595 2967742019 Bacteria 6794534
953 2967746716 2967742019 Bacteria 6794534
954 2967750999 2967748971 Bacteria 6733771
955 2967755527 2967748971 Bacteria 6733771
956 2967758795 2967755722 Bacteria 6814706
957 2967761632 2967755722 Bacteria 6814706
958 2967762941 2967762386 Bacteria 6923502
959 2967765425 2967762386 Bacteria 6923502
960 2967774294 2967769361 Bacteria 6587838
961 2967775703 2967769361 Bacteria 6587838
962 2967777956 2967775926 Bacteria 6738189
963 2967780552 2967775926 Bacteria 6738189
964 2970023668 2970019648 Bacteria 7072033
965 2970026473 2970019648 Bacteria 7072033
966 2970030753 2970026789 Bacteria 6785236
967 2970031381 2970026789 Bacteria 6785236
968 2970039389 2970033650 Bacteria 7118744
969 2970039767 2970033650 Bacteria 7118744
970 2970047161 2970040964 Bacteria 6731123
971 2970047364 2970040964 Bacteria 6731123
972 2970051534 2970047711 Bacteria 7088379
973 2970051946 2970047711 Bacteria 7088379
974 2970057766 2970054988 Bacteria 6611507
975 2970060075 2970054988 Bacteria 6611507
976 2970067251 2970061556 Bacteria 7099761
977 2970067486 2970061556 Bacteria 7099761
978 2970069076 2970068827 Bacteria 7123112
979 2970072954 2970068827 Bacteria 7123112
980 2970077309 2970076120 Bacteria 6697332
981 2970077504 2970076120 Bacteria 6697332
982 2970086153 2970082768 Bacteria 6183754
983 2970087264 2970082768 Bacteria 6183754
984 2970091127 2970088815 Bacteria 6933825
985 2970094482 2970088815 Bacteria 6933825
986 2970100638 2970095765 Bacteria 6936963
987 2970101061 2970095765 Bacteria 6936963
988 2970107545 2970102677 Bacteria 6812532
989 2970108278 2970102677 Bacteria 6812532
990 2970110820 2970109326 Bacteria 6863976
991 2970115327 2970109326 Bacteria 6863976
992 2970122118 2970116247 Bacteria 6501857
993 2970122504 2970116247 Bacteria 6501857
994 2970123027 2970122695 Bacteria 6625855
995 2970123546 2970122695 Bacteria 6625855
996 2970131730 2970129317 Bacteria 6806560
997 2970134783 2970129317 Bacteria 6806560
998 2970137531 2970136068 Bacteria 7207982
999 2970142179 2970136068 Bacteria 7207982
1000 2970144053 2970143518 Bacteria 6446480
1001 2970149534 2970143518 Bacteria 6446480
1002 2970153039 2970149975 Bacteria 6779706
1003 2970154210 2970149975 Bacteria 6779706
1004 2970160171 2970156795 Bacteria 7168044
1005 2970162792 2970156795 Bacteria 7168044
1006 2970167168 2970164137 Bacteria 6861252
1007 2970167900 2970164137 Bacteria 6861252
1008 2970173238 2970170962 Bacteria 6876229
1009 2970174457 2970170962 Bacteria 6876229
1010 2970179245 2970177841 Bacteria 6768001
1011 2970180276 2970177841 Bacteria 6768001
1012 2970187625 2970184632 Bacteria 7054431
1013 2970189969 2970184632 Bacteria 7054431
1014 2970193382 2970191845 Bacteria 7032787
1015 2970196830 2970191845 Bacteria 7032787
1016 2977520314 2977516862 Bacteria 6940108
1017 2977521891 2977516862 Bacteria 6940108
1018 2977526727 2977523885 Bacteria 6960446
1019 2977528958 2977523885 Bacteria 6960446
1020 2977531716 2977530762 Bacteria 6951399
1021 2977536749 2977530762 Bacteria 6951399
1022 2977539022 2977537788 Bacteria 6929320
1023 2977540518 2977537788 Bacteria 6929320
1024 2977547599 2977544691 Bacteria 6875412
1025 2977548531 2977544691 Bacteria 6875412
1026 2977554370 2977551784 Bacteria 7125765
1027 2977555221 2977551784 Bacteria 7125765
1028 2977564474 2977558990 Bacteria 6863948
1029 2977564513 2977558990 Bacteria 6863948
1030 2977566807 2977565890 Bacteria 6901543
1031 2977572214 2977565890 Bacteria 6901543
1032 2977575335 2977572785 Bacteria 6763888
1033 2977578385 2977572785 Bacteria 6763888
1034 2977580220 2977579622 Bacteria 6772100
1035 2977580809 2977579622 Bacteria 6772100
1036 2979093523 2979089926 Bacteria 5670289
1037 2979099090 2979095461 Bacteria 5669583
1038 2979105498 2979100975 Bacteria 5423623
1039 2984512654 2984509177 Bacteria 5274802
1040 2984520986 2984518228 Bacteria 5277463
1041 2984540280 2984537506 Bacteria 5277481
1042 2984602476 2984601300 Bacteria 5455244
1043 2989349464 2989349275 Bacteria 6349068
1044 2989774987 2989771324 Bacteria 5605128
1045 2989778838 2989776772 Bacteria 4843317
1046 3003932038 3003930520 Bacteria 5667563
1047 3003936001 3003930520 Bacteria 5667563
1048 3005419969 3005416602 Bacteria 7064308
1049 3005451319 3005445848 Bacteria 6906074
1050 3005454397 3005452660 Bacteria 5889319
1051 639645275 639633055 Bacteria 7751309
1052 643826024 643692032 Bacteria 6891900
1053 648739602 648276728 Bacteria 6968865
1054 648741120 648276728 Bacteria 6968865
1055 650739335 650716007 Bacteria 5573770
1056 8003570371 8003570095 Bacteria 5747666
1057 8003993893 8003992118 Bacteria 7266902
1058 8003996428 8003992118 Bacteria 7266902
1059 8004001440 8003999396 Bacteria 7063185
1060 8004004376 8003999396 Bacteria 7063185
1061 8005248388 8005246636 Bacteria 4933972
1062 8005277927 8005275841 Bacteria 6929066
1063 8005285866 8005282627 Bacteria 6675747
1064 8005295270 8005289223 Bacteria 6634003
1065 8005306547 8005301065 Bacteria 6614431
1066 8005308354 8005307578 Bacteria 7395396
1067 8005316920 8005314921 Bacteria 7072929
1068 8005380497 8005376324 Bacteria 6590079
1069 8005383072 8005382845 Bacteria 6732062
1070 8005398673 8005395548 Bacteria 6806915
1071 8005434337 8005430974 Bacteria 6689030
1072 8005467492 8005460587 Bacteria 7157962
1073 8005485281 8005484373 Bacteria 6297373
1074 8005502031 8005497431 Bacteria 6477605
1075 8005545300 8005542996 Bacteria 7077758
1076 8005563327 8005556819 Bacteria 6908598
1077 8005566151 8005563573 Bacteria 7153261
1078 8005572527 8005570704 Bacteria 6957481
1079 8005574424 8005570704 Bacteria 6957481
1080 8005624286 8005619151 Bacteria 7030230
1081 8005629550 8005626139 Bacteria 6534237
1082 8005649734 8005645114 Bacteria 6950293
1083 8005659520 8005658619 Bacteria 4500593
1084 8005673454 8005668836 Bacteria 6953162
1085 8005683050 8005682033 Bacteria 6726518
1086 8005693757 8005688590 Bacteria 6610080
1087 8005701078 8005695170 Bacteria 6912330
1088 8018129164 8018127388 Bacteria 7351159
1089 8018151468 8018150411 Bacteria 5549903
1090 8018168860 8018163183 Bacteria 7277977
1091 8018176481 8018176218 Bacteria 6896178
1092 8023681534 8023680758 Bacteria 7729763
1093 8024485083 8024479707 Bacteria 6954785
1094 8024491956 8024486573 Bacteria 6540512
1095 8024502843 8024501048 Bacteria 6427847
1096 8046770394 8046767195 Bacteria 7547379
1097 8049294500 8049293176 Bacteria 6128433
1098 8049295030 8049293176 Bacteria 6128433
1099 8054461681 8054460903 Bacteria 4872905
1100 8056379601 8056375014 Bacteria 7006639
1101 8056382214 8056382006 Bacteria 6408074
1102 8057575899 8057575449 Bacteria 7367519
1103 8057879023 8057874678 Bacteria 7494653
1104 Ga0495671_0027549
1105 JGI25155J39150_1000021
1106 JGI25156J39149_1000001
1107 JGI25162J39368_1000281
1108 JGI25154J39366_1000011
1109 JGI25158J39367_1000306
1110 JGI25157J39369_1000079
1111 JGI25152J39213_1006277
1112 JGI25152J39213_1011367
1113 JGI25159J45721_1001112
1114 JGI25151J46595_10003428
1115 JGI25151J46595_10017710
1116 JGI25165J46597_1000337
1117 JGI25165J46597_1000696
1118 JGI25153J46596_10002434
1119 JGI25153J46596_10010526
1120 rootH1_10071641
1121 rootL2_10012458
1122 rootH1_10031282
1123 rootH1_10043892
1124 JGI25160J50197_1000055
1125 JGI25160J50197_1000087
1126 JGI25160J50197_1001447
1127 JGI25161J50226_1000066
1128 JGI25161J50226_1000096
1129 JGI25161J50226_1002875
1130 Ga0055526_1000570
1131 Ga0055526_1001292
1132 Ga0055526_1002700
1133 Ga0055526_1006322
1134 Ga0055524_1000319
1135 Ga0055524_1000689
1136 Ga0055524_1002647
1137 Ga0055524_1005474
1138 Ga0055524_1017865
1139 Ga0055536_1005165
1140 Ga0055528_1000293
1141 Ga0055528_1000935
1142 Ga0055528_1004785
1143 Ga0055530_10009879
1144 Ga0055540_1000095
1145 Ga0055540_1009376
1146 Ga0055540_1010857
1147 Ga0055540_1013872
1148 Ga0055540_1020561
1149 Ga0055531_10008588
1150 Ga0058692_1003189
1151 Ga0058692_1004412
1152 Ga0055543_1000045
1153 Ga0055543_1000068
1154 Ga0055543_1000140
1155 Ga0055543_1000624
1156 Ga0065165_1000218
1157 Ga0065165_1000265
1158 Ga0065165_1001569
1159 Ga0065165_1011466
1160 Ga0065165_1016015
1161 Ga0070665_100001300
1162 Ga0070665_100158716
1163 Ga0068855_100476380
1164 Ga0068854_100009281
1165 Ga0068856_100002641
1166 Ga0068856_100331526
1167 Ga0068851_10015857
1168 Ga0075365_10002812
1169 Ga0075365_10037992
1170 Ga0075363_100002963
1171 Ga0075363_100007355
1172 Ga0075363_100184600
1173 Ga0075362_10004095
1174 Ga0075367_10062338
1175 Ga0075369_10006499
1176 Ga0075369_10052235
1177 Ga0075366_10004559
1178 Ga0075366_10028972
1179 Ga0075370_10009992
1180 Ga0075370_10029168
1181 Ga0075370_10051930
1182 Ga0079104_1003101
1183 Ga0079104_1003833
1184 Ga0099826_10000030
1185 Ga0099826_10055392
1186 Ga0105240_10000076
1187 Ga0105237_10000766
1188 Ga0123341_1010765
1189 Ga0123342_1039039
1190 Ga0105239_10005364
1191 Ga0157373_10019544
1192 Ga0157371_10000294
1193 Ga0157371_10026804
1194 Ga0157370_10000046
1195 Ga0157370_10000090
1196 Ga0182008_10080525
1197 Ga0182007_10001917
1198 Ga0183363_1136
1199 Ga0214544_1001350
1200 Ga0214542_1002270
1201 Ga0214543_1000028
1202 Ga0228711_1000016
1203 Ga0228710_1000013
1204 Ga0228710_1016203
1205 Ga0209435_100012
1206 Ga0209436_100004
1207 Ga0209436_102482
1208 Ga0209436_110829
1209 Ga0209437_100047
1210 Ga0209437_100242
1211 Ga0209437_103964
1212 Ga0209646_1000026
1213 Ga0209026_1000014
1214 Ga0209677_102178
1215 Ga0209759_1000012
1216 Ga0209129_1000462
1217 Ga0209129_1003461
1218 Ga0209129_1009641
1219 Ga0209233_1000048
1220 Ga0209233_1000069
1221 Ga0209233_1000257
1222 Ga0209455_1006251
1223 Ga0209673_1000022
1224 Ga0209673_1001049
1225 Ga0209673_1005240
1226 Ga0209673_1031132
1227 Ga0209130_1000001
1228 Ga0209130_1000021
1229 Ga0209130_1000026
1230 Ga0209675_1014525
1231 Ga0209676_1007418
1232 Ga0209025_1000074
1233 Ga0209025_1000080
1234 Ga0209025_1000119
1235 Ga0209025_1000767
1236 Ga0209025_1002405
1237 Ga0209025_1037675
1238 Ga0209564_1000208
1239 Ga0209564_1000571
1240 Ga0209564_1000720
1241 Ga0209564_1001831
1242 Ga0209564_1007386
1243 Ga0209564_1016386
1244 Ga0209758_1003250
1245 Ga0209758_1004485
1246 Ga0209758_1012395
1247 Ga0209758_1038229
1248 Ga0209050_1003275
1249 Ga0209050_1012448
1250 Ga0209256_1000042
1251 Ga0209256_1000520
1252 Ga0209256_1001980
1253 Ga0209256_1003309
1254 Ga0209256_1006860
1255 Ga0207426_1000005
1256 Ga0207426_1000006
1257 Ga0207426_1000010
1258 Ga0207426_1000075
1259 Ga0209051_1000027
1260 Ga0209051_1001559
1261 Ga0209051_1007571
1262 Ga0209051_1011000
1263 Ga0209051_1020758
1264 Ga0209051_1045319
1265 Ga0209257_1004173
1266 Ga0209257_1008400
1267 Ga0209257_1011294
1268 Ga0207656_10009553
1269 Ga0207695_10000011
1270 Ga0207671_10003104
1271 Ga0207681_10077507
1272 Ga0207650_10012077
1273 Ga0207702_10008026
1274 Ga0209281_1000221
1275 Ga0209281_1000712
1276 Ga0209281_1001297
1277 Ga0209371_1000009
1278 Ga0209371_1002646
1279 Ga0209371_1006915
1280 Ga0209282_1000041
1281 Ga0209282_1000085
1282 Ga0209282_1000754
1283 Ga0209813_10032833
1284 Ga0268266_10005806
1285 Ga0268266_10143279
1286 Ga0307515_10000023
1287 Ga0307515_10017103
1288 Ga0307515_10035588
1289 Ga0268256_1000010
1290 Ga0268256_1003290
1291 Ga0268256_1007035
1292 Ga0307513_10005895
1293 Ga0307408_100052466
1294 Ga0307413_10225936
1295 Ga0307406_10032928
1296 Ga0307412_10155339
1297 Ga0315914_1000030
1298 Ga0315914_1021885
1299 Ga0307414_10038941
1300 Ga0315913_1000017
1301 Ga0315915_1000017
1302 Ga0315915_1004904
1303 Ga0439436_0002297
1304 Ga0439466_0017931
1305 Ga0439465_0042872
1306 Ga0451847_0621914
1307 Ga0451855_1544007
1308 Ga0451853_2671069
1309 Ga0439445_0028220
1310 Ga0439449_0002773
1311 Ga0439449_0055183
1312 Ga0439446_0058321
1313 Ga0450918_003271
1314 Ga0466970_0022402
1315 Ga0495638_0000221
1316 Ga0495605_0061112
1317 Ga0495585_0009657
1318 Ga0495585_0021143
1319 Ga0495585_0031732
1320 Ga0495607_0026645
1321 Ga0495583_0001355
1322 Ga0495606_0001089
1323 Ga0495606_0026240
1324 Ga0495610_0011301
1325 Ga0495620_0000877
1326 Ga0495631_0003858
1327 Ga0495643_0074642
1328 Ga0495643_0131861
1329 Ga0495648_0166235
1330 Ga0495609_0062718
1331 Ga0495597_0015313
1332 Ga0495656_0019263
1333 Ga0495656_0192648
1334 Ga0495668_0041546
1335 Ga0495668_0058352
1336 Ga0495668_0062732
1337 Ga0495625_0014853
1338 Ga0495625_0034467
1339 Ga0495588_0005561
1340 Ga0495588_0024342
1341 Ga0495670_0160549
1342 Ga0495671_0000085
1343 Ga0495649_0013671
1344 Ga0495649_0026338
1345 Ga0495672_0012297
1346 Ga0495687_014545
1347 Ga0495686_0013314
1348 Ga0495686_0021230
1349 Ga0495626_0073364
1350 Ga0496102_0011685
1351 Ga0496103_0002275
1352 Ga0496106_0000075
1353 Ga0496116_0011074
1354 Ga0496116_0034693
1355 Ga0496116_0074732
1356 Ga0496117_0000002
1357 Ga0496117_0005288
1358 Ga0496117_0011408
1359 Ga0496118_0000084
1360 Ga0496118_0000204
1361 Ga0496118_0038714
1362 Ga0496118_0044099
1363 Ga0496118_0105069
1364 Ga0496119_0007112
1365 Ga0496119_0019788
1366 Ga0496119_0113761
1367 Ga0496120_0000087
1368 Ga0496120_0006252
1369 Ga0496121_0001814
1370 Ga0496121_0024204
1371 Ga0496121_0028417
1372 Ga0496122_0000001
1373 Ga0496122_0001317
1374 Ga0496122_0010556
1375 Ga0496122_0026947
1376 Ga0496122_0038087
1377 Ga0496123_0000001
1378 Ga0496123_0000448
1379 Ga0496123_0011211
1380 Ga0496123_0023750
1381 Ga0496123_0026862
1382 Ga0496124_0000187
1383 Ga0496124_0004677
1384 Ga0496124_0006035
1385 Ga0496124_0008032
1386 Ga0496124_0063255
1387 Ga0496124_0109319
1388 Ga0496124_0180274
1389 Ga0496125_0002129
1390 Ga0496125_0016411
1391 Ga0496125_0021597
1392 Ga0496126_0002636
1393 Ga0501032_0030312
1394 Ga0501033_0001601
1395 Ga0501036_0121331
1396 Ga0501037_0040185
1397 Ga0501035_0004471
1398 Ga0501044_0051622
1399 Ga0501045_0078244
1400 nmdc:mga03683_10300_c1
1401 nmdc:mga03683_21926_c1
1402 nmdc:mga03n38_24937_c1
1403 nmdc:mga00v17_64_c1
1404 nmdc:mga0yw44_281_c1
1405 nmdc:mga0yw44_80027_c1
1406 nmdc:mga0yw44_9250_c1
1407 nmdc:mga0k408_11736_c1
1408 nmdc:mga0k408_29828_c1
1409 nmdc:mga0k408_56715_c1
1410 nmdc:mga06z11_100773_c1
1411 nmdc:mga04h51_48485_c1
1412 nmdc:mga07m45_21653_c1
1413 nmdc:mga0sz30_13729_c1
1414 nmdc:mga0sz30_1514_c1
1415 nmdc:mga0sz30_2231_c1
1416 nmdc:mga0sz30_75765_c1
1417 nmdc:mga0sz30_97149_c1
1418 Ga0495619_0042060
1419 Ga0500557_057981
1420 Ga0500569_003493
1421 Ga0500572_027097
1422 Ga0500618_003087
1423 Ga0500658_0011057
1424 Ga0500561_0000019
1425 Ga0500568_0001666
1426 Ga0500568_0002168
1427 Ga0500573_0000901
1428 Ga0500590_010882
1429 Ga0500616_0003476
1430 Ga0500622_0000099
1431 Ga0500633_0001356
1432 Ga0500636_0000004
1433 Ga0587080_000578
1434 Ga0587080_006544
1435 Ga0587082_016257
1436 Ga0587083_0000437
1437 Ga0587106_001857
1438 Ga0587072_002235
1439 Ga0587107_000630
1440 2509375627
1441 2509391373
1442 2509445512
1443 2510136064
1444 2510302862
1445 2510303249
1446 2510841848
1447 2510892266
1448 2511134567
1449 2511199766
1450 2511497920
1451 2511502014
1452 2512529095
1453 2512533384
1454 2512969338
1455 2512971047
1456 2513568358
1457 2513581321
1458 2513582590
1459 2513586996
1460 2513594725
1461 2513597060
1462 2513604595
1463 2513605292
1464 2513615508
1465 2513620413
1466 2513630771
1467 2513713804
1468 2513864795
1469 2513881297
1470 2513885228
1471 2513901875
1472 2513902428
1473 2513913486
1474 2513926032
1475 2513929293
1476 2513984549
1477 2513989283
1478 2513997031
1479 2514002423
1480 2514007206
1481 2514007647
1482 2514021065
1483 2515109016
1484 2515608807
1485 2515612915
1486 2515632182
1487 2515643568
1488 2515658374
1489 2515744362
1490 2516205920
1491 2516209744
1492 2516893310
1493 2516896436
1494 2517041071
1495 2517080570
1496 2517097919
1497 2517410024
1498 2517565931
1499 2517570068
1500 2524448788
1501 2524453875
1502 2524459413
1503 2530649142
1504 2535516641
1505 2537875518
1506 2551674360
1507 2551675112
1508 2551680562
1509 2551682956
1510 2551688094
1511 2551691096
1512 2551694671
1513 2551699886
1514 2551700140
1515 2551709598
1516 2551710860
1517 2551719128
1518 2551722467
1519 2551727328
1520 2551728376
1521 2551733243
1522 2551737606
1523 2551741825
1524 2551745126
1525 2554246918
1526 2559294144
1527 2561466605
1528 2585166171
1529 2585200323
1530 2585221498
1531 2585229858
1532 2585267624
1533 2585275677
1534 2585277336
1535 2585323491
1536 2585331626
1537 2585386683
1538 2585393083
1539 2585398288
1540 2585404359
1541 2585529957
1542 2585534962
1543 2585537713
1544 2585541795
1545 2585544332
1546 2585555810
1547 2585562468
1548 2585835663
1549 2585839988
1550 2585898076
1551 2585899165
1552 2585906366
1553 2587981788
1554 2599331615
1555 2599415482
1556 2599417508
1557 2599603526
1558 2600195681
1559 2601608876
1560 2601745651
1561 2616294985
1562 2616308716
1563 2616556981
1564 2617385812
1565 2643803536
1566 2643811632
1567 2643918515
1568 2643921791
1569 2644003910
1570 2644050695
1571 2644065392
1572 2644067503
1573 2644107650
1574 2644148678
1575 2644192565
1576 2644202840
1577 2644205169
1578 2644210192
1579 2644300610
1580 2644309044
1581 2644332873
1582 2644375183
1583 2644418556
1584 2644451923
1585 2644483613
1586 2644496531
1587 2644501387
1588 2644518940
1589 2644545955
1590 2644614986
1591 2644653744
1592 2644658736
1593 2644676523
1594 2644690685
1595 2657681259
1596 2657684707
1597 2671111586
1598 2692315800
1599 2692317713
1600 2719389583
1601 2719668882
1602 2720489575
1603 2720610264
1604 2720617688
1605 2720628830
1606 2720772779
1607 2721402351
1608 2723030219
1609 2723564610
1610 2723569733
1611 2724036185
1612 2724092808
1613 2724101280
1614 2724113195
1615 2725948279
1616 2730110752
1617 2738945986
1618 2739036686
1619 2739039012
1620 2753461908
1621 2753462540
1622 2766069158
1623 2776911095
1624 2776911101
1625 2776913444
1626 2778175280
1627 2792581092
1628 2792581688
1629 2792620206
1630 2792623794
1631 2792626374
1632 2792629827
1633 2792639321
1634 2792642199
1635 2793279967
1636 2793297187
1637 2793317459
1638 2793324466
1639 2793327904
1640 2793337917
1641 2793342448
1642 2793354460
1643 2793362842
1644 2793371015
1645 2802719562
1646 2802720441
1647 2802726844
1648 2802727719
1649 2802732296
1650 2802732821
1651 2802739899
1652 2802739981
1653 2802745405
1654 2802747694
1655 2802752602
1656 2802752797
1657 2804752456
1658 2804755853
1659 2805930277
1660 2805934675
1661 2806043342
1662 2806049517
1663 2806050723
1664 2806052950
1665 2806057540
1666 2806063669
1667 2806064922
1668 2806068412
1669 2806078008
1670 2808986079
1671 2819241866
1672 2819556203
1673 2819608996
1674 2819637775
1675 2834581117
1676 2838020535
1677 2838029956
1678 2838035595
1679 2838038280
1680 2838044044
1681 2838050279
1682 2838062241
1683 2838069400
1684 2838074717
1685 2838079544
1686 2838661843
1687 2838665357
1688 2838673008
1689 2838676931
1690 2838684771
1691 2838693927
1692 2838698932
1693 2838705788
1694 2838712188
1695 2838715818
1696 2838720381
1697 2838726571
1698 2838733224
1699 2838749334
1700 2841847313
1701 2841858578
1702 2841860151
1703 2841868539
1704 2842111505
1705 2842122587
1706 2842126657
1707 2842131824
1708 2842153006
1709 2842163429
1710 2842164483
1711 2842172062
1712 2842176625
1713 2842187289
1714 2842188927
1715 2842196741
1716 2842209102
1717 2842213239
1718 2842223760
1719 2842225143
1720 2842236651
1721 2842241600
1722 2842250335
1723 2842255468
1724 2842264277
1725 2842264769
1726 2842278375
1727 2842282852
1728 2842295890
1729 2842301192
1730 2842307296
1731 2842312919
1732 2842320354
1733 2842342486
1734 2842357639
1735 2842365740
1736 2842374229
1737 2842382294
1738 2842389135
1739 2842400464
1740 2842405549
1741 2842412132
1742 2842418779
1743 2842422591
1744 2842429178
1745 2842435791
1746 2842441347
1747 2842449753
1748 2842463595
1749 2842470121
1750 2842476759
1751 2842484702
1752 2842489319
1753 2842498025
1754 2842503484
1755 2842511289
1756 2842516936
1757 2842522729
1758 2842527339
1759 2842924015
1760 2844167807
1761 2844460075
1762 2847419137
1763 2847421906
1764 2848994166
1765 2848996670
1766 2850081199
1767 2852390048
1768 2854684880
1769 2854899377
1770 2854917989
1771 2855826034
1772 2855828739
1773 2855841379
1774 2855843863
1775 2855873111
1776 2855876809
1777 2857518315
1778 2858802365
1779 2858806894
1780 2891373204
1781 2894656656
1782 2896384899
1783 2896389309
1784 2899792218
1785 2899808845
1786 2899849084
1787 2913300787
1788 2913311431
1789 2915981843
1790 2915986419
1791 2915990038
1792 2915992321
1793 2915994319
1794 2915997035
1795 2916004340
1796 2916006468
1797 2916012429
1798 2916013248
1799 2916017740
1800 2916019123
1801 2916024189
1802 2916026215
1803 2916031722
1804 2916034965
1805 2916036598
1806 2916041316
1807 2916045249
1808 2916047128
1809 2916052321
1810 2916054651
1811 2916056282
1812 2916056391
1813 2916063163
1814 2916067529
1815 2916071277
1816 2916072225
1817 2916078471
1818 2916081542
1819 2919103596
1820 2919116021
1821 2919411556
1822 2920765742
1823 2920824773
1824 2921202891
1825 2921208127
1826 2921213186
1827 2921214355
1828 2921240769
1829 2921242628
1830 2921244680
1831 2921248688
1832 2921251125
1833 2921253338
1834 2921259523
1835 2921263817
1836 2921264882
1837 2921265070
1838 2921283541
1839 2921288260
1840 2921293693
1841 2921296696
1842 2921298315
1843 2921299322
1844 2923558076
1845 2924145757
1846 2924147144
1847 2924153389
1848 2924156859
1849 2924160811
1850 2924165365
1851 2924167387
1852 2924168275
1853 2924173182
1854 2924179028
1855 2924180822
1856 2924185518
1857 2924189023
1858 2924193383
1859 2924194750
1860 2924198577
1861 2924203402
1862 2924205260
1863 2924208877
1864 2924209077
1865 2924216033
1866 2924223828
1867 2924227225
1868 2924229904
1869 2924233816
1870 2926756974
1871 2926761194
1872 2933007650
1873 2933012421
1874 2933017283
1875 2933574048
1876 2933588059
1877 2933594862
1878 2933600062
1879 2935898850
1880 2935906056
1881 2936370922
1882 2936375823
1883 2936383289
1884 2936998078
1885 2937000612
1886 2937004422
1887 2937005109
1888 2937012163
1889 2937013070
1890 2937017632
1891 2937018678
1892 2937028682
1893 2937029017
1894 2937030669
1895 2937031323
1896 2937039427
1897 2937040286
1898 2937048585
1899 2937048883
1900 2937050141
1901 2937050904
1902 2937061751
1903 2937062043
1904 2937064915
1905 2937065183
1906 2937073093
1907 2937077238
1908 2937079844
1909 2937080984
1910 2937085897
1911 2937087788
1912 2937092239
1913 2937096215
1914 2937099582
1915 2937102694
1916 2937112363
1917 2937112933
1918 2937116224
1919 2937119347
1920 2937123034
1921 2937124756
1922 2937128753
1923 2937130907
1924 2941504921
1925 2957376631
1926 2957378258
1927 2957383079
1928 2957384848
1929 2957389593
1930 2957394891
1931 2957400431
1932 2957402195
1933 2957403160
1934 2957404563
1935 2957410568
1936 2957411553
1937 2957418281
1938 2957421476
1939 2957425258
1940 2957426119
1941 2957432845
1942 2957435063
1943 2957439366
1944 2957440798
1945 2957445034
1946 2957448914
1947 2957451506
1948 2957456015
1949 2957459874
1950 2957463902
1951 2957464689
1952 2957466038
1953 2957474230
1954 2957477580
1955 2957478333
1956 2957479173
1957 2957486302
1958 2957490742
1959 2957491554
1960 2957492447
1961 2957499588
1962 2957503673
1963 2957507612
1964 2957511676
1965 2960589278
1966 2960589648
1967 2960592670
1968 2960593549
1969 2960599060
1970 2960602641
1971 2960605980
1972 2960607100
1973 2960612465
1974 2960615592
1975 2960619968
1976 2960623031
1977 2960627849
1978 2960628738
1979 2960632787
1980 2960636999
1981 2960638210
1982 2960641409
1983 2960645501
1984 2960650550
1985 2960659994
1986 2960660279
1987 2960660804
1988 2960664548
1989 2960668300
1990 2960671012
1991 2960678509
1992 2960679075
1993 2960681906
1994 2960683668
1995 2960689995
1996 2960692132
1997 2960694235
1998 2960694612
1999 2964609941
2000 2964614650
2001 2964616622
2002 2964621793
2003 2964622536
2004 2964626322
2005 2964631748
2006 2964635757
2007 2964639627
2008 2964640993
2009 2964644007
2010 2964647822
2011 2964651740
2012 2964652850
2013 2964657062
2014 2964660568
2015 2964665248
2016 2964667090
2017 2964671316
2018 2964674780
2019 2964683519
2020 2964684624
2021 2964686450
2022 2964689027
2023 2964695703
2024 2964697307
2025 2964702276
2026 2964704394
2027 2964711443
2028 2964711890
2029 2964715524
2030 2964715626
2031 2964723147
2032 2964724745
2033 2967664681
2034 2967669981
2035 2967674485
2036 2967677686
2037 2967681811
2038 2967684080
2039 2967687380
2040 2967691799
2041 2967695208
2042 2967697970
2043 2967702679
2044 2967704045
2045 2967713089
2046 2967713329
2047 2967716707
2048 2967720805
2049 2967721708
2050 2967725742
2051 2967732608
2052 2967735030
2053 2967736906
2054 2967741738
2055 2967746595
2056 2967746716
2057 2967750999
2058 2967755527
2059 2967758795
2060 2967761632
2061 2967762941
2062 2967765425
2063 2967774294
2064 2967775703
2065 2967777956
2066 2967780552
2067 2970023668
2068 2970026473
2069 2970030753
2070 2970031381
2071 2970039389
2072 2970039767
2073 2970047161
2074 2970047364
2075 2970051534
2076 2970051946
2077 2970057766
2078 2970060075
2079 2970067251
2080 2970067486
2081 2970069076
2082 2970072954
2083 2970077309
2084 2970077504
2085 2970086153
2086 2970087264
2087 2970091127
2088 2970094482
2089 2970100638
2090 2970101061
2091 2970107545
2092 2970108278
2093 2970110820
2094 2970115327
2095 2970122118
2096 2970122504
2097 2970123027
2098 2970123546
2099 2970131730
2100 2970134783
2101 2970137531
2102 2970142179
2103 2970144053
2104 2970149534
2105 2970153039
2106 2970154210
2107 2970160171
2108 2970162792
2109 2970167168
2110 2970167900
2111 2970173238
2112 2970174457
2113 2970179245
2114 2970180276
2115 2970187625
2116 2970189969
2117 2970193382
2118 2970196830
2119 2977520314
2120 2977521891
2121 2977526727
2122 2977528958
2123 2977531716
2124 2977536749
2125 2977539022
2126 2977540518
2127 2977547599
2128 2977548531
2129 2977554370
2130 2977555221
2131 2977564474
2132 2977564513
2133 2977566807
2134 2977572214
2135 2977575335
2136 2977578385
2137 2977580220
2138 2977580809
2139 2979093523
2140 2979099090
2141 2979105498
2142 2984512654
2143 2984520986
2144 2984540280
2145 2984602476
2146 2989349464
2147 2989774987
2148 2989778838
2149 3003932038
2150 3003936001
2151 3005419969
2152 3005451319
2153 3005454397
2154 639645275
2155 643826024
2156 648739602
2157 648741120
2158 650739335
2159 8003570371
2160 8003993893
2161 8003996428
2162 8004001440
2163 8004004376
2164 8005248388
2165 8005277927
2166 8005285866
2167 8005295270
2168 8005306547
2169 8005308354
2170 8005316920
2171 8005380497
2172 8005383072
2173 8005398673
2174 8005434337
2175 8005467492
2176 8005485281
2177 8005502031
2178 8005545300
2179 8005563327
2180 8005566151
2181 8005572527
2182 8005574424
2183 8005624286
2184 8005629550
2185 8005649734
2186 8005659520
2187 8005673454
2188 8005683050
2189 8005693757
2190 8005701078
2191 8018129164
2192 8018151468
2193 8018168860
2194 8018176481
2195 8023681534
2196 8024485083
2197 8024491956
2198 8024502843
2199 8046770394
2200 8049294500
2201 8049295030
2202 8054461681
2203 8056379601
2204 8056382214
2205 8057575899
2206 8057879023

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04069

OpuAC

Substrate binding domain of ABC-type glycine betaine transport system

90

374

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7yle-assembly1.cif.gz_A rndmpx in complex with dmsp 0.9609 26 331
7yle-assembly1.cif.gz_A rndmpx in complex with dmsp 0.9453 26 331
3tmg-assembly4.cif.gz_D crystal structure of glycine betaine, l-proline abc transporter, glycine/betaine/l-proline-binding protein (prox) from borrelia burgdorferi 0.8795 28 329
3l6h-assembly1.cif.gz_A crystal structure of lactococcal opuac in its closed-liganded conformation complexed with glycine betaine 0.8744 27 322
3tmg-assembly4.cif.gz_D crystal structure of glycine betaine, l-proline abc transporter, glycine/betaine/l-proline-binding protein (prox) from borrelia burgdorferi 0.8703 28 329
ID Description Score Start End Superfamily
af_K7LT93_1_227_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9091 27 63 3.40.50.2000
3tmgD02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Glycine betaine-binding periplasmic protein; domain 2 0.9026 114 226 3.40.190.100
3l6hA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Glycine betaine-binding periplasmic protein; domain 2 0.873 112 225 3.40.190.100
3l6hA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Glycine betaine-binding periplasmic protein; domain 2 0.8492 112 225 3.40.190.100
3l6hA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.846 27 322 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A1L3LJ01-F1-model_v4 Glycine betaine/L-proline ABC transporter, substrate-binding protein 0.9948 34 333 GO:0022857
GO:0043190
AF-A0A1L3LJ01-F1-model_v4 Glycine betaine/L-proline ABC transporter, substrate-binding protein 0.9915 34 333 GO:0022857
GO:0043190
AF-A0A6I7HMV2-F1-model_v4 Glycine betaine/proline transport system substrate-binding protein 0.9895 34 271 GO:0022857
GO:0043190
AF-A0A8A7AUY3-F1-model_v4 deleted 0.9886 34 333
AF-A0A8A7AUY3-F1-model_v4 deleted 0.9853 34 333

Map