F490127

General Info

Members Datasets Scaffolds Average Seq Length
1104 889 422 306

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2738541317|2738948850
Length 350
Sequence LPFFLIGLAILLMVAYSSVFVVNERQQAIVVRFGQIQAVRNEPGLYFKLPFAFLDADRVQYVPDQSLRFDLNDIRVQVSGGKFYEVDAFVVYKIADARRFRQTVSGDRDAAESRLRTRLDASLRRVYGLRGFESALSDARASMMQEVRDDLRPDADTLGIRIEDVRIRRTDLTQEVSQQTFERMKAERLAEAELIRARGNEEGQRRRAIADRQVVEIQAEARRDADILRGEGDAQRNKIFADAYSRDPGFFQFYRSMSAYDDALGTSGSSSTMVLSPSTSQFFRYFDGGPDSDRLMDSADKGAEGNSGGASDMTIPQATPSTSTPATTEPSATTAPAASGAPATPAPASN

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
4 2509276019 Ensifer aridi TW10 Isolate Nodule
5 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
6 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
7 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
8 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
9 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
10 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
11 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
12 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
13 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
14 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
15 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
16 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
17 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
18 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
19 2512875024 Mesorhizobium loti R88b Isolate Nodule
20 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
21 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
22 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
23 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
24 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
25 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
26 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
27 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
28 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
29 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
30 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
31 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
32 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
33 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
34 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
35 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
36 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
37 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
38 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
39 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
40 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
41 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
42 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
43 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
44 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
45 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
46 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
47 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
48 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
49 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
50 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
51 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
52 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
53 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
54 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
55 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
56 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
57 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
58 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
59 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
60 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
61 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
62 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
63 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
64 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
65 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
66 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
67 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
68 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
69 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
70 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
71 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
72 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
73 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
74 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
75 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
76 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
77 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
78 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
79 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
80 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
81 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
82 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
83 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
84 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
85 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
86 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
87 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
88 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
89 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
90 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
91 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
92 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
93 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
94 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
95 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
96 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
97 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
98 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
99 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
100 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
101 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
102 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
103 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
104 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
105 2643221557 Ensifer sp. Root558 Isolate Unclassified
106 2643221558 Rhizobium sp. Root149 Isolate Unclassified
107 2643221568 Rhizobium sp. Root564 Isolate Unclassified
108 2643221582 Rhizobium sp. Root651 Isolate Unclassified
109 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
110 2643221599 Rhizobium sp. Root708 Isolate Unclassified
111 2643221607 Rhizobium sp. Root73 Isolate Unclassified
112 2643221610 Ensifer sp. Root74 Isolate Unclassified
113 2643221618 Ensifer sp. Root231 Isolate Unclassified
114 2643221626 Ensifer sp. Root31 Isolate Unclassified
115 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
116 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
117 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
118 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
119 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
120 2643221655 Ensifer sp. Root1252 Isolate Unclassified
121 2643221659 Ensifer sp. Root127 Isolate Unclassified
122 2643221668 Ensifer sp. Root423 Isolate Unclassified
123 2643221675 Ensifer sp. Root1298 Isolate Unclassified
124 2643221680 Ensifer sp. Root1312 Isolate Unclassified
125 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
126 2643221688 Rhizobium sp. Root482 Isolate Unclassified
127 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
128 2643221693 Rhizobium sp. Root491 Isolate Unclassified
129 2643221698 Ensifer sp. Root142 Isolate Unclassified
130 2643221712 Ensifer sp. Root258 Isolate Unclassified
131 2643221718 Rhizobium sp. Root268 Isolate Unclassified
132 2643221719 Rhizobium sp. Root274 Isolate Unclassified
133 2643221723 Ensifer sp. Root278 Isolate Unclassified
134 2643221726 Ensifer sp. Root954 Isolate Unclassified
135 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
136 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
137 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
138 2718217882 Rhizobium sp. N741 Isolate Nodule
139 2718217927 Rhizobium sp. N324 Isolate Nodule
140 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
141 2718218009 Rhizobium sp. N561 Isolate Nodule
142 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
143 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
144 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
145 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
146 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
147 2718218363 Rhizobium sp. N113 Isolate Nodule
148 2718218365 Rhizobium sp. N731 Isolate Nodule
149 2718218366 Rhizobium sp. N621 Isolate Nodule
150 2718218423 Rhizobium sp. N941 Isolate Nodule
151 2721755514 Rhizobium sp. N6212 Isolate Nodule
152 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
153 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
154 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
155 2721755809 Rhizobium sp. N541 Isolate Nodule
156 2721755810 Rhizobium sp. N871 Isolate Nodule
157 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
158 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
159 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
160 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
161 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
162 2728369365 Rhizobium sp. N1341 Isolate Nodule
163 2728369397 Rhizobium sp. N1314 Isolate Nodule
164 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
165 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
166 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
167 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
168 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
169 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
170 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
171 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
172 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
173 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
174 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
175 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
176 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
177 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
178 2791355256 Rhizobium sp. M10 Isolate Nodule
179 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
180 2791355260 Rhizobium sp. L9 Isolate Nodule
181 2791355262 Rhizobium sp. M1 Isolate Nodule
182 2791355263 Rhizobium chutanense C5 Isolate Nodule
183 2791355264 Rhizobium sp. S9 Isolate Nodule
184 2791355265 Rhizobium sp. H4 Isolate Nodule
185 2791355266 Rhizobium sp. L43 Isolate Nodule
186 2791355267 Rhizobium sp. L18 Isolate Nodule
187 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
188 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
189 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
190 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
191 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
192 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
193 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
194 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
195 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
196 2802429633 Rhizobium anhuiense J3 Isolate Nodule
197 2802429634 Rhizobium anhuiense S10 Isolate Nodule
198 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
199 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
200 2802429637 Rhizobium anhuiense C15 Isolate Nodule
201 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
202 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
203 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
204 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
205 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
206 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
207 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
208 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
209 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
210 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
211 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
212 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
213 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
214 2838048938 Rhizobium pisi 27/80 Isolate Nodule
215 2838061910 Rhizobium phaseoli L15 Isolate Nodule
216 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
217 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
218 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
219 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
220 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
221 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
222 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
223 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
224 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
225 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
226 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
227 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
228 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
229 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
230 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
231 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
232 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
233 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
234 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
235 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
236 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
237 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
238 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
239 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
240 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
241 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
242 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
243 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
244 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
245 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
246 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
247 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
248 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
249 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
250 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
251 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
252 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
253 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
254 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
255 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
256 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
257 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
258 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
259 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
260 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
261 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
262 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
263 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
264 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
265 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
266 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
267 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
268 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
269 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
270 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
271 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
272 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
273 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
274 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
275 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
276 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
277 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
278 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
279 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
280 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
281 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
282 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
283 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
284 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
285 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
286 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
287 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
288 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
289 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
290 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
291 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
292 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
293 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
294 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
295 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
296 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
297 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
298 2844163670 Ensifer sp. 1H6 Isolate Unclassified
299 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
300 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
301 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
302 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
303 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
304 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
305 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
306 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
307 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
308 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
309 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
310 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
311 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
312 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
313 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
314 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
315 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
316 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
317 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
318 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
319 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
320 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
321 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
322 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
323 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
324 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
325 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
326 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
327 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
328 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
329 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
330 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
331 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
332 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
333 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
334 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
335 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
336 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
337 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
338 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
339 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
340 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
341 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
342 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
343 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
344 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
345 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
346 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
347 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
348 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
349 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
350 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
351 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
352 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
353 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
354 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
355 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
356 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
357 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
358 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
359 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
360 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
361 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
362 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
363 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
364 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
365 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
366 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
367 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
368 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
369 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
370 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
371 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
372 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
373 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
374 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
375 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
376 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
377 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
378 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
379 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
380 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
381 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
382 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
383 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
384 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
385 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
386 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
387 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
388 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
389 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
390 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
391 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
392 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
393 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
394 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
395 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
396 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
397 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
398 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
399 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
400 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
401 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
402 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
403 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
404 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
405 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
406 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
407 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
408 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
409 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
410 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
411 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
412 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
413 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
414 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
415 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
416 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
417 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
418 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
419 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
420 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
421 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
422 2933599457 Rhizobium phaseoli M3 Isolate Nodule
423 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
424 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
425 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
426 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
427 2936381700 Rhizobium chutanense C16 Isolate Unclassified
428 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
429 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
430 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
431 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
432 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
433 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
434 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
435 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
436 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
437 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
438 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
439 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
440 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
441 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
442 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
443 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
444 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
445 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
446 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
447 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
448 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
449 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
450 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
451 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
452 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
453 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
454 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
455 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
456 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
457 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
458 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
459 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
460 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
461 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
462 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
463 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
464 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
465 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
466 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
467 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
468 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
469 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
470 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
471 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
472 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
473 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
474 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
475 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
476 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
477 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
478 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
479 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
480 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
481 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
482 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
483 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
484 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
485 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
486 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
487 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
488 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
489 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
490 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
491 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
492 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
493 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
494 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
495 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
496 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
497 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
498 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
499 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
500 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
501 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
502 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
503 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
504 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
505 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
506 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
507 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
508 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
509 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
510 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
511 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
512 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
513 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
514 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
515 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
516 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
517 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
518 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
519 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
520 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
521 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
522 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
523 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
524 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
525 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
526 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
527 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
528 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
529 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
530 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
531 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
532 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
533 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
534 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
535 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
536 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
537 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
538 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
539 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
540 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
541 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
542 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
543 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
544 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
545 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
546 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
547 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
548 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
549 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
550 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
551 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
552 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
553 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
554 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
555 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
556 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
557 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
558 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
559 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
560 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
561 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
562 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
563 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
564 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
565 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
566 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
567 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
568 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
569 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
570 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
571 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
572 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
573 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
574 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
575 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
576 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
577 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
578 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
579 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
580 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
581 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
582 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
583 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
584 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
585 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
586 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
587 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
588 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
589 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
590 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
591 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
592 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
593 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
594 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
595 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
596 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
597 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
598 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
599 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
600 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
601 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
602 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
603 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
604 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
605 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
606 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
607 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
608 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
609 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
610 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
611 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
612 2996893221 Rhizobium sp. R635 Isolate Nodule
613 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
614 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
615 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
616 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
617 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
618 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
619 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
620 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
621 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
622 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
623 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
624 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
625 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
626 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
627 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
628 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
629 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
630 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
631 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
632 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
633 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
634 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
635 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
636 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
637 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
638 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
639 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
640 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
641 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
642 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
643 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
644 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
645 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
646 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
647 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
648 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
649 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
650 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
651 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
652 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
653 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
654 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
655 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
656 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
657 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
658 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
659 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
660 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
661 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
662 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
663 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
664 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
665 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
666 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
667 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
668 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
669 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
670 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
671 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
672 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
673 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
674 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
675 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
676 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
677 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
678 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
679 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
680 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
681 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
682 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
683 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
684 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
685 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
686 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
687 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
688 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
689 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
690 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
691 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
692 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
693 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
694 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
695 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
696 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
697 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
698 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
699 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
700 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
701 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
702 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
703 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
704 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
705 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
706 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
707 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
708 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
709 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
710 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
711 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
712 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
713 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
714 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
715 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
716 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
717 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
718 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
719 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
720 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
721 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
722 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
723 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
724 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
725 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
726 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
727 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
728 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
729 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
730 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
731 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
732 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
733 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
734 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
735 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
736 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
737 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
738 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
739 3300041497 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT Metatranscriptome Unclassified
740 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
741 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
742 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
743 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
744 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
745 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
746 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
747 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
748 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
749 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
750 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
751 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
752 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
753 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
754 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
755 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
756 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
757 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
758 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
759 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
760 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
761 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
762 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
763 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
764 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
765 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
766 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
767 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
768 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
769 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
770 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
771 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
772 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
773 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
774 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
775 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
776 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
777 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
778 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
779 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
780 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
781 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
782 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
783 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
784 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
785 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
786 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
787 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
788 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
789 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
790 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
791 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
792 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
793 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
794 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
795 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
796 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
797 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
798 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
799 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
800 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
801 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
802 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
803 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
804 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
805 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
806 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
807 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
808 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
809 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
810 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
811 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
812 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
813 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
814 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
815 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
816 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
817 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
818 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
819 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
820 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
821 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
822 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
823 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
824 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
825 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
826 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
827 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
828 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
829 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
830 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
831 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
832 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
833 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
834 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
835 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
836 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
837 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
838 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
839 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
840 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
841 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
842 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
843 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
844 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
845 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
846 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
847 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
848 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
849 8005275841 Rhizobium sp. N4311 Isolate Nodule
850 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
851 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
852 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
853 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
854 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
855 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
856 8005382845 Rhizobium sp. R634 Isolate Nodule
857 8005395548 Rhizobium sp. R339 Isolate Nodule
858 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
859 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
860 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
861 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
862 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
863 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
864 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
865 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
866 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
867 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
868 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
869 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
870 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
871 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
872 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
873 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
874 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
875 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
876 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
877 8018176218 Rhizobium sp. N122 Isolate Nodule
878 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
879 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
880 8024501048 Rhizobium sp. H4 Isolate Nodule
881 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
882 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
883 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
884 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
885 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
886 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
887 8056382006 Rhizobium croatiense 13T Isolate Nodule
888 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
889 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 37.77
Metatranscriptomes 0.45
Isolates 61.78

Biome Distribution

Category Percentage (%)
Aerial Root 0.45
Bulb 0
Endosphere 17.66
Nodule 48.64
Rhizoplane 1.27
Rhizosphere 15.67
Stem 0
Stem Tuber 0
Unclassified 16.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001450 3300001979 Bacteria 10864
2 JGI25155J39150_1000001 3300002704 Bacteria 354543
3 JGI25156J39149_1000001 3300002705 Bacteria 354557
4 JGI25162J39368_1001394 3300002737 Bacteria 13232
5 JGI25162J39368_1002031 3300002737 Bacteria 8907
6 JGI25154J39366_1000011 3300002738 Bacteria 296007
7 JGI25157J39369_1000044 3300002741 Bacteria 122466
8 JGI25152J39213_1004036 3300002773 Bacteria 4781
9 JGI25152J39213_1004765 3300002773 Bacteria 4170
10 JGI25152J39213_1006271 3300002773 Bacteria 3285
11 JGI25152J39213_1010226 3300002773 Bacteria 2164
12 JGI25150J39212_1002037 3300002774 Bacteria 5264
13 JGI25159J45721_1000040 3300002987 Bacteria 68143
14 JGI25151J46595_10000802 3300003187 Bacteria 25191
15 JGI25151J46595_10003620 3300003187 Bacteria 8447
16 JGI25151J46595_10005257 3300003187 Bacteria 6713
17 JGI25151J46595_10014307 3300003187 Bacteria 3538
18 JGI25151J46595_10015478 3300003187 Bacteria 3358
19 JGI25151J46595_10047755 3300003187 Bacteria 1486
20 JGI25165J46597_1001318 3300003214 Bacteria 14040
21 JGI25165J46597_1001394 3300003214 Bacteria 13232
22 JGI25153J46596_10003413 3300003215 Bacteria 8895
23 JGI25153J46596_10009364 3300003215 Bacteria 4566
24 JGI25153J46596_10010004 3300003215 Bacteria 4333
25 JGI25153J46596_10020054 3300003215 Bacteria 2540
26 rootH1_10025312 3300003323 Bacteria 2661
27 rootH1_10081983 3300003323 Bacteria 1234
28 JGI25160J50197_1000001 3300003354 Bacteria 782301
29 JGI25160J50197_1000128 3300003354 Bacteria 68143
30 JGI25160J50197_1001466 3300003354 Bacteria 11766
31 JGI25160J50197_1005764 3300003354 Bacteria 5107
32 JGI25161J50226_1000001 3300003374 Bacteria 655036
33 JGI25161J50226_1000099 3300003374 Bacteria 70186
34 JGI25161J50226_1000504 3300003374 Bacteria 17099
35 JGI25161J50226_1001908 3300003374 Bacteria 5778
36 Ga0006562J51391_1003487 3300003578 Bacteria 6510
37 Ga0006562J51391_1063939 3300003578 Bacteria 3043
38 Ga0055526_1001851 3300003771 Bacteria 14653
39 Ga0055526_1003335 3300003771 Bacteria 10262
40 Ga0055526_1006448 3300003771 Bacteria 6362
41 Ga0055526_1014076 3300003771 Bacteria 3321
42 Ga0055526_1014414 3300003771 Bacteria 3254
43 Ga0055526_1028071 3300003771 Bacteria 1714
44 Ga0055524_1001226 3300003775 Bacteria 15158
45 Ga0055524_1002049 3300003775 Bacteria 10712
46 Ga0055524_1005359 3300003775 Bacteria 5745
47 Ga0055524_1019593 3300003775 Bacteria 2307
48 Ga0055524_1022669 3300003775 Bacteria 2044
49 Ga0055524_1036639 3300003775 Bacteria 1314
50 Ga0055536_1000853 3300003781 Bacteria 20033
51 Ga0055536_1006964 3300003781 Bacteria 5148
52 Ga0055528_1000281 3300003790 Bacteria 43508
53 Ga0055528_1001066 3300003790 Bacteria 18103
54 Ga0055528_1001765 3300003790 Bacteria 12429
55 Ga0055528_1002408 3300003790 Bacteria 10051
56 Ga0055528_1004373 3300003790 Bacteria 6814
57 Ga0055528_1020609 3300003790 Bacteria 2134
58 Ga0055530_10009853 3300003791 Bacteria 3608
59 Ga0055530_10012786 3300003791 Bacteria 2906
60 Ga0055540_1002080 3300003792 Bacteria 11001
61 Ga0055540_1004164 3300003792 Bacteria 6671
62 Ga0055540_1008927 3300003792 Bacteria 3539
63 Ga0055540_1016183 3300003792 Bacteria 2135
64 Ga0055540_1023288 3300003792 Bacteria 1562
65 Ga0055531_10004968 3300003794 Bacteria 7894
66 Ga0055531_10034638 3300003794 Bacteria 1598
67 Ga0058692_1002413 3300003856 Bacteria 6262
68 Ga0055543_1000003 3300004625 Bacteria 358656
69 Ga0055543_1000128 3300004625 Bacteria 63029
70 Ga0055543_1000130 3300004625 Bacteria 62045
71 Ga0055543_1000499 3300004625 Bacteria 22628
72 Ga0065165_1000013 3300005262 Bacteria 301887
73 Ga0065165_1000068 3300005262 Bacteria 170609
74 Ga0065165_1007280 3300005262 Bacteria 5495
75 Ga0065165_1013944 3300005262 Bacteria 3150
76 Ga0070670_100002228 3300005331 Bacteria 15933
77 Ga0070669_100440008 3300005353 Bacteria 1073
78 Ga0070665_100010357 3300005548 Bacteria 9434
79 Ga0070665_100034110 3300005548 Bacteria 5118
80 Ga0068856_100035371 3300005614 Bacteria 4895
81 Ga0075365_10005049 3300006038 Bacteria 7081
82 Ga0075365_10017434 3300006038 Bacteria 4393
83 Ga0075368_10000115 3300006042 Bacteria 20911
84 Ga0075363_100217386 3300006048 Bacteria 1095
85 Ga0075364_10000201 3300006051 Bacteria 27803
86 Ga0075364_10090871 3300006051 Bacteria 2025
87 Ga0075362_10002426 3300006177 Bacteria 6257
88 Ga0075362_10099807 3300006177 Bacteria 1356
89 Ga0075367_10039870 3300006178 Bacteria 2740
90 Ga0075367_10056233 3300006178 Bacteria 2337
91 Ga0075367_10124203 3300006178 Bacteria 1592
92 Ga0075369_10030900 3300006186 Bacteria 2257
93 Ga0075369_10045859 3300006186 Bacteria 1881
94 Ga0075369_10083644 3300006186 Bacteria 1417
95 Ga0075366_10009773 3300006195 Bacteria 5363
96 Ga0075366_10063729 3300006195 Bacteria 2191
97 Ga0075370_10036962 3300006353 Bacteria 2745
98 Ga0075370_10138849 3300006353 Bacteria 1420
99 Ga0079104_1000193 3300006946 Bacteria 85489
100 Ga0079104_1002847 3300006946 Bacteria 8673
101 Ga0099826_10000236 3300006948 Bacteria 24244
102 Ga0099826_10005829 3300006948 Bacteria 8891
103 Ga0105240_10000076 3300009093 Bacteria 198848
104 Ga0105243_10159193 3300009148 Bacteria 1945
105 Ga0105237_10013061 3300009545 Bacteria 8721
106 Ga0123341_1000032 3300009765 Bacteria 62527
107 Ga0123342_1022564 3300009766 Bacteria 4241
108 Ga0105239_10023424 3300010375 Bacteria 6800
109 Ga0105239_10509241 3300010375 Bacteria 1369
110 Ga0105246_10055949 3300011119 Bacteria 2725
111 Ga0157373_10020121 3300013100 Bacteria 4855
112 Ga0157371_10000908 3300013102 Bacteria 33346
113 Ga0157370_10000282 3300013104 Bacteria 64601
114 Ga0157370_10000351 3300013104 Bacteria 58496
115 Ga0157370_10166708 3300013104 Bacteria 2048
116 Ga0157369_10056027 3300013105 Bacteria 4254
117 Ga0171463_1003 3300013249 Bacteria 695693
118 Ga0182007_10002618 3300015262 Bacteria 8862
119 Ga0182005_1003881 3300015265 Bacteria 4954
120 Ga0183363_1093 3300015690 Bacteria 25804
121 Ga0214544_1000161 3300021320 Bacteria 101808
122 Ga0214542_1000012 3300021321 Bacteria 235800
123 Ga0214543_1000024 3300021327 Bacteria 235745
124 Ga0228711_1000008 3300022739 Bacteria 169893
125 Ga0228710_1000009 3300022740 Bacteria 169770
126 Ga0209435_100012 3300025206 Bacteria 401621
127 Ga0209436_100194 3300025208 Bacteria 28386
128 Ga0209436_100328 3300025208 Bacteria 21572
129 Ga0209436_104199 3300025208 Bacteria 3610
130 Ga0209437_100047 3300025233 Bacteria 405163
131 Ga0209437_100242 3300025233 Bacteria 89060
132 Ga0209437_106591 3300025233 Bacteria 1926
133 Ga0207425_1004664 3300025245 Bacteria 4055
134 Ga0207425_1005442 3300025245 Bacteria 3629
135 Ga0207425_1012745 3300025245 Bacteria 1960
136 Ga0209646_1000026 3300025246 Bacteria 401621
137 Ga0209646_1007277 3300025246 Bacteria 1814
138 Ga0209026_1000014 3300025250 Bacteria 401621
139 Ga0209677_100268 3300025253 Bacteria 35373
140 Ga0209759_1000012 3300025256 Bacteria 401621
141 Ga0209129_1000161 3300025258 Bacteria 102017
142 Ga0209129_1000284 3300025258 Bacteria 48264
143 Ga0209129_1000340 3300025258 Bacteria 40271
144 Ga0209129_1012857 3300025258 Bacteria 1883
145 Ga0209233_1000048 3300025261 Bacteria 453669
146 Ga0209233_1000069 3300025261 Bacteria 367639
147 Ga0209233_1000260 3300025261 Bacteria 79607
148 Ga0209673_1000010 3300025273 Bacteria 596656
149 Ga0209673_1000117 3300025273 Bacteria 172081
150 Ga0209673_1000151 3300025273 Bacteria 148103
151 Ga0209673_1002957 3300025273 Bacteria 10639
152 Ga0209673_1009157 3300025273 Bacteria 4321
153 Ga0209673_1011643 3300025273 Bacteria 3610
154 Ga0209130_1000003 3300025284 Bacteria 677988
155 Ga0209130_1000020 3300025284 Bacteria 379297
156 Ga0209130_1000034 3300025284 Bacteria 302439
157 Ga0209130_1020796 3300025284 Bacteria 1494
158 Ga0209676_1001758 3300025292 Bacteria 18389
159 Ga0209676_1008369 3300025292 Bacteria 4624
160 Ga0209676_1010120 3300025292 Bacteria 3974
161 Ga0209025_1000058 3300025294 Bacteria 311398
162 Ga0209025_1000140 3300025294 Bacteria 184765
163 Ga0209025_1000314 3300025294 Bacteria 107720
164 Ga0209025_1000405 3300025294 Bacteria 87670
165 Ga0209025_1003057 3300025294 Bacteria 16472
166 Ga0209025_1031695 3300025294 Bacteria 2494
167 Ga0209025_1035281 3300025294 Bacteria 2263
168 Ga0209025_1061989 3300025294 Bacteria 1391
169 Ga0209564_1000013 3300025295 Bacteria 775755
170 Ga0209564_1000512 3300025295 Bacteria 63708
171 Ga0209564_1002528 3300025295 Bacteria 14113
172 Ga0209564_1002713 3300025295 Bacteria 13365
173 Ga0209564_1013517 3300025295 Bacteria 3458
174 Ga0209564_1015070 3300025295 Bacteria 3169
175 Ga0209758_1000565 3300025297 Bacteria 58312
176 Ga0209758_1000642 3300025297 Bacteria 53219
177 Ga0209758_1001296 3300025297 Bacteria 30665
178 Ga0209758_1001849 3300025297 Bacteria 23242
179 Ga0209758_1004965 3300025297 Bacteria 10641
180 Ga0209758_1016110 3300025297 Bacteria 3816
181 Ga0209758_1041242 3300025297 Bacteria 1729
182 Ga0209050_1003728 3300025298 Bacteria 10962
183 Ga0209050_1010555 3300025298 Bacteria 4532
184 Ga0209050_1012699 3300025298 Bacteria 3831
185 Ga0209256_1000662 3300025299 Bacteria 46618
186 Ga0209256_1000736 3300025299 Bacteria 43165
187 Ga0209256_1001430 3300025299 Bacteria 24732
188 Ga0209256_1002653 3300025299 Bacteria 14067
189 Ga0209256_1003881 3300025299 Bacteria 9915
190 Ga0209256_1012287 3300025299 Bacteria 3305
191 Ga0209256_1018396 3300025299 Bacteria 2273
192 Ga0207426_1000006 3300025302 Bacteria 1025969
193 Ga0207426_1000008 3300025302 Bacteria 848730
194 Ga0207426_1000011 3300025302 Bacteria 791203
195 Ga0207426_1000221 3300025302 Bacteria 134756
196 Ga0207426_1000946 3300025302 Bacteria 28694
197 Ga0209051_1000308 3300025303 Bacteria 76477
198 Ga0209051_1001154 3300025303 Bacteria 24022
199 Ga0209051_1002141 3300025303 Bacteria 14692
200 Ga0209051_1006065 3300025303 Bacteria 6895
201 Ga0209051_1012386 3300025303 Bacteria 4129
202 Ga0209051_1015007 3300025303 Bacteria 3587
203 Ga0209051_1036746 3300025303 Bacteria 1805
204 Ga0209051_1055308 3300025303 Bacteria 1289
205 Ga0209257_1000853 3300025304 Bacteria 43617
206 Ga0209257_1003795 3300025304 Bacteria 12447
207 Ga0209257_1005658 3300025304 Bacteria 8632
208 Ga0209257_1026656 3300025304 Bacteria 1941
209 Ga0207695_10000011 3300025913 Bacteria 910221
210 Ga0207671_10000093 3300025914 Bacteria 138939
211 Ga0207681_10037365 3300025923 Bacteria 3209
212 Ga0207650_10005240 3300025925 Bacteria 8839
213 Ga0207640_10005039 3300025981 Bacteria 7186
214 Ga0207702_10024929 3300026078 Bacteria 4963
215 Ga0207702_10254780 3300026078 Bacteria 1650
216 Ga0209281_1000034 3300027111 Bacteria 382562
217 Ga0209281_1000106 3300027111 Bacteria 219666
218 Ga0209281_1001243 3300027111 Bacteria 16710
219 Ga0209371_1000022 3300027312 Bacteria 536342
220 Ga0209371_1001863 3300027312 Bacteria 12965
221 Ga0209282_1000024 3300027666 Bacteria 170348
222 Ga0209282_1000309 3300027666 Bacteria 24248
223 Ga0268266_10017271 3300028379 Bacteria 6160
224 Ga0268266_10044819 3300028379 Bacteria 3782
225 Ga0268266_10121269 3300028379 Bacteria 2327
226 Ga0307515_10000788 3300028794 Bacteria 72975
227 Ga0307515_10019424 3300028794 Bacteria 12229
228 Ga0268256_1000019 3300030500 Bacteria 587949
229 Ga0268256_1002097 3300030500 Bacteria 10709
230 Ga0268256_1002316 3300030500 Bacteria 9856
231 Ga0307513_10003732 3300031456 Bacteria 20589
232 Ga0307513_10226847 3300031456 Bacteria 1684
233 Ga0307408_100197002 3300031548 Bacteria 1627
234 Ga0307413_10182534 3300031824 Bacteria 1498
235 Ga0307410_10095610 3300031852 Bacteria 2119
236 Ga0315914_1000012 3300031967 Bacteria 169896
237 Ga0315913_1000006 3300033430 Bacteria 169893
238 Ga0315915_1000010 3300033464 Bacteria 240214
239 Ga0373927_0003658 3300035695 Bacteria 10956
240 Ga0373925_0004759 3300037068 Bacteria 10224
241 Ga0395900_0068310 3300037418 Bacteria 3652
242 Ga0395905_0000736 3300037471 Bacteria 43138
243 Ga0395905_0026045 3300037471 Bacteria 5515
244 Ga0395905_0047474 3300037471 Bacteria 4024
245 Ga0395901_0320100 3300038443 Bacteria 1605
246 Ga0439436_0002765 3300041404 Bacteria 5306
247 Ga0439465_0002296 3300041413 Bacteria 6277
248 Ga0439465_0004949 3300041413 Bacteria 4280
249 Ga0451789_0849729 3300041443 Bacteria 1324
250 Ga0451833_1022124 3300041491 Bacteria 2354
251 Ga0451837_0020137 3300041494 Bacteria 1660
252 Ga0451840_04660 3300041497 Bacteria 1999
253 Ga0451846_30876 3300041502 Bacteria 3995
254 Ga0451854_03511 3300041510 Bacteria 1023
255 Ga0451853_1792861 3300041512 Bacteria 2212
256 Ga0439449_0002827 3300042007 Bacteria 6751
257 Ga0450907_012476 3300042146 Bacteria 1415
258 Ga0450909_003704 3300042185 Bacteria 2171
259 Ga0466965_0083947 3300044683 Bacteria 1613
260 Ga0495592_0033798 3300046454 Bacteria 3857
261 Ga0495651_0050724 3300046462 Bacteria 3201
262 Ga0495605_0058533 3300046474 Bacteria 1852
263 Ga0495662_0044495 3300046476 Bacteria 2143
264 Ga0495584_0027957 3300046491 Bacteria 2857
265 Ga0495585_0113273 3300046492 Bacteria 1440
266 Ga0495596_0061849 3300046500 Bacteria 1458
267 Ga0495606_0006550 3300046507 Bacteria 10708
268 Ga0495620_0006130 3300046515 Bacteria 6636
269 Ga0495631_0130368 3300046518 Bacteria 1080
270 Ga0495648_0034731 3300046524 Bacteria 3278
271 Ga0495648_0037827 3300046524 Bacteria 3095
272 Ga0495652_0203742 3300046529 Bacteria 1500
273 Ga0495654_0000254 3300046530 Bacteria 48831
274 Ga0495656_0107810 3300046615 Bacteria 1298
275 Ga0495668_0028120 3300046616 Bacteria 3181
276 Ga0495668_0157065 3300046616 Bacteria 1246
277 Ga0495634_0142916 3300046642 Bacteria 1518
278 Ga0495625_0072163 3300046660 Bacteria 2421
279 Ga0495625_0105655 3300046660 Bacteria 1928
280 Ga0495661_0116948 3300046665 Bacteria 1478
281 Ga0495588_0001754 3300046674 Bacteria 9235
282 Ga0495588_0047830 3300046674 Bacteria 2197
283 Ga0495657_0196402 3300046675 Bacteria 1231
284 Ga0495670_0015378 3300046691 Bacteria 3761
285 Ga0495671_0008553 3300046692 Bacteria 5750
286 Ga0495649_0004661 3300046694 Bacteria 8907
287 Ga0495600_0006237 3300046809 Bacteria 7237
288 Ga0495660_0017816 3300046810 Bacteria 4085
289 Ga0495604_0020449 3300047317 Bacteria 5286
290 Ga0495681_0001510 3300047470 Bacteria 17385
291 Ga0495686_0021069 3300047472 Bacteria 4337
292 Ga0495686_0023633 3300047472 Bacteria 4052
293 Ga0496106_0000598 3300048909 Bacteria 25773
294 Ga0496107_0059446 3300048910 Bacteria 2766
295 Ga0496110_0606790 3300048913 Bacteria 992
296 Ga0496111_0000592 3300048914 Bacteria 19050
297 Ga0496116_0000322 3300048919 Bacteria 78643
298 Ga0496116_0022069 3300048919 Bacteria 4786
299 Ga0496116_0056826 3300048919 Bacteria 2562
300 Ga0496117_0000002 3300048920 Bacteria 2483758
301 Ga0496117_0001468 3300048920 Bacteria 33907
302 Ga0496117_0002529 3300048920 Bacteria 22887
303 Ga0496117_0046617 3300048920 Bacteria 3116
304 Ga0496117_0106842 3300048920 Bacteria 1755
305 Ga0496118_0000087 3300048921 Bacteria 176693
306 Ga0496118_0001567 3300048921 Bacteria 33913
307 Ga0496118_0003434 3300048921 Bacteria 19946
308 Ga0496118_0026260 3300048921 Bacteria 4967
309 Ga0496119_0010023 3300048922 Bacteria 8018
310 Ga0496119_0015291 3300048922 Bacteria 5926
311 Ga0496119_0049644 3300048922 Bacteria 2592
312 Ga0496120_0000180 3300048923 Bacteria 107518
313 Ga0496120_0060106 3300048923 Bacteria 2127
314 Ga0496121_0000003 3300048924 Bacteria 1191431
315 Ga0496121_0001848 3300048924 Bacteria 34098
316 Ga0496121_0192787 3300048924 Bacteria 1459
317 Ga0496122_0000004 3300048925 Bacteria 645283
318 Ga0496122_0000190 3300048925 Bacteria 140376
319 Ga0496122_0002690 3300048925 Bacteria 24724
320 Ga0496122_0008984 3300048925 Bacteria 10625
321 Ga0496122_0025449 3300048925 Bacteria 5138
322 Ga0496122_0025510 3300048925 Bacteria 5130
323 Ga0496122_0038039 3300048925 Bacteria 3862
324 Ga0496122_0083953 3300048925 Bacteria 2205
325 Ga0496122_0101287 3300048925 Bacteria 1924
326 Ga0496123_0000007 3300048926 Bacteria 645283
327 Ga0496123_0000054 3300048926 Bacteria 234046
328 Ga0496123_0001016 3300048926 Bacteria 42813
329 Ga0496123_0003077 3300048926 Bacteria 19163
330 Ga0496123_0006907 3300048926 Bacteria 10859
331 Ga0496123_0027520 3300048926 Bacteria 4232
332 Ga0496123_0056248 3300048926 Bacteria 2573
333 Ga0496123_0109631 3300048926 Bacteria 1581
334 Ga0496124_0010846 3300048927 Bacteria 9175
335 Ga0496124_0032471 3300048927 Bacteria 4608
336 Ga0496124_0038352 3300048927 Bacteria 4161
337 Ga0496124_0052109 3300048927 Bacteria 3478
338 Ga0496124_0118299 3300048927 Bacteria 2121
339 Ga0496124_0160148 3300048927 Bacteria 1755
340 Ga0496125_0000039 3300048928 Bacteria 318665
341 Ga0496125_0006424 3300048928 Bacteria 12705
342 Ga0496125_0048797 3300048928 Bacteria 3525
343 Ga0496125_0072597 3300048928 Bacteria 2680
344 Ga0496126_0000589 3300048929 Bacteria 68753
345 Ga0496126_0001391 3300048929 Bacteria 38285
346 Ga0496126_0009857 3300048929 Bacteria 10109
347 Ga0496126_0056442 3300048929 Bacteria 3550
348 Ga0495678_012840 3300049459 Bacteria 3953
349 Ga0501031_0000018 3300049568 Bacteria 106734
350 Ga0501031_0072363 3300049568 Bacteria 2244
351 Ga0501032_0000003 3300049569 Bacteria 317700
352 Ga0501032_0124577 3300049569 Bacteria 1702
353 Ga0501033_0000132 3300049570 Bacteria 72558
354 Ga0501033_0039180 3300049570 Bacteria 3540
355 Ga0501033_0065569 3300049570 Bacteria 2671
356 Ga0501034_0000005 3300049571 Bacteria 367512
357 Ga0501034_0015209 3300049571 Bacteria 7909
358 Ga0501034_0084248 3300049571 Bacteria 3181
359 Ga0501034_0109404 3300049571 Bacteria 2754
360 Ga0501034_0196403 3300049571 Bacteria 1977
361 Ga0501036_0000005 3300049572 Bacteria 246420
362 Ga0501037_0000045 3300049573 Bacteria 117148
363 Ga0501037_0010771 3300049573 Bacteria 6719
364 Ga0501038_0000001 3300049574 Bacteria 375481
365 Ga0501038_0057487 3300049574 Bacteria 3339
366 Ga0501039_0000007 3300049575 Bacteria 277831
367 Ga0501039_0047957 3300049575 Bacteria 3301
368 Ga0501040_0002864 3300049576 Bacteria 11141
369 Ga0501042_0069903 3300049578 Bacteria 2511
370 Ga0501043_0000333 3300049579 Bacteria 42740
371 Ga0501043_0029830 3300049579 Bacteria 4285
372 Ga0501043_0048556 3300049579 Bacteria 3337
373 Ga0501043_0316411 3300049579 Bacteria 1190
374 Ga0501046_0095057 3300049580 Bacteria 2290
375 Ga0501047_0000708 3300049581 Bacteria 34744
376 Ga0501047_0150237 3300049581 Bacteria 2206
377 Ga0501070_0046550 3300049586 Bacteria 3606
378 Ga0501071_0029005 3300049587 Bacteria 3903
379 Ga0501074_0045015 3300049590 Bacteria 3193
380 Ga0501080_0088046 3300049742 Bacteria 2884
381 Ga0501083_0029179 3300049744 Bacteria 3796
382 Ga0501035_0000008 3300049822 Bacteria 313425
383 Ga0501035_0034332 3300049822 Bacteria 4609
384 Ga0501044_0000001 3300049823 Bacteria 418087
385 Ga0501044_0018565 3300049823 Bacteria 7452
386 Ga0501044_0070396 3300049823 Bacteria 3558
387 Ga0501044_0127037 3300049823 Bacteria 2546
388 nmdc:mga03683_15911_c1 3300050489 Bacteria 2817
389 nmdc:mga00v17_109_c1 3300050491 Bacteria 49123
390 nmdc:mga00v17_12_c1 3300050491 Bacteria 129050
391 nmdc:mga0yw44_109488_c1 3300050492 Bacteria 1769
392 nmdc:mga0yw44_9875_c1 3300050492 Bacteria 4848
393 nmdc:mga0k408_41938_c1 3300050493 Bacteria 2636
394 nmdc:mga0k408_91151_c1 3300050493 Bacteria 1791
395 nmdc:mga06z11_42859_c1 3300050494 Bacteria 2273
396 nmdc:mga04h51_10505_c1 3300050495 Bacteria 2544
397 nmdc:mga07m45_217770_c1 3300050496 Bacteria 1111
398 nmdc:mga07m45_22178_c1 3300050496 Bacteria 3465
399 nmdc:mga0sz30_14406_c1 3300050516 Bacteria 3111
400 nmdc:mga0sz30_234_c1 3300050516 Bacteria 21206
401 nmdc:mga0sz30_27949_c1 3300050516 Bacteria 2319
402 Ga0500578_0031569 3300053086 Bacteria 3403
403 Ga0500560_001784 3300053107 Bacteria 3873
404 Ga0500572_013979 3300053111 Bacteria 1997
405 Ga0500608_075572 3300053122 Bacteria 1597
406 Ga0500618_000361 3300053125 Bacteria 31600
407 Ga0500618_002086 3300053125 Bacteria 7961
408 Ga0500658_0010047 3300053134 Bacteria 3493
409 Ga0500559_0005232 3300053136 Bacteria 5981
410 Ga0500561_0000158 3300053137 Bacteria 12739
411 Ga0500568_0004569 3300053139 Bacteria 7374
412 Ga0500573_0000351 3300053140 Bacteria 19560
413 Ga0500573_0004201 3300053140 Bacteria 7546
414 Ga0500590_001679 3300053148 Bacteria 9256
415 Ga0500604_0004056 3300053151 Bacteria 3902
416 Ga0500616_0000884 3300053153 Bacteria 33039
417 Ga0500622_0000825 3300053156 Bacteria 26536
418 Ga0500622_0036562 3300053156 Bacteria 2567
419 Ga0500633_0017213 3300053160 Bacteria 2115
420 Ga0500634_0000230 3300053161 Bacteria 18142
421 Ga0500636_0001765 3300053177 Bacteria 11844
422 Ga0501082_0099050 3300060353 Bacteria 2520

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037471 Ga0395905_0026045 Ga0395905_0026045_1486_2448 256
2 3300038443 Ga0395901_0320100 Ga0395901_0320100_43_1005 256
3 3300049569 Ga0501032_0124577 Ga0501032_0124577_401_1363 257
4 3300049570 Ga0501033_0065569 Ga0501033_0065569_340_1302 257
5 3300049574 Ga0501038_0057487 Ga0501038_0057487_1349_2311 257
6 3300049575 Ga0501039_0047957 Ga0501039_0047957_1183_2145 257
7 3300049578 Ga0501042_0069903 Ga0501042_0069903_1261_2223 257
8 3300049579 Ga0501043_0316411 Ga0501043_0316411_119_1081 257
9 3300049586 Ga0501070_0046550 Ga0501070_0046550_688_1650 257
10 3300049587 Ga0501071_0029005 Ga0501071_0029005_2230_3192 257
11 3300049590 Ga0501074_0045015 Ga0501074_0045015_1831_2793 257
12 3300049742 Ga0501080_0088046 Ga0501080_0088046_1470_2432 257
13 3300049823 Ga0501044_0070396 Ga0501044_0070396_1227_2189 257
14 3300049568 Ga0501031_0000018 Ga0501031_0000018_41698_42642 258
15 3300049568 Ga0501031_0072363 Ga0501031_0072363_363_1292 258
16 3300049569 Ga0501032_0000003 Ga0501032_0000003_302358_303302 258
17 3300049570 Ga0501033_0000132 Ga0501033_0000132_52704_53648 258
18 3300049571 Ga0501034_0000005 Ga0501034_0000005_302358_303302 258
19 3300049572 Ga0501036_0000005 Ga0501036_0000005_181226_182170 258
20 3300049573 Ga0501037_0000045 Ga0501037_0000045_52105_53049 258
21 3300049574 Ga0501038_0000001 Ga0501038_0000001_302358_303302 258
22 3300049575 Ga0501039_0000007 Ga0501039_0000007_193873_194817 258
23 3300049576 Ga0501040_0002864 Ga0501040_0002864_444_1388 258
24 3300049579 Ga0501043_0000333 Ga0501043_0000333_16957_17901 258
25 3300049581 Ga0501047_0000708 Ga0501047_0000708_11683_12627 258
26 3300049822 Ga0501035_0000008 Ga0501035_0000008_248237_249181 258
27 3300049823 Ga0501044_0000001 Ga0501044_0000001_114786_115730 258
28 3300028379 Ga0268266_10121269 Ga0268266_101212692 260
29 3300049581 Ga0501047_0150237 Ga0501047_0150237_95_1039 260
30 3300049571 Ga0501034_0015209 Ga0501034_0015209_1175_2125 268
31 3300049571 Ga0501034_0196403 Ga0501034_0196403_626_1570 272
32 3300049579 Ga0501043_0048556 Ga0501043_0048556_314_1258 272
33 3300049822 Ga0501035_0034332 Ga0501035_0034332_1810_2754 272
34 3300049823 Ga0501044_0127037 Ga0501044_0127037_422_1366 272
35 3300048921 Ga0496118_0026260 Ga0496118_0026260_1033_2001 273
36 3300003771 Ga0055526_1014076 Ga0055526_10140762 277
37 3300003771 Ga0055526_1014414 Ga0055526_10144142 277
38 3300003775 Ga0055524_1036639 Ga0055524_10366392 277
39 3300003790 Ga0055528_1001765 Ga0055528_100176510 277
40 3300025273 Ga0209673_1000117 Ga0209673_1000117151 277
41 3300025295 Ga0209564_1002528 Ga0209564_10025284 277
42 3300025299 Ga0209256_1018396 Ga0209256_10183962 277
43 3300041413 Ga0439465_0002296 Ga0439465_0002296_2950_3918 277
44 iso_pu_bacteria 2961183825 2961188133 277
45 3300006946 Ga0079104_1002847 Ga0079104_100284710 278
46 3300022739 Ga0228711_1000008 Ga0228711_1000008109 278
47 3300022740 Ga0228710_1000009 Ga0228710_1000009108 278
48 3300027111 Ga0209281_1000106 Ga0209281_1000106122 278
49 3300027111 Ga0209281_1001243 Ga0209281_100124311 278
50 3300027666 Ga0209282_1000024 Ga0209282_100002453 278
51 3300031852 Ga0307410_10095610 Ga0307410_100956103 278
52 3300031967 Ga0315914_1000012 Ga0315914_1000012109 278
53 3300033430 Ga0315913_1000006 Ga0315913_1000006108 278
54 3300033464 Ga0315915_1000010 Ga0315915_1000010155 278
55 3300042007 Ga0439449_0002827 Ga0439449_0002827_3468_4400 278
56 iso_pu_bacteria 2965102966 2965103599 281
57 3300003187 JGI25151J46595_10015478 JGI25151J46595_100154784 282
58 3300003578 Ga0006562J51391_1003487 Ga0006562J51391_10034875 282
59 3300025294 Ga0209025_1000405 Ga0209025_100040592 282
60 3300025303 Ga0209051_1055308 Ga0209051_10553082 282
61 3300048922 Ga0496119_0015291 Ga0496119_0015291_3739_4641 284
62 3300048926 Ga0496123_0109631 Ga0496123_0109631_409_1311 284
63 3300048928 Ga0496125_0072597 Ga0496125_0072597_413_1315 284
64 iso_pu_bacteria 2871481445 2871485984 284
65 iso_pu_bacteria 2874131515 2874138478 284
66 3300003856 Ga0058692_1002413 Ga0058692_10024132 285
67 3300006186 Ga0075369_10083644 Ga0075369_100836442 285
68 3300030500 Ga0268256_1002316 Ga0268256_100231610 285
69 3300048925 Ga0496122_0002690 Ga0496122_0002690_11167_12144 285
70 3300048926 Ga0496123_0000054 Ga0496123_0000054_44739_45716 285
71 3300050516 nmdc:mga0sz30_14406_c1 nmdc:mga0sz30_14406_c1_895_1818 285
72 3300005353 Ga0070669_100440008 Ga0070669_1004400082 286
73 3300005548 Ga0070665_100010357 Ga0070665_1000103572 286
74 3300006042 Ga0075368_10000115 Ga0075368_100001153 286
75 3300006177 Ga0075362_10099807 Ga0075362_100998072 286
76 3300006178 Ga0075367_10056233 Ga0075367_100562331 286
77 3300006186 Ga0075369_10030900 Ga0075369_100309002 286
78 3300006195 Ga0075366_10063729 Ga0075366_100637291 286
79 3300009148 Ga0105243_10159193 Ga0105243_101591932 286
80 3300011119 Ga0105246_10055949 Ga0105246_100559492 286
81 3300013100 Ga0157373_10020121 Ga0157373_100201213 286
82 3300013102 Ga0157371_10000908 Ga0157371_1000090832 286
83 3300013104 Ga0157370_10000351 Ga0157370_1000035162 286
84 3300028379 Ga0268266_10017271 Ga0268266_100172715 286
85 3300048919 Ga0496116_0056826 Ga0496116_0056826_640_1563 286
86 3300048920 Ga0496117_0000002 Ga0496117_0000002_535165_536088 286
87 3300048921 Ga0496118_0000087 Ga0496118_0000087_146724_147647 286
88 3300048922 Ga0496119_0049644 Ga0496119_0049644_1028_1951 286
89 3300048923 Ga0496120_0000180 Ga0496120_0000180_53765_54688 286
90 3300048925 Ga0496122_0000004 Ga0496122_0000004_53770_54693 286
91 3300048926 Ga0496123_0000007 Ga0496123_0000007_53770_54693 286
92 3300048927 Ga0496124_0052109 Ga0496124_0052109_66_989 286
93 3300048928 Ga0496125_0048797 Ga0496125_0048797_102_1025 286
94 3300050489 nmdc:mga03683_15911_c1 nmdc:mga03683_15911_c1_490_1413 286
95 3300050491 nmdc:mga00v17_12_c1 nmdc:mga00v17_12_c1_81924_82847 286
96 3300050492 nmdc:mga0yw44_109488_c1 nmdc:mga0yw44_109488_c1_823_1746 286
97 3300050493 nmdc:mga0k408_91151_c1 nmdc:mga0k408_91151_c1_143_1066 286
98 3300050516 nmdc:mga0sz30_234_c1 nmdc:mga0sz30_234_c1_6752_7675 286
99 3300053137 Ga0500561_0000158 Ga0500561_0000158_3991_4914 286
100 3300047472 Ga0495686_0021069 Ga0495686_0021069_2787_3758 287
101 3300048927 Ga0496124_0038352 Ga0496124_0038352_1422_2399 287
102 3300053156 Ga0500622_0036562 Ga0500622_0036562_1252_2202 287
103 iso_pu_bacteria 2965110997 2965115779 287
104 3300048927 Ga0496124_0160148 Ga0496124_0160148_772_1698 288
105 iso_pu_bacteria 2937042894 2937045605 288
106 3300006946 Ga0079104_1000193 Ga0079104_100019319 289
107 3300006948 Ga0099826_10000236 Ga0099826_100002368 289
108 3300027111 Ga0209281_1000034 Ga0209281_100003419 289
109 3300027666 Ga0209282_1000309 Ga0209282_10003098 289
110 3300053125 Ga0500618_000361 Ga0500618_000361_3004_3948 289
111 3300053161 Ga0500634_0000230 Ga0500634_0000230_9560_10474 289
112 3300003578 Ga0006562J51391_1063939 Ga0006562J51391_10639394 290
113 3300013105 Ga0157369_10056027 Ga0157369_100560272 290
114 3300027312 Ga0209371_1000022 Ga0209371_100002231 290
115 3300030500 Ga0268256_1000019 Ga0268256_1000019489 290
116 3300048927 Ga0496124_0118299 Ga0496124_0118299_249_1199 290
117 3300048929 Ga0496126_0001391 Ga0496126_0001391_15709_16659 290
118 3300025294 Ga0209025_1061989 Ga0209025_10619891 291
119 3300048919 Ga0496116_0000322 Ga0496116_0000322_3461_4411 291
120 3300003775 Ga0055524_1001226 Ga0055524_10012262 292
121 3300003775 Ga0055524_1019593 Ga0055524_10195932 292
122 3300021320 Ga0214544_1000161 Ga0214544_100016138 292
123 3300021321 Ga0214542_1000012 Ga0214542_1000012148 292
124 3300021327 Ga0214543_1000024 Ga0214543_1000024149 292
125 3300025284 Ga0209130_1020796 Ga0209130_10207962 292
126 3300025294 Ga0209025_1035281 Ga0209025_10352812 292
127 3300025299 Ga0209256_1001430 Ga0209256_10014306 292
128 3300053125 Ga0500618_002086 Ga0500618_002086_4394_5335 292
129 iso_pu_bacteria 2970619444 2970623840 292
130 3300025294 Ga0209025_1031695 Ga0209025_10316952 293
131 iso_pu_bacteria 2899803654 2899807334 293
132 iso_pu_bacteria 2915650412 2915653113 293
133 iso_pu_bacteria 2965047637 2965050751 293
134 iso_pu_bacteria 2977950692 2977957496 293
135 3300002773 JGI25152J39213_1004765 JGI25152J39213_10047652 294
136 3300002773 JGI25152J39213_1006271 JGI25152J39213_10062712 294
137 3300003187 JGI25151J46595_10047755 JGI25151J46595_100477551 294
138 3300025245 Ga0207425_1012745 Ga0207425_10127452 294
139 3300025258 Ga0209129_1000161 Ga0209129_1000161107 294
140 3300025294 Ga0209025_1003057 Ga0209025_10030575 294
141 3300025297 Ga0209758_1041242 Ga0209758_10412422 294
142 3300025303 Ga0209051_1036746 Ga0209051_10367462 294
143 3300028794 Ga0307515_10000788 Ga0307515_1000078847 294
144 3300031456 Ga0307513_10003732 Ga0307513_1000373211 294
145 3300031456 Ga0307513_10226847 Ga0307513_102268471 294
146 iso_pu_bacteria 2857367948 2857374691 294
147 3300003775 Ga0055524_1005359 Ga0055524_10053593 295
148 3300003790 Ga0055528_1000281 Ga0055528_100028131 295
149 3300013104 Ga0157370_10166708 Ga0157370_101667083 295
150 3300025273 Ga0209673_1000010 Ga0209673_1000010125 295
151 3300025292 Ga0209676_1010120 Ga0209676_10101202 295
152 3300025295 Ga0209564_1015070 Ga0209564_10150703 295
153 3300025299 Ga0209256_1000662 Ga0209256_100066238 295
154 3300046674 Ga0495588_0001754 Ga0495588_0001754_4008_4925 295
155 3300048920 Ga0496117_0046617 Ga0496117_0046617_1529_2467 295
156 3300048925 Ga0496122_0101287 Ga0496122_0101287_925_1863 295
157 3300048926 Ga0496123_0056248 Ga0496123_0056248_128_1066 295
158 3300050496 nmdc:mga07m45_22178_c1 nmdc:mga07m45_22178_c1_764_1702 295
159 3300003187 JGI25151J46595_10014307 JGI25151J46595_100143073 296
160 3300025294 Ga0209025_1000140 Ga0209025_1000140139 296
161 3300048920 Ga0496117_0002529 Ga0496117_0002529_3562_4512 296
162 iso_pu_bacteria 2558860983 2561468997 296
163 iso_pu_bacteria 2979793036 2979800598 296
164 iso_pu_bacteria 3003930520 3003933958 296
165 3300002773 JGI25152J39213_1010226 JGI25152J39213_10102261 297
166 3300003187 JGI25151J46595_10000802 JGI25151J46595_100008022 297
167 3300003187 JGI25151J46595_10003620 JGI25151J46595_100036206 297
168 3300003215 JGI25153J46596_10009364 JGI25153J46596_100093644 297
169 3300003215 JGI25153J46596_10010004 JGI25153J46596_100100042 297
170 3300003354 JGI25160J50197_1005764 JGI25160J50197_10057642 297
171 3300003374 JGI25161J50226_1001908 JGI25161J50226_10019084 297
172 3300003771 Ga0055526_1006448 Ga0055526_10064482 297
173 3300003775 Ga0055524_1022669 Ga0055524_10226692 297
174 3300003790 Ga0055528_1002408 Ga0055528_10024082 297
175 3300003790 Ga0055528_1004373 Ga0055528_10043734 297
176 3300003790 Ga0055528_1020609 Ga0055528_10206091 297
177 3300003792 Ga0055540_1008927 Ga0055540_10089272 297
178 3300003792 Ga0055540_1016183 Ga0055540_10161831 297
179 3300003792 Ga0055540_1023288 Ga0055540_10232881 297
180 3300003794 Ga0055531_10034638 Ga0055531_100346382 297
181 3300004625 Ga0055543_1000499 Ga0055543_10004992 297
182 3300006038 Ga0075365_10005049 Ga0075365_100050492 297
183 3300006048 Ga0075363_100217386 Ga0075363_1002173861 297
184 3300006177 Ga0075362_10002426 Ga0075362_100024262 297
185 3300006178 Ga0075367_10039870 Ga0075367_100398702 297
186 3300006195 Ga0075366_10009773 Ga0075366_100097734 297
187 3300006353 Ga0075370_10036962 Ga0075370_100369623 297
188 3300006353 Ga0075370_10138849 Ga0075370_101388492 297
189 3300009765 Ga0123341_1000032 Ga0123341_100003215 297
190 3300009766 Ga0123342_1022564 Ga0123342_10225643 297
191 3300025245 Ga0207425_1005442 Ga0207425_10054422 297
192 3300025258 Ga0209129_1000284 Ga0209129_100028448 297
193 3300025258 Ga0209129_1012857 Ga0209129_10128571 297
194 3300025273 Ga0209673_1000151 Ga0209673_100015110 297
195 3300025273 Ga0209673_1009157 Ga0209673_10091574 297
196 3300025273 Ga0209673_1011643 Ga0209673_10116431 297
197 3300025294 Ga0209025_1000058 Ga0209025_1000058275 297
198 3300025295 Ga0209564_1002713 Ga0209564_10027139 297
199 3300025295 Ga0209564_1013517 Ga0209564_10135173 297
200 3300025297 Ga0209758_1000565 Ga0209758_10005658 297
201 3300025297 Ga0209758_1004965 Ga0209758_10049659 297
202 3300025298 Ga0209050_1012699 Ga0209050_10126991 297
203 3300025299 Ga0209256_1000736 Ga0209256_10007368 297
204 3300025299 Ga0209256_1012287 Ga0209256_10122872 297
205 3300025302 Ga0207426_1000221 Ga0207426_100022160 297
206 3300025302 Ga0207426_1000946 Ga0207426_100094612 297
207 3300025303 Ga0209051_1000308 Ga0209051_100030875 297
208 3300025303 Ga0209051_1006065 Ga0209051_10060655 297
209 3300025303 Ga0209051_1012386 Ga0209051_10123861 297
210 3300025304 Ga0209257_1000853 Ga0209257_10008538 297
211 3300025304 Ga0209257_1026656 Ga0209257_10266562 297
212 3300041443 Ga0451789_0849729 Ga0451789_0849729_236_1192 297
213 3300041491 Ga0451833_1022124 Ga0451833_1022124_1106_2062 297
214 3300041494 Ga0451837_0020137 Ga0451837_0020137_557_1513 297
215 3300041502 Ga0451846_30876 Ga0451846_30876_3007_3963 297
216 3300041510 Ga0451854_03511 Ga0451854_03511_49_1005 297
217 3300041512 Ga0451853_1792861 Ga0451853_1792861_964_1920 297
218 3300044683 Ga0466965_0083947 Ga0466965_0083947_33_989 297
219 3300046474 Ga0495605_0058533 Ga0495605_0058533_22_978 297
220 3300046491 Ga0495584_0027957 Ga0495584_0027957_1004_1960 297
221 3300046492 Ga0495585_0113273 Ga0495585_0113273_153_1109 297
222 3300046500 Ga0495596_0061849 Ga0495596_0061849_450_1406 297
223 3300046507 Ga0495606_0006550 Ga0495606_0006550_560_1516 297
224 3300046515 Ga0495620_0006130 Ga0495620_0006130_3395_4351 297
225 3300046518 Ga0495631_0130368 Ga0495631_0130368_105_1061 297
226 3300046524 Ga0495648_0037827 Ga0495648_0037827_1086_2042 297
227 3300046615 Ga0495656_0107810 Ga0495656_0107810_26_994 297
228 3300046616 Ga0495668_0028120 Ga0495668_0028120_2186_3142 297
229 3300046660 Ga0495625_0072163 Ga0495625_0072163_967_1935 297
230 3300046660 Ga0495625_0105655 Ga0495625_0105655_920_1876 297
231 3300046665 Ga0495661_0116948 Ga0495661_0116948_38_994 297
232 3300046691 Ga0495670_0015378 Ga0495670_0015378_608_1576 297
233 3300046810 Ga0495660_0017816 Ga0495660_0017816_3078_4034 297
234 3300047472 Ga0495686_0023633 Ga0495686_0023633_2076_3032 297
235 3300048910 Ga0496107_0059446 Ga0496107_0059446_317_1255 297
236 3300048924 Ga0496121_0192787 Ga0496121_0192787_42_980 297
237 3300049459 Ga0495678_012840 Ga0495678_012840_2123_3079 297
238 3300050493 nmdc:mga0k408_41938_c1 nmdc:mga0k408_41938_c1_1133_2089 297
239 3300050494 nmdc:mga06z11_42859_c1 nmdc:mga06z11_42859_c1_463_1419 297
240 3300050495 nmdc:mga04h51_10505_c1 nmdc:mga04h51_10505_c1_258_1214 297
241 3300050496 nmdc:mga07m45_217770_c1 nmdc:mga07m45_217770_c1_142_1098 297
242 3300050516 nmdc:mga0sz30_27949_c1 nmdc:mga0sz30_27949_c1_249_1205 297
243 3300053086 Ga0500578_0031569 Ga0500578_0031569_1384_2340 297
244 3300053122 Ga0500608_075572 Ga0500608_075572_282_1187 297
245 3300053134 Ga0500658_0010047 Ga0500658_0010047_2134_3090 297
246 3300053136 Ga0500559_0005232 Ga0500559_0005232_4525_5430 297
247 iso_pu_bacteria 2523231067 2523470791 297
248 iso_pu_bacteria 2738543031 2739349024 297
249 iso_pu_bacteria 2757320392 2757569680 297
250 iso_pu_bacteria 2869234852 2869241241 297
251 iso_pu_bacteria 2996893221 2996894409 297
252 3300006051 Ga0075364_10000201 Ga0075364_1000020125 298
253 3300035695 Ga0373927_0003658 Ga0373927_0003658_2615_3523 298
254 3300037068 Ga0373925_0004759 Ga0373925_0004759_5414_6322 298
255 3300037418 Ga0395900_0068310 Ga0395900_0068310_758_1666 298
256 3300037471 Ga0395905_0047474 Ga0395905_0047474_1782_2690 298
257 3300050491 nmdc:mga00v17_109_c1 nmdc:mga00v17_109_c1_3026_3958 298
258 3300053153 Ga0500616_0000884 Ga0500616_0000884_12451_13401 298
259 iso_pu_bacteria 2513237159 2513996861 298
260 iso_pu_bacteria 2582581283 2585166289 298
261 iso_pu_bacteria 2582581306 2585267498 298
262 iso_pu_bacteria 2582581865 2585386563 298
263 iso_pu_bacteria 2582581866 2585393198 298
264 iso_pu_bacteria 2588253730 2588517208 298
265 iso_pu_bacteria 2643221607 2644050579 298
266 iso_pu_bacteria 2643221636 2644205053 298
267 iso_pu_bacteria 2643221637 2644210081 298
268 iso_pu_bacteria 2643221686 2644483497 298
269 iso_pu_bacteria 2643221688 2644491978 298
270 iso_pu_bacteria 2643221689 2644499703 298
271 iso_pu_bacteria 2643221718 2644653633 298
272 iso_pu_bacteria 2837651117 2837654428 298
273 iso_pu_bacteria 2842521101 2842522901 298
274 3300006051 Ga0075364_10090871 Ga0075364_100908712 299
275 3300006186 Ga0075369_10045859 Ga0075369_100458591 299
276 3300037471 Ga0395905_0000736 Ga0395905_0000736_9005_9925 299
277 3300048923 Ga0496120_0060106 Ga0496120_0060106_830_1780 299
278 3300048925 Ga0496122_0000190 Ga0496122_0000190_50800_51750 299
279 3300048926 Ga0496123_0001016 Ga0496123_0001016_39715_40665 299
280 iso_pu_bacteria 2510065019 2510133891 299
281 iso_pu_bacteria 2512875016 2512931378 299
282 iso_pu_bacteria 2516653077 2517036637 299
283 iso_pu_bacteria 2643221557 2643803155 299
284 iso_pu_bacteria 2643221610 2644063516 299
285 iso_pu_bacteria 2643221668 2644374800 299
286 iso_pu_bacteria 2643221675 2644414279 299
287 iso_pu_bacteria 2643221680 2644447807 299
288 iso_pu_bacteria 2643221726 2644690280 299
289 iso_pu_bacteria 2876363079 2876369440 299
290 iso_pu_bacteria 2903448605 2903451442 299
291 iso_pu_bacteria 2903521522 2903522953 299
292 iso_pu_bacteria 2903528002 2903534587 299
293 iso_pu_bacteria 2963644680 2963647836 299
294 iso_pu_bacteria 2968083720 2968086009 299
295 iso_pu_bacteria 637000159 637074483 299
296 iso_pu_bacteria 8005658619 8005659095 299
297 iso_pu_bacteria 8018150411 8018153174 299
298 iso_pu_bacteria 8057874678 8057877306 299
299 3300041497 Ga0451840_04660 Ga0451840_04660_1012_1971 300
300 3300046692 Ga0495671_0008553 Ga0495671_0008553_212_1117 300
301 3300047470 Ga0495681_0001510 Ga0495681_0001510_10795_11700 300
302 3300048927 Ga0496124_0010846 Ga0496124_0010846_2858_3808 300
303 3300048929 Ga0496126_0000589 Ga0496126_0000589_47022_47972 300
304 3300049571 Ga0501034_0084248 Ga0501034_0084248_2161_3087 300
305 iso_pu_bacteria 2503198000 2503201650 300
306 iso_pu_bacteria 2510917022 2511135327 300
307 iso_pu_bacteria 2582581307 2585271064 300
308 iso_pu_bacteria 2585427531 2585558788 300
309 iso_pu_bacteria 2585427609 2585904242 300
310 iso_pu_bacteria 2585428125 2587980641 300
311 iso_pu_bacteria 2599185352 2600194325 300
312 iso_pu_bacteria 2643221558 2643811578 300
313 iso_pu_bacteria 2643221618 2644107349 300
314 iso_pu_bacteria 2643221626 2644150916 300
315 iso_pu_bacteria 2643221655 2644308744 300
316 iso_pu_bacteria 2643221659 2644335561 300
317 iso_pu_bacteria 2643221698 2644539967 300
318 iso_pu_bacteria 2643221712 2644614685 300
319 iso_pu_bacteria 2643221723 2644676147 300
320 iso_pu_bacteria 2844163670 2844166628 300
321 iso_pu_bacteria 2869271264 2869274383 300
322 iso_pu_bacteria 2920760137 2920761596 300
323 iso_pu_bacteria 2920822456 2920825150 300
324 iso_pu_bacteria 2941499720 2941502198 300
325 iso_pu_bacteria 2996310559 2996313974 300
326 3300006038 Ga0075365_10017434 Ga0075365_100174342 301
327 3300006948 Ga0099826_10005829 Ga0099826_100058298 301
328 3300048929 Ga0496126_0056442 Ga0496126_0056442_992_1933 301
329 3300050492 nmdc:mga0yw44_9875_c1 nmdc:mga0yw44_9875_c1_566_1558 301
330 iso_pu_bacteria 2509276022 2509396416 301
331 iso_pu_bacteria 2513237144 2513909064 301
332 iso_pu_bacteria 2513237146 2513925441 301
333 iso_pu_bacteria 2513237164 2514033745 301
334 iso_pu_bacteria 2517093000 2517095768 301
335 iso_pu_bacteria 2537561587 2537875613 301
336 iso_pu_bacteria 2554235003 2554248173 301
337 iso_pu_bacteria 2558860242 2559295289 301
338 iso_pu_bacteria 2599185170 2599417358 301
339 iso_pu_bacteria 2599185210 2599601603 301
340 iso_pu_bacteria 2600255279 2601610137 301
341 iso_pu_bacteria 2600255308 2601746911 301
342 iso_pu_bacteria 2643221599 2644003218 301
343 iso_pu_bacteria 2643221693 2644522017 301
344 iso_pu_bacteria 2775507049 2776913867 301
345 iso_pu_bacteria 2808606387 2808987977 301
346 iso_pu_bacteria 2818991439 2819559006 301
347 iso_pu_bacteria 2838035591 2838038442 301
348 iso_pu_bacteria 2838661181 2838661649 301
349 iso_pu_bacteria 2838675328 2838675832 301
350 iso_pu_bacteria 2838714209 2838714714 301
351 iso_pu_bacteria 2838719591 2838721485 301
352 iso_pu_bacteria 2838724970 2838725474 301
353 iso_pu_bacteria 2841846520 2841848437 301
354 iso_pu_bacteria 2841859092 2841862067 301
355 iso_pu_bacteria 2842124991 2842125532 301
356 iso_pu_bacteria 2842130223 2842130727 301
357 iso_pu_bacteria 2842152218 2842154103 301
358 iso_pu_bacteria 2842170452 2842170958 301
359 iso_pu_bacteria 2842175837 2842177723 301
360 iso_pu_bacteria 2842187318 2842187823 301
361 iso_pu_bacteria 2842211629 2842212134 301
362 iso_pu_bacteria 2842224351 2842226247 301
363 iso_pu_bacteria 2842515876 2842518851 301
364 iso_pu_bacteria 2856320880 2856325358 301
365 iso_pu_bacteria 2869278585 2869285041 301
366 iso_pu_bacteria 2874139085 2874145983 301
367 iso_pu_bacteria 2878738818 2878745335 301
368 iso_pu_bacteria 2888337043 2888339536 301
369 iso_pu_bacteria 2891373044 2891373277 301
370 iso_pu_bacteria 2899792073 2899796108 301
371 iso_pu_bacteria 2899845264 2899850693 301
372 iso_pu_bacteria 2906386501 2906393426 301
373 iso_pu_bacteria 2919114240 2919114752 301
374 iso_pu_bacteria 2924718760 2924724740 301
375 iso_pu_bacteria 2924733363 2924733513 301
376 iso_pu_bacteria 2924776078 2924783579 301
377 iso_pu_bacteria 2926754445 2926755768 301
378 iso_pu_bacteria 2926760298 2926762888 301
379 iso_pu_bacteria 2933006813 2933008748 301
380 iso_pu_bacteria 2933011516 2933014975 301
381 iso_pu_bacteria 2933016740 2933021444 301
382 iso_pu_bacteria 2933594066 2933596655 301
383 iso_pu_bacteria 2937848649 2937853070 301
384 iso_pu_bacteria 2937877337 2937882013 301
385 iso_pu_bacteria 2937972304 2937978475 301
386 iso_pu_bacteria 2958034702 2958040743 301
387 iso_pu_bacteria 2958041894 2958056825 301
388 iso_pu_bacteria 2958084443 2958089135 301
389 iso_pu_bacteria 2968016561 2968018331 301
390 iso_pu_bacteria 2970469710 2970471495 301
391 iso_pu_bacteria 2970593180 2970599655 301
392 iso_pu_bacteria 2977922695 2977924339 301
393 iso_pu_bacteria 2977986579 2977991562 301
394 iso_pu_bacteria 2979089926 2979094620 301
395 iso_pu_bacteria 2979095461 2979100815 301
396 iso_pu_bacteria 2979100975 2979103858 301
397 iso_pu_bacteria 2984509177 2984511575 301
398 iso_pu_bacteria 2984518228 2984522064 301
399 iso_pu_bacteria 2984537506 2984541362 301
400 iso_pu_bacteria 2984601300 2984603639 301
401 iso_pu_bacteria 2989349275 2989349577 301
402 iso_pu_bacteria 2996348954 2996350280 301
403 iso_pu_bacteria 3004211236 3004216072 301
404 iso_pu_bacteria 3004218560 3004223822 301
405 iso_pu_bacteria 3004268573 3004273621 301
406 iso_pu_bacteria 3004275668 3004276978 301
407 iso_pu_bacteria 3004289098 3004295795 301
408 iso_pu_bacteria 3004334049 3004334224 301
409 iso_pu_bacteria 3005409236 3005414689 301
410 iso_pu_bacteria 3005452660 3005454571 301
411 iso_pu_bacteria 650716007 650740498 301
412 iso_pu_bacteria 8005542996 8005545556 301
413 iso_pu_bacteria 8054558443 8054561322 301
414 3300028794 Ga0307515_10019424 Ga0307515_1001942411 302
415 3300031548 Ga0307408_100197002 Ga0307408_1001970021 302
416 3300041404 Ga0439436_0002765 Ga0439436_0002765_3468_4385 302
417 3300041413 Ga0439465_0004949 Ga0439465_0004949_1478_2395 302
418 3300042146 Ga0450907_012476 Ga0450907_012476_208_1125 302
419 3300042185 Ga0450909_003704 Ga0450909_003704_780_1697 302
420 3300046674 Ga0495588_0047830 Ga0495588_0047830_975_1892 302
421 3300048913 Ga0496110_0606790 Ga0496110_0606790_25_963 302
422 3300048914 Ga0496111_0000592 Ga0496111_0000592_16948_17886 302
423 3300048925 Ga0496122_0038039 Ga0496122_0038039_1994_2932 302
424 3300048926 Ga0496123_0006907 Ga0496123_0006907_5618_6556 302
425 iso_pu_bacteria 2508501123 2509113242 302
426 iso_pu_bacteria 2509276018 2509367708 302
427 iso_pu_bacteria 2510065059 2510315388 302
428 iso_pu_bacteria 2512875024 2512959210 302
429 iso_pu_bacteria 2513237088 2513596411 302
430 iso_pu_bacteria 2599185156 2599331704 302
431 iso_pu_bacteria 2617270742 2617384780 302
432 iso_pu_bacteria 2643221551 2643776002 302
433 iso_pu_bacteria 2643221555 2643794449 302
434 iso_pu_bacteria 2643221582 2643920401 302
435 iso_pu_bacteria 2643221595 2643984509 302
436 iso_pu_bacteria 2643221627 2644153366 302
437 iso_pu_bacteria 2687453392 2688598562 302
438 iso_pu_bacteria 2718217882 2719181747 302
439 iso_pu_bacteria 2718218009 2719732411 302
440 iso_pu_bacteria 2718218363 2721147838 302
441 iso_pu_bacteria 2718218365 2721159288 302
442 iso_pu_bacteria 2718218366 2721164674 302
443 iso_pu_bacteria 2721755514 2722840844 302
444 iso_pu_bacteria 2721755810 2724045167 302
445 iso_pu_bacteria 2728369365 2730164982 302
446 iso_pu_bacteria 2728369397 2730298920 302
447 iso_pu_bacteria 2756170246 2756675355 302
448 iso_pu_bacteria 2775507266 2778175354 302
449 iso_pu_bacteria 2791355123 2792749353 302
450 iso_pu_bacteria 2791355260 2793320431 302
451 iso_pu_bacteria 2791355264 2793348819 302
452 iso_pu_bacteria 2842922631 2842924109 302
453 iso_pu_bacteria 2844002411 2844007312 302
454 iso_pu_bacteria 2856328259 2856331211 302
455 iso_pu_bacteria 2856334872 2856338295 302
456 iso_pu_bacteria 2869242130 2869245284 302
457 iso_pu_bacteria 2869249662 2869253102 302
458 iso_pu_bacteria 2869256925 2869259770 302
459 iso_pu_bacteria 2869264136 2869267565 302
460 iso_pu_bacteria 2871451962 2871456459 302
461 iso_pu_bacteria 2871459585 2871466310 302
462 iso_pu_bacteria 2871466892 2871471122 302
463 iso_pu_bacteria 2874109183 2874115206 302
464 iso_pu_bacteria 2874116593 2874121190 302
465 iso_pu_bacteria 2874168670 2874174696 302
466 iso_pu_bacteria 2876386047 2876389568 302
467 iso_pu_bacteria 2876399893 2876401479 302
468 iso_pu_bacteria 2876420981 2876427573 302
469 iso_pu_bacteria 2878774303 2878779504 302
470 iso_pu_bacteria 2878781027 2878786158 302
471 iso_pu_bacteria 2903513507 2903515452 302
472 iso_pu_bacteria 2906363423 2906369322 302
473 iso_pu_bacteria 2906370794 2906372368 302
474 iso_pu_bacteria 2906378014 2906378835 302
475 iso_pu_bacteria 2906393657 2906396297 302
476 iso_pu_bacteria 2906401398 2906401523 302
477 iso_pu_bacteria 2906408224 2906413950 302
478 iso_pu_bacteria 2906427513 2906427793 302
479 iso_pu_bacteria 2913295892 2913299375 302
480 iso_pu_bacteria 2922151315 2922154136 302
481 iso_pu_bacteria 2922172374 2922172627 302
482 iso_pu_bacteria 2922178524 2922178912 302
483 iso_pu_bacteria 2924741084 2924744364 302
484 iso_pu_bacteria 2924748358 2924749784 302
485 iso_pu_bacteria 2937861824 2937866478 302
486 iso_pu_bacteria 2937980651 2937980932 302
487 iso_pu_bacteria 2958108152 2958111780 302
488 iso_pu_bacteria 2958122699 2958129790 302
489 iso_pu_bacteria 2965025482 2965031440 302
490 iso_pu_bacteria 2965032056 2965035073 302
491 iso_pu_bacteria 2965040258 2965045852 302
492 iso_pu_bacteria 2965089291 2965093696 302
493 iso_pu_bacteria 2970489779 2970491007 302
494 iso_pu_bacteria 2970510686 2970513702 302
495 iso_pu_bacteria 2970547951 2970552401 302
496 iso_pu_bacteria 2970627176 2970627431 302
497 iso_pu_bacteria 2977851361 2977857942 302
498 iso_pu_bacteria 2977872689 2977876806 302
499 iso_pu_bacteria 2977915119 2977920831 302
500 iso_pu_bacteria 2977935797 2977939612 302
501 iso_pu_bacteria 2977957713 2977964149 302
502 iso_pu_bacteria 2979764755 2979771057 302
503 iso_pu_bacteria 2979772303 2979776920 302
504 iso_pu_bacteria 2987645492 2987647803 302
505 iso_pu_bacteria 2987673487 2987676252 302
506 iso_pu_bacteria 2996386984 2996388139 302
507 iso_pu_bacteria 3004195979 3004203034 302
508 iso_pu_bacteria 3004232784 3004235970 302
509 iso_pu_bacteria 3004239961 3004245630 302
510 iso_pu_bacteria 3004248173 3004249834 302
511 iso_pu_bacteria 649633066 649873081 302
512 iso_pu_bacteria 8003570095 8003571566 302
513 iso_pu_bacteria 8004300914 8004307383 302
514 iso_pu_bacteria 8004312739 8004318974 302
515 iso_pu_bacteria 8004361976 8004364952 302
516 iso_pu_bacteria 8004727605 8004730578 302
517 3300003215 JGI25153J46596_10020054 JGI25153J46596_100200542 303
518 3300003781 Ga0055536_1006964 Ga0055536_10069644 303
519 3300003791 Ga0055530_10012786 Ga0055530_100127863 303
520 3300003792 Ga0055540_1004164 Ga0055540_10041644 303
521 3300003794 Ga0055531_10004968 Ga0055531_100049686 303
522 3300005331 Ga0070670_100002228 Ga0070670_10000222814 303
523 3300025292 Ga0209676_1008369 Ga0209676_10083693 303
524 3300025297 Ga0209758_1000642 Ga0209758_100064222 303
525 3300025298 Ga0209050_1010555 Ga0209050_10105553 303
526 3300025303 Ga0209051_1001154 Ga0209051_10011546 303
527 3300025304 Ga0209257_1005658 Ga0209257_10056583 303
528 3300025925 Ga0207650_10005240 Ga0207650_100052409 303
529 3300049580 Ga0501046_0095057 Ga0501046_0095057_1287_2246 303
530 3300049744 Ga0501083_0029179 Ga0501083_0029179_1339_2298 303
531 3300053111 Ga0500572_013979 Ga0500572_013979_589_1506 303
532 3300053177 Ga0500636_0001765 Ga0500636_0001765_3594_4511 303
533 3300060353 Ga0501082_0099050 Ga0501082_0099050_969_1928 303
534 iso_pu_bacteria 2509276019 2509376411 303
535 iso_pu_bacteria 2510065057 2510304408 303
536 iso_pu_bacteria 2510461069 2510840089 303
537 iso_pu_bacteria 2511231052 2511502182 303
538 iso_pu_bacteria 2512047086 2512533560 303
539 iso_pu_bacteria 2512875026 2512970766 303
540 iso_pu_bacteria 2513237086 2513588090 303
541 iso_pu_bacteria 2513237089 2513604191 303
542 iso_pu_bacteria 2513237091 2513617965 303
543 iso_pu_bacteria 2513237140 2513885523 303
544 iso_pu_bacteria 2513237143 2513903299 303
545 iso_pu_bacteria 2513237156 2513985334 303
546 iso_pu_bacteria 2513237160 2514006460 303
547 iso_pu_bacteria 2515154107 2515608961 303
548 iso_pu_bacteria 2516653046 2516893561 303
549 iso_pu_bacteria 2517487022 2517570263 303
550 iso_pu_bacteria 2524023207 2524448615 303
551 iso_pu_bacteria 2551306084 2551674604 303
552 iso_pu_bacteria 2551306084 2551675814 303
553 iso_pu_bacteria 2551306085 2551684194 303
554 iso_pu_bacteria 2551306086 2551694570 303
555 iso_pu_bacteria 2551306087 2551704959 303
556 iso_pu_bacteria 2551306089 2551708436 303
557 iso_pu_bacteria 2551306090 2551723919 303
558 iso_pu_bacteria 2551306091 2551724818 303
559 iso_pu_bacteria 2551306092 2551735483 303
560 iso_pu_bacteria 2551306093 2551746455 303
561 iso_pu_bacteria 2558860100 2558867763 303
562 iso_pu_bacteria 2585427608 2585898183 303
563 iso_pu_bacteria 2690316117 2692315597 303
564 iso_pu_bacteria 2751185821 2753461972 303
565 iso_pu_bacteria 2791355091 2792620834 303
566 iso_pu_bacteria 2791355092 2792626194 303
567 iso_pu_bacteria 2791355094 2792639131 303
568 iso_pu_bacteria 2802428858 2802719958 303
569 iso_pu_bacteria 2802428859 2802727109 303
570 iso_pu_bacteria 2802428860 2802731888 303
571 iso_pu_bacteria 2802428861 2802739219 303
572 iso_pu_bacteria 2802428862 2802745800 303
573 iso_pu_bacteria 2802428863 2802752402 303
574 iso_pu_bacteria 2838022645 2838028410 303
575 iso_pu_bacteria 2838074704 2838076922 303
576 iso_pu_bacteria 2842198810 2842204459 303
577 iso_pu_bacteria 2847417321 2847419345 303
578 iso_pu_bacteria 2848992105 2848994367 303
579 iso_pu_bacteria 2850079185 2850081382 303
580 iso_pu_bacteria 2855825444 2855826283 303
581 iso_pu_bacteria 2855839649 2855841628 303
582 iso_pu_bacteria 2855872281 2855876118 303
583 iso_pu_bacteria 2858800743 2858801744 303
584 iso_pu_bacteria 2896384573 2896388115 303
585 iso_pu_bacteria 2915980308 2915981370 303
586 iso_pu_bacteria 2915986958 2915989438 303
587 iso_pu_bacteria 2915993759 2915998098 303
588 iso_pu_bacteria 2916000859 2916006873 303
589 iso_pu_bacteria 2916007675 2916013835 303
590 iso_pu_bacteria 2916014648 2916017567 303
591 iso_pu_bacteria 2916021584 2916025062 303
592 iso_pu_bacteria 2916028427 2916029198 303
593 iso_pu_bacteria 2916035215 2916041644 303
594 iso_pu_bacteria 2916041962 2916044030 303
595 iso_pu_bacteria 2916048683 2916054211 303
596 iso_pu_bacteria 2916055098 2916061721 303
597 iso_pu_bacteria 2916061851 2916064236 303
598 iso_pu_bacteria 2916068649 2916070346 303
599 iso_pu_bacteria 2916076590 2916077776 303
600 iso_pu_bacteria 2919171160 2919174763 303
601 iso_pu_bacteria 2921201388 2921208487 303
602 iso_pu_bacteria 2921208531 2921214529 303
603 iso_pu_bacteria 2921237296 2921244105 303
604 iso_pu_bacteria 2921244191 2921248584 303
605 iso_pu_bacteria 2921250672 2921252017 303
606 iso_pu_bacteria 2921257292 2921261240 303
607 iso_pu_bacteria 2921263974 2921264449 303
608 iso_pu_bacteria 2921282425 2921285878 303
609 iso_pu_bacteria 2921289301 2921289435 303
610 iso_pu_bacteria 2921296804 2921302069 303
611 iso_pu_bacteria 2924144063 2924148420 303
612 iso_pu_bacteria 2924150972 2924158048 303
613 iso_pu_bacteria 2924158325 2924159218 303
614 iso_pu_bacteria 2924165586 2924166745 303
615 iso_pu_bacteria 2924172951 2924174327 303
616 iso_pu_bacteria 2924179722 2924183731 303
617 iso_pu_bacteria 2924186466 2924187510 303
618 iso_pu_bacteria 2924193448 2924197973 303
619 iso_pu_bacteria 2924200457 2924204735 303
620 iso_pu_bacteria 2924207177 2924211481 303
621 iso_pu_bacteria 2924214083 2924215740 303
622 iso_pu_bacteria 2924221636 2924225759 303
623 iso_pu_bacteria 2924228884 2924233044 303
624 iso_pu_bacteria 2929138655 2929140809 303
625 iso_pu_bacteria 2936996657 2936999669 303
626 iso_pu_bacteria 2937002841 2937007370 303
627 iso_pu_bacteria 2937009748 2937012900 303
628 iso_pu_bacteria 2937016420 2937022568 303
629 iso_pu_bacteria 2937023124 2937026903 303
630 iso_pu_bacteria 2937029754 2937030216 303
631 iso_pu_bacteria 2937036028 2937042596 303
632 iso_pu_bacteria 2937049772 2937053659 303
633 iso_pu_bacteria 2937056579 2937063382 303
634 iso_pu_bacteria 2937063883 2937070709 303
635 iso_pu_bacteria 2937071275 2937071693 303
636 iso_pu_bacteria 2937078374 2937080346 303
637 iso_pu_bacteria 2937084907 2937086647 303
638 iso_pu_bacteria 2937091812 2937098179 303
639 iso_pu_bacteria 2937098957 2937102544 303
640 iso_pu_bacteria 2937106411 2937111254 303
641 iso_pu_bacteria 2937113482 2937117887 303
642 iso_pu_bacteria 2937119839 2937124062 303
643 iso_pu_bacteria 2937126314 2937130606 303
644 iso_pu_bacteria 2957375807 2957376455 303
645 iso_pu_bacteria 2957382221 2957386589 303
646 iso_pu_bacteria 2957388812 2957392929 303
647 iso_pu_bacteria 2957395598 2957395955 303
648 iso_pu_bacteria 2957402308 2957406688 303
649 iso_pu_bacteria 2957408893 2957410749 303
650 iso_pu_bacteria 2957415311 2957417578 303
651 iso_pu_bacteria 2957422303 2957423698 303
652 iso_pu_bacteria 2957430029 2957434322 303
653 iso_pu_bacteria 2957437181 2957440196 303
654 iso_pu_bacteria 2957443900 2957446321 303
655 iso_pu_bacteria 2957450854 2957454745 303
656 iso_pu_bacteria 2957457609 2957461961 303
657 iso_pu_bacteria 2957464669 2957468663 303
658 iso_pu_bacteria 2957471148 2957476447 303
659 iso_pu_bacteria 2957478035 2957484698 303
660 iso_pu_bacteria 2957484790 2957488681 303
661 iso_pu_bacteria 2957491536 2957496950 303
662 iso_pu_bacteria 2957498199 2957503251 303
663 iso_pu_bacteria 2957505466 2957510556 303
664 iso_pu_bacteria 2960584000 2960584545 303
665 iso_pu_bacteria 2960591022 2960592015 303
666 iso_pu_bacteria 2960597568 2960602473 303
667 iso_pu_bacteria 2960603979 2960606430 303
668 iso_pu_bacteria 2960610863 2960612376 303
669 iso_pu_bacteria 2960617483 2960621467 303
670 iso_pu_bacteria 2960624210 2960630812 303
671 iso_pu_bacteria 2960631154 2960631976 303
672 iso_pu_bacteria 2960637947 2960638621 303
673 iso_pu_bacteria 2960645483 2960649990 303
674 iso_pu_bacteria 2960652885 2960654499 303
675 iso_pu_bacteria 2960660292 2960665266 303
676 iso_pu_bacteria 2960667422 2960671751 303
677 iso_pu_bacteria 2960674078 2960678328 303
678 iso_pu_bacteria 2960680706 2960681551 303
679 iso_pu_bacteria 2960687367 2960692165 303
680 iso_pu_bacteria 2960693952 2960698134 303
681 iso_pu_bacteria 2964607997 2964614485 303
682 iso_pu_bacteria 2964615318 2964621082 303
683 iso_pu_bacteria 2964621998 2964625707 303
684 iso_pu_bacteria 2964628898 2964632968 303
685 iso_pu_bacteria 2964636051 2964640166 303
686 iso_pu_bacteria 2964643177 2964646856 303
687 iso_pu_bacteria 2964649959 2964655360 303
688 iso_pu_bacteria 2964656573 2964663201 303
689 iso_pu_bacteria 2964663802 2964668278 303
690 iso_pu_bacteria 2964670856 2964672367 303
691 iso_pu_bacteria 2964678106 2964681574 303
692 iso_pu_bacteria 2964685014 2964691362 303
693 iso_pu_bacteria 2964691889 2964698296 303
694 iso_pu_bacteria 2964698721 2964705078 303
695 iso_pu_bacteria 2964705432 2964709848 303
696 iso_pu_bacteria 2964712639 2964716506 303
697 iso_pu_bacteria 2964719344 2964723228 303
698 iso_pu_bacteria 2967664464 2967666440 303
699 iso_pu_bacteria 2967671571 2967675890 303
700 iso_pu_bacteria 2967678726 2967684484 303
701 iso_pu_bacteria 2967686174 2967688898 303
702 iso_pu_bacteria 2967693043 2967697336 303
703 iso_pu_bacteria 2967699805 2967706643 303
704 iso_pu_bacteria 2967706974 2967711526 303
705 iso_pu_bacteria 2967714385 2967714815 303
706 iso_pu_bacteria 2967721400 2967725791 303
707 iso_pu_bacteria 2967728569 2967729067 303
708 iso_pu_bacteria 2967735183 2967738839 303
709 iso_pu_bacteria 2967742019 2967745237 303
710 iso_pu_bacteria 2967748971 2967753547 303
711 iso_pu_bacteria 2967755722 2967758975 303
712 iso_pu_bacteria 2967762386 2967768500 303
713 iso_pu_bacteria 2967769361 2967773868 303
714 iso_pu_bacteria 2967775926 2967777944 303
715 iso_pu_bacteria 2970019648 2970023473 303
716 iso_pu_bacteria 2970026789 2970030371 303
717 iso_pu_bacteria 2970033650 2970040231 303
718 iso_pu_bacteria 2970040964 2970042111 303
719 iso_pu_bacteria 2970047711 2970053986 303
720 iso_pu_bacteria 2970054988 2970059305 303
721 iso_pu_bacteria 2970061556 2970065638 303
722 iso_pu_bacteria 2970068827 2970075471 303
723 iso_pu_bacteria 2970076120 2970080213 303
724 iso_pu_bacteria 2970082768 2970087761 303
725 iso_pu_bacteria 2970088815 2970093240 303
726 iso_pu_bacteria 2970095765 2970100091 303
727 iso_pu_bacteria 2970102677 2970108058 303
728 iso_pu_bacteria 2970109326 2970113905 303
729 iso_pu_bacteria 2970116247 2970120471 303
730 iso_pu_bacteria 2970122695 2970127378 303
731 iso_pu_bacteria 2970129317 2970133222 303
732 iso_pu_bacteria 2970136068 2970140479 303
733 iso_pu_bacteria 2970143518 2970146173 303
734 iso_pu_bacteria 2970149975 2970155988 303
735 iso_pu_bacteria 2970156795 2970161072 303
736 iso_pu_bacteria 2970164137 2970168457 303
737 iso_pu_bacteria 2970170962 2970171877 303
738 iso_pu_bacteria 2970177841 2970182875 303
739 iso_pu_bacteria 2970184632 2970188718 303
740 iso_pu_bacteria 2970191845 2970196345 303
741 iso_pu_bacteria 2977516862 2977518450 303
742 iso_pu_bacteria 2977523885 2977526269 303
743 iso_pu_bacteria 2977530762 2977534363 303
744 iso_pu_bacteria 2977537788 2977542000 303
745 iso_pu_bacteria 2977544691 2977547730 303
746 iso_pu_bacteria 2977551784 2977558373 303
747 iso_pu_bacteria 2977558990 2977562700 303
748 iso_pu_bacteria 2977565890 2977570251 303
749 iso_pu_bacteria 2977572785 2977577052 303
750 iso_pu_bacteria 2977579622 2977583597 303
751 iso_pu_bacteria 2989771324 2989774224 303
752 iso_pu_bacteria 648276728 648740512 303
753 iso_pu_bacteria 8003992118 8003994104 303
754 iso_pu_bacteria 8003999396 8004001726 303
755 iso_pu_bacteria 8005301065 8005303057 303
756 iso_pu_bacteria 8005688590 8005692173 303
757 iso_pu_bacteria 8046767195 8046771611 303
758 iso_pu_bacteria 8054460903 8054462926 303
759 iso_pu_bacteria 8055431914 8055432827 303
760 3300002987 JGI25159J45721_1000040 JGI25159J45721_100004067 304
761 3300003187 JGI25151J46595_10005257 JGI25151J46595_100052575 304
762 3300003354 JGI25160J50197_1000128 JGI25160J50197_100012814 304
763 3300003374 JGI25161J50226_1000504 JGI25161J50226_100050411 304
764 3300003771 Ga0055526_1028071 Ga0055526_10280712 304
765 3300003781 Ga0055536_1000853 Ga0055536_100085313 304
766 3300003791 Ga0055530_10009853 Ga0055530_100098533 304
767 3300004625 Ga0055543_1000130 Ga0055543_100013064 304
768 3300005262 Ga0065165_1000013 Ga0065165_1000013232 304
769 3300006178 Ga0075367_10124203 Ga0075367_101242032 304
770 3300013249 Ga0171463_1003 Ga0171463_1003229 304
771 3300015690 Ga0183363_1093 Ga0183363_10937 304
772 3300025208 Ga0209436_100194 Ga0209436_10019415 304
773 3300025284 Ga0209130_1000034 Ga0209130_1000034227 304
774 3300025292 Ga0209676_1001758 Ga0209676_100175813 304
775 3300025294 Ga0209025_1000314 Ga0209025_100031488 304
776 3300025295 Ga0209564_1000013 Ga0209564_1000013225 304
777 3300025298 Ga0209050_1003728 Ga0209050_10037285 304
778 3300025299 Ga0209256_1002653 Ga0209256_10026536 304
779 3300025302 Ga0207426_1000006 Ga0207426_1000006600 304
780 3300025303 Ga0209051_1002141 Ga0209051_100214110 304
781 3300025304 Ga0209257_1003795 Ga0209257_100379513 304
782 3300048925 Ga0496122_0008984 Ga0496122_0008984_6404_7354 304
783 3300049570 Ga0501033_0039180 Ga0501033_0039180_2090_3022 304
784 3300049571 Ga0501034_0109404 Ga0501034_0109404_1783_2715 304
785 3300049573 Ga0501037_0010771 Ga0501037_0010771_4088_5020 304
786 3300049579 Ga0501043_0029830 Ga0501043_0029830_1987_2919 304
787 3300049823 Ga0501044_0018565 Ga0501044_0018565_4300_5232 304
788 3300053107 Ga0500560_001784 Ga0500560_001784_840_1757 304
789 iso_pu_bacteria 2582581299 2585232776 304
790 iso_pu_bacteria 2643221568 2643856826 304
791 iso_pu_bacteria 2643221634 2644193440 304
792 iso_pu_bacteria 2791355082 2792585185 304
793 iso_pu_bacteria 2802429268 2804752697 304
794 iso_pu_bacteria 2818991461 2819684847 304
795 iso_pu_bacteria 2821123053 2821127539 304
796 iso_pu_bacteria 2838736955 2838738063 304
797 iso_pu_bacteria 2841840854 2841841568 304
798 iso_pu_bacteria 2842140634 2842141346 304
799 iso_pu_bacteria 2857531043 2857536448 304
800 iso_pu_bacteria 2978969890 2978974562 304
801 iso_pu_bacteria 3005445848 3005448375 304
802 iso_pu_bacteria 8005289223 8005293574 304
803 iso_pu_bacteria 8005382845 8005385268 304
804 iso_pu_bacteria 8005395548 8005396185 304
805 iso_pu_bacteria 8049293176 8049295263 304
806 3300048928 Ga0496125_0000039 Ga0496125_0000039_103541_104458 305
807 3300048929 Ga0496126_0009857 Ga0496126_0009857_6085_7035 305
808 iso_pu_bacteria 2513237084 2513573636 305
809 iso_pu_bacteria 2515075009 2515112934 305
810 iso_pu_bacteria 2643221643 2644238868 305
811 iso_pu_bacteria 2643221719 2644656838 305
812 iso_pu_bacteria 2724679232 2725952624 305
813 iso_pu_bacteria 2738541317 2738948850 305
814 iso_pu_bacteria 2818991272 2819241465 305
815 iso_pu_bacteria 2854896431 2854899196 305
816 iso_pu_bacteria 2854916844 2854918773 305
817 iso_pu_bacteria 2913308742 2913313738 305
818 iso_pu_bacteria 2917554339 2917557256 305
819 iso_pu_bacteria 2989776772 2989779143 305
820 iso_pu_bacteria 8005460587 8005463612 305
821 3300031824 Ga0307413_10182534 Ga0307413_101825342 306
822 3300046454 Ga0495592_0033798 Ga0495592_0033798_556_1488 306
823 3300046462 Ga0495651_0050724 Ga0495651_0050724_355_1287 306
824 3300046476 Ga0495662_0044495 Ga0495662_0044495_285_1217 306
825 3300046524 Ga0495648_0034731 Ga0495648_0034731_1075_2007 306
826 3300046529 Ga0495652_0203742 Ga0495652_0203742_32_964 306
827 3300046530 Ga0495654_0000254 Ga0495654_0000254_31444_32379 306
828 3300046642 Ga0495634_0142916 Ga0495634_0142916_30_962 306
829 3300046675 Ga0495657_0196402 Ga0495657_0196402_274_1206 306
830 3300046809 Ga0495600_0006237 Ga0495600_0006237_933_1865 306
831 3300047317 Ga0495604_0020449 Ga0495604_0020449_1710_2642 306
832 3300048909 Ga0496106_0000598 Ga0496106_0000598_19787_20752 306
833 3300053139 Ga0500568_0004569 Ga0500568_0004569_1126_2091 306
834 3300053148 Ga0500590_001679 Ga0500590_001679_2748_3680 306
835 3300053151 Ga0500604_0004056 Ga0500604_0004056_760_1725 306
836 iso_pu_bacteria 2509276021 2509392121 306
837 iso_pu_bacteria 2509276033 2509445769 306
838 iso_pu_bacteria 2509276033 2509446929 306
839 iso_pu_bacteria 2510461076 2510895310 306
840 iso_pu_bacteria 2510917026 2511169200 306
841 iso_pu_bacteria 2510917030 2511196090 306
842 iso_pu_bacteria 2513237085 2513576880 306
843 iso_pu_bacteria 2513237093 2513629462 306
844 iso_pu_bacteria 2513237103 2513708112 306
845 iso_pu_bacteria 2513237162 2514020071 306
846 iso_pu_bacteria 2515154113 2515639506 306
847 iso_pu_bacteria 2515154114 2515640897 306
848 iso_pu_bacteria 2515154116 2515655419 306
849 iso_pu_bacteria 2515154134 2515739419 306
850 iso_pu_bacteria 2516653085 2517076999 306
851 iso_pu_bacteria 2517287029 2517407335 306
852 iso_pu_bacteria 2529292951 2530646021 306
853 iso_pu_bacteria 2582581298 2585222759 306
854 iso_pu_bacteria 2585427526 2585527379 306
855 iso_pu_bacteria 2585427528 2585538120 306
856 iso_pu_bacteria 2585427529 2585545342 306
857 iso_pu_bacteria 2585427593 2585836068 306
858 iso_pu_bacteria 2585427633 2585996135 306
859 iso_pu_bacteria 2585427634 2586000751 306
860 iso_pu_bacteria 2599185236 2599721968 306
861 iso_pu_bacteria 2615840624 2616293425 306
862 iso_pu_bacteria 2718217927 2719386271 306
863 iso_pu_bacteria 2718217997 2719666093 306
864 iso_pu_bacteria 2718218199 2720492513 306
865 iso_pu_bacteria 2718218232 2720613948 306
866 iso_pu_bacteria 2718218233 2720620752 306
867 iso_pu_bacteria 2718218235 2720632075 306
868 iso_pu_bacteria 2718218269 2720775803 306
869 iso_pu_bacteria 2718218423 2721400053 306
870 iso_pu_bacteria 2721755556 2723027410 306
871 iso_pu_bacteria 2721755684 2723561029 306
872 iso_pu_bacteria 2721755685 2723567622 306
873 iso_pu_bacteria 2721755809 2724038866 306
874 iso_pu_bacteria 2721755819 2724090410 306
875 iso_pu_bacteria 2721755822 2724104887 306
876 iso_pu_bacteria 2721755823 2724110692 306
877 iso_pu_bacteria 2728369352 2730108346 306
878 iso_pu_bacteria 2738541333 2739032778 306
879 iso_pu_bacteria 2765235942 2766065802 306
880 iso_pu_bacteria 2791355256 2793294501 306
881 iso_pu_bacteria 2791355259 2793314604 306
882 iso_pu_bacteria 2791355262 2793336847 306
883 iso_pu_bacteria 2791355263 2793339141 306
884 iso_pu_bacteria 2791355265 2793351895 306
885 iso_pu_bacteria 2791355266 2793363633 306
886 iso_pu_bacteria 2791355267 2793370241 306
887 iso_pu_bacteria 2802429633 2806043757 306
888 iso_pu_bacteria 2802429634 2806050311 306
889 iso_pu_bacteria 2802429635 2806057128 306
890 iso_pu_bacteria 2802429636 2806064510 306
891 iso_pu_bacteria 2802429637 2806071777 306
892 iso_pu_bacteria 2838016132 2838017718 306
893 iso_pu_bacteria 2838042994 2838043905 306
894 iso_pu_bacteria 2838048938 2838051989 306
895 iso_pu_bacteria 2838061910 2838067393 306
896 iso_pu_bacteria 2838068647 2838070211 306
897 iso_pu_bacteria 2838680041 2838681675 306
898 iso_pu_bacteria 2838686498 2838687118 306
899 iso_pu_bacteria 2838694306 2838696247 306
900 iso_pu_bacteria 2838707686 2838710514 306
901 iso_pu_bacteria 2838729681 2838729909 306
902 iso_pu_bacteria 2838742623 2838743076 306
903 iso_pu_bacteria 2841851746 2841852562 306
904 iso_pu_bacteria 2841864319 2841869862 306
905 iso_pu_bacteria 2842077413 2842078688 306
906 iso_pu_bacteria 2842110456 2842114917 306
907 iso_pu_bacteria 2842118031 2842118803 306
908 iso_pu_bacteria 2842156927 2842157978 306
909 iso_pu_bacteria 2842163707 2842167472 306
910 iso_pu_bacteria 2842180545 2842181597 306
911 iso_pu_bacteria 2842217011 2842217870 306
912 iso_pu_bacteria 2842229732 2842230352 306
913 iso_pu_bacteria 2842237096 2842239926 306
914 iso_pu_bacteria 2842243621 2842244254 306
915 iso_pu_bacteria 2842257432 2842257660 306
916 iso_pu_bacteria 2842264693 2842266199 306
917 iso_pu_bacteria 2842271015 2842271344 306
918 iso_pu_bacteria 2842285085 2842285662 306
919 iso_pu_bacteria 2842291075 2842292350 306
920 iso_pu_bacteria 2842304105 2842304972 306
921 iso_pu_bacteria 2842311132 2842314979 306
922 iso_pu_bacteria 2842341865 2842346392 306
923 iso_pu_bacteria 2842363717 2842369029 306
924 iso_pu_bacteria 2842370503 2842372243 306
925 iso_pu_bacteria 2842377471 2842378747 306
926 iso_pu_bacteria 2842384541 2842385313 306
927 iso_pu_bacteria 2842395702 2842399943 306
928 iso_pu_bacteria 2842402390 2842403022 306
929 iso_pu_bacteria 2842409023 2842409606 306
930 iso_pu_bacteria 2842415677 2842416257 306
931 iso_pu_bacteria 2842422224 2842423825 306
932 iso_pu_bacteria 2842428310 2842430662 306
933 iso_pu_bacteria 2842434925 2842437351 306
934 iso_pu_bacteria 2842441272 2842443721 306
935 iso_pu_bacteria 2842447887 2842453153 306
936 iso_pu_bacteria 2842462802 2842464805 306
937 iso_pu_bacteria 2842469257 2842471969 306
938 iso_pu_bacteria 2844454524 2844458485 306
939 iso_pu_bacteria 2857516855 2857517502 306
940 iso_pu_bacteria 2919100787 2919107731 306
941 iso_pu_bacteria 2933570622 2933570780 306
942 iso_pu_bacteria 2933586486 2933591289 306
943 iso_pu_bacteria 2933599457 2933601017 306
944 iso_pu_bacteria 2935894831 2935900747 306
945 iso_pu_bacteria 2935901341 2935902022 306
946 iso_pu_bacteria 2936367885 2936372108 306
947 iso_pu_bacteria 2936375103 2936381087 306
948 iso_pu_bacteria 2936381700 2936382954 306
949 iso_pu_bacteria 2984587000 2984589883 306
950 iso_pu_bacteria 639633055 639649128 306
951 iso_pu_bacteria 8005275841 8005281063 306
952 iso_pu_bacteria 8005282627 8005283327 306
953 iso_pu_bacteria 8005307578 8005312767 306
954 iso_pu_bacteria 8005376324 8005380861 306
955 iso_pu_bacteria 8005430974 8005435088 306
956 iso_pu_bacteria 8005497431 8005500826 306
957 iso_pu_bacteria 8005556819 8005557081 306
958 iso_pu_bacteria 8005563573 8005567925 306
959 iso_pu_bacteria 8005570704 8005573530 306
960 iso_pu_bacteria 8005619151 8005622203 306
961 iso_pu_bacteria 8005626139 8005632320 306
962 iso_pu_bacteria 8005668836 8005672244 306
963 iso_pu_bacteria 8005695170 8005697337 306
964 iso_pu_bacteria 8018127388 8018134028 306
965 iso_pu_bacteria 8018163183 8018163881 306
966 iso_pu_bacteria 8018176218 8018181389 306
967 iso_pu_bacteria 8023680758 8023683235 306
968 iso_pu_bacteria 8024479707 8024482932 306
969 iso_pu_bacteria 8056375014 8056378462 306
970 iso_pu_bacteria 8056382006 8056386660 306
971 3300048924 Ga0496121_0000003 Ga0496121_0000003_324899_325822 307
972 3300048925 Ga0496122_0083953 Ga0496122_0083953_944_1867 307
973 3300053160 Ga0500633_0017213 Ga0500633_0017213_940_1905 307
974 iso_pu_bacteria 2600254933 2600374409 307
975 iso_pu_bacteria 2802429605 2805928866 307
976 iso_pu_bacteria 2802429606 2805935147 307
977 iso_pu_bacteria 2838668709 2838670297 307
978 iso_pu_bacteria 2838701080 2838702668 307
979 iso_pu_bacteria 2842146304 2842148074 307
980 iso_pu_bacteria 2842192696 2842197292 307
981 iso_pu_bacteria 2842205361 2842205543 307
982 iso_pu_bacteria 2842250916 2842253140 307
983 iso_pu_bacteria 2842278818 2842279000 307
984 iso_pu_bacteria 2842317721 2842320645 307
985 iso_pu_bacteria 2842489311 2842491914 307
986 iso_pu_bacteria 2842495871 2842496891 307
987 iso_pu_bacteria 2842509118 2842511195 307
988 iso_pu_bacteria 8024501048 8024504354 307
989 3300002774 JGI25150J39212_1002037 JGI25150J39212_10020373 308
990 3300005262 Ga0065165_1007280 Ga0065165_10072805 308
991 3300025245 Ga0207425_1004664 Ga0207425_10046644 308
992 3300025297 Ga0209758_1001296 Ga0209758_10012967 308
993 3300025297 Ga0209758_1016110 Ga0209758_10161102 308
994 iso_pu_bacteria 2524023209 2524459528 308
995 iso_pu_bacteria 2582581308 2585277420 308
996 iso_pu_bacteria 2582581315 2585323406 308
997 iso_pu_bacteria 2582581316 2585331540 308
998 iso_pu_bacteria 2585427527 2585535047 308
999 iso_pu_bacteria 2585427530 2585555895 308
1000 iso_pu_bacteria 2615840626 2616308895 308
1001 iso_pu_bacteria 2615840698 2616556896 308
1002 iso_pu_bacteria 2667528174 2671111499 308
1003 iso_pu_bacteria 2818991448 2819609077 308
1004 iso_pu_bacteria 2818991453 2819637689 308
1005 iso_pu_bacteria 2838029111 2838029877 308
1006 iso_pu_bacteria 2842298080 2842301309 308
1007 iso_pu_bacteria 2842357229 2842357846 308
1008 iso_pu_bacteria 2842475841 2842476838 308
1009 iso_pu_bacteria 2842482326 2842484626 308
1010 iso_pu_bacteria 2842502639 2842503405 308
1011 iso_pu_bacteria 2852387548 2852390148 308
1012 iso_pu_bacteria 2919408235 2919409910 308
1013 iso_pu_bacteria 3005416602 3005419543 308
1014 iso_pu_bacteria 8005314921 8005316834 308
1015 iso_pu_bacteria 8005645114 8005649650 308
1016 iso_pu_bacteria 8005682033 8005682962 308
1017 iso_pu_bacteria 8057575449 8057575803 308
1018 3300002773 JGI25152J39213_1004036 JGI25152J39213_10040365 309
1019 3300003215 JGI25153J46596_10003413 JGI25153J46596_100034139 309
1020 3300003354 JGI25160J50197_1001466 JGI25160J50197_10014666 309
1021 3300003374 JGI25161J50226_1000099 JGI25161J50226_100009939 309
1022 3300003771 Ga0055526_1001851 Ga0055526_10018515 309
1023 3300003771 Ga0055526_1003335 Ga0055526_10033359 309
1024 3300003775 Ga0055524_1002049 Ga0055524_10020495 309
1025 3300003790 Ga0055528_1001066 Ga0055528_100106611 309
1026 3300003792 Ga0055540_1002080 Ga0055540_10020804 309
1027 3300004625 Ga0055543_1000128 Ga0055543_10001283 309
1028 3300005262 Ga0065165_1013944 Ga0065165_10139444 309
1029 3300005548 Ga0070665_100034110 Ga0070665_1000341106 309
1030 3300025208 Ga0209436_100328 Ga0209436_10032810 309
1031 3300025258 Ga0209129_1000340 Ga0209129_10003403 309
1032 3300025273 Ga0209673_1002957 Ga0209673_10029573 309
1033 3300025284 Ga0209130_1000020 Ga0209130_1000020324 309
1034 3300025295 Ga0209564_1000512 Ga0209564_100051231 309
1035 3300025297 Ga0209758_1001849 Ga0209758_10018499 309
1036 3300025299 Ga0209256_1003881 Ga0209256_10038815 309
1037 3300025302 Ga0207426_1000008 Ga0207426_1000008391 309
1038 3300025303 Ga0209051_1015007 Ga0209051_10150072 309
1039 3300028379 Ga0268266_10044819 Ga0268266_100448194 309
1040 3300053140 Ga0500573_0000351 Ga0500573_0000351_11889_12818 309
1041 3300053140 Ga0500573_0004201 Ga0500573_0004201_3825_4754 309
1042 iso_pu_bacteria 8005484373 8005485360 309
1043 3300025923 Ga0207681_10037365 Ga0207681_100373652 310
1044 3300046616 Ga0495668_0157065 Ga0495668_0157065_257_1222 310
1045 3300046694 Ga0495649_0004661 Ga0495649_0004661_136_1101 310
1046 3300048920 Ga0496117_0106842 Ga0496117_0106842_533_1498 310
1047 3300048921 Ga0496118_0003434 Ga0496118_0003434_14075_15040 310
1048 3300048925 Ga0496122_0025510 Ga0496122_0025510_1051_2016 310
1049 3300048926 Ga0496123_0027520 Ga0496123_0027520_2963_3928 310
1050 3300053156 Ga0500622_0000825 Ga0500622_0000825_7119_8084 310
1051 3300001979 JGI24740J21852_10001450 JGI24740J21852_100014507 312
1052 3300002704 JGI25155J39150_1000001 JGI25155J39150_1000001227 312
1053 3300002705 JGI25156J39149_1000001 JGI25156J39149_1000001106 312
1054 3300002737 JGI25162J39368_1001394 JGI25162J39368_10013947 312
1055 3300002737 JGI25162J39368_1002031 JGI25162J39368_10020313 312
1056 3300002738 JGI25154J39366_1000011 JGI25154J39366_1000011278 312
1057 3300002741 JGI25157J39369_1000044 JGI25157J39369_1000044108 312
1058 3300003214 JGI25165J46597_1001318 JGI25165J46597_10013188 312
1059 3300003214 JGI25165J46597_1001394 JGI25165J46597_10013948 312
1060 3300003323 rootH1_10025312 rootH1_100253122 312
1061 3300003323 rootH1_10081983 rootH1_100819831 312
1062 3300003354 JGI25160J50197_1000001 JGI25160J50197_1000001715 312
1063 3300003374 JGI25161J50226_1000001 JGI25161J50226_100000135 312
1064 3300004625 Ga0055543_1000003 Ga0055543_100000351 312
1065 3300005262 Ga0065165_1000068 Ga0065165_1000068117 312
1066 3300005614 Ga0068856_100035371 Ga0068856_1000353714 312
1067 3300009093 Ga0105240_10000076 Ga0105240_1000007698 312
1068 3300009545 Ga0105237_10013061 Ga0105237_100130616 312
1069 3300010375 Ga0105239_10023424 Ga0105239_100234243 312
1070 3300010375 Ga0105239_10509241 Ga0105239_105092411 312
1071 3300013104 Ga0157370_10000282 Ga0157370_1000028223 312
1072 3300015262 Ga0182007_10002618 Ga0182007_100026182 312
1073 3300015265 Ga0182005_1003881 Ga0182005_10038815 312
1074 3300025206 Ga0209435_100012 Ga0209435_100012278 312
1075 3300025208 Ga0209436_104199 Ga0209436_1041994 312
1076 3300025233 Ga0209437_100047 Ga0209437_1000477 312
1077 3300025233 Ga0209437_100242 Ga0209437_10024281 312
1078 3300025233 Ga0209437_106591 Ga0209437_1065912 312
1079 3300025246 Ga0209646_1000026 Ga0209646_1000026278 312
1080 3300025246 Ga0209646_1007277 Ga0209646_10072772 312
1081 3300025250 Ga0209026_1000014 Ga0209026_1000014278 312
1082 3300025253 Ga0209677_100268 Ga0209677_10026822 312
1083 3300025256 Ga0209759_1000012 Ga0209759_1000012278 312
1084 3300025261 Ga0209233_1000048 Ga0209233_1000048395 312
1085 3300025261 Ga0209233_1000069 Ga0209233_100006951 312
1086 3300025261 Ga0209233_1000260 Ga0209233_100026043 312
1087 3300025284 Ga0209130_1000003 Ga0209130_100000361 312
1088 3300025302 Ga0207426_1000011 Ga0207426_1000011717 312
1089 3300025913 Ga0207695_10000011 Ga0207695_10000011100 312
1090 3300025914 Ga0207671_10000093 Ga0207671_1000009328 312
1091 3300025981 Ga0207640_10005039 Ga0207640_100050392 312
1092 3300026078 Ga0207702_10024929 Ga0207702_100249294 312
1093 3300026078 Ga0207702_10254780 Ga0207702_102547802 312
1094 3300027312 Ga0209371_1001863 Ga0209371_10018638 312
1095 3300030500 Ga0268256_1002097 Ga0268256_10020978 312
1096 3300048919 Ga0496116_0022069 Ga0496116_0022069_110_1051 312
1097 3300048920 Ga0496117_0001468 Ga0496117_0001468_25502_26443 312
1098 3300048921 Ga0496118_0001567 Ga0496118_0001567_7471_8412 312
1099 3300048922 Ga0496119_0010023 Ga0496119_0010023_4566_5507 312
1100 3300048924 Ga0496121_0001848 Ga0496121_0001848_25958_26899 312
1101 3300048925 Ga0496122_0025449 Ga0496122_0025449_4099_5037 312
1102 3300048926 Ga0496123_0003077 Ga0496123_0003077_12437_13378 312
1103 3300048927 Ga0496124_0032471 Ga0496124_0032471_874_1812 312
1104 3300048928 Ga0496125_0006424 Ga0496125_0006424_6063_7004 312

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01145

Band_7

SPFH domain / Band 7 family

20

201

0.94

Feature Viewer

pLDDT pTM Quality
76.2 0.43 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map