metagRoot

F490144

General Info

Members	Datasets	Scaffolds	Average Seq Length
1105	661	928	124

Family's Representative Sequence

Representative Sequence	3300049568\|Ga0501031_0070029\|Ga0501031_0070029_668_1051
Length	127
Sequence	MRDMRTPLGKVRGLGSAHEGTDHFWRVRLSSIALIPLSLFVIGWIVSLKGAGYAEVRASLSQPWVTLIVALFLVVSLDHMRLGMKEIIEDYVHGEGGKLALFILNTFFTIAIGVVSLFALAKLAFGG

Samples

	Sample ID	Description	Type	Environment
1	2508501122	Ensifer yinggardensis WSM1721	Isolate	Nodule
2	2509276019	Ensifer aridi TW10	Isolate	Nodule
3	2509276021	Rhizobium leguminosarum bv. trifolii WSM597	Isolate	Nodule
4	2509276033	Rhizobium leguminosarum bv. trifolii WSM2012	Isolate	Nodule
5	2510917028	Rhizobium sp. CF122	Isolate	Rhizosphere
6	2510917030	Rhizobium sp. CF142	Isolate	Rhizosphere
7	2513237084	Rhizobium leguminosarum bv. viciae UPM1131	Isolate	Nodule
8	2513237085	Rhizobium leguminosarum bv. viciae UPM1137	Isolate	Nodule
9	2513237088	Rhizobium mesoamericanum STM6155	Isolate	Nodule
10	2513237093	Rhizobium leguminosarum bv. phaseoli FA23	Isolate	Nodule
11	2513237103	Rhizobium leguminosarum bv. viciae VF39	Isolate	Nodule
12	2513237138	Rhizobium favelukesii OR191	Isolate	Nodule
13	2513237144	Rhizobium sullae WSM1592	Isolate	Nodule
14	2513237159	Rhizobium giardinii bv. giardinii H152	Isolate	Nodule
15	2515075009	Rhizobium leguminosarum bv. viciae 248	Isolate	Nodule
16	2515154113	Rhizobium ruizarguesonis Vc2	Isolate	Nodule
17	2515154114	Rhizobium ruizarguesonis Vh3	Isolate	Nodule
18	2515154134	Rhizobium gallicum bv. gallicum R602sp	Isolate	Nodule
19	2516143018	Ensifer sp. BR816	Isolate	Nodule
20	2516653077	Rhizobium acaciae WSM1481	Isolate	Nodule
21	2516653085	Rhizobium leguminosarum bv. phaseoli 4292	Isolate	Nodule
22	2517093000	Rhizobium leguminosarum bv. trifolii SRDI943	Isolate	Nodule
23	2519899620	Rhizobium sp. Pop5	Isolate	Nodule
24	2534681796	Rhizobium grahamii CCGE 502	Isolate	Nodule
25	2554235003	Agrobacterium tumefaciens WRT31	Isolate	Rhizosphere
26	2558860100	Sinorhizobium sp. PC2	Isolate	Nodule
27	2558860242	Agrobacterium fabacearum P4	Isolate	Rhizosphere
28	2582581294	Rhizobium sp. CF394	Isolate	Rhizosphere
29	2582581298	Rhizobium alamii YR540	Isolate	Rhizosphere
30	2582581316	Agrobacterium rhizogenes OK036	Isolate	Rhizosphere
31	2582581866	Rhizobium sp. CF097	Isolate	Rhizosphere
32	2582581867	Rhizobium sp. OV201	Isolate	Rhizosphere
33	2585427526	Rhizobium leguminosarum OV152	Isolate	Rhizosphere
34	2585427528	Rhizobium leguminosarum CF307	Isolate	Rhizosphere
35	2585427529	Rhizobium alamii YR584	Isolate	Rhizosphere
36	2585427590	Rhizobium sp. CF048	Isolate	Rhizosphere
37	2585427593	Rhizobium tropici CF286	Isolate	Rhizosphere
38	2585427608	Agrobacterium rhizogenes OV677	Isolate	Rhizosphere
39	2599185156	Rhizobium sp. NFR03	Isolate	Rhizoplane
40	2599185210	Rhizobium sp. NFACC06-2	Isolate	Rhizoplane
41	2600255279	Rhizobium sp. NFIX01	Isolate	Rhizoplane
42	2600255308	Rhizobium sp. NFIX02	Isolate	Rhizoplane
43	2643221551	Mesorhizobium sp. Root1471	Isolate	Unclassified
44	2643221555	Mesorhizobium sp. Root554	Isolate	Unclassified
45	2643221582	Rhizobium sp. Root651	Isolate	Unclassified
46	2643221599	Rhizobium sp. Root708	Isolate	Unclassified
47	2643221643	Rhizobium sp. Root1220	Isolate	Unclassified
48	2643221693	Rhizobium sp. Root491	Isolate	Unclassified
49	2643221723	Ensifer sp. Root278	Isolate	Unclassified
50	2657244999	Sinorhizobium sojae CCBAU 05684	Isolate	Unclassified
51	2690316117	Sinorhizobium fredii CCBAU 45436	Isolate	Unclassified
52	2718217927	Rhizobium sp. N324	Isolate	Nodule
53	2718218423	Rhizobium sp. N941	Isolate	Nodule
54	2721755809	Rhizobium sp. N541	Isolate	Nodule
55	2724679232	Rhizobium leguminosarum Vaf12	Isolate	Unclassified
56	2738541333	Rhizobium sophoriradicis CCBAU 03470	Isolate	Unclassified
57	2751185821	Ensifer shofinae CCBAU 251167	Isolate	Unclassified
58	2791355082	Ensifer alkalisoli YIC4027	Isolate	Nodule
59	2791355091	Sinorhizobium sp. FG01	Isolate	Nodule
60	2791355092	Sinorhizobium sp. NG07B	Isolate	Nodule
61	2791355094	Sinorhizobium sp. BJ1	Isolate	Nodule
62	2791355259	Rhizobium hidalgonense FH14	Isolate	Nodule
63	2791355263	Rhizobium chutanense C5	Isolate	Nodule
64	2791355266	Rhizobium sp. L43	Isolate	Nodule
65	2791355267	Rhizobium sp. L18	Isolate	Nodule
66	2802429268	Sinorhizobium sojae CCBAU 05684	Isolate	Unclassified
67	2802429633	Rhizobium anhuiense J3	Isolate	Nodule
68	2802429634	Rhizobium anhuiense S10	Isolate	Nodule
69	2802429635	Rhizobium anhuiense Y27	Isolate	Nodule
70	2802429636	Rhizobium anhuiense JX3	Isolate	Nodule
71	2802429637	Rhizobium anhuiense C15	Isolate	Nodule
72	2808606387	Rhizobium sp. SJZ105	Isolate	Rhizosphere
73	2818991439	Agrobacterium tumefaciens 1187	Isolate	Unclassified
74	2838042994	Rhizobium esperanzae SEMIA 4089	Isolate	Nodule
75	2838675328	Agrobacterium radiobacter SEMIA 410	Isolate	Nodule
76	2838680041	Rhizobium leguminosarum SEMIA 415	Isolate	Nodule
77	2838686498	Rhizobium leguminosarum SEMIA 416	Isolate	Nodule
78	2838694306	Rhizobium leguminosarum SEMIA 421	Isolate	Nodule
79	2838707686	Rhizobium leguminosarum SEMIA 430	Isolate	Nodule
80	2838714209	Agrobacterium radiobacter SEMIA 435	Isolate	Nodule
81	2838719591	Agrobacterium radiobacter SEMIA 436	Isolate	Nodule
82	2838724970	Agrobacterium radiobacter SEMIA 437	Isolate	Nodule
83	2838729681	Rhizobium leguminosarum SEMIA 445	Isolate	Nodule
84	2838742623	Rhizobium leguminosarum SEMIA 449	Isolate	Nodule
85	2841846520	Agrobacterium radiobacter SEMIA 440	Isolate	Nodule
86	2841851746	Rhizobium leguminosarum SEMIA 498	Isolate	Nodule
87	2841864319	Rhizobium leguminosarum SEMIA 4052	Isolate	Nodule
88	2842077413	Rhizobium leguminosarum SEMIA 422	Isolate	Nodule
89	2842110456	Rhizobium esperanzae SEMIA 414	Isolate	Nodule
90	2842118031	Rhizobium esperanzae SEMIA 420	Isolate	Nodule
91	2842124991	Agrobacterium radiobacter SEMIA 434	Isolate	Nodule
92	2842130223	Agrobacterium radiobacter SEMIA 441	Isolate	Nodule
93	2842152218	Agrobacterium radiobacter SEMIA 457	Isolate	Nodule
94	2842156927	Rhizobium leguminosarum SEMIA 459	Isolate	Nodule
95	2842163707	Rhizobium leguminosarum SEMIA 460	Isolate	Nodule
96	2842170452	Agrobacterium radiobacter SEMIA 461	Isolate	Nodule
97	2842175837	Agrobacterium radiobacter SEMIA 462	Isolate	Nodule
98	2842180545	Rhizobium leguminosarum SEMIA 463	Isolate	Nodule
99	2842187318	Agrobacterium radiobacter SEMIA 464	Isolate	Nodule
100	2842211629	Agrobacterium radiobacter SEMIA 472	Isolate	Nodule
101	2842217011	Rhizobium leguminosarum SEMIA 475	Isolate	Nodule
102	2842224351	Agrobacterium radiobacter SEMIA 480	Isolate	Nodule
103	2842229732	Rhizobium leguminosarum SEMIA 481	Isolate	Nodule
104	2842237096	Rhizobium leguminosarum SEMIA 482	Isolate	Nodule
105	2842243621	Rhizobium leguminosarum SEMIA 483	Isolate	Nodule
106	2842257432	Rhizobium leguminosarum SEMIA 485	Isolate	Nodule
107	2842271015	Rhizobium leguminosarum SEMIA 488	Isolate	Nodule
108	2842291075	Rhizobium leguminosarum SEMIA 491	Isolate	Nodule
109	2842304105	Rhizobium leguminosarum SEMIA 499	Isolate	Nodule
110	2842341865	Rhizobium leguminosarum SEMIA 4011	Isolate	Nodule
111	2842363717	Rhizobium leguminosarum SEMIA 4016	Isolate	Nodule
112	2842370503	Rhizobium leguminosarum SEMIA 4022	Isolate	Nodule
113	2842377471	Rhizobium leguminosarum SEMIA 4024	Isolate	Nodule
114	2842384541	Rhizobium leguminosarum SEMIA 4025	Isolate	Nodule
115	2842395702	Rhizobium ecuadorense SEMIA 4029	Isolate	Nodule
116	2842482326	Rhizobium lusitanum SEMIA 4060	Isolate	Nodule
117	2842521101	Rhizobium giardinii SEMIA 4084	Isolate	Nodule
118	2842922631	Pararhizobium sp. R-72066	Isolate	Unclassified
119	2844454524	Rhizobium leguminosarum bv. viciae BIHB 1217	Isolate	Nodule
120	2847417321	Sinorhizobium fredii CCBAU 45436	Isolate	Unclassified
121	2848992105	Sinorhizobium fredii CCBAU 25509	Isolate	Unclassified
122	2850079185	Ensifer aridi JNVU TP6	Isolate	Unclassified
123	2855872281	Sinorhizobium fredii PCH1	Isolate	Nodule
124	2857516855	Rhizobium sp. R-72456	Isolate	Unclassified
125	2896384573	Ensifer sp. MPMI2T	Isolate	Unclassified
126	2899803654	Agrobacterium sp. a22-2	Isolate	Unclassified
127	2899845264	Agrobacterium fabacearum CNPSo 675	Isolate	Unclassified
128	2919100787	Rhizobium sp. 1399	Isolate	Rhizosphere
129	2919114240	Agrobacterium tumefaciens 1457	Isolate	Rhizosphere
130	2920760137	Ensifer psoraleae CCBAU 65732	Isolate	Unclassified
131	2920822456	Ensifer sesbaniae CCBAU 65729	Isolate	Unclassified
132	2923556063	Rhizobium tibeticum 3740	Isolate	Unclassified
133	2926754445	Agrobacterium radiobacter SLBN-94	Isolate	Rhizosphere
134	2926760298	Agrobacterium tumefaciens SLBN-170	Isolate	Rhizosphere
135	2933006813	Rhizobium sp. SEMIA 439	Isolate	Unclassified
136	2933570622	Rhizobium leguminosarum SEMIA 409	Isolate	Nodule
137	2933586486	Rhizobium leguminosarum SEMIA 4039	Isolate	Nodule
138	2933594066	Agrobacterium fabrum 35/80	Isolate	Nodule
139	2935894831	Rhizobium leguminosarum SEMIA 419	Isolate	Nodule
140	2935901341	Rhizobium leguminosarum SEMIA 4082	Isolate	Nodule
141	2936367885	Rhizobium changzhiense WYCCWR 11290	Isolate	Nodule
142	2936375103	Rhizobium changzhiense WYCCWR 11317	Isolate	Nodule
143	2936381700	Rhizobium chutanense C16	Isolate	Unclassified
144	2979089926	Agrobacterium sp. SORGH_AS 745	Isolate	Unclassified
145	2979095461	Agrobacterium tumefaciens SORGH_AS 749	Isolate	Unclassified
146	2979100975	Agrobacterium pusense SORGH_AS 755	Isolate	Unclassified
147	2984509177	Agrobacterium pusense SORGH_AS260	Isolate	Aerial Root
148	2984518228	Agrobacterium pusense SORGH_AS285	Isolate	Aerial Root
149	2984537506	Agrobacterium sp. SORGH_AS440	Isolate	Aerial Root
150	2984601300	Rhizobium pusense SORGH_AS1083	Isolate	Aerial Root
151	2996887358	Rhizobium sp. R711	Isolate	Nodule
152	2996893221	Rhizobium sp. R635	Isolate	Nodule
153	3003930520	Sinorhizobium sp. BG8	Isolate	Unclassified
154	3005445848	Rhizobium sp. WYJ-E13	Isolate	Unclassified
155	3005452660	Rhizobium grahamii BG7	Isolate	Unclassified
156	3300001977	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5	Metagenome	Rhizosphere
157	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
158	3300002070	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4	Metagenome	Rhizosphere
159	3300002075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4	Metagenome	Rhizosphere
160	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
161	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
162	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
163	3300002771	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB	Metagenome	Endosphere
164	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
165	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
166	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
167	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
168	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
169	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
170	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
171	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
172	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
173	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
174	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
175	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
176	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
177	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
178	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
179	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
180	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
181	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
182	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
183	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
184	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
185	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
186	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
187	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
188	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
189	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
190	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
191	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
192	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
193	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
194	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
195	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
196	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
197	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
198	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
199	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
200	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
201	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
202	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
203	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
204	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
205	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
206	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
207	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
208	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
209	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
210	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
211	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
212	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
213	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
214	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
215	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
216	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
217	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
218	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
219	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
220	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
221	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
222	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
223	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
224	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
225	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
226	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
227	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
228	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
229	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
230	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
231	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
232	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
233	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
234	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
235	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
236	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
237	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
238	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
239	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
240	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
241	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
242	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
243	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
244	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
245	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
246	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
247	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
248	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
249	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
250	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
251	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
252	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
253	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
254	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
255	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
256	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
257	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
258	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
259	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
260	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
261	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
262	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
263	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
264	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
265	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
266	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
267	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
268	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
269	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
270	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
271	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
272	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
273	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
274	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
275	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
276	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
277	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
278	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
279	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
280	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
281	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
282	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
283	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
284	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
285	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
286	3300009763	Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix	Metagenome	Nodule
287	3300009765	Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule	Metagenome	Nodule
288	3300009766	Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule	Metagenome	Nodule
289	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
290	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
291	3300012497	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510	Metagenome	Rhizosphere
292	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
293	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
294	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
295	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
296	3300013249	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06	Metagenome	Rhizosphere
297	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
298	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
299	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
300	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
301	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
302	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
303	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
304	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
305	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
306	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
307	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
308	3300015690	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05	Metagenome	Rhizosphere
309	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
310	3300021321	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1	Metagenome	Nodule
311	3300021327	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2	Metagenome	Nodule
312	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
313	3300025207	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
314	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
315	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
316	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
317	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
318	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
319	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
320	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
321	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
322	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
323	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
324	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
325	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
326	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
327	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
328	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
329	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
330	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
331	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
332	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
333	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
334	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
335	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
336	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
337	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
338	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
339	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
340	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
341	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
342	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
343	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
344	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
345	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
346	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
347	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
348	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
349	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
350	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
351	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
352	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
353	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
354	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
355	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
356	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
357	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
358	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
359	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
360	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
361	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
362	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
363	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
364	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
365	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
366	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
367	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
368	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
369	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
370	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
371	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
372	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
373	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
374	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
375	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
376	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
377	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
378	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
379	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
380	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
381	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
382	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
383	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
384	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
385	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
386	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
387	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
388	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
389	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
390	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
391	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
392	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
393	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
394	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
395	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
396	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
397	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
398	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
399	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
400	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
401	3300027717	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
402	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
403	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
404	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
405	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
406	3300028558	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG	Metagenome	Rhizosphere
407	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
408	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
409	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
410	3300031665	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3	Metagenome	Rhizosphere
411	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
412	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
413	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
414	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
415	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
416	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
417	3300032137	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC	Metagenome	Rhizosphere
418	3300032139	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB	Metagenome	Rhizosphere
419	3300032168	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
420	3300033528	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
421	3300033541	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
422	3300034816	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3	Metagenome	Rhizosphere
423	3300034818	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3	Metagenome	Rhizosphere
424	3300034957	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2	Metagenome	Rhizosphere
425	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
426	3300035084	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1	Metagenome	Rhizosphere
427	3300035085	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2	Metagenome	Rhizosphere
428	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
429	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
430	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
431	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
432	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
433	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
434	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
435	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
436	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
437	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
438	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
439	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
440	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
441	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
442	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
443	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
444	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
445	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
446	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
447	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
448	3300037588	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA	Metagenome	Rhizosphere
449	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
450	3300038996	Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19	Metagenome	Rhizosphere
451	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
452	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
453	3300041443	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG	Metagenome	Rhizoplane
454	3300041494	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG	Metagenome	Unclassified
455	3300041497	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT	Metatranscriptome	Unclassified
456	3300041501	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG	Metagenome	Unclassified
457	3300041502	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT	Metatranscriptome	Unclassified
458	3300041506	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT	Metatranscriptome	Unclassified
459	3300041507	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG	Metagenome	Unclassified
460	3300041509	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG	Metagenome	Unclassified
461	3300041511	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG	Metagenome	Unclassified
462	3300041907	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run	Metatranscriptome	Unclassified
463	3300041916	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run	Metatranscriptome	Unclassified
464	3300042002	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616	Metagenome	Rhizosphere
465	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
466	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
467	3300042145	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581	Metagenome	Rhizosphere
468	3300042146	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979	Metagenome	Rhizosphere
469	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
470	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
471	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
472	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
473	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
474	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
475	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
476	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
477	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
478	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
479	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
480	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
481	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
482	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
483	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
484	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
485	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
486	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
487	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
488	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
489	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
490	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
491	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
492	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
493	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
494	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
495	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
496	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
497	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
498	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
499	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
500	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
501	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
502	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
503	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
504	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
505	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
506	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
507	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
508	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
509	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
510	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
511	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
512	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
513	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
514	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
515	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
516	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
517	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
518	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
519	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
520	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
521	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
522	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
523	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
524	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
525	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
526	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
527	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
528	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
529	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
530	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
531	3300048090	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere	Metagenome	Rhizosphere
532	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
533	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
534	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
535	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
536	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
537	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
538	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
539	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
540	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
541	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
542	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
543	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
544	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
545	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
546	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
547	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
548	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
549	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
550	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
551	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
552	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
553	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
554	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
555	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
556	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
557	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
558	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
559	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
560	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
561	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
562	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
563	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
564	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
565	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
566	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
567	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
568	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
569	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
570	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
571	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
572	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
573	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
574	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
575	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
576	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
577	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
578	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
579	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
580	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
581	3300049664	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought	Metagenome	Rhizosphere
582	3300049705	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought	Metagenome	Rhizosphere
583	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
584	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
585	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
586	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
587	3300049776	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought	Metagenome	Rhizosphere
588	3300049778	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control	Metagenome	Rhizosphere
589	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
590	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
591	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
592	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
593	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
594	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
595	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
596	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
597	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
598	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
599	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
600	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
601	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
602	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
603	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
604	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
605	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
606	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
607	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
608	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
609	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
610	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
611	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
612	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
613	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
614	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
615	3300053107	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere	Metagenome	Endosphere
616	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
617	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
618	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
619	3300053152	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 endosphere	Metagenome	Endosphere
620	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
621	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
622	3300053157	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere	Metagenome	Endosphere
623	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
624	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
625	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
626	3300059491	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
627	3300059503	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
628	3300059504	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
629	3300059505	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
630	3300059604	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
631	3300059605	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
632	3300059641	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
633	3300059643	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
634	3300059649	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
635	3300060344	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
636	3300060346	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
637	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
638	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
639	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
640	639633055	Rhizobium leguminosarum bv. viciae 3841	Isolate	Unclassified
641	643692032	Sinorhizobium fredii NGR234	Isolate	Nodule
642	650716007	Agrobacterium fabacearum H13-3	Isolate	Rhizosphere
643	8003570095	Agrobacterium rhizogenes GBBC3284	Isolate	Unclassified
644	8005258706	Rhizobium sp. R693	Isolate	Nodule
645	8005275841	Rhizobium sp. N4311	Isolate	Nodule
646	8005307578	Rhizobium leguminosarum bv. phaseoli LCS0306	Isolate	Unclassified
647	8005321885	Rhizobium sp. R72	Isolate	Nodule
648	8005376324	Rhizobium changzhiense WYCCWR 11279	Isolate	Nodule
649	8005460587	Rhizobium leguminosarum bv. viciae 248	Isolate	Nodule
650	8005542996	Rhizobium grahamii CCGM3	Isolate	Unclassified
651	8005556819	Rhizobium sp. WYCCWR 11128	Isolate	Nodule
652	8005563573	Rhizobium sp. WYCCWR 11152	Isolate	Nodule
653	8005570704	Rhizobium anhuiense bv. trifolii WYCCWR10015	Isolate	Nodule
654	8005695170	Rhizobium sp. RMa-01	Isolate	Unclassified
655	8018127388	Rhizobium aegyptiacum 950	Isolate	Nodule
656	8018163183	Rhizobium sp. WYCCWR 11146	Isolate	Nodule
657	8018176218	Rhizobium sp. N122	Isolate	Nodule
658	8023680758	Rhizobium leguminosarum SARCC-132	Isolate	Nodule
659	8049293176	Ensifer alkalisoli YIC4027	Isolate	Nodule
660	8056375014	Rhizobium redzepovicii 18T	Isolate	Nodule
661	8057874678	Rhizobium acaciae 1AS12	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	82.08
Metatranscriptomes	1.9
Isolates	16.02

Biome Distribution

Category	Percentage (%)
Aerial Root	0.36
Bulb	0
Endosphere	11.13
Nodule	10.68
Rhizoplane	6.43
Rhizosphere	65.43
Stem	0
Stem Tuber	0
Unclassified	5.97

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24746J21847_1017923	3300001977	Unclassified	1004
2	JGI24735J21928_10061026	3300002067	Unclassified	1083
3	JGI24750J21931_1006143	3300002070	Unclassified	1490
4	JGI24738J21930_10002453	3300002075	Unclassified	4848
5	JGI25156J39149_1000102	3300002705	Bacteria	62463
6	JGI25154J39366_1000184	3300002738	Bacteria	48243
7	JGI25157J39369_1000009	3300002741	Bacteria	207868
8	JGI25163J39215_1004657	3300002771	Bacteria	940
9	JGI25152J39213_1009567	3300002773	Bacteria	2293
10	JGI25152J39213_1055319	3300002773	Bacteria	503
11	JGI25150J39212_1008276	3300002774	Bacteria	2045
12	JGI25150J39212_1014880	3300002774	Bacteria	1309
13	JGI25151J46595_10001921	3300003187	Bacteria	13177
14	JGI25151J46595_10110296	3300003187	Bacteria	721
15	JGI25165J46597_1001832	3300003214	Bacteria	8867
16	JGI25153J46596_10051319	3300003215	Bacteria	1182
17	JGI25153J46596_10078744	3300003215	Bacteria	828
18	JGI25153J46596_10080008	3300003215	Bacteria	818
19	JGI25153J46596_10149312	3300003215	Bacteria	503
20	JGI25160J50197_1000401	3300003354	Bacteria	27912
21	JGI25160J50197_1023007	3300003354	Bacteria	1812
22	JGI25161J50226_1000137	3300003374	Bacteria	50627
23	JGI25161J50226_1006204	3300003374	Bacteria	2200
24	Ga0055526_1002794	3300003771	Bacteria	11559
25	Ga0055526_1002810	3300003771	Bacteria	11530
26	Ga0055526_1020533	3300003771	Bacteria	2344
27	Ga0055524_1005991	3300003775	Bacteria	5341
28	Ga0055524_1011602	3300003775	Bacteria	3435
29	Ga0055528_1027613	3300003790	Bacteria	1591
30	Ga0055528_1032661	3300003790	Bacteria	1322
31	Ga0055528_1045430	3300003790	Bacteria	936
32	Ga0055528_1051977	3300003790	Bacteria	822
33	Ga0055530_10067243	3300003791	Bacteria	782
34	Ga0055540_1002204	3300003792	Bacteria	10584
35	Ga0055540_1015240	3300003792	Bacteria	2249
36	Ga0055531_10052461	3300003794	Bacteria	1062
37	Ga0055543_1000321	3300004625	Bacteria	33172
38	Ga0055543_1000609	3300004625	Bacteria	19299
39	Ga0065165_1004116	3300005262	Bacteria	9358
40	Ga0065165_1028090	3300005262	Bacteria	1822
41	Ga0070676_10005852	3300005328	Bacteria	6562
42	Ga0070683_100066464	3300005329	Bacteria	3359
43	Ga0070690_100001183	3300005330	Bacteria	13435
44	Ga0070690_100432947	3300005330	Bacteria	972
45	Ga0070670_100004193	3300005331	Bacteria	12065
46	Ga0070677_10112150	3300005333	Bacteria	1219
47	Ga0068869_100227382	3300005334	Bacteria	1481
48	Ga0070666_10009770	3300005335	Bacteria	5996
49	Ga0070680_100249096	3300005336	Bacteria	1502
50	Ga0070680_101050848	3300005336	Bacteria	704
51	Ga0070682_100012032	3300005337	Bacteria	4951
52	Ga0070682_100211738	3300005337	Bacteria	1374
53	Ga0068868_100012990	3300005338	Bacteria	6094
54	Ga0068868_100413612	3300005338	Bacteria	1166
55	Ga0070660_100001653	3300005339	Bacteria	15315
56	Ga0070689_100005243	3300005340	Bacteria	8832
57	Ga0070691_10000575	3300005341	Bacteria	14031
58	Ga0070687_100005939	3300005343	Bacteria	4968
59	Ga0070661_100006402	3300005344	Bacteria	8119
60	Ga0070692_10052185	3300005345	Bacteria	2129
61	Ga0070668_100006301	3300005347	Bacteria	8786
62	Ga0070668_100011925	3300005347	Bacteria	6471
63	Ga0070668_100301192	3300005347	Bacteria	1344
64	Ga0070669_100018232	3300005353	Bacteria	5014
65	Ga0070675_100030980	3300005354	Bacteria	4320
66	Ga0070671_100002577	3300005355	Bacteria	14056
67	Ga0070674_100001585	3300005356	Bacteria	12179
68	Ga0070674_100907956	3300005356	Bacteria	768
69	Ga0070673_100793331	3300005364	Bacteria	874
70	Ga0070688_100404485	3300005365	Bacteria	1011
71	Ga0070688_100927204	3300005365	Unclassified	688
72	Ga0070659_100090849	3300005366	Bacteria	2447
73	Ga0070659_101031674	3300005366	Bacteria	723
74	Ga0070667_100006721	3300005367	Bacteria	9558
75	Ga0070667_100271069	3300005367	Bacteria	1522
76	Ga0070703_10028059	3300005406	Bacteria	1681
77	Ga0070709_10006649	3300005434	Bacteria	6310
78	Ga0070714_100006975	3300005435	Bacteria	8759
79	Ga0070714_102008847	3300005435	Bacteria	564
80	Ga0070713_100043144	3300005436	Bacteria	3686
81	Ga0070710_10006661	3300005437	Bacteria	5559
82	Ga0070701_10182397	3300005438	Bacteria	1230
83	Ga0070701_10606035	3300005438	Bacteria	726
84	Ga0070711_100169110	3300005439	Bacteria	1664
85	Ga0070705_100001205	3300005440	Bacteria	14054
86	Ga0070705_100824902	3300005440	Bacteria	740
87	Ga0070705_101262470	3300005440	Bacteria	611
88	Ga0070700_100046200	3300005441	Bacteria	2690
89	Ga0070700_100180221	3300005441	Bacteria	1470
90	Ga0070700_101425788	3300005441	Bacteria	586
91	Ga0070700_101664134	3300005441	Bacteria	547
92	Ga0070694_100001865	3300005444	Bacteria	12483
93	Ga0070694_100129373	3300005444	Bacteria	1822
94	Ga0070694_100963675	3300005444	Bacteria	707
95	Ga0070663_100001588	3300005455	Bacteria	12518
96	Ga0070663_100849317	3300005455	Bacteria	786
97	Ga0070663_101134167	3300005455	Bacteria	685
98	Ga0070678_100033727	3300005456	Bacteria	3557
99	Ga0070662_100002202	3300005457	Bacteria	11960
100	Ga0070662_100517336	3300005457	Bacteria	997
101	Ga0070662_100807267	3300005457	Bacteria	798
102	Ga0070681_10115781	3300005458	Bacteria	2618
103	Ga0068867_100059754	3300005459	Bacteria	2826
104	Ga0068867_100079768	3300005459	Bacteria	2464
105	Ga0068867_100485808	3300005459	Bacteria	1059
106	Ga0068867_101360610	3300005459	Bacteria	657
107	Ga0070685_10225859	3300005466	Bacteria	1229
108	Ga0070685_10429265	3300005466	Bacteria	921
109	Ga0070679_100865744	3300005530	Bacteria	847
110	Ga0070679_102095316	3300005530	Bacteria	515
111	Ga0070684_100009018	3300005535	Bacteria	7836
112	Ga0070697_100047621	3300005536	Bacteria	3476
113	Ga0068853_100003000	3300005539	Bacteria	12879
114	Ga0068853_100709273	3300005539	Bacteria	960
115	Ga0068853_101015796	3300005539	Bacteria	799
116	Ga0068853_101596505	3300005539	Bacteria	632
117	Ga0070672_100004861	3300005543	Bacteria	8834
118	Ga0070686_100003237	3300005544	Bacteria	8910
119	Ga0070686_100344333	3300005544	Bacteria	1118
120	Ga0070686_101722743	3300005544	Bacteria	532
121	Ga0070695_100021775	3300005545	Bacteria	3927
122	Ga0070695_100729749	3300005545	Bacteria	788
123	Ga0070696_100003761	3300005546	Bacteria	10134
124	Ga0070696_100284864	3300005546	Bacteria	1261
125	Ga0070696_100978288	3300005546	Bacteria	706
126	Ga0070693_100000393	3300005547	Bacteria	19877
127	Ga0070693_101383024	3300005547	Bacteria	547
128	Ga0070665_100298730	3300005548	Bacteria	1613
129	Ga0070665_100409283	3300005548	Bacteria	1364
130	Ga0070665_100616059	3300005548	Bacteria	1098
131	Ga0070704_100011772	3300005549	Bacteria	5378
132	Ga0068855_100009780	3300005563	Bacteria	11569
133	Ga0068855_101170376	3300005563	Bacteria	801
134	Ga0070664_100013997	3300005564	Bacteria	6542
135	Ga0068857_100018626	3300005577	Bacteria	6092
136	Ga0068854_100001016	3300005578	Bacteria	16856
137	Ga0068856_100004785	3300005614	Bacteria	13418
138	Ga0068856_101987749	3300005614	Bacteria	592
139	Ga0070702_100000623	3300005615	Bacteria	13052
140	Ga0070702_100162171	3300005615	Bacteria	1446
141	Ga0070702_100747513	3300005615	Bacteria	751
142	Ga0070702_101095150	3300005615	Bacteria	636
143	Ga0068852_101066360	3300005616	Bacteria	828
144	Ga0068852_101447828	3300005616	Unclassified	709
145	Ga0068859_100029959	3300005617	Bacteria	5459
146	Ga0068859_100327537	3300005617	Bacteria	1626
147	Ga0068859_100706443	3300005617	Bacteria	1099
148	Ga0068864_100004464	3300005618	Bacteria	11500
149	Ga0068866_10006282	3300005718	Bacteria	4946
150	Ga0068866_10041793	3300005718	Bacteria	2277
151	Ga0068861_100008474	3300005719	Bacteria	7078
152	Ga0068861_100025133	3300005719	Bacteria	4316
153	Ga0068851_10027056	3300005834	Bacteria	2824
154	Ga0068870_10442635	3300005840	Bacteria	855
155	Ga0068863_100013678	3300005841	Bacteria	7824
156	Ga0068858_100010770	3300005842	Bacteria	8646
157	Ga0068858_100303741	3300005842	Bacteria	1523
158	Ga0068858_100944221	3300005842	Bacteria	844
159	Ga0068858_101151754	3300005842	Bacteria	762
160	Ga0068860_100006715	3300005843	Bacteria	11548
161	Ga0068860_100503130	3300005843	Bacteria	1210
162	Ga0068862_100382161	3300005844	Bacteria	1314
163	Ga0068862_101764921	3300005844	Unclassified	628
164	Ga0081455_10108988	3300005937	Bacteria	2204
165	Ga0081455_10145509	3300005937	Bacteria	1834
166	Ga0081540_1000034	3300005983	Bacteria	142197
167	Ga0075365_10036684	3300006038	Bacteria	3177
168	Ga0075365_10108551	3300006038	Bacteria	1906
169	Ga0075365_10451524	3300006038	Bacteria	908
170	Ga0075368_10294718	3300006042	Bacteria	699
171	Ga0075363_100192490	3300006048	Bacteria	1163
172	Ga0075364_10128678	3300006051	Bacteria	1699
173	Ga0075364_10148567	3300006051	Bacteria	1579
174	Ga0070715_10000579	3300006163	Bacteria	9656
175	Ga0070716_100002213	3300006173	Bacteria	8959
176	Ga0070716_100290828	3300006173	Bacteria	1132
177	Ga0070712_100001945	3300006175	Bacteria	12657
178	Ga0070712_100079616	3300006175	Bacteria	2368
179	Ga0070712_101115186	3300006175	Bacteria	685
180	Ga0075362_10191263	3300006177	Bacteria	994
181	Ga0075367_10010829	3300006178	Bacteria	4805
182	Ga0075369_10026434	3300006186	Bacteria	2419
183	Ga0075369_10027517	3300006186	Bacteria	2377
184	Ga0075369_10213477	3300006186	Bacteria	892
185	Ga0075369_10253479	3300006186	Bacteria	817
186	Ga0075366_10223458	3300006195	Bacteria	1147
187	Ga0097621_100029648	3300006237	Bacteria	4324
188	Ga0097621_100921360	3300006237	Bacteria	815
189	Ga0075370_10030765	3300006353	Bacteria	2996
190	Ga0075370_10370834	3300006353	Bacteria	857
191	Ga0075370_10405159	3300006353	Bacteria	818
192	Ga0068871_100054247	3300006358	Bacteria	3251
193	Ga0068871_100099281	3300006358	Bacteria	2437
194	Ga0075430_100619687	3300006846	Bacteria	893
195	Ga0075430_100654682	3300006846	Bacteria	866
196	Ga0075431_100038429	3300006847	Bacteria	4928
197	Ga0075434_100070297	3300006871	Bacteria	3491
198	Ga0075434_100681458	3300006871	Bacteria	1046
199	Ga0075429_100024906	3300006880	Bacteria	5194
200	Ga0075429_100720081	3300006880	Bacteria	874
201	Ga0068865_100000600	3300006881	Bacteria	20229
202	Ga0068865_101017601	3300006881	Bacteria	726
203	Ga0068865_101408674	3300006881	Bacteria	622
204	Ga0075436_100016305	3300006914	Bacteria	5086
205	Ga0097620_100029959	3300006931	Bacteria	5459
206	Ga0097620_100327564	3300006931	Bacteria	1626
207	Ga0097620_100706467	3300006931	Bacteria	1099
208	Ga0099826_10002340	3300006948	Bacteria	12184
209	Ga0105251_10073604	3300009011	Bacteria	1587
210	Ga0105244_10128666	3300009036	Bacteria	1223
211	Ga0105250_10032241	3300009092	Bacteria	2104
212	Ga0105250_10456806	3300009092	Bacteria	574
213	Ga0105240_10066878	3300009093	Bacteria	4457
214	Ga0111539_10477106	3300009094	Bacteria	1452
215	Ga0111539_12281461	3300009094	Bacteria	628
216	Ga0105245_10006645	3300009098	Bacteria	10155
217	Ga0105245_10568784	3300009098	Bacteria	1157
218	Ga0105247_10007053	3300009101	Bacteria	6910
219	Ga0105247_10026666	3300009101	Bacteria	3491
220	Ga0105247_10095351	3300009101	Bacteria	1894
221	Ga0114129_10095313	3300009147	Bacteria	4122
222	Ga0114129_10170704	3300009147	Bacteria	2965
223	Ga0105243_10005106	3300009148	Bacteria	10304
224	Ga0105243_10229124	3300009148	Bacteria	1647
225	Ga0105243_10268943	3300009148	Bacteria	1529
226	Ga0105241_10001163	3300009174	Bacteria	20014
227	Ga0105242_10002287	3300009176	Bacteria	15132
228	Ga0105242_11372436	3300009176	Bacteria	733
229	Ga0105248_10229441	3300009177	Bacteria	2090
230	Ga0105248_10871148	3300009177	Bacteria	1017
231	Ga0105248_11379300	3300009177	Bacteria	797
232	Ga0105237_10052300	3300009545	Bacteria	4100
233	Ga0105237_10269730	3300009545	Bacteria	1705
234	Ga0105249_10003419	3300009553	Bacteria	13740
235	Ga0105249_10089040	3300009553	Bacteria	2884
236	Ga0105249_10674729	3300009553	Bacteria	1092
237	Ga0105249_11061002	3300009553	Bacteria	880
238	Ga0123340_1063014	3300009763	Bacteria	1023
239	Ga0123341_1000009	3300009765	Bacteria	122597
240	Ga0123341_1073508	3300009765	Bacteria	1444
241	Ga0123342_1037816	3300009766	Bacteria	1914
242	Ga0105239_10206821	3300010375	Bacteria	2199
243	Ga0105239_10786969	3300010375	Bacteria	1089
244	Ga0105239_10926238	3300010375	Bacteria	1000
245	Ga0105239_11243057	3300010375	Bacteria	859
246	Ga0105239_11392289	3300010375	Bacteria	810
247	Ga0105246_10000990	3300011119	Bacteria	16316
248	Ga0157319_1003163	3300012497	Bacteria	1000
249	Ga0157373_10192941	3300013100	Bacteria	1435
250	Ga0157371_10204821	3300013102	Bacteria	1415
251	Ga0157370_10114211	3300013104	Bacteria	2523
252	Ga0157369_10001931	3300013105	Bacteria	24983
253	Ga0171463_1004	3300013249	Bacteria	437207
254	Ga0157374_10613236	3300013296	Bacteria	1099
255	Ga0157374_11447556	3300013296	Bacteria	710
256	Ga0157378_10003666	3300013297	Bacteria	13613
257	Ga0157378_10052061	3300013297	Bacteria	3642
258	Ga0157378_10326852	3300013297	Bacteria	1491
259	Ga0163162_10007123	3300013306	Bacteria	10851
260	Ga0163162_10133511	3300013306	Bacteria	2592
261	Ga0163162_10194453	3300013306	Bacteria	2157
262	Ga0163162_12114179	3300013306	Bacteria	646
263	Ga0157372_10012262	3300013307	Bacteria	9128
264	Ga0157375_10006707	3300013308	Bacteria	10029
265	Ga0157375_10020038	3300013308	Bacteria	6101
266	Ga0157375_10151826	3300013308	Bacteria	2452
267	Ga0157375_10475460	3300013308	Bacteria	1415
268	Ga0163163_10028147	3300014325	Bacteria	5392
269	Ga0157380_10006092	3300014326	Bacteria	8453
270	Ga0157380_11212745	3300014326	Bacteria	798
271	Ga0157377_10005777	3300014745	Bacteria	5841
272	Ga0157379_10005438	3300014968	Bacteria	10942
273	Ga0157379_10131266	3300014968	Bacteria	2255
274	Ga0157379_10135704	3300014968	Bacteria	2217
275	Ga0157379_10143598	3300014968	Bacteria	2152
276	Ga0157379_11565407	3300014968	Bacteria	643
277	Ga0157376_10010202	3300014969	Bacteria	6859
278	Ga0182006_1115383	3300015261	Bacteria	938
279	Ga0183363_1208	3300015690	Bacteria	11915
280	Ga0163161_10005735	3300017792	Bacteria	8603
281	Ga0163161_10013491	3300017792	Bacteria	5689
282	Ga0163161_10546541	3300017792	Bacteria	949
283	Ga0163161_10681292	3300017792	Bacteria	854
284	Ga0214542_1039603	3300021321	Bacteria	1244
285	Ga0214543_1000053	3300021327	Bacteria	141797
286	Ga0209435_100009	3300025206	Bacteria	476614
287	Ga0209760_104952	3300025207	Bacteria	1119
288	Ga0209436_100299	3300025208	Bacteria	22971
289	Ga0209672_122692	3300025228	Bacteria	586
290	Ga0209437_100107	3300025233	Bacteria	218656
291	Ga0207425_1001864	3300025245	Bacteria	8100
292	Ga0207425_1005340	3300025245	Bacteria	3678
293	Ga0207425_1013468	3300025245	Bacteria	1889
294	Ga0209646_1000018	3300025246	Bacteria	476716
295	Ga0209026_1000068	3300025250	Bacteria	207601
296	Ga0209759_1000007	3300025256	Bacteria	476614
297	Ga0209129_1001625	3300025258	Bacteria	12189
298	Ga0209129_1002128	3300025258	Bacteria	10070
299	Ga0209129_1002500	3300025258	Bacteria	8964
300	Ga0209129_1034437	3300025258	Bacteria	829
301	Ga0209233_1000072	3300025261	Bacteria	363074
302	Ga0209565_1029005	3300025263	Bacteria	1089
303	Ga0209673_1000052	3300025273	Bacteria	279795
304	Ga0209673_1000459	3300025273	Bacteria	68727
305	Ga0209673_1002376	3300025273	Bacteria	13220
306	Ga0209673_1016194	3300025273	Bacteria	2799
307	Ga0209673_1039469	3300025273	Bacteria	1362
308	Ga0209130_1000009	3300025284	Bacteria	498952
309	Ga0209675_1035903	3300025291	Bacteria	1126
310	Ga0209676_1024551	3300025292	Bacteria	1950
311	Ga0209025_1000765	3300025294	Bacteria	53466
312	Ga0209025_1001035	3300025294	Bacteria	40774
313	Ga0209025_1017322	3300025294	Bacteria	4169
314	Ga0209025_1032055	3300025294	Bacteria	2468
315	Ga0209025_1141499	3300025294	Bacteria	680
316	Ga0209564_1000569	3300025295	Bacteria	58592
317	Ga0209564_1006046	3300025295	Bacteria	6668
318	Ga0209564_1011522	3300025295	Bacteria	3953
319	Ga0209758_1002002	3300025297	Bacteria	21937
320	Ga0209758_1005244	3300025297	Bacteria	10149
321	Ga0209758_1006541	3300025297	Bacteria	8305
322	Ga0209758_1012770	3300025297	Bacteria	4655
323	Ga0209758_1056284	3300025297	Bacteria	1329
324	Ga0209758_1127188	3300025297	Bacteria	679
325	Ga0209050_1019253	3300025298	Bacteria	2603
326	Ga0209256_1002153	3300025299	Bacteria	16996
327	Ga0209256_1003192	3300025299	Bacteria	11860
328	Ga0209256_1013250	3300025299	Bacteria	3072
329	Ga0209256_1035927	3300025299	Bacteria	1304
330	Ga0207426_1000041	3300025302	Bacteria	433536
331	Ga0207426_1000723	3300025302	Bacteria	38116
332	Ga0209051_1000561	3300025303	Bacteria	45148
333	Ga0209051_1013102	3300025303	Bacteria	3965
334	Ga0209051_1013239	3300025303	Bacteria	3937
335	Ga0209051_1014030	3300025303	Bacteria	3766
336	Ga0209051_1115038	3300025303	Bacteria	693
337	Ga0209257_1003339	3300025304	Bacteria	13886
338	Ga0209257_1082273	3300025304	Bacteria	823
339	Ga0209257_1151158	3300025304	Bacteria	511
340	Ga0207656_10047332	3300025321	Bacteria	1848
341	Ga0207653_10066898	3300025885	Bacteria	1222
342	Ga0207682_10304003	3300025893	Bacteria	748
343	Ga0207692_10050912	3300025898	Bacteria	2097
344	Ga0207642_10007409	3300025899	Bacteria	3707
345	Ga0207710_10001879	3300025900	Bacteria	10086
346	Ga0207710_10009612	3300025900	Bacteria	4062
347	Ga0207710_10208660	3300025900	Bacteria	967
348	Ga0207688_10000781	3300025901	Bacteria	15856
349	Ga0207680_10123650	3300025903	Bacteria	1695
350	Ga0207680_10475353	3300025903	Bacteria	888
351	Ga0207647_10002004	3300025904	Bacteria	15585
352	Ga0207685_10000430	3300025905	Bacteria	6967
353	Ga0207699_10045417	3300025906	Bacteria	2564
354	Ga0207645_10003961	3300025907	Bacteria	11055
355	Ga0207654_10026356	3300025911	Bacteria	3147
356	Ga0207707_10284519	3300025912	Bacteria	1431
357	Ga0207695_11233763	3300025913	Bacteria	628
358	Ga0207671_10035049	3300025914	Bacteria	3727
359	Ga0207671_10649682	3300025914	Bacteria	840
360	Ga0207693_10003215	3300025915	Bacteria	14019
361	Ga0207693_10040693	3300025915	Bacteria	3660
362	Ga0207663_10001183	3300025916	Bacteria	12040
363	Ga0207660_10014769	3300025917	Bacteria	5146
364	Ga0207660_10071857	3300025917	Bacteria	2519
365	Ga0207660_10653482	3300025917	Bacteria	857
366	Ga0207662_10003968	3300025918	Bacteria	7709
367	Ga0207657_10005198	3300025919	Bacteria	13646
368	Ga0207649_10007541	3300025920	Bacteria	5914
369	Ga0207652_10222628	3300025921	Bacteria	1700
370	Ga0207652_10409825	3300025921	Bacteria	1223
371	Ga0207652_11451594	3300025921	Bacteria	590
372	Ga0207681_10022013	3300025923	Bacteria	4060
373	Ga0207694_10705441	3300025924	Bacteria	851
374	Ga0207650_10036970	3300025925	Bacteria	3555
375	Ga0207659_10047610	3300025926	Bacteria	3033
376	Ga0207687_10466654	3300025927	Bacteria	1049
377	Ga0207700_10197747	3300025928	Bacteria	1693
378	Ga0207664_10318878	3300025929	Bacteria	1371
379	Ga0207644_10026611	3300025931	Bacteria	3987
380	Ga0207644_10091207	3300025931	Bacteria	2272
381	Ga0207690_10001664	3300025932	Bacteria	13738
382	Ga0207690_10912910	3300025932	Bacteria	729
383	Ga0207706_10001697	3300025933	Bacteria	21712
384	Ga0207706_11171206	3300025933	Bacteria	640
385	Ga0207706_11245822	3300025933	Bacteria	616
386	Ga0207706_11550520	3300025933	Bacteria	538
387	Ga0207686_10048940	3300025934	Bacteria	2621
388	Ga0207686_10693344	3300025934	Bacteria	809
389	Ga0207709_10008122	3300025935	Bacteria	5815
390	Ga0207670_10011889	3300025936	Bacteria	5070
391	Ga0207670_10114514	3300025936	Bacteria	1949
392	Ga0207669_10015329	3300025937	Bacteria	3863
393	Ga0207704_10004556	3300025938	Bacteria	6341
394	Ga0207704_11047966	3300025938	Bacteria	691
395	Ga0207704_11870339	3300025938	Unclassified	516
396	Ga0207665_10001914	3300025939	Bacteria	14041
397	Ga0207665_10139399	3300025939	Bacteria	1728
398	Ga0207691_10003057	3300025940	Bacteria	16320
399	Ga0207711_10129591	3300025941	Bacteria	2260
400	Ga0207711_11979475	3300025941	Bacteria	525
401	Ga0207689_10030514	3300025942	Bacteria	4492
402	Ga0207661_10038903	3300025944	Bacteria	3731
403	Ga0207679_10112200	3300025945	Bacteria	2154
404	Ga0207667_10330185	3300025949	Bacteria	1557
405	Ga0207651_10003634	3300025960	Bacteria	7604
406	Ga0207651_11745695	3300025960	Bacteria	560
407	Ga0207712_10409358	3300025961	Bacteria	1142
408	Ga0207712_10471801	3300025961	Bacteria	1068
409	Ga0207668_10002585	3300025972	Bacteria	10584
410	Ga0207668_10038031	3300025972	Bacteria	3226
411	Ga0207668_10227946	3300025972	Bacteria	1500
412	Ga0207668_10318406	3300025972	Bacteria	1290
413	Ga0207668_10435224	3300025972	Bacteria	1116
414	Ga0207668_10699971	3300025972	Bacteria	890
415	Ga0207640_10099381	3300025981	Bacteria	2036
416	Ga0207658_10036173	3300025986	Bacteria	3539
417	Ga0207658_10180187	3300025986	Bacteria	1748
418	Ga0207658_10283153	3300025986	Bacteria	1422
419	Ga0207677_10453621	3300026023	Bacteria	1099
420	Ga0207703_10032220	3300026035	Bacteria	4148
421	Ga0207703_10074968	3300026035	Bacteria	2802
422	Ga0207703_10926455	3300026035	Bacteria	835
423	Ga0207639_10006015	3300026041	Bacteria	8230
424	Ga0207639_10762957	3300026041	Bacteria	900
425	Ga0207678_10000713	3300026067	Bacteria	30377
426	Ga0207678_10650294	3300026067	Bacteria	926
427	Ga0207678_10728556	3300026067	Bacteria	874
428	Ga0207708_10013357	3300026075	Bacteria	6135
429	Ga0207708_10031718	3300026075	Bacteria	4012
430	Ga0207702_10337829	3300026078	Bacteria	1438
431	Ga0207702_11382333	3300026078	Unclassified	698
432	Ga0207641_10021793	3300026088	Bacteria	5267
433	Ga0207641_10498914	3300026088	Bacteria	1182
434	Ga0207648_10016114	3300026089	Bacteria	6846
435	Ga0207648_10027714	3300026089	Bacteria	5027
436	Ga0207648_10713445	3300026089	Bacteria	930
437	Ga0207676_10009201	3300026095	Bacteria	7031
438	Ga0207676_10313736	3300026095	Bacteria	1437
439	Ga0207676_10340417	3300026095	Bacteria	1384
440	Ga0207674_10003356	3300026116	Bacteria	19646
441	Ga0207675_100000737	3300026118	Bacteria	32454
442	Ga0207675_100038774	3300026118	Bacteria	4446
443	Ga0207675_100310822	3300026118	Bacteria	1537
444	Ga0207675_101346729	3300026118	Bacteria	734
445	Ga0207683_10001157	3300026121	Bacteria	23993
446	Ga0207683_10695299	3300026121	Bacteria	943
447	Ga0207698_11419942	3300026142	Unclassified	709
448	Ga0209371_1000037	3300027312	Bacteria	367074
449	Ga0209282_1000283	3300027666	Bacteria	25146
450	Ga0209998_10046994	3300027717	Bacteria	992
451	Ga0207428_10092439	3300027907	Bacteria	2348
452	Ga0207428_10939355	3300027907	Bacteria	610
453	Ga0268266_10015655	3300028379	Bacteria	6499
454	Ga0268266_10148689	3300028379	Bacteria	2109
455	Ga0268266_10206261	3300028379	Bacteria	1801
456	Ga0268265_10013228	3300028380	Bacteria	5607
457	Ga0268265_10861047	3300028380	Bacteria	887
458	Ga0268265_11585848	3300028380	Bacteria	659
459	Ga0268265_11591079	3300028380	Bacteria	658
460	Ga0268264_10016088	3300028381	Bacteria	6129
461	Ga0268264_10561948	3300028381	Bacteria	1120
462	Ga0265326_10191054	3300028558	Bacteria	587
463	Ga0268256_1000039	3300030500	Bacteria	354969
464	Ga0307408_100088678	3300031548	Bacteria	2330
465	Ga0307408_101614047	3300031548	Bacteria	616
466	Ga0265313_10087883	3300031595	Bacteria	1400
467	Ga0316575_10067100	3300031665	Bacteria	1437
468	Ga0316579_10015964	3300031691	Bacteria	3270
469	Ga0307405_11181405	3300031731	Bacteria	661
470	Ga0307410_11467391	3300031852	Bacteria	600
471	Ga0307412_11046151	3300031911	Bacteria	724
472	Ga0307409_100180120	3300031995	Bacteria	1870
473	Ga0307416_102436601	3300032002	Bacteria	622
474	Ga0316585_10011147	3300032137	Bacteria	2646
475	Ga0316580_10039032	3300032139	Bacteria	1467
476	Ga0316593_10047381	3300032168	Bacteria	1445
477	Ga0316588_1010782	3300033528	Bacteria	1936
478	Ga0316596_1054526	3300033541	Bacteria	1061
479	Ga0373930_0200497	3300034816	Bacteria	519
480	Ga0373950_0007884	3300034818	Bacteria	1664
481	Ga0373938_0105499	3300034957	Bacteria	712
482	Ga0373926_0072495	3300035083	Bacteria	1267
483	Ga0373928_0025767	3300035084	Bacteria	1270
484	Ga0373928_0133326	3300035084	Bacteria	675
485	Ga0373929_0026560	3300035085	Bacteria	1210
486	Ga0373944_0086211	3300035089	Bacteria	1044
487	Ga0373951_0021909	3300035091	Bacteria	1469
488	Ga0373939_0007709	3300035114	Bacteria	2620
489	Ga0373939_0218120	3300035114	Bacteria	729
490	Ga0373941_0032062	3300035115	Bacteria	1570
491	Ga0373960_0008203	3300035121	Bacteria	2497
492	Ga0373943_0035525	3300035170	Bacteria	2382
493	Ga0373955_0680572	3300035172	Bacteria	631
494	Ga0373942_0215990	3300035207	Bacteria	641
495	Ga0373961_0007966	3300035241	Bacteria	2573
496	Ga0373962_0021864	3300035242	Bacteria	1691
497	Ga0373962_0054070	3300035242	Bacteria	1163
498	Ga0316574_0134243	3300035398	Bacteria	1593
499	Ga0316574_0296234	3300035398	Bacteria	1029
500	Ga0373931_0005310	3300035691	Bacteria	5944
501	Ga0373931_0134333	3300035691	Bacteria	1427
502	Ga0373927_0007119	3300035695	Bacteria	7590
503	Ga0373933_0539438	3300035724	Bacteria	765
504	Ga0373937_0060093	3300036401	Bacteria	3493
505	Ga0373937_0100519	3300036401	Bacteria	2684
506	Ga0316584_0010954	3300036712	Bacteria	6352
507	Ga0373925_0015254	3300037068	Bacteria	5555
508	Ga0373925_0445652	3300037068	Bacteria	1060
509	Ga0395900_0126709	3300037418	Bacteria	2619
510	Ga0395900_1530040	3300037418	Bacteria	579
511	Ga0395898_0070119	3300037466	Bacteria	3390
512	Ga0395905_0002416	3300037471	Bacteria	20729
513	Ga0395905_0004800	3300037471	Bacteria	13959
514	Ga0316581_0013248	3300037588	Bacteria	2335
515	Ga0395901_0009382	3300038443	Bacteria	9927
516	Ga0242420_076400	3300038996	Bacteria	687
517	Ga0439436_0014089	3300041404	Bacteria	2417
518	Ga0439436_0033077	3300041404	Bacteria	1498
519	Ga0439465_0008566	3300041413	Bacteria	3227
520	Ga0451789_0752798	3300041443	Bacteria	659
521	Ga0451837_1751948	3300041494	Bacteria	734
522	Ga0451840_04176	3300041497	Bacteria	2034
523	Ga0451845_0007443	3300041501	Bacteria	824
524	Ga0451846_27217	3300041502	Bacteria	1742
525	Ga0451850_30014	3300041506	Bacteria	1069
526	Ga0451851_0866658	3300041507	Bacteria	1100
527	Ga0451843_0436542	3300041509	Bacteria	1249
528	Ga0451855_0167070	3300041511	Bacteria	745
529	Ga0451855_1087730	3300041511	Bacteria	780
530	Ga0452268_52640	3300041907	Bacteria	601
531	Ga0452271_63270	3300041916	Bacteria	964
532	Ga0439442_020778	3300042002	Bacteria	1361
533	Ga0439432_094439	3300042006	Bacteria	898
534	Ga0439462_0019330	3300042015	Bacteria	1773
535	Ga0450906_038550	3300042145	Bacteria	843
536	Ga0450907_019460	3300042146	Bacteria	1138
537	Ga0439446_0280508	3300042156	Bacteria	581
538	Ga0439434_0043630	3300042435	Bacteria	1380
539	Ga0439435_0136590	3300042436	Bacteria	778
540	Ga0439460_0034822	3300042461	Bacteria	1454
541	Ga0466963_0057534	3300044694	Bacteria	2589
542	Ga0466964_0061044	3300044706	Bacteria	1569
543	Ga0466970_0023346	3300044765	Bacteria	3229
544	Ga0466957_0252756	3300044842	Bacteria	1172
545	Ga0466959_0276600	3300045049	Bacteria	1153
546	Ga0466958_0031431	3300045836	Bacteria	3155
547	Ga0495603_0001772	3300046455	Bacteria	12725
548	Ga0495629_0068282	3300046459	Bacteria	2480
549	Ga0495638_0051177	3300046460	Bacteria	2577
550	Ga0495638_0069013	3300046460	Bacteria	2166
551	Ga0495641_0021588	3300046461	Bacteria	3237
552	Ga0495651_0392239	3300046462	Bacteria	908
553	Ga0495651_0782726	3300046462	Bacteria	590
554	Ga0495650_0041533	3300046471	Bacteria	1966
555	Ga0495580_0003171	3300046472	Bacteria	14098
556	Ga0495582_0042654	3300046473	Bacteria	2498
557	Ga0495605_0037125	3300046474	Bacteria	2453
558	Ga0495639_0012412	3300046475	Bacteria	3674
559	Ga0495584_0036460	3300046491	Bacteria	2485
560	Ga0495585_0185418	3300046492	Bacteria	1067
561	Ga0495594_0001783	3300046499	Bacteria	11185
562	Ga0495607_0131841	3300046501	Bacteria	1299
563	Ga0495583_0054461	3300046506	Bacteria	1811
564	Ga0495583_0158492	3300046506	Bacteria	935
565	Ga0495606_0062227	3300046507	Bacteria	2383
566	Ga0495610_0038438	3300046512	Bacteria	2429
567	Ga0495610_0124037	3300046512	Bacteria	1128
568	Ga0495616_0172887	3300046513	Bacteria	965
569	Ga0495618_0433076	3300046514	Bacteria	800
570	Ga0495620_0019875	3300046515	Bacteria	3290
571	Ga0495630_0334524	3300046517	Bacteria	1158
572	Ga0495643_0069570	3300046522	Bacteria	1849
573	Ga0495643_0083782	3300046522	Bacteria	1655
574	Ga0495663_0062945	3300046525	Bacteria	1169
575	Ga0495663_0084430	3300046525	Bacteria	1027
576	Ga0495666_0065052	3300046526	Bacteria	1740
577	Ga0495640_0380312	3300046533	Bacteria	869
578	Ga0495587_0179364	3300046536	Bacteria	1201
579	Ga0495597_0062015	3300046542	Bacteria	1627
580	Ga0495622_0010178	3300046557	Bacteria	4347
581	Ga0495633_0075615	3300046558	Bacteria	1568
582	Ga0495667_0119527	3300046559	Bacteria	1702
583	Ga0495667_0172307	3300046559	Bacteria	1390
584	Ga0495656_0151638	3300046615	Bacteria	1120
585	Ga0495668_0145854	3300046616	Bacteria	1296
586	Ga0495668_0428521	3300046616	Bacteria	727
587	Ga0495634_0021144	3300046642	Bacteria	4604
588	Ga0495634_0334891	3300046642	Bacteria	909
589	Ga0495625_0182287	3300046660	Bacteria	1395
590	Ga0495635_0163203	3300046663	Bacteria	1516
591	Ga0495588_0000643	3300046674	Bacteria	16231
592	Ga0495588_0021234	3300046674	Bacteria	3197
593	Ga0495658_0002983	3300046683	Bacteria	8469
594	Ga0495669_0323774	3300046684	Bacteria	744
595	Ga0495613_0001403	3300046689	Bacteria	18361
596	Ga0495670_0028226	3300046691	Bacteria	2782
597	Ga0495671_0130316	3300046692	Bacteria	1226
598	Ga0495671_0195091	3300046692	Bacteria	983
599	Ga0495649_0152342	3300046694	Bacteria	1214
600	Ga0495649_0458290	3300046694	Bacteria	636
601	Ga0495660_0100952	3300046810	Bacteria	1485
602	Ga0495581_0009747	3300047315	Bacteria	5558
603	Ga0495636_0083962	3300047318	Bacteria	1375
604	Ga0495676_0049130	3300047321	Bacteria	3395
605	Ga0495680_0042838	3300047322	Bacteria	3588
606	Ga0495680_0155173	3300047322	Bacteria	1666
607	Ga0495687_024792	3300047443	Bacteria	2845
608	Ga0495681_0013196	3300047470	Bacteria	4808
609	Ga0495681_0088867	3300047470	Bacteria	1367
610	Ga0495681_0178441	3300047470	Bacteria	874
611	Ga0495686_0039215	3300047472	Bacteria	3026
612	Ga0495593_0000485	3300047673	Bacteria	22382
613	Ga0495614_0013112	3300048089	Bacteria	3636
614	Ga0495615_0032759	3300048090	Bacteria	1255
615	Ga0496100_0039596	3300048903	Bacteria	2993
616	Ga0496100_0519826	3300048903	Bacteria	919
617	Ga0496101_0002407	3300048904	Bacteria	11481
618	Ga0496101_0047111	3300048904	Bacteria	3094
619	Ga0496101_0103744	3300048904	Bacteria	2131
620	Ga0496101_0501418	3300048904	Bacteria	959
621	Ga0496101_0687171	3300048904	Bacteria	808
622	Ga0496102_0056670	3300048905	Bacteria	3575
623	Ga0496102_0166532	3300048905	Bacteria	2074
624	Ga0496102_0278015	3300048905	Bacteria	1578
625	Ga0496102_0712722	3300048905	Bacteria	926
626	Ga0496103_0080051	3300048906	Bacteria	2054
627	Ga0496103_0272638	3300048906	Bacteria	1088
628	Ga0496103_0281195	3300048906	Bacteria	1070
629	Ga0496104_0029777	3300048907	Bacteria	5066
630	Ga0496104_0049983	3300048907	Bacteria	3944
631	Ga0496104_0057801	3300048907	Bacteria	3671
632	Ga0496104_0070681	3300048907	Bacteria	3319
633	Ga0496104_0262609	3300048907	Bacteria	1639
634	Ga0496104_0623124	3300048907	Bacteria	988
635	Ga0496105_0011421	3300048908	Bacteria	7016
636	Ga0496105_0026949	3300048908	Bacteria	4690
637	Ga0496105_0100918	3300048908	Bacteria	2383
638	Ga0496105_0346220	3300048908	Bacteria	1188
639	Ga0496105_0920161	3300048908	Bacteria	658
640	Ga0496106_0017822	3300048909	Bacteria	5251
641	Ga0496106_0159652	3300048909	Bacteria	1782
642	Ga0496106_0370738	3300048909	Bacteria	1150
643	Ga0496106_0470871	3300048909	Bacteria	1009
644	Ga0496107_0001358	3300048910	Bacteria	15054
645	Ga0496107_0083569	3300048910	Bacteria	2328
646	Ga0496107_0101018	3300048910	Bacteria	2115
647	Ga0496107_0119095	3300048910	Bacteria	1944
648	Ga0496107_0187464	3300048910	Bacteria	1536
649	Ga0496107_0339655	3300048910	Bacteria	1117
650	Ga0496108_0024853	3300048911	Bacteria	4932
651	Ga0496108_0562218	3300048911	Bacteria	995
652	Ga0496108_0706282	3300048911	Bacteria	874
653	Ga0496108_0784273	3300048911	Bacteria	823
654	Ga0496109_0135009	3300048912	Bacteria	2305
655	Ga0496109_0183260	3300048912	Bacteria	1967
656	Ga0496109_0220706	3300048912	Bacteria	1782
657	Ga0496109_0232801	3300048912	Bacteria	1733
658	Ga0496109_0789677	3300048912	Bacteria	887
659	Ga0496109_1281753	3300048912	Bacteria	669
660	Ga0496110_0045215	3300048913	Bacteria	3847
661	Ga0496110_0990220	3300048913	Bacteria	748
662	Ga0496111_0058009	3300048914	Bacteria	2803
663	Ga0496111_0211468	3300048914	Bacteria	1440
664	Ga0496111_0680613	3300048914	Bacteria	749
665	Ga0496112_0044007	3300048915	Bacteria	4372
666	Ga0496112_0342140	3300048915	Bacteria	1439
667	Ga0496113_0078149	3300048916	Bacteria	2531
668	Ga0496113_0273158	3300048916	Bacteria	1351
669	Ga0496113_0329173	3300048916	Bacteria	1225
670	Ga0496113_0582740	3300048916	Bacteria	896
671	Ga0496114_0022516	3300048917	Bacteria	5135
672	Ga0496114_0056058	3300048917	Bacteria	3287
673	Ga0496114_0237826	3300048917	Bacteria	1601
674	Ga0496114_0257287	3300048917	Bacteria	1536
675	Ga0496115_0048102	3300048918	Bacteria	3411
676	Ga0496115_0196313	3300048918	Bacteria	1668
677	Ga0496115_0228021	3300048918	Bacteria	1536
678	Ga0496115_0246995	3300048918	Bacteria	1470
679	Ga0496115_0629598	3300048918	Bacteria	850
680	Ga0496115_0736178	3300048918	Bacteria	772
681	Ga0496116_0046812	3300048919	Bacteria	2916
682	Ga0496116_0114632	3300048919	Bacteria	1574
683	Ga0496117_0017870	3300048920	Bacteria	5908
684	Ga0496118_0097827	3300048921	Bacteria	1995
685	Ga0496119_0010694	3300048922	Bacteria	7691
686	Ga0496119_0148172	3300048922	Bacteria	1260
687	Ga0496121_0145426	3300048924	Bacteria	1752
688	Ga0496124_0059610	3300048927	Bacteria	3205
689	Ga0496125_0014218	3300048928	Bacteria	7760
690	Ga0496125_0108719	3300048928	Bacteria	2016
691	Ga0501031_0024005	3300049568	Bacteria	3976
692	Ga0501031_0027698	3300049568	Bacteria	3694
693	Ga0501031_0069791	3300049568	Bacteria	2289
694	Ga0501031_0070029	3300049568	Bacteria	2284
695	Ga0501032_0027773	3300049569	Bacteria	3888
696	Ga0501032_0148822	3300049569	Bacteria	1540
697	Ga0501032_0312312	3300049569	Bacteria	1015
698	Ga0501032_0350931	3300049569	Bacteria	950
699	Ga0501033_0013646	3300049570	Bacteria	6183
700	Ga0501033_0179009	3300049570	Bacteria	1520
701	Ga0501033_0207317	3300049570	Bacteria	1399
702	Ga0501033_0474085	3300049570	Bacteria	868
703	Ga0501034_0052171	3300049571	Bacteria	4121
704	Ga0501034_0144297	3300049571	Bacteria	2358
705	Ga0501036_0057353	3300049572	Bacteria	3299
706	Ga0501036_0171057	3300049572	Bacteria	1830
707	Ga0501036_1386693	3300049572	Unclassified	570
708	Ga0501037_0021088	3300049573	Bacteria	4813
709	Ga0501037_0056639	3300049573	Bacteria	2862
710	Ga0501037_0223778	3300049573	Bacteria	1323
711	Ga0501037_0371693	3300049573	Bacteria	984
712	Ga0501037_0559338	3300049573	Bacteria	771
713	Ga0501038_0118169	3300049574	Bacteria	2189
714	Ga0501038_0172037	3300049574	Bacteria	1752
715	Ga0501038_0219776	3300049574	Bacteria	1516
716	Ga0501038_0326874	3300049574	Bacteria	1198
717	Ga0501038_0364532	3300049574	Bacteria	1123
718	Ga0501038_0533711	3300049574	Bacteria	894
719	Ga0501039_0043064	3300049575	Bacteria	3488
720	Ga0501039_0087768	3300049575	Bacteria	2423
721	Ga0501039_0107925	3300049575	Bacteria	2175
722	Ga0501039_0144550	3300049575	Bacteria	1869
723	Ga0501039_0196150	3300049575	Bacteria	1587
724	Ga0501039_1170823	3300049575	Bacteria	595
725	Ga0501040_0004960	3300049576	Bacteria	8614
726	Ga0501040_0087631	3300049576	Bacteria	2161
727	Ga0501040_0155820	3300049576	Bacteria	1613
728	Ga0501040_0173783	3300049576	Bacteria	1526
729	Ga0501040_0275546	3300049576	Bacteria	1201
730	Ga0501040_0782894	3300049576	Bacteria	690
731	Ga0501040_0980410	3300049576	Bacteria	613
732	Ga0501041_0010987	3300049577	Bacteria	5346
733	Ga0501041_0107518	3300049577	Bacteria	1729
734	Ga0501041_0223159	3300049577	Bacteria	1182
735	Ga0501041_0628695	3300049577	Bacteria	686
736	Ga0501042_0027801	3300049578	Bacteria	3979
737	Ga0501042_0035803	3300049578	Bacteria	3522
738	Ga0501042_0043419	3300049578	Bacteria	3201
739	Ga0501042_0061145	3300049578	Bacteria	2691
740	Ga0501042_0369653	3300049578	Bacteria	1038
741	Ga0501042_0996738	3300049578	Bacteria	610
742	Ga0501043_0127756	3300049579	Bacteria	1993
743	Ga0501043_0161009	3300049579	Bacteria	1753
744	Ga0501043_0334818	3300049579	Bacteria	1152
745	Ga0501046_0000033	3300049580	Bacteria	174675
746	Ga0501046_0015269	3300049580	Bacteria	6458
747	Ga0501046_0019945	3300049580	Bacteria	5551
748	Ga0501046_0031563	3300049580	Bacteria	4293
749	Ga0501046_0238214	3300049580	Bacteria	1343
750	Ga0501046_0293165	3300049580	Bacteria	1189
751	Ga0501046_1040117	3300049580	Bacteria	567
752	Ga0501047_0035547	3300049581	Bacteria	4813
753	Ga0501047_0078900	3300049581	Bacteria	3166
754	Ga0501048_0012783	3300049582	Bacteria	6241
755	Ga0501048_0030744	3300049582	Bacteria	3886
756	Ga0501048_0098012	3300049582	Bacteria	2068
757	Ga0501048_0118261	3300049582	Bacteria	1872
758	Ga0501048_0213222	3300049582	Bacteria	1369
759	Ga0501067_0098466	3300049583	Bacteria	1624
760	Ga0501067_0169244	3300049583	Bacteria	1217
761	Ga0501068_0027086	3300049584	Bacteria	3382
762	Ga0501068_0200028	3300049584	Bacteria	1267
763	Ga0501068_0283349	3300049584	Bacteria	1059
764	Ga0501068_0490917	3300049584	Bacteria	796
765	Ga0501068_0807258	3300049584	Bacteria	615
766	Ga0501069_0228398	3300049585	Bacteria	1083
767	Ga0501069_0406921	3300049585	Bacteria	806
768	Ga0501070_0038589	3300049586	Bacteria	3985
769	Ga0501070_0157356	3300049586	Bacteria	1874
770	Ga0501070_0344002	3300049586	Bacteria	1211
771	Ga0501071_0007570	3300049587	Bacteria	7149
772	Ga0501071_0045768	3300049587	Bacteria	3141
773	Ga0501071_0122599	3300049587	Bacteria	1927
774	Ga0501071_0327531	3300049587	Bacteria	1164
775	Ga0501071_0605637	3300049587	Bacteria	842
776	Ga0501072_0052692	3300049588	Bacteria	3203
777	Ga0501072_0145596	3300049588	Bacteria	1889
778	Ga0501072_0190375	3300049588	Bacteria	1636
779	Ga0501072_0559433	3300049588	Bacteria	903
780	Ga0501072_0681837	3300049588	Bacteria	808
781	Ga0501073_0014826	3300049589	Bacteria	5657
782	Ga0501073_0234421	3300049589	Bacteria	1268
783	Ga0501073_0274601	3300049589	Bacteria	1163
784	Ga0501073_0786556	3300049589	Bacteria	656
785	Ga0501074_0019437	3300049590	Bacteria	4934
786	Ga0501074_0192522	3300049590	Bacteria	1454
787	Ga0501074_0383474	3300049590	Bacteria	997
788	Ga0501075_0006472	3300049591	Bacteria	8061
789	Ga0501075_0218839	3300049591	Bacteria	1453
790	Ga0501075_0497357	3300049591	Bacteria	930
791	Ga0501075_0527233	3300049591	Bacteria	901
792	Ga0501075_0586295	3300049591	Bacteria	850
793	Ga0501075_0841331	3300049591	Bacteria	698
794	Ga0501076_0023982	3300049592	Bacteria	4709
795	Ga0501076_0072173	3300049592	Bacteria	2762
796	Ga0501076_0146137	3300049592	Bacteria	1922
797	Ga0501076_0164282	3300049592	Bacteria	1809
798	Ga0501076_0529683	3300049592	Bacteria	971
799	Ga0501076_0571246	3300049592	Bacteria	933
800	Ga0501076_0656410	3300049592	Bacteria	866
801	Ga0501076_0970258	3300049592	Bacteria	700
802	Ga0501077_0000799	3300049593	Bacteria	19041
803	Ga0501077_0012746	3300049593	Bacteria	5266
804	Ga0501077_0055028	3300049593	Bacteria	2526
805	Ga0501077_0188210	3300049593	Bacteria	1311
806	Ga0501077_0208998	3300049593	Bacteria	1240
807	Ga0501077_0437117	3300049593	Bacteria	837
808	Ga0501077_0528688	3300049593	Bacteria	757
809	Ga0501224_065989	3300049664	Bacteria	569
810	Ga0501225_0144555	3300049705	Bacteria	721
811	Ga0501079_0010994	3300049741	Bacteria	6897
812	Ga0501079_0229217	3300049741	Bacteria	1451
813	Ga0501079_0270049	3300049741	Bacteria	1329
814	Ga0501079_0422049	3300049741	Bacteria	1047
815	Ga0501079_0834892	3300049741	Bacteria	725
816	Ga0501079_1119025	3300049741	Bacteria	620
817	Ga0501080_0002809	3300049742	Bacteria	15307
818	Ga0501080_0111896	3300049742	Bacteria	2531
819	Ga0501080_0148538	3300049742	Bacteria	2167
820	Ga0501080_0264867	3300049742	Bacteria	1565
821	Ga0501080_0301855	3300049742	Bacteria	1452
822	Ga0501080_0364119	3300049742	Bacteria	1304
823	Ga0501081_0006091	3300049743	Bacteria	7815
824	Ga0501081_0008934	3300049743	Bacteria	6511
825	Ga0501081_0060246	3300049743	Bacteria	2629
826	Ga0501081_0069603	3300049743	Bacteria	2451
827	Ga0501081_0160373	3300049743	Bacteria	1620
828	Ga0501083_0040593	3300049744	Bacteria	3158
829	Ga0501083_0083209	3300049744	Bacteria	2120
830	Ga0501083_0513722	3300049744	Bacteria	780
831	Ga0501280_001760	3300049776	Bacteria	3806
832	Ga0501282_006444	3300049778	Bacteria	1254
833	Ga0501035_0030791	3300049822	Bacteria	4890
834	Ga0501035_0098791	3300049822	Bacteria	2563
835	Ga0501035_0101862	3300049822	Bacteria	2519
836	Ga0501035_0343524	3300049822	Bacteria	1250
837	Ga0501035_0574640	3300049822	Bacteria	921
838	Ga0501035_1106125	3300049822	Bacteria	619
839	Ga0501044_0041132	3300049823	Bacteria	4813
840	Ga0501044_0217206	3300049823	Bacteria	1864
841	Ga0501044_0529205	3300049823	Bacteria	1078
842	Ga0501045_0007497	3300049824	Bacteria	7579
843	Ga0501045_0017322	3300049824	Bacteria	5114
844	Ga0501045_0034733	3300049824	Bacteria	3661
845	Ga0501045_0077756	3300049824	Bacteria	2445
846	Ga0501045_0169080	3300049824	Bacteria	1628
847	Ga0501045_1089312	3300049824	Bacteria	584
848	nmdc:mga03683_49273_c1	3300050489	Bacteria	1753
849	nmdc:mga03n38_131231_c1	3300050490	Bacteria	1242
850	nmdc:mga00v17_302357_c1	3300050491	Bacteria	1039
851	nmdc:mga0yw44_105992_c1	3300050492	Bacteria	1796
852	nmdc:mga0k408_134283_c1	3300050493	Bacteria	1470
853	nmdc:mga06z11_103300_c1	3300050494	Bacteria	1567
854	nmdc:mga07m45_218835_c1	3300050496	Bacteria	1108
855	nmdc:mga07m45_465551_c1	3300050496	Bacteria	733
856	nmdc:mga05p37_65356_c1	3300050507	Bacteria	2169
857	nmdc:mga05p37_916593_c1	3300050507	Bacteria	943
858	nmdc:mga09592_151598_c1	3300050508	Bacteria	2000
859	nmdc:mga09592_866246_c1	3300050508	Bacteria	761
860	nmdc:mga0qj67_405377_c1	3300050509	Bacteria	1100
861	nmdc:mga0qj67_635793_c1	3300050509	Bacteria	852
862	nmdc:mga06r32_153587_c1	3300050510	Bacteria	2282
863	nmdc:mga06r32_480203_c1	3300050510	Bacteria	1221
864	nmdc:mga08y16_617345_c1	3300050511	Bacteria	1091
865	nmdc:mga0n895_29298_c1	3300050512	Bacteria	5249
866	nmdc:mga0n895_625022_c1	3300050512	Bacteria	1078
867	nmdc:mga0rr50_213813_c1	3300050513	Bacteria	1590
868	nmdc:mga08x19_53829_c1	3300050514	Bacteria	2590
869	nmdc:mga0a205_147705_c1	3300050515	Bacteria	2251
870	nmdc:mga0a205_79293_c1	3300050515	Bacteria	3173
871	nmdc:mga0sz30_18140_c1	3300050516	Bacteria	2152
872	nmdc:mga0sz30_32740_c1	3300050516	Bacteria	2157
873	nmdc:mga0sz30_63064_c1	3300050516	Bacteria	1586
874	Ga0495601_0014670	3300053077	Bacteria	4725
875	Ga0495601_0201900	3300053077	Bacteria	1299
876	Ga0495612_0059173	3300053078	Bacteria	1584
877	Ga0495655_0000929	3300053083	Bacteria	4540
878	Ga0495655_0125202	3300053083	Bacteria	786
879	Ga0495595_0133204	3300053084	Bacteria	1216
880	Ga0495619_0005161	3300053085	Bacteria	8288
881	Ga0495619_0024417	3300053085	Bacteria	3877
882	Ga0500578_0143727	3300053086	Bacteria	1490
883	Ga0500560_039064	3300053107	Bacteria	1479
884	Ga0500569_007712	3300053109	Bacteria	2428
885	Ga0500569_180721	3300053109	Bacteria	716
886	Ga0500594_0009824	3300053118	Bacteria	2210
887	Ga0500658_0008278	3300053134	Bacteria	3842
888	Ga0500606_165687	3300053152	Bacteria	706
889	Ga0500616_0051370	3300053153	Bacteria	2172
890	Ga0500622_0001966	3300053156	Bacteria	15471
891	Ga0500624_000741	3300053157	Bacteria	7966
892	Ga0500627_0213346	3300053158	Bacteria	863
893	Ga0500634_0093330	3300053161	Bacteria	1522
894	Ga0501084_0006692	3300054114	Bacteria	9475
895	Ga0501084_0058709	3300054114	Bacteria	3219
896	Ga0501084_0163986	3300054114	Bacteria	1875
897	Ga0501084_0212658	3300054114	Bacteria	1631
898	Ga0501084_0318144	3300054114	Bacteria	1314
899	Ga0501084_0331195	3300054114	Bacteria	1286
900	Ga0501084_0940953	3300054114	Bacteria	726
901	Ga0587070_018695	3300059491	Bacteria	1139
902	Ga0587080_019117	3300059503	Bacteria	1106
903	Ga0587082_156312	3300059504	Bacteria	543
904	Ga0587083_0018824	3300059505	Bacteria	1254
905	Ga0587098_035589	3300059604	Bacteria	704
906	Ga0587106_009052	3300059605	Bacteria	1257
907	Ga0587068_009375	3300059641	Bacteria	1438
908	Ga0587068_022656	3300059641	Bacteria	1042
909	Ga0587072_039714	3300059643	Bacteria	910
910	Ga0587102_022652	3300059649	Bacteria	720
911	Ga0587071_022486	3300060344	Bacteria	1164
912	Ga0587071_137479	3300060344	Bacteria	597
913	Ga0587111_0178200	3300060346	Bacteria	589
914	Ga0501082_0008964	3300060353	Bacteria	8635
915	Ga0501082_0024084	3300060353	Bacteria	5250
916	Ga0501082_0081064	3300060353	Bacteria	2800
917	Ga0501082_0514923	3300060353	Bacteria	1046
918	Ga0501082_0541104	3300060353	Bacteria	1018
919	Ga0501082_0547904	3300060353	Bacteria	1012
920	Ga0501082_0925362	3300060353	Bacteria	762
921	Ga0501082_1077468	3300060353	Bacteria	703
922	Ga0501082_1176957	3300060353	Bacteria	670
923	Ga0501082_1414441	3300060353	Bacteria	607
924	Ga0466962_0090810	3300061719	Bacteria	1463
925	Ga0530510_0096539	3300061734	Bacteria	2160
926	Ga0530510_0390345	3300061734	Bacteria	1048
927	Ga0530510_0492797	3300061734	Bacteria	929
928	Ga0530510_0636915	3300061734	Bacteria	811

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300026067	Ga0207678_10728556	Ga0207678_107285562	110
2	iso_pu_bacteria	2920760137	2920760451	119
3	iso_pu_bacteria	2508501122	2509109485	121
4	iso_pu_bacteria	2509276019	2509378205	121
5	iso_pu_bacteria	2509276021	2509389477	121
6	iso_pu_bacteria	2509276033	2509446111	121
7	iso_pu_bacteria	2510917028	2511183932	121
8	iso_pu_bacteria	2510917030	2511198234	121
9	iso_pu_bacteria	2513237084	2513571539	121
10	iso_pu_bacteria	2513237085	2513578563	121
11	iso_pu_bacteria	2513237088	2513598137	121
12	iso_pu_bacteria	2513237093	2513630258	121
13	iso_pu_bacteria	2513237103	2513713134	121
14	iso_pu_bacteria	2513237138	2513869181	121
15	iso_pu_bacteria	2513237144	2513912317	121
16	iso_pu_bacteria	2513237159	2513998551	121
17	iso_pu_bacteria	2515075009	2515114324	121
18	iso_pu_bacteria	2515154113	2515636216	121
19	iso_pu_bacteria	2515154114	2515643290	121
20	iso_pu_bacteria	2515154134	2515741491	121
21	iso_pu_bacteria	2516143018	2516205490	121
22	iso_pu_bacteria	2516653077	2517037944	121
23	iso_pu_bacteria	2516653085	2517078211	121
24	iso_pu_bacteria	2517093000	2517096980	121
25	iso_pu_bacteria	2519899620	2520376389	121
26	iso_pu_bacteria	2534681796	2535518951	121
27	iso_pu_bacteria	2554235003	2554248806	121
28	iso_pu_bacteria	2558860100	2558867309	121
29	iso_pu_bacteria	2558860242	2559295894	121
30	iso_pu_bacteria	2582581294	2585201806	121
31	iso_pu_bacteria	2582581298	2585223861	121
32	iso_pu_bacteria	2582581316	2585334213	121
33	iso_pu_bacteria	2582581866	2585396002	121
34	iso_pu_bacteria	2582581867	2585399683	121
35	iso_pu_bacteria	2585427526	2585526143	121
36	iso_pu_bacteria	2585427528	2585540703	121
37	iso_pu_bacteria	2585427529	2585549084	121
38	iso_pu_bacteria	2585427590	2585820770	121
39	iso_pu_bacteria	2585427593	2585838972	121
40	iso_pu_bacteria	2585427608	2585902789	121
41	iso_pu_bacteria	2599185156	2599335035	121
42	iso_pu_bacteria	2599185210	2599603314	121
43	iso_pu_bacteria	2600255279	2601610780	121
44	iso_pu_bacteria	2600255308	2601747554	121
45	iso_pu_bacteria	2643221582	2643921419	121
46	iso_pu_bacteria	2643221599	2644002404	121
47	iso_pu_bacteria	2643221643	2644240569	121
48	iso_pu_bacteria	2643221693	2644521472	121
49	iso_pu_bacteria	2643221723	2644677186	121
50	iso_pu_bacteria	2657244999	2657682516	121
51	iso_pu_bacteria	2690316117	2692320213	121
52	iso_pu_bacteria	2718217927	2719387595	121
53	iso_pu_bacteria	2718218423	2721401229	121
54	iso_pu_bacteria	2721755809	2724040043	121
55	iso_pu_bacteria	2724679232	2725947429	121
56	iso_pu_bacteria	2738541333	2739037190	121
57	iso_pu_bacteria	2751185821	2753463720	121
58	iso_pu_bacteria	2791355082	2792582133	121
59	iso_pu_bacteria	2791355091	2792622006	121
60	iso_pu_bacteria	2791355092	2792628736	121
61	iso_pu_bacteria	2791355094	2792641335	121
62	iso_pu_bacteria	2791355259	2793313459	121
63	iso_pu_bacteria	2791355263	2793338734	121
64	iso_pu_bacteria	2791355266	2793359461	121
65	iso_pu_bacteria	2791355267	2793365837	121
66	iso_pu_bacteria	2802429268	2804753593	121
67	iso_pu_bacteria	2802429633	2806047281	121
68	iso_pu_bacteria	2802429634	2806054145	121
69	iso_pu_bacteria	2802429635	2806060271	121
70	iso_pu_bacteria	2802429636	2806068891	121
71	iso_pu_bacteria	2802429637	2806077166	121
72	iso_pu_bacteria	2808606387	2808988282	121
73	iso_pu_bacteria	2818991439	2819560904	121
74	iso_pu_bacteria	2838042994	2838048405	121
75	iso_pu_bacteria	2838675328	2838678733	121
76	iso_pu_bacteria	2838680041	2838683959	121
77	iso_pu_bacteria	2838686498	2838690177	121
78	iso_pu_bacteria	2838694306	2838698488	121
79	iso_pu_bacteria	2838707686	2838711603	121
80	iso_pu_bacteria	2838714209	2838718178	121
81	iso_pu_bacteria	2838719591	2838723030	121
82	iso_pu_bacteria	2838724970	2838728245	121
83	iso_pu_bacteria	2838729681	2838731952	121
84	iso_pu_bacteria	2838742623	2838744848	121
85	iso_pu_bacteria	2841846520	2841850586	121
86	iso_pu_bacteria	2841851746	2841855905	121
87	iso_pu_bacteria	2841864319	2841867826	121
88	iso_pu_bacteria	2842077413	2842081404	121
89	iso_pu_bacteria	2842110456	2842116355	121
90	iso_pu_bacteria	2842118031	2842121819	121
91	iso_pu_bacteria	2842124991	2842128904	121
92	iso_pu_bacteria	2842130223	2842133625	121
93	iso_pu_bacteria	2842152218	2842155463	121
94	iso_pu_bacteria	2842156927	2842161075	121
95	iso_pu_bacteria	2842163707	2842166594	121
96	iso_pu_bacteria	2842170452	2842174580	121
97	iso_pu_bacteria	2842175837	2842179239	121
98	iso_pu_bacteria	2842180545	2842184691	121
99	iso_pu_bacteria	2842187318	2842190602	121
100	iso_pu_bacteria	2842211629	2842215074	121
101	iso_pu_bacteria	2842217011	2842223349	121
102	iso_pu_bacteria	2842224351	2842227795	121
103	iso_pu_bacteria	2842229732	2842232274	121
104	iso_pu_bacteria	2842237096	2842240834	121
105	iso_pu_bacteria	2842243621	2842246689	121
106	iso_pu_bacteria	2842257432	2842261209	121
107	iso_pu_bacteria	2842271015	2842274197	121
108	iso_pu_bacteria	2842291075	2842295061	121
109	iso_pu_bacteria	2842304105	2842305943	121
110	iso_pu_bacteria	2842341865	2842346650	121
111	iso_pu_bacteria	2842363717	2842366340	121
112	iso_pu_bacteria	2842370503	2842374921	121
113	iso_pu_bacteria	2842377471	2842381460	121
114	iso_pu_bacteria	2842384541	2842388530	121
115	iso_pu_bacteria	2842395702	2842396026	121
116	iso_pu_bacteria	2842482326	2842487956	121
117	iso_pu_bacteria	2842521101	2842524418	121
118	iso_pu_bacteria	2842922631	2842926224	121
119	iso_pu_bacteria	2844454524	2844457125	121
120	iso_pu_bacteria	2847417321	2847420727	121
121	iso_pu_bacteria	2848992105	2848995559	121
122	iso_pu_bacteria	2850079185	2850082545	121
123	iso_pu_bacteria	2855872281	2855878085	121
124	iso_pu_bacteria	2857516855	2857521066	121
125	iso_pu_bacteria	2896384573	2896387973	121
126	iso_pu_bacteria	2899803654	2899808099	121
127	iso_pu_bacteria	2899845264	2899849241	121
128	iso_pu_bacteria	2919100787	2919105322	121
129	iso_pu_bacteria	2919114240	2919118564	121
130	iso_pu_bacteria	2920822456	2920825839	121
131	iso_pu_bacteria	2923556063	2923559558	121
132	iso_pu_bacteria	2926754445	2926755094	121
133	iso_pu_bacteria	2926760298	2926762254	121
134	iso_pu_bacteria	2933006813	2933010687	121
135	iso_pu_bacteria	2933570622	2933572448	121
136	iso_pu_bacteria	2933586486	2933592571	121
137	iso_pu_bacteria	2933594066	2933597620	121
138	iso_pu_bacteria	2935894831	2935897863	121
139	iso_pu_bacteria	2935901341	2935903735	121
140	iso_pu_bacteria	2936367885	2936369811	121
141	iso_pu_bacteria	2936375103	2936378998	121
142	iso_pu_bacteria	2936381700	2936382028	121
143	iso_pu_bacteria	2979089926	2979092476	121
144	iso_pu_bacteria	2979095461	2979100133	121
145	iso_pu_bacteria	2979100975	2979104447	121
146	iso_pu_bacteria	2984509177	2984513757	121
147	iso_pu_bacteria	2984518228	2984522665	121
148	iso_pu_bacteria	2984537506	2984541971	121
149	iso_pu_bacteria	2984601300	2984601401	121
150	iso_pu_bacteria	2996887358	2996890173	121
151	iso_pu_bacteria	2996893221	2996895215	121
152	iso_pu_bacteria	3003930520	3003930915	121
153	iso_pu_bacteria	3005445848	3005449594	121
154	iso_pu_bacteria	3005452660	3005455875	121
155	iso_pu_bacteria	639633055	639650327	121
156	iso_pu_bacteria	643692032	643827324	121
157	iso_pu_bacteria	650716007	650741108	121
158	iso_pu_bacteria	8003570095	8003573833	121
159	iso_pu_bacteria	8005258706	8005262357	121
160	iso_pu_bacteria	8005275841	8005282349	121
161	iso_pu_bacteria	8005307578	8005313599	121
162	iso_pu_bacteria	8005321885	8005324700	121
163	iso_pu_bacteria	8005376324	8005381644	121
164	iso_pu_bacteria	8005460587	8005465017	121
165	iso_pu_bacteria	8005542996	8005546601	121
166	iso_pu_bacteria	8005556819	8005561058	121
167	iso_pu_bacteria	8005563573	8005565684	121
168	iso_pu_bacteria	8005570704	8005571756	121
169	iso_pu_bacteria	8005695170	8005695651	121
170	iso_pu_bacteria	8018127388	8018128845	121
171	iso_pu_bacteria	8018163183	8018165205	121
172	iso_pu_bacteria	8018176218	8018177078	121
173	iso_pu_bacteria	8023680758	8023686437	121
174	iso_pu_bacteria	8049293176	8049296162	121
175	iso_pu_bacteria	8056375014	8056380346	121
176	iso_pu_bacteria	8057874678	8057879181	121
177	3300035398	Ga0316574_0296234	Ga0316574_0296234_558_938	122
178	3300049576	Ga0501040_0782894	Ga0501040_0782894_83_457	122
179	3300049580	Ga0501046_0000033	Ga0501046_0000033_148914_149297	122
180	3300060353	Ga0501082_1176957	Ga0501082_1176957_105_479	122
181	3300061734	Ga0530510_0492797	Ga0530510_0492797_364_738	122
182	iso_pu_bacteria	2643221551	2643777274	122
183	iso_pu_bacteria	2643221555	2643795722	122
184	3300001977	JGI24746J21847_1017923	JGI24746J21847_10179232	123
185	3300002067	JGI24735J21928_10061026	JGI24735J21928_100610262	123
186	3300002070	JGI24750J21931_1006143	JGI24750J21931_10061432	123
187	3300002075	JGI24738J21930_10002453	JGI24738J21930_100024532	123
188	3300002705	JGI25156J39149_1000102	JGI25156J39149_100010260	123
189	3300002738	JGI25154J39366_1000184	JGI25154J39366_10001848	123
190	3300002741	JGI25157J39369_1000009	JGI25157J39369_100000958	123
191	3300002771	JGI25163J39215_1004657	JGI25163J39215_10046572	123
192	3300002773	JGI25152J39213_1009567	JGI25152J39213_10095672	123
193	3300002773	JGI25152J39213_1055319	JGI25152J39213_10553191	123
194	3300002774	JGI25150J39212_1008276	JGI25150J39212_10082761	123
195	3300002774	JGI25150J39212_1014880	JGI25150J39212_10148802	123
196	3300003187	JGI25151J46595_10001921	JGI25151J46595_1000192114	123
197	3300003187	JGI25151J46595_10110296	JGI25151J46595_101102962	123
198	3300003214	JGI25165J46597_1001832	JGI25165J46597_10018322	123
199	3300003215	JGI25153J46596_10051319	JGI25153J46596_100513191	123
200	3300003215	JGI25153J46596_10078744	JGI25153J46596_100787441	123
201	3300003215	JGI25153J46596_10080008	JGI25153J46596_100800082	123
202	3300003215	JGI25153J46596_10149312	JGI25153J46596_101493121	123
203	3300003354	JGI25160J50197_1000401	JGI25160J50197_10004017	123
204	3300003354	JGI25160J50197_1023007	JGI25160J50197_10230074	123
205	3300003374	JGI25161J50226_1000137	JGI25161J50226_100013745	123
206	3300003374	JGI25161J50226_1006204	JGI25161J50226_10062044	123
207	3300003771	Ga0055526_1002794	Ga0055526_10027949	123
208	3300003771	Ga0055526_1002810	Ga0055526_10028102	123
209	3300003771	Ga0055526_1020533	Ga0055526_10205332	123
210	3300003775	Ga0055524_1005991	Ga0055524_10059913	123
211	3300003775	Ga0055524_1011602	Ga0055524_10116022	123
212	3300003790	Ga0055528_1027613	Ga0055528_10276132	123
213	3300003790	Ga0055528_1032661	Ga0055528_10326612	123
214	3300003790	Ga0055528_1045430	Ga0055528_10454301	123
215	3300003790	Ga0055528_1051977	Ga0055528_10519771	123
216	3300003791	Ga0055530_10067243	Ga0055530_100672432	123
217	3300003792	Ga0055540_1002204	Ga0055540_100220410	123
218	3300003792	Ga0055540_1015240	Ga0055540_10152402	123
219	3300003794	Ga0055531_10052461	Ga0055531_100524612	123
220	3300004625	Ga0055543_1000321	Ga0055543_10003218	123
221	3300004625	Ga0055543_1000609	Ga0055543_10006098	123
222	3300005262	Ga0065165_1004116	Ga0065165_10041163	123
223	3300005262	Ga0065165_1028090	Ga0065165_10280902	123
224	3300005328	Ga0070676_10005852	Ga0070676_100058525	123
225	3300005329	Ga0070683_100066464	Ga0070683_1000664642	123
226	3300005330	Ga0070690_100001183	Ga0070690_1000011833	123
227	3300005330	Ga0070690_100432947	Ga0070690_1004329472	123
228	3300005331	Ga0070670_100004193	Ga0070670_10000419311	123
229	3300005333	Ga0070677_10112150	Ga0070677_101121503	123
230	3300005334	Ga0068869_100227382	Ga0068869_1002273822	123
231	3300005335	Ga0070666_10009770	Ga0070666_100097703	123
232	3300005336	Ga0070680_100249096	Ga0070680_1002490961	123
233	3300005336	Ga0070680_101050848	Ga0070680_1010508481	123
234	3300005337	Ga0070682_100012032	Ga0070682_1000120323	123
235	3300005337	Ga0070682_100211738	Ga0070682_1002117382	123
236	3300005338	Ga0068868_100012990	Ga0068868_1000129905	123
237	3300005338	Ga0068868_100413612	Ga0068868_1004136122	123
238	3300005339	Ga0070660_100001653	Ga0070660_1000016534	123
239	3300005340	Ga0070689_100005243	Ga0070689_1000052434	123
240	3300005341	Ga0070691_10000575	Ga0070691_1000057511	123
241	3300005343	Ga0070687_100005939	Ga0070687_1000059394	123
242	3300005344	Ga0070661_100006402	Ga0070661_1000064026	123
243	3300005345	Ga0070692_10052185	Ga0070692_100521852	123
244	3300005347	Ga0070668_100006301	Ga0070668_1000063013	123
245	3300005347	Ga0070668_100011925	Ga0070668_1000119258	123
246	3300005347	Ga0070668_100301192	Ga0070668_1003011922	123
247	3300005353	Ga0070669_100018232	Ga0070669_1000182322	123
248	3300005354	Ga0070675_100030980	Ga0070675_1000309804	123
249	3300005355	Ga0070671_100002577	Ga0070671_1000025778	123
250	3300005356	Ga0070674_100001585	Ga0070674_10000158513	123
251	3300005356	Ga0070674_100907956	Ga0070674_1009079561	123
252	3300005364	Ga0070673_100793331	Ga0070673_1007933312	123
253	3300005365	Ga0070688_100404485	Ga0070688_1004044851	123
254	3300005365	Ga0070688_100927204	Ga0070688_1009272041	123
255	3300005366	Ga0070659_100090849	Ga0070659_1000908494	123
256	3300005366	Ga0070659_101031674	Ga0070659_1010316742	123
257	3300005367	Ga0070667_100006721	Ga0070667_1000067212	123
258	3300005367	Ga0070667_100271069	Ga0070667_1002710692	123
259	3300005406	Ga0070703_10028059	Ga0070703_100280592	123
260	3300005434	Ga0070709_10006649	Ga0070709_100066495	123
261	3300005435	Ga0070714_100006975	Ga0070714_1000069754	123
262	3300005435	Ga0070714_102008847	Ga0070714_1020088472	123
263	3300005436	Ga0070713_100043144	Ga0070713_1000431445	123
264	3300005437	Ga0070710_10006661	Ga0070710_100066615	123
265	3300005438	Ga0070701_10182397	Ga0070701_101823972	123
266	3300005438	Ga0070701_10606035	Ga0070701_106060351	123
267	3300005439	Ga0070711_100169110	Ga0070711_1001691103	123
268	3300005440	Ga0070705_100001205	Ga0070705_1000012055	123
269	3300005440	Ga0070705_100824902	Ga0070705_1008249022	123
270	3300005440	Ga0070705_101262470	Ga0070705_1012624701	123
271	3300005441	Ga0070700_100046200	Ga0070700_1000462002	123
272	3300005441	Ga0070700_100180221	Ga0070700_1001802211	123
273	3300005441	Ga0070700_101425788	Ga0070700_1014257882	123
274	3300005441	Ga0070700_101664134	Ga0070700_1016641341	123
275	3300005444	Ga0070694_100001865	Ga0070694_1000018654	123
276	3300005444	Ga0070694_100129373	Ga0070694_1001293733	123
277	3300005444	Ga0070694_100963675	Ga0070694_1009636752	123
278	3300005455	Ga0070663_100001588	Ga0070663_1000015888	123
279	3300005455	Ga0070663_100849317	Ga0070663_1008493172	123
280	3300005455	Ga0070663_101134167	Ga0070663_1011341672	123
281	3300005456	Ga0070678_100033727	Ga0070678_1000337274	123
282	3300005457	Ga0070662_100002202	Ga0070662_1000022028	123
283	3300005457	Ga0070662_100517336	Ga0070662_1005173362	123
284	3300005457	Ga0070662_100807267	Ga0070662_1008072671	123
285	3300005458	Ga0070681_10115781	Ga0070681_101157812	123
286	3300005459	Ga0068867_100059754	Ga0068867_1000597543	123
287	3300005459	Ga0068867_100079768	Ga0068867_1000797682	123
288	3300005459	Ga0068867_100485808	Ga0068867_1004858082	123
289	3300005459	Ga0068867_101360610	Ga0068867_1013606101	123
290	3300005466	Ga0070685_10225859	Ga0070685_102258593	123
291	3300005466	Ga0070685_10429265	Ga0070685_104292652	123
292	3300005530	Ga0070679_100865744	Ga0070679_1008657442	123
293	3300005530	Ga0070679_102095316	Ga0070679_1020953161	123
294	3300005535	Ga0070684_100009018	Ga0070684_1000090185	123
295	3300005536	Ga0070697_100047621	Ga0070697_1000476214	123
296	3300005539	Ga0068853_100003000	Ga0068853_10000300010	123
297	3300005539	Ga0068853_100709273	Ga0068853_1007092731	123
298	3300005539	Ga0068853_101015796	Ga0068853_1010157962	123
299	3300005539	Ga0068853_101596505	Ga0068853_1015965051	123
300	3300005543	Ga0070672_100004861	Ga0070672_1000048617	123
301	3300005544	Ga0070686_100003237	Ga0070686_10000323711	123
302	3300005544	Ga0070686_100344333	Ga0070686_1003443332	123
303	3300005544	Ga0070686_101722743	Ga0070686_1017227432	123
304	3300005545	Ga0070695_100021775	Ga0070695_1000217754	123
305	3300005545	Ga0070695_100729749	Ga0070695_1007297491	123
306	3300005546	Ga0070696_100003761	Ga0070696_1000037614	123
307	3300005546	Ga0070696_100284864	Ga0070696_1002848642	123
308	3300005546	Ga0070696_100978288	Ga0070696_1009782882	123
309	3300005547	Ga0070693_100000393	Ga0070693_10000039310	123
310	3300005547	Ga0070693_101383024	Ga0070693_1013830241	123
311	3300005548	Ga0070665_100298730	Ga0070665_1002987302	123
312	3300005548	Ga0070665_100409283	Ga0070665_1004092833	123
313	3300005548	Ga0070665_100616059	Ga0070665_1006160592	123
314	3300005549	Ga0070704_100011772	Ga0070704_1000117725	123
315	3300005563	Ga0068855_100009780	Ga0068855_1000097807	123
316	3300005563	Ga0068855_101170376	Ga0068855_1011703762	123
317	3300005564	Ga0070664_100013997	Ga0070664_1000139975	123
318	3300005577	Ga0068857_100018626	Ga0068857_1000186265	123
319	3300005578	Ga0068854_100001016	Ga0068854_10000101611	123
320	3300005614	Ga0068856_100004785	Ga0068856_10000478512	123
321	3300005614	Ga0068856_101987749	Ga0068856_1019877492	123
322	3300005615	Ga0070702_100000623	Ga0070702_1000006233	123
323	3300005615	Ga0070702_100162171	Ga0070702_1001621713	123
324	3300005615	Ga0070702_100747513	Ga0070702_1007475131	123
325	3300005615	Ga0070702_101095150	Ga0070702_1010951501	123
326	3300005616	Ga0068852_101066360	Ga0068852_1010663602	123
327	3300005616	Ga0068852_101447828	Ga0068852_1014478281	123
328	3300005617	Ga0068859_100029959	Ga0068859_1000299594	123
329	3300005617	Ga0068859_100327537	Ga0068859_1003275371	123
330	3300005617	Ga0068859_100706443	Ga0068859_1007064432	123
331	3300005618	Ga0068864_100004464	Ga0068864_1000044649	123
332	3300005718	Ga0068866_10006282	Ga0068866_100062823	123
333	3300005718	Ga0068866_10041793	Ga0068866_100417932	123
334	3300005719	Ga0068861_100008474	Ga0068861_1000084746	123
335	3300005719	Ga0068861_100025133	Ga0068861_1000251332	123
336	3300005834	Ga0068851_10027056	Ga0068851_100270562	123
337	3300005840	Ga0068870_10442635	Ga0068870_104426352	123
338	3300005841	Ga0068863_100013678	Ga0068863_1000136789	123
339	3300005842	Ga0068858_100010770	Ga0068858_1000107705	123
340	3300005842	Ga0068858_100303741	Ga0068858_1003037411	123
341	3300005842	Ga0068858_100944221	Ga0068858_1009442212	123
342	3300005842	Ga0068858_101151754	Ga0068858_1011517542	123
343	3300005843	Ga0068860_100006715	Ga0068860_1000067159	123
344	3300005843	Ga0068860_100503130	Ga0068860_1005031302	123
345	3300005844	Ga0068862_100382161	Ga0068862_1003821613	123
346	3300005844	Ga0068862_101764921	Ga0068862_1017649212	123
347	3300005937	Ga0081455_10108988	Ga0081455_101089884	123
348	3300005937	Ga0081455_10145509	Ga0081455_101455092	123
349	3300005983	Ga0081540_1000034	Ga0081540_100003421	123
350	3300006038	Ga0075365_10036684	Ga0075365_100366842	123
351	3300006038	Ga0075365_10108551	Ga0075365_101085512	123
352	3300006038	Ga0075365_10451524	Ga0075365_104515242	123
353	3300006042	Ga0075368_10294718	Ga0075368_102947182	123
354	3300006048	Ga0075363_100192490	Ga0075363_1001924902	123
355	3300006051	Ga0075364_10128678	Ga0075364_101286782	123
356	3300006051	Ga0075364_10148567	Ga0075364_101485672	123
357	3300006163	Ga0070715_10000579	Ga0070715_100005794	123
358	3300006173	Ga0070716_100002213	Ga0070716_1000022137	123
359	3300006173	Ga0070716_100290828	Ga0070716_1002908282	123
360	3300006175	Ga0070712_100001945	Ga0070712_1000019457	123
361	3300006175	Ga0070712_100079616	Ga0070712_1000796162	123
362	3300006175	Ga0070712_101115186	Ga0070712_1011151862	123
363	3300006177	Ga0075362_10191263	Ga0075362_101912632	123
364	3300006178	Ga0075367_10010829	Ga0075367_100108292	123
365	3300006186	Ga0075369_10026434	Ga0075369_100264341	123
366	3300006186	Ga0075369_10027517	Ga0075369_100275174	123
367	3300006186	Ga0075369_10213477	Ga0075369_102134771	123
368	3300006186	Ga0075369_10253479	Ga0075369_102534792	123
369	3300006195	Ga0075366_10223458	Ga0075366_102234582	123
370	3300006237	Ga0097621_100029648	Ga0097621_1000296484	123
371	3300006237	Ga0097621_100921360	Ga0097621_1009213602	123
372	3300006353	Ga0075370_10030765	Ga0075370_100307653	123
373	3300006353	Ga0075370_10370834	Ga0075370_103708342	123
374	3300006353	Ga0075370_10405159	Ga0075370_104051592	123
375	3300006358	Ga0068871_100054247	Ga0068871_1000542472	123
376	3300006358	Ga0068871_100099281	Ga0068871_1000992812	123
377	3300006846	Ga0075430_100619687	Ga0075430_1006196871	123
378	3300006846	Ga0075430_100654682	Ga0075430_1006546822	123
379	3300006847	Ga0075431_100038429	Ga0075431_1000384293	123
380	3300006871	Ga0075434_100070297	Ga0075434_1000702974	123
381	3300006871	Ga0075434_100681458	Ga0075434_1006814582	123
382	3300006880	Ga0075429_100024906	Ga0075429_1000249064	123
383	3300006880	Ga0075429_100720081	Ga0075429_1007200811	123
384	3300006881	Ga0068865_100000600	Ga0068865_10000060023	123
385	3300006881	Ga0068865_101017601	Ga0068865_1010176011	123
386	3300006881	Ga0068865_101408674	Ga0068865_1014086742	123
387	3300006914	Ga0075436_100016305	Ga0075436_1000163054	123
388	3300006931	Ga0097620_100029959	Ga0097620_1000299593	123
389	3300006931	Ga0097620_100327564	Ga0097620_1003275643	123
390	3300006931	Ga0097620_100706467	Ga0097620_1007064672	123
391	3300006948	Ga0099826_10002340	Ga0099826_100023409	123
392	3300009011	Ga0105251_10073604	Ga0105251_100736043	123
393	3300009036	Ga0105244_10128666	Ga0105244_101286662	123
394	3300009092	Ga0105250_10032241	Ga0105250_100322412	123
395	3300009092	Ga0105250_10456806	Ga0105250_104568062	123
396	3300009093	Ga0105240_10066878	Ga0105240_100668781	123
397	3300009094	Ga0111539_10477106	Ga0111539_104771063	123
398	3300009094	Ga0111539_12281461	Ga0111539_122814612	123
399	3300009098	Ga0105245_10006645	Ga0105245_100066456	123
400	3300009098	Ga0105245_10568784	Ga0105245_105687842	123
401	3300009101	Ga0105247_10007053	Ga0105247_100070535	123
402	3300009101	Ga0105247_10026666	Ga0105247_100266662	123
403	3300009101	Ga0105247_10095351	Ga0105247_100953512	123
404	3300009147	Ga0114129_10095313	Ga0114129_100953132	123
405	3300009147	Ga0114129_10170704	Ga0114129_101707043	123
406	3300009148	Ga0105243_10005106	Ga0105243_100051062	123
407	3300009148	Ga0105243_10229124	Ga0105243_102291242	123
408	3300009148	Ga0105243_10268943	Ga0105243_102689432	123
409	3300009174	Ga0105241_10001163	Ga0105241_1000116313	123
410	3300009176	Ga0105242_10002287	Ga0105242_1000228712	123
411	3300009176	Ga0105242_11372436	Ga0105242_113724362	123
412	3300009177	Ga0105248_10229441	Ga0105248_102294412	123
413	3300009177	Ga0105248_10871148	Ga0105248_108711482	123
414	3300009177	Ga0105248_11379300	Ga0105248_113793002	123
415	3300009545	Ga0105237_10052300	Ga0105237_100523004	123
416	3300009545	Ga0105237_10269730	Ga0105237_102697301	123
417	3300009553	Ga0105249_10003419	Ga0105249_100034193	123
418	3300009553	Ga0105249_10089040	Ga0105249_100890404	123
419	3300009553	Ga0105249_10674729	Ga0105249_106747292	123
420	3300009553	Ga0105249_11061002	Ga0105249_110610022	123
421	3300009763	Ga0123340_1063014	Ga0123340_10630142	123
422	3300009765	Ga0123341_1000009	Ga0123341_100000919	123
423	3300009765	Ga0123341_1073508	Ga0123341_10735082	123
424	3300009766	Ga0123342_1037816	Ga0123342_10378162	123
425	3300010375	Ga0105239_10206821	Ga0105239_102068212	123
426	3300010375	Ga0105239_10786969	Ga0105239_107869692	123
427	3300010375	Ga0105239_10926238	Ga0105239_109262382	123
428	3300010375	Ga0105239_11243057	Ga0105239_112430572	123
429	3300010375	Ga0105239_11392289	Ga0105239_113922891	123
430	3300011119	Ga0105246_10000990	Ga0105246_100009908	123
431	3300012497	Ga0157319_1003163	Ga0157319_10031632	123
432	3300013100	Ga0157373_10192941	Ga0157373_101929412	123
433	3300013102	Ga0157371_10204821	Ga0157371_102048212	123
434	3300013104	Ga0157370_10114211	Ga0157370_101142112	123
435	3300013105	Ga0157369_10001931	Ga0157369_100019317	123
436	3300013249	Ga0171463_1004	Ga0171463_1004105	123
437	3300013296	Ga0157374_10613236	Ga0157374_106132362	123
438	3300013296	Ga0157374_11447556	Ga0157374_114475562	123
439	3300013297	Ga0157378_10003666	Ga0157378_1000366612	123
440	3300013297	Ga0157378_10052061	Ga0157378_100520616	123
441	3300013297	Ga0157378_10326852	Ga0157378_103268522	123
442	3300013306	Ga0163162_10007123	Ga0163162_100071237	123
443	3300013306	Ga0163162_10133511	Ga0163162_101335114	123
444	3300013306	Ga0163162_10194453	Ga0163162_101944532	123
445	3300013306	Ga0163162_12114179	Ga0163162_121141792	123
446	3300013307	Ga0157372_10012262	Ga0157372_100122628	123
447	3300013308	Ga0157375_10006707	Ga0157375_100067078	123
448	3300013308	Ga0157375_10020038	Ga0157375_100200385	123
449	3300013308	Ga0157375_10151826	Ga0157375_101518262	123
450	3300013308	Ga0157375_10475460	Ga0157375_104754602	123
451	3300014325	Ga0163163_10028147	Ga0163163_100281473	123
452	3300014326	Ga0157380_10006092	Ga0157380_100060927	123
453	3300014326	Ga0157380_11212745	Ga0157380_112127451	123
454	3300014745	Ga0157377_10005777	Ga0157377_100057775	123
455	3300014968	Ga0157379_10005438	Ga0157379_100054384	123
456	3300014968	Ga0157379_10131266	Ga0157379_101312662	123
457	3300014968	Ga0157379_10135704	Ga0157379_101357044	123
458	3300014968	Ga0157379_10143598	Ga0157379_101435981	123
459	3300014968	Ga0157379_11565407	Ga0157379_115654072	123
460	3300014969	Ga0157376_10010202	Ga0157376_100102027	123
461	3300015261	Ga0182006_1115383	Ga0182006_11153832	123
462	3300015690	Ga0183363_1208	Ga0183363_12084	123
463	3300017792	Ga0163161_10005735	Ga0163161_100057352	123
464	3300017792	Ga0163161_10013491	Ga0163161_100134914	123
465	3300017792	Ga0163161_10546541	Ga0163161_105465412	123
466	3300017792	Ga0163161_10681292	Ga0163161_106812922	123
467	3300021321	Ga0214542_1039603	Ga0214542_10396031	123
468	3300021327	Ga0214543_1000053	Ga0214543_100005392	123
469	3300025206	Ga0209435_100009	Ga0209435_100009317	123
470	3300025207	Ga0209760_104952	Ga0209760_1049522	123
471	3300025208	Ga0209436_100299	Ga0209436_10029920	123
472	3300025228	Ga0209672_122692	Ga0209672_1226922	123
473	3300025233	Ga0209437_100107	Ga0209437_100107118	123
474	3300025245	Ga0207425_1001864	Ga0207425_10018646	123
475	3300025245	Ga0207425_1005340	Ga0207425_10053405	123
476	3300025245	Ga0207425_1013468	Ga0207425_10134682	123
477	3300025246	Ga0209646_1000018	Ga0209646_1000018317	123
478	3300025250	Ga0209026_1000068	Ga0209026_100006859	123
479	3300025256	Ga0209759_1000007	Ga0209759_1000007317	123
480	3300025258	Ga0209129_1001625	Ga0209129_10016251	123
481	3300025258	Ga0209129_1002128	Ga0209129_10021288	123
482	3300025258	Ga0209129_1002500	Ga0209129_100250010	123
483	3300025258	Ga0209129_1034437	Ga0209129_10344372	123
484	3300025261	Ga0209233_1000072	Ga0209233_100007250	123
485	3300025263	Ga0209565_1029005	Ga0209565_10290052	123
486	3300025273	Ga0209673_1000052	Ga0209673_100005267	123
487	3300025273	Ga0209673_1000459	Ga0209673_100045910	123
488	3300025273	Ga0209673_1002376	Ga0209673_100237613	123
489	3300025273	Ga0209673_1016194	Ga0209673_10161942	123
490	3300025273	Ga0209673_1039469	Ga0209673_10394692	123
491	3300025284	Ga0209130_1000009	Ga0209130_1000009328	123
492	3300025291	Ga0209675_1035903	Ga0209675_10359031	123
493	3300025292	Ga0209676_1024551	Ga0209676_10245513	123
494	3300025294	Ga0209025_1000765	Ga0209025_10007654	123
495	3300025294	Ga0209025_1001035	Ga0209025_100103542	123
496	3300025294	Ga0209025_1017322	Ga0209025_10173224	123
497	3300025294	Ga0209025_1032055	Ga0209025_10320552	123
498	3300025294	Ga0209025_1141499	Ga0209025_11414992	123
499	3300025295	Ga0209564_1000569	Ga0209564_100056950	123
500	3300025295	Ga0209564_1006046	Ga0209564_10060464	123
501	3300025295	Ga0209564_1011522	Ga0209564_10115225	123
502	3300025297	Ga0209758_1002002	Ga0209758_100200221	123
503	3300025297	Ga0209758_1005244	Ga0209758_10052446	123
504	3300025297	Ga0209758_1006541	Ga0209758_10065419	123
505	3300025297	Ga0209758_1012770	Ga0209758_10127702	123
506	3300025297	Ga0209758_1056284	Ga0209758_10562842	123
507	3300025297	Ga0209758_1127188	Ga0209758_11271881	123
508	3300025298	Ga0209050_1019253	Ga0209050_10192532	123
509	3300025299	Ga0209256_1002153	Ga0209256_100215311	123
510	3300025299	Ga0209256_1003192	Ga0209256_100319210	123
511	3300025299	Ga0209256_1013250	Ga0209256_10132501	123
512	3300025299	Ga0209256_1035927	Ga0209256_10359272	123
513	3300025302	Ga0207426_1000041	Ga0207426_1000041266	123
514	3300025302	Ga0207426_1000723	Ga0207426_100072320	123
515	3300025303	Ga0209051_1000561	Ga0209051_100056113	123
516	3300025303	Ga0209051_1013102	Ga0209051_10131026	123
517	3300025303	Ga0209051_1013239	Ga0209051_10132395	123
518	3300025303	Ga0209051_1014030	Ga0209051_10140306	123
519	3300025303	Ga0209051_1115038	Ga0209051_11150382	123
520	3300025304	Ga0209257_1003339	Ga0209257_100333910	123
521	3300025304	Ga0209257_1082273	Ga0209257_10822732	123
522	3300025304	Ga0209257_1151158	Ga0209257_11511581	123
523	3300025321	Ga0207656_10047332	Ga0207656_100473322	123
524	3300025885	Ga0207653_10066898	Ga0207653_100668982	123
525	3300025893	Ga0207682_10304003	Ga0207682_103040032	123
526	3300025898	Ga0207692_10050912	Ga0207692_100509122	123
527	3300025899	Ga0207642_10007409	Ga0207642_100074093	123
528	3300025900	Ga0207710_10001879	Ga0207710_100018793	123
529	3300025900	Ga0207710_10009612	Ga0207710_100096125	123
530	3300025900	Ga0207710_10208660	Ga0207710_102086602	123
531	3300025901	Ga0207688_10000781	Ga0207688_100007816	123
532	3300025903	Ga0207680_10123650	Ga0207680_101236502	123
533	3300025903	Ga0207680_10475353	Ga0207680_104753533	123
534	3300025904	Ga0207647_10002004	Ga0207647_100020043	123
535	3300025905	Ga0207685_10000430	Ga0207685_100004302	123
536	3300025906	Ga0207699_10045417	Ga0207699_100454172	123
537	3300025907	Ga0207645_10003961	Ga0207645_100039615	123
538	3300025911	Ga0207654_10026356	Ga0207654_100263564	123
539	3300025912	Ga0207707_10284519	Ga0207707_102845192	123
540	3300025913	Ga0207695_11233763	Ga0207695_112337632	123
541	3300025914	Ga0207671_10035049	Ga0207671_100350493	123
542	3300025914	Ga0207671_10649682	Ga0207671_106496821	123
543	3300025915	Ga0207693_10003215	Ga0207693_1000321512	123
544	3300025915	Ga0207693_10040693	Ga0207693_100406932	123
545	3300025916	Ga0207663_10001183	Ga0207663_100011834	123
546	3300025917	Ga0207660_10014769	Ga0207660_100147692	123
547	3300025917	Ga0207660_10071857	Ga0207660_100718572	123
548	3300025917	Ga0207660_10653482	Ga0207660_106534822	123
549	3300025918	Ga0207662_10003968	Ga0207662_100039688	123
550	3300025919	Ga0207657_10005198	Ga0207657_100051983	123
551	3300025920	Ga0207649_10007541	Ga0207649_100075415	123
552	3300025921	Ga0207652_10222628	Ga0207652_102226282	123
553	3300025921	Ga0207652_10409825	Ga0207652_104098252	123
554	3300025921	Ga0207652_11451594	Ga0207652_114515942	123
555	3300025923	Ga0207681_10022013	Ga0207681_100220133	123
556	3300025924	Ga0207694_10705441	Ga0207694_107054412	123
557	3300025925	Ga0207650_10036970	Ga0207650_100369704	123
558	3300025926	Ga0207659_10047610	Ga0207659_100476102	123
559	3300025927	Ga0207687_10466654	Ga0207687_104666542	123
560	3300025928	Ga0207700_10197747	Ga0207700_101977472	123
561	3300025929	Ga0207664_10318878	Ga0207664_103188782	123
562	3300025931	Ga0207644_10026611	Ga0207644_100266115	123
563	3300025931	Ga0207644_10091207	Ga0207644_100912072	123
564	3300025932	Ga0207690_10001664	Ga0207690_1000166412	123
565	3300025932	Ga0207690_10912910	Ga0207690_109129101	123
566	3300025933	Ga0207706_10001697	Ga0207706_1000169712	123
567	3300025933	Ga0207706_11171206	Ga0207706_111712062	123
568	3300025933	Ga0207706_11245822	Ga0207706_112458222	123
569	3300025933	Ga0207706_11550520	Ga0207706_115505201	123
570	3300025934	Ga0207686_10048940	Ga0207686_100489402	123
571	3300025934	Ga0207686_10693344	Ga0207686_106933442	123
572	3300025935	Ga0207709_10008122	Ga0207709_100081223	123
573	3300025936	Ga0207670_10011889	Ga0207670_100118892	123
574	3300025936	Ga0207670_10114514	Ga0207670_101145142	123
575	3300025937	Ga0207669_10015329	Ga0207669_100153294	123
576	3300025938	Ga0207704_10004556	Ga0207704_100045562	123
577	3300025938	Ga0207704_11047966	Ga0207704_110479662	123
578	3300025938	Ga0207704_11870339	Ga0207704_118703392	123
579	3300025939	Ga0207665_10001914	Ga0207665_1000191412	123
580	3300025939	Ga0207665_10139399	Ga0207665_101393992	123
581	3300025940	Ga0207691_10003057	Ga0207691_1000305715	123
582	3300025941	Ga0207711_10129591	Ga0207711_101295913	123
583	3300025941	Ga0207711_11979475	Ga0207711_119794751	123
584	3300025942	Ga0207689_10030514	Ga0207689_100305145	123
585	3300025944	Ga0207661_10038903	Ga0207661_100389033	123
586	3300025945	Ga0207679_10112200	Ga0207679_101122003	123
587	3300025949	Ga0207667_10330185	Ga0207667_103301852	123
588	3300025960	Ga0207651_10003634	Ga0207651_100036347	123
589	3300025960	Ga0207651_11745695	Ga0207651_117456952	123
590	3300025961	Ga0207712_10409358	Ga0207712_104093581	123
591	3300025961	Ga0207712_10471801	Ga0207712_104718012	123
592	3300025972	Ga0207668_10002585	Ga0207668_100025854	123
593	3300025972	Ga0207668_10038031	Ga0207668_100380312	123
594	3300025972	Ga0207668_10227946	Ga0207668_102279462	123
595	3300025972	Ga0207668_10318406	Ga0207668_103184063	123
596	3300025972	Ga0207668_10435224	Ga0207668_104352242	123
597	3300025972	Ga0207668_10699971	Ga0207668_106999711	123
598	3300025981	Ga0207640_10099381	Ga0207640_100993813	123
599	3300025986	Ga0207658_10036173	Ga0207658_100361734	123
600	3300025986	Ga0207658_10180187	Ga0207658_101801872	123
601	3300025986	Ga0207658_10283153	Ga0207658_102831532	123
602	3300026023	Ga0207677_10453621	Ga0207677_104536212	123
603	3300026035	Ga0207703_10032220	Ga0207703_100322205	123
604	3300026035	Ga0207703_10074968	Ga0207703_100749683	123
605	3300026035	Ga0207703_10926455	Ga0207703_109264552	123
606	3300026041	Ga0207639_10006015	Ga0207639_100060154	123
607	3300026041	Ga0207639_10762957	Ga0207639_107629572	123
608	3300026067	Ga0207678_10000713	Ga0207678_1000071312	123
609	3300026067	Ga0207678_10650294	Ga0207678_106502942	123
610	3300026075	Ga0207708_10013357	Ga0207708_100133574	123
611	3300026075	Ga0207708_10031718	Ga0207708_100317182	123
612	3300026078	Ga0207702_10337829	Ga0207702_103378292	123
613	3300026078	Ga0207702_11382333	Ga0207702_113823331	123
614	3300026088	Ga0207641_10021793	Ga0207641_100217935	123
615	3300026088	Ga0207641_10498914	Ga0207641_104989142	123
616	3300026089	Ga0207648_10016114	Ga0207648_100161144	123
617	3300026089	Ga0207648_10027714	Ga0207648_100277145	123
618	3300026089	Ga0207648_10713445	Ga0207648_107134452	123
619	3300026095	Ga0207676_10009201	Ga0207676_100092015	123
620	3300026095	Ga0207676_10313736	Ga0207676_103137362	123
621	3300026095	Ga0207676_10340417	Ga0207676_103404172	123
622	3300026116	Ga0207674_10003356	Ga0207674_1000335610	123
623	3300026118	Ga0207675_100000737	Ga0207675_10000073732	123
624	3300026118	Ga0207675_100038774	Ga0207675_1000387744	123
625	3300026118	Ga0207675_100310822	Ga0207675_1003108222	123
626	3300026118	Ga0207675_101346729	Ga0207675_1013467291	123
627	3300026121	Ga0207683_10001157	Ga0207683_100011573	123
628	3300026121	Ga0207683_10695299	Ga0207683_106952992	123
629	3300026142	Ga0207698_11419942	Ga0207698_114199422	123
630	3300027312	Ga0209371_1000037	Ga0209371_100003788	123
631	3300027666	Ga0209282_1000283	Ga0209282_10002837	123
632	3300027717	Ga0209998_10046994	Ga0209998_100469942	123
633	3300027907	Ga0207428_10092439	Ga0207428_100924392	123
634	3300027907	Ga0207428_10939355	Ga0207428_109393552	123
635	3300028379	Ga0268266_10015655	Ga0268266_100156552	123
636	3300028379	Ga0268266_10148689	Ga0268266_101486892	123
637	3300028379	Ga0268266_10206261	Ga0268266_102062612	123
638	3300028380	Ga0268265_10013228	Ga0268265_100132285	123
639	3300028380	Ga0268265_10861047	Ga0268265_108610472	123
640	3300028380	Ga0268265_11585848	Ga0268265_115858482	123
641	3300028380	Ga0268265_11591079	Ga0268265_115910792	123
642	3300028381	Ga0268264_10016088	Ga0268264_100160885	123
643	3300028381	Ga0268264_10561948	Ga0268264_105619482	123
644	3300028558	Ga0265326_10191054	Ga0265326_101910542	123
645	3300030500	Ga0268256_1000039	Ga0268256_1000039221	123
646	3300031548	Ga0307408_100088678	Ga0307408_1000886782	123
647	3300031548	Ga0307408_101614047	Ga0307408_1016140472	123
648	3300031595	Ga0265313_10087883	Ga0265313_100878832	123
649	3300031665	Ga0316575_10067100	Ga0316575_100671004	123
650	3300031691	Ga0316579_10015964	Ga0316579_100159642	123
651	3300031731	Ga0307405_11181405	Ga0307405_111814052	123
652	3300031852	Ga0307410_11467391	Ga0307410_114673912	123
653	3300031911	Ga0307412_11046151	Ga0307412_110461512	123
654	3300031995	Ga0307409_100180120	Ga0307409_1001801201	123
655	3300032002	Ga0307416_102436601	Ga0307416_1024366012	123
656	3300032137	Ga0316585_10011147	Ga0316585_100111472	123
657	3300032139	Ga0316580_10039032	Ga0316580_100390322	123
658	3300032168	Ga0316593_10047381	Ga0316593_100473812	123
659	3300033528	Ga0316588_1010782	Ga0316588_10107822	123
660	3300033541	Ga0316596_1054526	Ga0316596_10545262	123
661	3300034816	Ga0373930_0200497	Ga0373930_0200497_30_401	123
662	3300034818	Ga0373950_0007884	Ga0373950_0007884_918_1289	123
663	3300034957	Ga0373938_0105499	Ga0373938_0105499_114_485	123
664	3300035083	Ga0373926_0072495	Ga0373926_0072495_446_820	123
665	3300035084	Ga0373928_0025767	Ga0373928_0025767_749_1120	123
666	3300035084	Ga0373928_0133326	Ga0373928_0133326_225_599	123
667	3300035085	Ga0373929_0026560	Ga0373929_0026560_459_830	123
668	3300035089	Ga0373944_0086211	Ga0373944_0086211_200_574	123
669	3300035091	Ga0373951_0021909	Ga0373951_0021909_222_593	123
670	3300035114	Ga0373939_0007709	Ga0373939_0007709_322_693	123
671	3300035114	Ga0373939_0218120	Ga0373939_0218120_185_556	123
672	3300035115	Ga0373941_0032062	Ga0373941_0032062_783_1154	123
673	3300035121	Ga0373960_0008203	Ga0373960_0008203_211_582	123
674	3300035170	Ga0373943_0035525	Ga0373943_0035525_823_1197	123
675	3300035172	Ga0373955_0680572	Ga0373955_0680572_182_556	123
676	3300035207	Ga0373942_0215990	Ga0373942_0215990_127_498	123
677	3300035241	Ga0373961_0007966	Ga0373961_0007966_238_609	123
678	3300035242	Ga0373962_0021864	Ga0373962_0021864_538_909	123
679	3300035242	Ga0373962_0054070	Ga0373962_0054070_354_728	123
680	3300035398	Ga0316574_0134243	Ga0316574_0134243_348_722	123
681	3300035691	Ga0373931_0005310	Ga0373931_0005310_2639_3010	123
682	3300035691	Ga0373931_0134333	Ga0373931_0134333_268_642	123
683	3300035695	Ga0373927_0007119	Ga0373927_0007119_4419_4793	123
684	3300035724	Ga0373933_0539438	Ga0373933_0539438_364_738	123
685	3300036401	Ga0373937_0060093	Ga0373937_0060093_2698_3072	123
686	3300036401	Ga0373937_0100519	Ga0373937_0100519_1988_2362	123
687	3300036712	Ga0316584_0010954	Ga0316584_0010954_3048_3422	123
688	3300037068	Ga0373925_0015254	Ga0373925_0015254_1584_1958	123
689	3300037068	Ga0373925_0445652	Ga0373925_0445652_294_677	123
690	3300037418	Ga0395900_0126709	Ga0395900_0126709_2220_2597	123
691	3300037418	Ga0395900_1530040	Ga0395900_1530040_175_546	123
692	3300037466	Ga0395898_0070119	Ga0395898_0070119_361_738	123
693	3300037471	Ga0395905_0002416	Ga0395905_0002416_14261_14644	123
694	3300037471	Ga0395905_0004800	Ga0395905_0004800_10213_10590	123
695	3300037588	Ga0316581_0013248	Ga0316581_0013248_250_624	123
696	3300038443	Ga0395901_0009382	Ga0395901_0009382_5630_6007	123
697	3300038996	Ga0242420_076400	Ga0242420_076400_212_583	123
698	3300041404	Ga0439436_0014089	Ga0439436_0014089_671_1051	123
699	3300041404	Ga0439436_0033077	Ga0439436_0033077_678_1058	123
700	3300041413	Ga0439465_0008566	Ga0439465_0008566_2286_2666	123
701	3300041443	Ga0451789_0752798	Ga0451789_0752798_266_646	123
702	3300041494	Ga0451837_1751948	Ga0451837_1751948_255_635	123
703	3300041497	Ga0451840_04176	Ga0451840_04176_1164_1544	123
704	3300041501	Ga0451845_0007443	Ga0451845_0007443_396_776	123
705	3300041502	Ga0451846_27217	Ga0451846_27217_873_1253	123
706	3300041506	Ga0451850_30014	Ga0451850_30014_483_863	123
707	3300041507	Ga0451851_0866658	Ga0451851_0866658_123_503	123
708	3300041509	Ga0451843_0436542	Ga0451843_0436542_770_1150	123
709	3300041511	Ga0451855_0167070	Ga0451855_0167070_80_460	123
710	3300041511	Ga0451855_1087730	Ga0451855_1087730_80_460	123
711	3300041907	Ga0452268_52640	Ga0452268_52640_173_553	123
712	3300041916	Ga0452271_63270	Ga0452271_63270_552_932	123
713	3300042002	Ga0439442_020778	Ga0439442_020778_338_718	123
714	3300042006	Ga0439432_094439	Ga0439432_094439_196_576	123
715	3300042015	Ga0439462_0019330	Ga0439462_0019330_819_1199	123
716	3300042145	Ga0450906_038550	Ga0450906_038550_104_484	123
717	3300042146	Ga0450907_019460	Ga0450907_019460_441_821	123
718	3300042156	Ga0439446_0280508	Ga0439446_0280508_166_546	123
719	3300042435	Ga0439434_0043630	Ga0439434_0043630_578_958	123
720	3300042436	Ga0439435_0136590	Ga0439435_0136590_54_428	123
721	3300042461	Ga0439460_0034822	Ga0439460_0034822_103_477	123
722	3300044694	Ga0466963_0057534	Ga0466963_0057534_2108_2488	123
723	3300044706	Ga0466964_0061044	Ga0466964_0061044_451_831	123
724	3300044765	Ga0466970_0023346	Ga0466970_0023346_662_1042	123
725	3300044842	Ga0466957_0252756	Ga0466957_0252756_605_985	123
726	3300045049	Ga0466959_0276600	Ga0466959_0276600_163_543	123
727	3300045836	Ga0466958_0031431	Ga0466958_0031431_2171_2551	123
728	3300046455	Ga0495603_0001772	Ga0495603_0001772_6227_6601	123
729	3300046459	Ga0495629_0068282	Ga0495629_0068282_634_1008	123
730	3300046460	Ga0495638_0051177	Ga0495638_0051177_2184_2564	123
731	3300046460	Ga0495638_0069013	Ga0495638_0069013_1684_2064	123
732	3300046461	Ga0495641_0021588	Ga0495641_0021588_104_478	123
733	3300046462	Ga0495651_0392239	Ga0495651_0392239_190_564	123
734	3300046462	Ga0495651_0782726	Ga0495651_0782726_16_390	123
735	3300046471	Ga0495650_0041533	Ga0495650_0041533_562_942	123
736	3300046472	Ga0495580_0003171	Ga0495580_0003171_8130_8504	123
737	3300046473	Ga0495582_0042654	Ga0495582_0042654_1872_2246	123
738	3300046474	Ga0495605_0037125	Ga0495605_0037125_646_1026	123
739	3300046475	Ga0495639_0012412	Ga0495639_0012412_971_1345	123
740	3300046491	Ga0495584_0036460	Ga0495584_0036460_786_1160	123
741	3300046492	Ga0495585_0185418	Ga0495585_0185418_36_416	123
742	3300046499	Ga0495594_0001783	Ga0495594_0001783_6573_6947	123
743	3300046501	Ga0495607_0131841	Ga0495607_0131841_483_863	123
744	3300046506	Ga0495583_0054461	Ga0495583_0054461_912_1292	123
745	3300046506	Ga0495583_0158492	Ga0495583_0158492_224_598	123
746	3300046507	Ga0495606_0062227	Ga0495606_0062227_1435_1815	123
747	3300046512	Ga0495610_0038438	Ga0495610_0038438_849_1223	123
748	3300046512	Ga0495610_0124037	Ga0495610_0124037_335_715	123
749	3300046513	Ga0495616_0172887	Ga0495616_0172887_284_658	123
750	3300046514	Ga0495618_0433076	Ga0495618_0433076_92_466	123
751	3300046515	Ga0495620_0019875	Ga0495620_0019875_197_577	123
752	3300046517	Ga0495630_0334524	Ga0495630_0334524_118_492	123
753	3300046522	Ga0495643_0069570	Ga0495643_0069570_791_1171	123
754	3300046522	Ga0495643_0083782	Ga0495643_0083782_911_1291	123
755	3300046525	Ga0495663_0062945	Ga0495663_0062945_49_423	123
756	3300046525	Ga0495663_0084430	Ga0495663_0084430_264_638	123
757	3300046526	Ga0495666_0065052	Ga0495666_0065052_814_1188	123
758	3300046533	Ga0495640_0380312	Ga0495640_0380312_393_767	123
759	3300046536	Ga0495587_0179364	Ga0495587_0179364_790_1164	123
760	3300046542	Ga0495597_0062015	Ga0495597_0062015_787_1167	123
761	3300046557	Ga0495622_0010178	Ga0495622_0010178_3123_3497	123
762	3300046558	Ga0495633_0075615	Ga0495633_0075615_208_588	123
763	3300046559	Ga0495667_0119527	Ga0495667_0119527_1142_1516	123
764	3300046559	Ga0495667_0172307	Ga0495667_0172307_1000_1374	123
765	3300046615	Ga0495656_0151638	Ga0495656_0151638_364_744	123
766	3300046616	Ga0495668_0145854	Ga0495668_0145854_201_575	123
767	3300046616	Ga0495668_0428521	Ga0495668_0428521_176_556	123
768	3300046642	Ga0495634_0021144	Ga0495634_0021144_1295_1669	123
769	3300046642	Ga0495634_0334891	Ga0495634_0334891_466_840	123
770	3300046660	Ga0495625_0182287	Ga0495625_0182287_592_972	123
771	3300046663	Ga0495635_0163203	Ga0495635_0163203_572_946	123
772	3300046674	Ga0495588_0000643	Ga0495588_0000643_871_1251	123
773	3300046674	Ga0495588_0021234	Ga0495588_0021234_2748_3122	123
774	3300046683	Ga0495658_0002983	Ga0495658_0002983_753_1127	123
775	3300046684	Ga0495669_0323774	Ga0495669_0323774_304_678	123
776	3300046689	Ga0495613_0001403	Ga0495613_0001403_6606_6980	123
777	3300046691	Ga0495670_0028226	Ga0495670_0028226_531_911	123
778	3300046692	Ga0495671_0130316	Ga0495671_0130316_471_851	123
779	3300046692	Ga0495671_0195091	Ga0495671_0195091_275_655	123
780	3300046694	Ga0495649_0152342	Ga0495649_0152342_578_952	123
781	3300046694	Ga0495649_0458290	Ga0495649_0458290_64_444	123
782	3300046810	Ga0495660_0100952	Ga0495660_0100952_540_920	123
783	3300047315	Ga0495581_0009747	Ga0495581_0009747_3807_4181	123
784	3300047318	Ga0495636_0083962	Ga0495636_0083962_541_921	123
785	3300047321	Ga0495676_0049130	Ga0495676_0049130_1024_1398	123
786	3300047322	Ga0495680_0042838	Ga0495680_0042838_478_852	123
787	3300047322	Ga0495680_0155173	Ga0495680_0155173_440_814	123
788	3300047443	Ga0495687_024792	Ga0495687_024792_791_1165	123
789	3300047470	Ga0495681_0013196	Ga0495681_0013196_1777_2157	123
790	3300047470	Ga0495681_0088867	Ga0495681_0088867_390_770	123
791	3300047470	Ga0495681_0178441	Ga0495681_0178441_157_537	123
792	3300047472	Ga0495686_0039215	Ga0495686_0039215_831_1211	123
793	3300047673	Ga0495593_0000485	Ga0495593_0000485_18992_19366	123
794	3300048089	Ga0495614_0013112	Ga0495614_0013112_2890_3264	123
795	3300048090	Ga0495615_0032759	Ga0495615_0032759_298_678	123
796	3300048903	Ga0496100_0039596	Ga0496100_0039596_541_912	123
797	3300048903	Ga0496100_0519826	Ga0496100_0519826_510_884	123
798	3300048904	Ga0496101_0002407	Ga0496101_0002407_7927_8298	123
799	3300048904	Ga0496101_0047111	Ga0496101_0047111_1100_1474	123
800	3300048904	Ga0496101_0103744	Ga0496101_0103744_950_1321	123
801	3300048904	Ga0496101_0501418	Ga0496101_0501418_218_592	123
802	3300048904	Ga0496101_0687171	Ga0496101_0687171_222_596	123
803	3300048905	Ga0496102_0056670	Ga0496102_0056670_2966_3337	123
804	3300048905	Ga0496102_0166532	Ga0496102_0166532_1278_1652	123
805	3300048905	Ga0496102_0278015	Ga0496102_0278015_656_1030	123
806	3300048905	Ga0496102_0712722	Ga0496102_0712722_497_871	123
807	3300048906	Ga0496103_0080051	Ga0496103_0080051_1404_1778	123
808	3300048906	Ga0496103_0272638	Ga0496103_0272638_239_610	123
809	3300048906	Ga0496103_0281195	Ga0496103_0281195_384_758	123
810	3300048907	Ga0496104_0029777	Ga0496104_0029777_3634_4005	123
811	3300048907	Ga0496104_0049983	Ga0496104_0049983_3002_3373	123
812	3300048907	Ga0496104_0057801	Ga0496104_0057801_1561_1935	123
813	3300048907	Ga0496104_0070681	Ga0496104_0070681_2112_2486	123
814	3300048907	Ga0496104_0262609	Ga0496104_0262609_690_1064	123
815	3300048907	Ga0496104_0623124	Ga0496104_0623124_411_785	123
816	3300048908	Ga0496105_0011421	Ga0496105_0011421_1960_2331	123
817	3300048908	Ga0496105_0026949	Ga0496105_0026949_3288_3659	123
818	3300048908	Ga0496105_0100918	Ga0496105_0100918_1293_1667	123
819	3300048908	Ga0496105_0346220	Ga0496105_0346220_49_423	123
820	3300048908	Ga0496105_0920161	Ga0496105_0920161_169_543	123
821	3300048909	Ga0496106_0017822	Ga0496106_0017822_339_710	123
822	3300048909	Ga0496106_0159652	Ga0496106_0159652_729_1100	123
823	3300048909	Ga0496106_0370738	Ga0496106_0370738_261_635	123
824	3300048909	Ga0496106_0470871	Ga0496106_0470871_371_745	123
825	3300048910	Ga0496107_0001358	Ga0496107_0001358_11602_11973	123
826	3300048910	Ga0496107_0083569	Ga0496107_0083569_1242_1616	123
827	3300048910	Ga0496107_0101018	Ga0496107_0101018_482_856	123
828	3300048910	Ga0496107_0119095	Ga0496107_0119095_1528_1902	123
829	3300048910	Ga0496107_0187464	Ga0496107_0187464_437_808	123
830	3300048910	Ga0496107_0339655	Ga0496107_0339655_735_1106	123
831	3300048911	Ga0496108_0024853	Ga0496108_0024853_3833_4204	123
832	3300048911	Ga0496108_0562218	Ga0496108_0562218_527_904	123
833	3300048911	Ga0496108_0706282	Ga0496108_0706282_61_432	123
834	3300048911	Ga0496108_0784273	Ga0496108_0784273_43_417	123
835	3300048912	Ga0496109_0135009	Ga0496109_0135009_1118_1492	123
836	3300048912	Ga0496109_0183260	Ga0496109_0183260_1004_1375	123
837	3300048912	Ga0496109_0220706	Ga0496109_0220706_683_1054	123
838	3300048912	Ga0496109_0232801	Ga0496109_0232801_1051_1425	123
839	3300048912	Ga0496109_0789677	Ga0496109_0789677_175_546	123
840	3300048912	Ga0496109_1281753	Ga0496109_1281753_110_484	123
841	3300048913	Ga0496110_0045215	Ga0496110_0045215_2748_3119	123
842	3300048913	Ga0496110_0990220	Ga0496110_0990220_198_572	123
843	3300048914	Ga0496111_0058009	Ga0496111_0058009_1996_2367	123
844	3300048914	Ga0496111_0211468	Ga0496111_0211468_387_758	123
845	3300048914	Ga0496111_0680613	Ga0496111_0680613_285_659	123
846	3300048915	Ga0496112_0044007	Ga0496112_0044007_2965_3339	123
847	3300048915	Ga0496112_0342140	Ga0496112_0342140_707_1078	123
848	3300048916	Ga0496113_0078149	Ga0496113_0078149_1724_2095	123
849	3300048916	Ga0496113_0273158	Ga0496113_0273158_610_984	123
850	3300048916	Ga0496113_0329173	Ga0496113_0329173_685_1056	123
851	3300048916	Ga0496113_0582740	Ga0496113_0582740_505_879	123
852	3300048917	Ga0496114_0022516	Ga0496114_0022516_578_949	123
853	3300048917	Ga0496114_0056058	Ga0496114_0056058_534_905	123
854	3300048917	Ga0496114_0237826	Ga0496114_0237826_877_1260	123
855	3300048917	Ga0496114_0257287	Ga0496114_0257287_709_1083	123
856	3300048918	Ga0496115_0048102	Ga0496115_0048102_535_906	123
857	3300048918	Ga0496115_0196313	Ga0496115_0196313_951_1325	123
858	3300048918	Ga0496115_0228021	Ga0496115_0228021_729_1100	123
859	3300048918	Ga0496115_0246995	Ga0496115_0246995_413_787	123
860	3300048918	Ga0496115_0629598	Ga0496115_0629598_209_592	123
861	3300048918	Ga0496115_0736178	Ga0496115_0736178_98_472	123
862	3300048919	Ga0496116_0046812	Ga0496116_0046812_461_835	123
863	3300048919	Ga0496116_0114632	Ga0496116_0114632_534_914	123
864	3300048920	Ga0496117_0017870	Ga0496117_0017870_703_1083	123
865	3300048921	Ga0496118_0097827	Ga0496118_0097827_1312_1692	123
866	3300048922	Ga0496119_0010694	Ga0496119_0010694_482_856	123
867	3300048922	Ga0496119_0148172	Ga0496119_0148172_283_654	123
868	3300048924	Ga0496121_0145426	Ga0496121_0145426_1146_1520	123
869	3300048927	Ga0496124_0059610	Ga0496124_0059610_854_1234	123
870	3300048928	Ga0496125_0014218	Ga0496125_0014218_2729_3103	123
871	3300048928	Ga0496125_0108719	Ga0496125_0108719_768_1148	123
872	3300049568	Ga0501031_0024005	Ga0501031_0024005_3572_3946	123
873	3300049568	Ga0501031_0027698	Ga0501031_0027698_2397_2777	123
874	3300049568	Ga0501031_0069791	Ga0501031_0069791_784_1155	123
875	3300049568	Ga0501031_0070029	Ga0501031_0070029_668_1051	123
876	3300049569	Ga0501032_0027773	Ga0501032_0027773_625_1008	123
877	3300049569	Ga0501032_0148822	Ga0501032_0148822_1021_1401	123
878	3300049569	Ga0501032_0312312	Ga0501032_0312312_41_415	123
879	3300049569	Ga0501032_0350931	Ga0501032_0350931_511_891	123
880	3300049570	Ga0501033_0013646	Ga0501033_0013646_2920_3303	123
881	3300049570	Ga0501033_0179009	Ga0501033_0179009_1019_1399	123
882	3300049570	Ga0501033_0207317	Ga0501033_0207317_980_1351	123
883	3300049570	Ga0501033_0474085	Ga0501033_0474085_232_606	123
884	3300049571	Ga0501034_0052171	Ga0501034_0052171_1966_2346	123
885	3300049571	Ga0501034_0144297	Ga0501034_0144297_625_1008	123
886	3300049572	Ga0501036_0057353	Ga0501036_0057353_2712_3086	123
887	3300049572	Ga0501036_0171057	Ga0501036_0171057_625_1008	123
888	3300049572	Ga0501036_1386693	Ga0501036_1386693_86_541	123
889	3300049573	Ga0501037_0021088	Ga0501037_0021088_625_1008	123
890	3300049573	Ga0501037_0056639	Ga0501037_0056639_1947_2327	123
891	3300049573	Ga0501037_0223778	Ga0501037_0223778_274_648	123
892	3300049573	Ga0501037_0371693	Ga0501037_0371693_87_461	123
893	3300049573	Ga0501037_0559338	Ga0501037_0559338_82_456	123
894	3300049574	Ga0501038_0118169	Ga0501038_0118169_1086_1466	123
895	3300049574	Ga0501038_0172037	Ga0501038_0172037_702_1085	123
896	3300049574	Ga0501038_0219776	Ga0501038_0219776_750_1121	123
897	3300049574	Ga0501038_0326874	Ga0501038_0326874_464_838	123
898	3300049574	Ga0501038_0364532	Ga0501038_0364532_716_1087	123
899	3300049574	Ga0501038_0533711	Ga0501038_0533711_29_403	123
900	3300049575	Ga0501039_0043064	Ga0501039_0043064_1118_1489	123
901	3300049575	Ga0501039_0087768	Ga0501039_0087768_1763_2137	123
902	3300049575	Ga0501039_0107925	Ga0501039_0107925_1168_1551	123
903	3300049575	Ga0501039_0144550	Ga0501039_0144550_1042_1413	123
904	3300049575	Ga0501039_0196150	Ga0501039_0196150_398_772	123
905	3300049575	Ga0501039_1170823	Ga0501039_1170823_100_474	123
906	3300049576	Ga0501040_0004960	Ga0501040_0004960_86_460	123
907	3300049576	Ga0501040_0087631	Ga0501040_0087631_549_920	123
908	3300049576	Ga0501040_0155820	Ga0501040_0155820_637_1008	123
909	3300049576	Ga0501040_0173783	Ga0501040_0173783_345_728	123
910	3300049576	Ga0501040_0275546	Ga0501040_0275546_461_835	123
911	3300049576	Ga0501040_0980410	Ga0501040_0980410_125_496	123
912	3300049577	Ga0501041_0010987	Ga0501041_0010987_3550_3921	123
913	3300049577	Ga0501041_0107518	Ga0501041_0107518_879_1250	123
914	3300049577	Ga0501041_0223159	Ga0501041_0223159_737_1111	123
915	3300049577	Ga0501041_0628695	Ga0501041_0628695_50_424	123
916	3300049578	Ga0501042_0027801	Ga0501042_0027801_3218_3589	123
917	3300049578	Ga0501042_0035803	Ga0501042_0035803_554_937	123
918	3300049578	Ga0501042_0043419	Ga0501042_0043419_199_573	123
919	3300049578	Ga0501042_0061145	Ga0501042_0061145_208_579	123
920	3300049578	Ga0501042_0369653	Ga0501042_0369653_117_491	123
921	3300049578	Ga0501042_0996738	Ga0501042_0996738_11_385	123
922	3300049579	Ga0501043_0127756	Ga0501043_0127756_95_469	123
923	3300049579	Ga0501043_0161009	Ga0501043_0161009_746_1129	123
924	3300049579	Ga0501043_0334818	Ga0501043_0334818_522_893	123
925	3300049580	Ga0501046_0015269	Ga0501046_0015269_2488_2871	123
926	3300049580	Ga0501046_0019945	Ga0501046_0019945_484_855	123
927	3300049580	Ga0501046_0031563	Ga0501046_0031563_3244_3615	123
928	3300049580	Ga0501046_0238214	Ga0501046_0238214_825_1205	123
929	3300049580	Ga0501046_0293165	Ga0501046_0293165_331_705	123
930	3300049580	Ga0501046_1040117	Ga0501046_1040117_14_388	123
931	3300049581	Ga0501047_0035547	Ga0501047_0035547_625_1008	123
932	3300049581	Ga0501047_0078900	Ga0501047_0078900_625_1005	123
933	3300049582	Ga0501048_0012783	Ga0501048_0012783_1259_1642	123
934	3300049582	Ga0501048_0030744	Ga0501048_0030744_3316_3687	123
935	3300049582	Ga0501048_0098012	Ga0501048_0098012_1171_1542	123
936	3300049582	Ga0501048_0118261	Ga0501048_0118261_1132_1506	123
937	3300049582	Ga0501048_0213222	Ga0501048_0213222_184_558	123
938	3300049583	Ga0501067_0098466	Ga0501067_0098466_586_969	123
939	3300049583	Ga0501067_0169244	Ga0501067_0169244_10_381	123
940	3300049584	Ga0501068_0027086	Ga0501068_0027086_843_1226	123
941	3300049584	Ga0501068_0200028	Ga0501068_0200028_274_648	123
942	3300049584	Ga0501068_0283349	Ga0501068_0283349_626_1021	123
943	3300049584	Ga0501068_0490917	Ga0501068_0490917_327_701	123
944	3300049584	Ga0501068_0807258	Ga0501068_0807258_32_406	123
945	3300049585	Ga0501069_0228398	Ga0501069_0228398_442_825	123
946	3300049585	Ga0501069_0406921	Ga0501069_0406921_391_762	123
947	3300049586	Ga0501070_0038589	Ga0501070_0038589_1115_1498	123
948	3300049586	Ga0501070_0157356	Ga0501070_0157356_10_405	123
949	3300049586	Ga0501070_0344002	Ga0501070_0344002_222_596	123
950	3300049587	Ga0501071_0007570	Ga0501071_0007570_5227_5601	123
951	3300049587	Ga0501071_0045768	Ga0501071_0045768_771_1142	123
952	3300049587	Ga0501071_0122599	Ga0501071_0122599_767_1150	123
953	3300049587	Ga0501071_0327531	Ga0501071_0327531_428_799	123
954	3300049587	Ga0501071_0605637	Ga0501071_0605637_92_466	123
955	3300049588	Ga0501072_0052692	Ga0501072_0052692_2150_2521	123
956	3300049588	Ga0501072_0145596	Ga0501072_0145596_1094_1468	123
957	3300049588	Ga0501072_0190375	Ga0501072_0190375_429_812	123
958	3300049588	Ga0501072_0559433	Ga0501072_0559433_55_426	123
959	3300049588	Ga0501072_0681837	Ga0501072_0681837_42_416	123
960	3300049589	Ga0501073_0014826	Ga0501073_0014826_947_1330	123
961	3300049589	Ga0501073_0234421	Ga0501073_0234421_611_985	123
962	3300049589	Ga0501073_0274601	Ga0501073_0274601_226_606	123
963	3300049589	Ga0501073_0786556	Ga0501073_0786556_73_447	123
964	3300049590	Ga0501074_0019437	Ga0501074_0019437_1464_1847	123
965	3300049590	Ga0501074_0192522	Ga0501074_0192522_211_585	123
966	3300049590	Ga0501074_0383474	Ga0501074_0383474_80_451	123
967	3300049591	Ga0501075_0006472	Ga0501075_0006472_2652_3023	123
968	3300049591	Ga0501075_0218839	Ga0501075_0218839_833_1207	123
969	3300049591	Ga0501075_0497357	Ga0501075_0497357_480_863	123
970	3300049591	Ga0501075_0527233	Ga0501075_0527233_135_509	123
971	3300049591	Ga0501075_0586295	Ga0501075_0586295_64_438	123
972	3300049591	Ga0501075_0841331	Ga0501075_0841331_82_456	123
973	3300049592	Ga0501076_0023982	Ga0501076_0023982_781_1152	123
974	3300049592	Ga0501076_0072173	Ga0501076_0072173_253_627	123
975	3300049592	Ga0501076_0146137	Ga0501076_0146137_391_762	123
976	3300049592	Ga0501076_0164282	Ga0501076_0164282_1140_1514	123
977	3300049592	Ga0501076_0529683	Ga0501076_0529683_146_520	123
978	3300049592	Ga0501076_0571246	Ga0501076_0571246_330_701	123
979	3300049592	Ga0501076_0656410	Ga0501076_0656410_237_620	123
980	3300049592	Ga0501076_0970258	Ga0501076_0970258_124_495	123
981	3300049593	Ga0501077_0000799	Ga0501077_0000799_2119_2493	123
982	3300049593	Ga0501077_0012746	Ga0501077_0012746_267_641	123
983	3300049593	Ga0501077_0055028	Ga0501077_0055028_1678_2052	123
984	3300049593	Ga0501077_0188210	Ga0501077_0188210_271_642	123
985	3300049593	Ga0501077_0208998	Ga0501077_0208998_404_775	123
986	3300049593	Ga0501077_0437117	Ga0501077_0437117_396_770	123
987	3300049593	Ga0501077_0528688	Ga0501077_0528688_85_456	123
988	3300049664	Ga0501224_065989	Ga0501224_065989_109_489	123
989	3300049705	Ga0501225_0144555	Ga0501225_0144555_224_598	123
990	3300049741	Ga0501079_0010994	Ga0501079_0010994_259_630	123
991	3300049741	Ga0501079_0229217	Ga0501079_0229217_537_908	123
992	3300049741	Ga0501079_0270049	Ga0501079_0270049_410_784	123
993	3300049741	Ga0501079_0422049	Ga0501079_0422049_622_1005	123
994	3300049741	Ga0501079_0834892	Ga0501079_0834892_146_520	123
995	3300049741	Ga0501079_1119025	Ga0501079_1119025_22_396	123
996	3300049742	Ga0501080_0002809	Ga0501080_0002809_10730_11113	123
997	3300049742	Ga0501080_0111896	Ga0501080_0111896_482_856	123
998	3300049742	Ga0501080_0148538	Ga0501080_0148538_392_766	123
999	3300049742	Ga0501080_0264867	Ga0501080_0264867_350_721	123
1000	3300049742	Ga0501080_0301855	Ga0501080_0301855_870_1241	123
1001	3300049742	Ga0501080_0364119	Ga0501080_0364119_847_1221	123
1002	3300049743	Ga0501081_0006091	Ga0501081_0006091_2801_3172	123
1003	3300049743	Ga0501081_0008934	Ga0501081_0008934_1525_1896	123
1004	3300049743	Ga0501081_0060246	Ga0501081_0060246_403_777	123
1005	3300049743	Ga0501081_0069603	Ga0501081_0069603_323_697	123
1006	3300049743	Ga0501081_0160373	Ga0501081_0160373_385_759	123
1007	3300049744	Ga0501083_0040593	Ga0501083_0040593_1930_2310	123
1008	3300049744	Ga0501083_0083209	Ga0501083_0083209_971_1354	123
1009	3300049744	Ga0501083_0513722	Ga0501083_0513722_306_680	123
1010	3300049776	Ga0501280_001760	Ga0501280_001760_2546_2926	123
1011	3300049778	Ga0501282_006444	Ga0501282_006444_420_800	123
1012	3300049822	Ga0501035_0030791	Ga0501035_0030791_702_1085	123
1013	3300049822	Ga0501035_0098791	Ga0501035_0098791_1842_2216	123
1014	3300049822	Ga0501035_0101862	Ga0501035_0101862_1232_1612	123
1015	3300049822	Ga0501035_0343524	Ga0501035_0343524_656_1036	123
1016	3300049822	Ga0501035_0574640	Ga0501035_0574640_532_903	123
1017	3300049822	Ga0501035_1106125	Ga0501035_1106125_16_387	123
1018	3300049823	Ga0501044_0041132	Ga0501044_0041132_3806_4189	123
1019	3300049823	Ga0501044_0217206	Ga0501044_0217206_205_579	123
1020	3300049823	Ga0501044_0529205	Ga0501044_0529205_125_496	123
1021	3300049824	Ga0501045_0007497	Ga0501045_0007497_5021_5404	123
1022	3300049824	Ga0501045_0017322	Ga0501045_0017322_2965_3336	123
1023	3300049824	Ga0501045_0034733	Ga0501045_0034733_879_1250	123
1024	3300049824	Ga0501045_0077756	Ga0501045_0077756_26_400	123
1025	3300049824	Ga0501045_0169080	Ga0501045_0169080_836_1210	123
1026	3300049824	Ga0501045_1089312	Ga0501045_1089312_83_457	123
1027	3300050489	nmdc:mga03683_49273_c1	nmdc:mga03683_49273_c1_1218_1598	123
1028	3300050490	nmdc:mga03n38_131231_c1	nmdc:mga03n38_131231_c1_55_435	123
1029	3300050491	nmdc:mga00v17_302357_c1	nmdc:mga00v17_302357_c1_70_450	123
1030	3300050492	nmdc:mga0yw44_105992_c1	nmdc:mga0yw44_105992_c1_861_1241	123
1031	3300050493	nmdc:mga0k408_134283_c1	nmdc:mga0k408_134283_c1_796_1176	123
1032	3300050494	nmdc:mga06z11_103300_c1	nmdc:mga06z11_103300_c1_31_411	123
1033	3300050496	nmdc:mga07m45_218835_c1	nmdc:mga07m45_218835_c1_48_428	123
1034	3300050496	nmdc:mga07m45_465551_c1	nmdc:mga07m45_465551_c1_306_686	123
1035	3300050507	nmdc:mga05p37_65356_c1	nmdc:mga05p37_65356_c1_461_835	123
1036	3300050507	nmdc:mga05p37_916593_c1	nmdc:mga05p37_916593_c1_186_557	123
1037	3300050508	nmdc:mga09592_151598_c1	nmdc:mga09592_151598_c1_564_935	123
1038	3300050508	nmdc:mga09592_866246_c1	nmdc:mga09592_866246_c1_47_421	123
1039	3300050509	nmdc:mga0qj67_405377_c1	nmdc:mga0qj67_405377_c1_313_684	123
1040	3300050509	nmdc:mga0qj67_635793_c1	nmdc:mga0qj67_635793_c1_447_821	123
1041	3300050510	nmdc:mga06r32_153587_c1	nmdc:mga06r32_153587_c1_316_687	123
1042	3300050510	nmdc:mga06r32_480203_c1	nmdc:mga06r32_480203_c1_296_670	123
1043	3300050511	nmdc:mga08y16_617345_c1	nmdc:mga08y16_617345_c1_181_555	123
1044	3300050512	nmdc:mga0n895_29298_c1	nmdc:mga0n895_29298_c1_3333_3704	123
1045	3300050512	nmdc:mga0n895_625022_c1	nmdc:mga0n895_625022_c1_553_927	123
1046	3300050513	nmdc:mga0rr50_213813_c1	nmdc:mga0rr50_213813_c1_238_609	123
1047	3300050514	nmdc:mga08x19_53829_c1	nmdc:mga08x19_53829_c1_1906_2277	123
1048	3300050515	nmdc:mga0a205_147705_c1	nmdc:mga0a205_147705_c1_339_713	123
1049	3300050515	nmdc:mga0a205_79293_c1	nmdc:mga0a205_79293_c1_1657_2028	123
1050	3300050516	nmdc:mga0sz30_18140_c1	nmdc:mga0sz30_18140_c1_1630_2010	123
1051	3300050516	nmdc:mga0sz30_32740_c1	nmdc:mga0sz30_32740_c1_305_685	123
1052	3300050516	nmdc:mga0sz30_63064_c1	nmdc:mga0sz30_63064_c1_537_917	123
1053	3300053077	Ga0495601_0014670	Ga0495601_0014670_4044_4418	123
1054	3300053077	Ga0495601_0201900	Ga0495601_0201900_743_1117	123
1055	3300053078	Ga0495612_0059173	Ga0495612_0059173_790_1164	123
1056	3300053083	Ga0495655_0000929	Ga0495655_0000929_1074_1448	123
1057	3300053083	Ga0495655_0125202	Ga0495655_0125202_169_549	123
1058	3300053084	Ga0495595_0133204	Ga0495595_0133204_292_666	123
1059	3300053085	Ga0495619_0005161	Ga0495619_0005161_6161_6535	123
1060	3300053085	Ga0495619_0024417	Ga0495619_0024417_2684_3058	123
1061	3300053086	Ga0500578_0143727	Ga0500578_0143727_635_1015	123
1062	3300053107	Ga0500560_039064	Ga0500560_039064_314_694	123
1063	3300053109	Ga0500569_007712	Ga0500569_007712_1574_1954	123
1064	3300053109	Ga0500569_180721	Ga0500569_180721_24_404	123
1065	3300053118	Ga0500594_0009824	Ga0500594_0009824_901_1281	123
1066	3300053134	Ga0500658_0008278	Ga0500658_0008278_2523_2903	123
1067	3300053152	Ga0500606_165687	Ga0500606_165687_220_600	123
1068	3300053153	Ga0500616_0051370	Ga0500616_0051370_1203_1583	123
1069	3300053156	Ga0500622_0001966	Ga0500622_0001966_857_1231	123
1070	3300053157	Ga0500624_000741	Ga0500624_000741_6698_7078	123
1071	3300053158	Ga0500627_0213346	Ga0500627_0213346_89_469	123
1072	3300053161	Ga0500634_0093330	Ga0500634_0093330_281_661	123
1073	3300054114	Ga0501084_0006692	Ga0501084_0006692_7264_7635	123
1074	3300054114	Ga0501084_0058709	Ga0501084_0058709_2353_2727	123
1075	3300054114	Ga0501084_0163986	Ga0501084_0163986_1123_1497	123
1076	3300054114	Ga0501084_0212658	Ga0501084_0212658_754_1125	123
1077	3300054114	Ga0501084_0318144	Ga0501084_0318144_860_1234	123
1078	3300054114	Ga0501084_0331195	Ga0501084_0331195_680_1054	123
1079	3300054114	Ga0501084_0940953	Ga0501084_0940953_130_504	123
1080	3300059491	Ga0587070_018695	Ga0587070_018695_492_872	123
1081	3300059503	Ga0587080_019117	Ga0587080_019117_472_852	123
1082	3300059504	Ga0587082_156312	Ga0587082_156312_22_402	123
1083	3300059505	Ga0587083_0018824	Ga0587083_0018824_394_774	123
1084	3300059604	Ga0587098_035589	Ga0587098_035589_82_462	123
1085	3300059605	Ga0587106_009052	Ga0587106_009052_626_1006	123
1086	3300059641	Ga0587068_009375	Ga0587068_009375_784_1164	123
1087	3300059641	Ga0587068_022656	Ga0587068_022656_476_856	123
1088	3300059643	Ga0587072_039714	Ga0587072_039714_198_578	123
1089	3300059649	Ga0587102_022652	Ga0587102_022652_57_437	123
1090	3300060344	Ga0587071_022486	Ga0587071_022486_475_855	123
1091	3300060344	Ga0587071_137479	Ga0587071_137479_75_458	123
1092	3300060346	Ga0587111_0178200	Ga0587111_0178200_158_541	123
1093	3300060353	Ga0501082_0008964	Ga0501082_0008964_1228_1599	123
1094	3300060353	Ga0501082_0024084	Ga0501082_0024084_2046_2420	123
1095	3300060353	Ga0501082_0081064	Ga0501082_0081064_448_822	123
1096	3300060353	Ga0501082_0514923	Ga0501082_0514923_300_674	123
1097	3300060353	Ga0501082_0541104	Ga0501082_0541104_412_783	123
1098	3300060353	Ga0501082_0547904	Ga0501082_0547904_147_518	123
1099	3300060353	Ga0501082_0925362	Ga0501082_0925362_370_744	123
1100	3300060353	Ga0501082_1077468	Ga0501082_1077468_188_562	123
1101	3300060353	Ga0501082_1414441	Ga0501082_1414441_154_525	123
1102	3300061719	Ga0466962_0090810	Ga0466962_0090810_220_600	123
1103	3300061734	Ga0530510_0096539	Ga0530510_0096539_350_721	123
1104	3300061734	Ga0530510_0390345	Ga0530510_0390345_376_750	123
1105	3300061734	Ga0530510_0636915	Ga0530510_0636915_24_398	123

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01127

Sdh_cyt

Succinate dehydrogenase/Fumarate reductase transmembrane subunit

2

119

0.81 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
2wu5-assembly1.cif.gz_H	crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhd his71met mutant	0.8454	17	118
7jz2-assembly1.cif.gz_D	succinate: quinone oxidoreductase sqr from e.coli k12	0.842	20	123
2acz-assembly1.cif.gz_D	complex ii (succinate dehydrogenase) from e. coli with atpenin a5 inhibitor co-crystallized at the ubiquinone binding site	0.8397	20	123
2wdq-assembly3.cif.gz_H	e. coli succinate:quinone oxidoreductase (sqr) with carboxin bound	0.8349	17	123
2wdq-assembly3.cif.gz_H	e. coli succinate:quinone oxidoreductase (sqr) with carboxin bound	0.8208	17	123

ID	Description	Score	Start	End	Superfamily
2wu5L00	Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit	0.8454	17	118	1.20.1300.10
2aczD01	Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit	0.8403	17	123	1.20.1300.10
2aczD01	Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit	0.8262	17	123	1.20.1300.10
2wu5L00	Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit	0.8171	17	118	1.20.1300.10
af_P0AC44_1_115_1.20.1300.10	Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit	0.8055	1	118	1.20.1300.10

ID	Description	Score	Start	End	GO Terms
AF-N1MLY3-F1-model_v4	Succinate dehydrogenase hydrophobic membrane anchor subunit	0.9846	20	123	GO:0006099 GO:0016020 GO:0020037 GO:0046872
AF-A0A1F3AMD6-F1-model_v4	Succinate dehydrogenase hydrophobic membrane anchor subunit	0.9821	17	120	GO:0006099 GO:0016020 GO:0020037 GO:0046872
AF-A0A537NV84-F1-model_v4	Succinate dehydrogenase, hydrophobic membrane anchor protein	0.9779	30	123	GO:0006099 GO:0016020 GO:0020037
AF-A0A2E4I3Q9-F1-model_v4	Succinate dehydrogenase hydrophobic membrane anchor subunit	0.9772	24	120	GO:0006099 GO:0016020 GO:0020037 GO:0046872
AF-U5T778-F1-model_v4	Succinate dehydrogenase hydrophobic membrane anchor subunit	0.9693	24	123	GO:0006099 GO:0016020 GO:0020037 GO:0046872

Feature Viewer

pLDDT	pTM	Quality
89.3	0.76	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F490144

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01127

Sdh_cyt

Succinate dehydrogenase/Fumarate reductase transmembrane subunit

2

119

0.81

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map