F490146
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1106 | 299 | 2212 | 96 |
Family's Representative Sequence
| Representative Sequence | 3300005844|Ga0068862_100530265|Ga0068862_1005302652 |
| Length | 112 |
| Sequence | LLILNLIRRTDRKIRIEVFKDLDPILHSQLRLAVMSLLISVKEAEFTFLKEKTNSTAGNLSVQIQKLKEAGYIEVTKQFKDNYPQTICKITSAGIKAFEEYVKNLQAYLTQK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 2 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 3 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 4 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 75 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 81 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 82 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 83 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 177 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 181 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 182 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 183 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 184 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 185 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 186 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 187 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 188 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 189 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 190 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 191 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 192 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 193 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 194 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 195 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 196 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 197 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 198 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 199 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 200 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 202 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 203 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 204 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 205 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 206 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 207 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 208 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 209 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 210 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 211 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 212 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 213 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 214 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 215 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 216 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 217 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 218 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 219 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 220 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 221 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 222 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 223 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 224 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 225 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 226 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 227 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 228 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 229 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 230 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 231 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 232 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 233 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 260 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 262 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 263 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 264 | 3300049525 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control | Metagenome | Rhizosphere |
| 265 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 272 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 273 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 274 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 275 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 276 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 279 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 284 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 285 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 286 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 287 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 288 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 289 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 290 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 291 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 292 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 293 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 294 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 295 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 296 | 2883068021 | Chitinophaga rhizosphaerae T16R-86 | Isolate | Rhizosphere |
| 297 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 298 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 299 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.46 |
| Metatranscriptomes | 0.09 |
| Isolates | 0.45 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.45 |
| Nodule | 0 |
| Rhizoplane | 1.08 |
| Rhizosphere | 95.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 18.35 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068862_100530265 | 3300005844 | Unclassified | 1122 |
| 2 | SwRhRL3b_contig_2918446 | 2162886006 | Unclassified | 1045 |
| 3 | JGI24744J21845_10026421 | 3300002077 | Bacteria | 1127 |
| 4 | rootH1_10028407 | 3300003316 | Bacteria | 7989 |
| 5 | rootH1_10141854 | 3300003316 | Bacteria | 3532 |
| 6 | rootH2_10001899 | 3300003320 | Bacteria | 96630 |
| 7 | rootH2_10020140 | 3300003320 | Bacteria | 1784 |
| 8 | rootH2_10040793 | 3300003320 | Bacteria | 5486 |
| 9 | rootH2_10136990 | 3300003320 | Bacteria | 4134 |
| 10 | rootH2_10295585 | 3300003320 | Bacteria | 1442 |
| 11 | rootH1_10153867 | 3300003323 | Bacteria | 2124 |
| 12 | rootH1_10173844 | 3300003323 | Bacteria | 1652 |
| 13 | Ga0065714_10037887 | 3300005288 | Bacteria | 809 |
| 14 | Ga0065714_10170248 | 3300005288 | Unclassified | 1008 |
| 15 | Ga0065712_10000551 | 3300005290 | Bacteria | 10759 |
| 16 | Ga0065712_10120229 | 3300005290 | Bacteria | 1681 |
| 17 | Ga0065712_10344289 | 3300005290 | Bacteria | 796 |
| 18 | Ga0065712_10596010 | 3300005290 | Unclassified | 593 |
| 19 | Ga0065715_10109776 | 3300005293 | Bacteria | 2653 |
| 20 | Ga0065715_10442593 | 3300005293 | Unclassified | 834 |
| 21 | Ga0065707_10094361 | 3300005295 | Unclassified | 3503 |
| 22 | Ga0070658_10203021 | 3300005327 | Bacteria | 1673 |
| 23 | Ga0070658_10216352 | 3300005327 | Bacteria | 1619 |
| 24 | Ga0070658_10217779 | 3300005327 | Bacteria | 1614 |
| 25 | Ga0070676_10053894 | 3300005328 | Bacteria | 2370 |
| 26 | Ga0070676_10063787 | 3300005328 | Bacteria | 2195 |
| 27 | Ga0070676_10190953 | 3300005328 | Bacteria | 1337 |
| 28 | Ga0070683_100000690 | 3300005329 | Bacteria | 24470 |
| 29 | Ga0070683_100008953 | 3300005329 | Bacteria | 8531 |
| 30 | Ga0070683_100358092 | 3300005329 | Bacteria | 1390 |
| 31 | Ga0070683_100914247 | 3300005329 | Unclassified | 842 |
| 32 | Ga0070683_101583656 | 3300005329 | Bacteria | 630 |
| 33 | Ga0070690_100022866 | 3300005330 | Bacteria | 3828 |
| 34 | Ga0070690_100887562 | 3300005330 | Bacteria | 697 |
| 35 | Ga0070670_100027295 | 3300005331 | Bacteria | 4911 |
| 36 | Ga0070670_100050041 | 3300005331 | Bacteria | 3591 |
| 37 | Ga0070670_100080085 | 3300005331 | Unclassified | 2807 |
| 38 | Ga0070670_100124164 | 3300005331 | Bacteria | 2228 |
| 39 | Ga0070670_100128886 | 3300005331 | Bacteria | 2184 |
| 40 | Ga0070670_100141443 | 3300005331 | Bacteria | 2081 |
| 41 | Ga0070670_100340293 | 3300005331 | Bacteria | 1317 |
| 42 | Ga0070670_100526442 | 3300005331 | Bacteria | 1053 |
| 43 | Ga0070670_100903023 | 3300005331 | Bacteria | 801 |
| 44 | Ga0070677_10023701 | 3300005333 | Bacteria | 2274 |
| 45 | Ga0070677_10051993 | 3300005333 | Bacteria | 1661 |
| 46 | Ga0070677_10255936 | 3300005333 | Bacteria | 871 |
| 47 | Ga0070677_10472948 | 3300005333 | Bacteria | 674 |
| 48 | Ga0068869_100008462 | 3300005334 | Bacteria | 6636 |
| 49 | Ga0068869_100013414 | 3300005334 | Bacteria | 5450 |
| 50 | Ga0068869_100090117 | 3300005334 | Bacteria | 2304 |
| 51 | Ga0068869_100099176 | 3300005334 | Bacteria | 2201 |
| 52 | Ga0068869_100669985 | 3300005334 | Bacteria | 882 |
| 53 | Ga0068869_101492840 | 3300005334 | Bacteria | 600 |
| 54 | Ga0070666_10000019 | 3300005335 | Bacteria | 185877 |
| 55 | Ga0070666_10008203 | 3300005335 | Bacteria | 6473 |
| 56 | Ga0070680_100107808 | 3300005336 | Bacteria | 2317 |
| 57 | Ga0070682_100017287 | 3300005337 | Bacteria | 4203 |
| 58 | Ga0070682_100406239 | 3300005337 | Unclassified | 1031 |
| 59 | Ga0070682_100451971 | 3300005337 | Bacteria | 984 |
| 60 | Ga0068868_100148510 | 3300005338 | Bacteria | 1929 |
| 61 | Ga0068868_100156233 | 3300005338 | Bacteria | 1881 |
| 62 | Ga0068868_100280714 | 3300005338 | Bacteria | 1410 |
| 63 | Ga0068868_100523648 | 3300005338 | Bacteria | 1041 |
| 64 | Ga0068868_100563530 | 3300005338 | Unclassified | 1005 |
| 65 | Ga0068868_100807207 | 3300005338 | Bacteria | 847 |
| 66 | Ga0068868_100895310 | 3300005338 | Bacteria | 806 |
| 67 | Ga0068868_100914227 | 3300005338 | Unclassified | 798 |
| 68 | Ga0070660_100000201 | 3300005339 | Bacteria | 39920 |
| 69 | Ga0070660_100022598 | 3300005339 | Bacteria | 4653 |
| 70 | Ga0070689_100007906 | 3300005340 | Bacteria | 7461 |
| 71 | Ga0070689_100023615 | 3300005340 | Bacteria | 4605 |
| 72 | Ga0070689_100055775 | 3300005340 | Bacteria | 3062 |
| 73 | Ga0070689_100136844 | 3300005340 | Bacteria | 1967 |
| 74 | Ga0070689_100348245 | 3300005340 | Bacteria | 1242 |
| 75 | Ga0070689_100435507 | 3300005340 | Unclassified | 1113 |
| 76 | Ga0070689_101238980 | 3300005340 | Unclassified | 670 |
| 77 | Ga0070689_101439739 | 3300005340 | Bacteria | 623 |
| 78 | Ga0070687_100103775 | 3300005343 | Bacteria | 1597 |
| 79 | Ga0070687_100694797 | 3300005343 | Unclassified | 710 |
| 80 | Ga0070661_100000615 | 3300005344 | Bacteria | 26536 |
| 81 | Ga0070661_100417412 | 3300005344 | Unclassified | 1063 |
| 82 | Ga0070692_11395091 | 3300005345 | Unclassified | 506 |
| 83 | Ga0070668_100008223 | 3300005347 | Bacteria | 7745 |
| 84 | Ga0070668_100036616 | 3300005347 | Unclassified | 3745 |
| 85 | Ga0070668_100491985 | 3300005347 | Bacteria | 1060 |
| 86 | Ga0070668_100796953 | 3300005347 | Bacteria | 839 |
| 87 | Ga0070668_100861191 | 3300005347 | Bacteria | 808 |
| 88 | Ga0070668_101671483 | 3300005347 | Unclassified | 584 |
| 89 | Ga0070669_100005200 | 3300005353 | Bacteria | 9416 |
| 90 | Ga0070669_100219718 | 3300005353 | Unclassified | 1502 |
| 91 | Ga0070669_101001982 | 3300005353 | Bacteria | 717 |
| 92 | Ga0070669_101173485 | 3300005353 | Bacteria | 663 |
| 93 | Ga0070675_100000570 | 3300005354 | Bacteria | 25293 |
| 94 | Ga0070675_100026342 | 3300005354 | Bacteria | 4666 |
| 95 | Ga0070675_100081634 | 3300005354 | Bacteria | 2696 |
| 96 | Ga0070675_100160819 | 3300005354 | Bacteria | 1931 |
| 97 | Ga0070675_100255080 | 3300005354 | Bacteria | 1536 |
| 98 | Ga0070675_101241691 | 3300005354 | Bacteria | 686 |
| 99 | Ga0070671_100010878 | 3300005355 | Bacteria | 7305 |
| 100 | Ga0070671_100161541 | 3300005355 | Bacteria | 1894 |
| 101 | Ga0070671_100486372 | 3300005355 | Bacteria | 1061 |
| 102 | Ga0070671_100760091 | 3300005355 | Bacteria | 843 |
| 103 | Ga0070671_101115223 | 3300005355 | Bacteria | 693 |
| 104 | Ga0070671_101269865 | 3300005355 | Bacteria | 649 |
| 105 | Ga0070671_101485252 | 3300005355 | Unclassified | 599 |
| 106 | Ga0070674_100180336 | 3300005356 | Bacteria | 1617 |
| 107 | Ga0070674_102143624 | 3300005356 | Unclassified | 510 |
| 108 | Ga0070673_100002308 | 3300005364 | Bacteria | 11592 |
| 109 | Ga0070673_100037373 | 3300005364 | Bacteria | 3699 |
| 110 | Ga0070673_100089173 | 3300005364 | Bacteria | 2517 |
| 111 | Ga0070673_100117623 | 3300005364 | Bacteria | 2212 |
| 112 | Ga0070673_100188339 | 3300005364 | Bacteria | 1771 |
| 113 | Ga0070673_100197869 | 3300005364 | Bacteria | 1729 |
| 114 | Ga0070673_100280322 | 3300005364 | Bacteria | 1462 |
| 115 | Ga0070673_100295556 | 3300005364 | Bacteria | 1424 |
| 116 | Ga0070673_101622291 | 3300005364 | Bacteria | 611 |
| 117 | Ga0070688_100004531 | 3300005365 | Bacteria | 7248 |
| 118 | Ga0070688_100032676 | 3300005365 | Bacteria | 3140 |
| 119 | Ga0070688_100052608 | 3300005365 | Bacteria | 2544 |
| 120 | Ga0070688_100080173 | 3300005365 | Bacteria | 2111 |
| 121 | Ga0070688_100312461 | 3300005365 | Bacteria | 1139 |
| 122 | Ga0070659_100070740 | 3300005366 | Bacteria | 2772 |
| 123 | Ga0070659_100353174 | 3300005366 | Bacteria | 1234 |
| 124 | Ga0070659_100803191 | 3300005366 | Bacteria | 818 |
| 125 | Ga0070659_101094408 | 3300005366 | Bacteria | 702 |
| 126 | Ga0070667_100009050 | 3300005367 | Bacteria | 8243 |
| 127 | Ga0070667_100022270 | 3300005367 | Bacteria | 5257 |
| 128 | Ga0070667_100030514 | 3300005367 | Bacteria | 4496 |
| 129 | Ga0070667_100131533 | 3300005367 | Unclassified | 2185 |
| 130 | Ga0070667_100416701 | 3300005367 | Bacteria | 1224 |
| 131 | Ga0070667_100518417 | 3300005367 | Bacteria | 1094 |
| 132 | Ga0070667_100663595 | 3300005367 | Bacteria | 963 |
| 133 | Ga0070667_100775616 | 3300005367 | Bacteria | 889 |
| 134 | Ga0070667_100851702 | 3300005367 | Bacteria | 847 |
| 135 | Ga0070667_100963925 | 3300005367 | Bacteria | 795 |
| 136 | Ga0070701_10179937 | 3300005438 | Bacteria | 1237 |
| 137 | Ga0070711_101473397 | 3300005439 | Bacteria | 593 |
| 138 | Ga0070700_100106236 | 3300005441 | Bacteria | 1858 |
| 139 | Ga0070700_100225680 | 3300005441 | Bacteria | 1330 |
| 140 | Ga0070700_101123423 | 3300005441 | Bacteria | 653 |
| 141 | Ga0070663_100372312 | 3300005455 | Bacteria | 1161 |
| 142 | Ga0070678_100152840 | 3300005456 | Bacteria | 1861 |
| 143 | Ga0070678_100394542 | 3300005456 | Bacteria | 1201 |
| 144 | Ga0070678_100695642 | 3300005456 | Bacteria | 915 |
| 145 | Ga0070662_100009313 | 3300005457 | Bacteria | 6418 |
| 146 | Ga0070662_100025234 | 3300005457 | Unclassified | 4103 |
| 147 | Ga0070662_100033436 | 3300005457 | Bacteria | 3621 |
| 148 | Ga0070662_100702802 | 3300005457 | Bacteria | 855 |
| 149 | Ga0070662_101404873 | 3300005457 | Unclassified | 601 |
| 150 | Ga0070681_10015835 | 3300005458 | Bacteria | 7517 |
| 151 | Ga0070681_10023433 | 3300005458 | Bacteria | 6207 |
| 152 | Ga0070681_10028151 | 3300005458 | Bacteria | 5650 |
| 153 | Ga0070681_10228959 | 3300005458 | Unclassified | 1773 |
| 154 | Ga0070681_10507055 | 3300005458 | Bacteria | 1120 |
| 155 | Ga0068867_100018265 | 3300005459 | Unclassified | 4983 |
| 156 | Ga0068867_100183940 | 3300005459 | Bacteria | 1663 |
| 157 | Ga0068867_100201843 | 3300005459 | Bacteria | 1592 |
| 158 | Ga0068867_100318698 | 3300005459 | Bacteria | 1287 |
| 159 | Ga0068867_100375223 | 3300005459 | Bacteria | 1193 |
| 160 | Ga0068867_100381808 | 3300005459 | Bacteria | 1183 |
| 161 | Ga0068867_100519871 | 3300005459 | Bacteria | 1026 |
| 162 | Ga0068867_100541096 | 3300005459 | Bacteria | 1007 |
| 163 | Ga0068867_100735490 | 3300005459 | Bacteria | 874 |
| 164 | Ga0068867_100790677 | 3300005459 | Bacteria | 845 |
| 165 | Ga0068867_100817043 | 3300005459 | Unclassified | 833 |
| 166 | Ga0068867_100896634 | 3300005459 | Bacteria | 798 |
| 167 | Ga0068867_100970208 | 3300005459 | Bacteria | 769 |
| 168 | Ga0068867_101127932 | 3300005459 | Unclassified | 717 |
| 169 | Ga0068867_101747296 | 3300005459 | Unclassified | 584 |
| 170 | Ga0068867_101958035 | 3300005459 | Unclassified | 553 |
| 171 | Ga0068867_102222867 | 3300005459 | Unclassified | 521 |
| 172 | Ga0068867_102299252 | 3300005459 | Unclassified | 512 |
| 173 | Ga0070685_10046592 | 3300005466 | Bacteria | 2489 |
| 174 | Ga0070685_10128593 | 3300005466 | Bacteria | 1581 |
| 175 | Ga0070685_11164796 | 3300005466 | Bacteria | 585 |
| 176 | Ga0070706_100370030 | 3300005467 | Bacteria | 1335 |
| 177 | Ga0070706_100677248 | 3300005467 | Bacteria | 957 |
| 178 | Ga0070707_101819369 | 3300005468 | Unclassified | 576 |
| 179 | Ga0070698_100000626 | 3300005471 | Bacteria | 38116 |
| 180 | Ga0070698_100015308 | 3300005471 | Bacteria | 8109 |
| 181 | Ga0070699_100629034 | 3300005518 | Bacteria | 979 |
| 182 | Ga0070699_101030075 | 3300005518 | Bacteria | 755 |
| 183 | Ga0070679_100006623 | 3300005530 | Bacteria | 10799 |
| 184 | Ga0070679_100015006 | 3300005530 | Bacteria | 7442 |
| 185 | Ga0070679_100027336 | 3300005530 | Bacteria | 5614 |
| 186 | Ga0070684_100000986 | 3300005535 | Bacteria | 20347 |
| 187 | Ga0070684_100348620 | 3300005535 | Bacteria | 1362 |
| 188 | Ga0070684_101369325 | 3300005535 | Bacteria | 666 |
| 189 | Ga0068853_100007621 | 3300005539 | Bacteria | 8673 |
| 190 | Ga0068853_100013072 | 3300005539 | Bacteria | 6771 |
| 191 | Ga0068853_100028951 | 3300005539 | Bacteria | 4663 |
| 192 | Ga0068853_100048315 | 3300005539 | Bacteria | 3655 |
| 193 | Ga0068853_100049027 | 3300005539 | Bacteria | 3628 |
| 194 | Ga0068853_100165373 | 3300005539 | Bacteria | 1999 |
| 195 | Ga0068853_100628104 | 3300005539 | Bacteria | 1021 |
| 196 | Ga0068853_100711557 | 3300005539 | Unclassified | 958 |
| 197 | Ga0068853_101308936 | 3300005539 | Bacteria | 700 |
| 198 | Ga0068853_101633770 | 3300005539 | Unclassified | 624 |
| 199 | Ga0068853_101914384 | 3300005539 | Bacteria | 575 |
| 200 | Ga0070672_100032907 | 3300005543 | Bacteria | 3920 |
| 201 | Ga0070672_100046912 | 3300005543 | Bacteria | 3350 |
| 202 | Ga0070672_100140227 | 3300005543 | Bacteria | 1993 |
| 203 | Ga0070672_100422792 | 3300005543 | Bacteria | 1145 |
| 204 | Ga0070672_100465889 | 3300005543 | Unclassified | 1090 |
| 205 | Ga0070672_100639697 | 3300005543 | Bacteria | 928 |
| 206 | Ga0070672_100924105 | 3300005543 | Bacteria | 771 |
| 207 | Ga0070672_101187067 | 3300005543 | Bacteria | 680 |
| 208 | Ga0070672_101898759 | 3300005543 | Bacteria | 536 |
| 209 | Ga0070686_100116143 | 3300005544 | Bacteria | 1831 |
| 210 | Ga0070686_100276979 | 3300005544 | Bacteria | 1236 |
| 211 | Ga0070686_100493840 | 3300005544 | Bacteria | 949 |
| 212 | Ga0070693_100391828 | 3300005547 | Bacteria | 961 |
| 213 | Ga0070693_101467320 | 3300005547 | Bacteria | 532 |
| 214 | Ga0070665_100000018 | 3300005548 | Bacteria | 434118 |
| 215 | Ga0070665_100134884 | 3300005548 | Bacteria | 2471 |
| 216 | Ga0070665_100478209 | 3300005548 | Bacteria | 1256 |
| 217 | Ga0070665_100801705 | 3300005548 | Bacteria | 955 |
| 218 | Ga0070665_101667838 | 3300005548 | Bacteria | 645 |
| 219 | Ga0070704_100076454 | 3300005549 | Unclassified | 2449 |
| 220 | Ga0070704_100108037 | 3300005549 | Bacteria | 2112 |
| 221 | Ga0068855_100044204 | 3300005563 | Bacteria | 5273 |
| 222 | Ga0068855_100055967 | 3300005563 | Unclassified | 4630 |
| 223 | Ga0068855_100061387 | 3300005563 | Bacteria | 4392 |
| 224 | Ga0068855_100112496 | 3300005563 | Bacteria | 3124 |
| 225 | Ga0068855_100552826 | 3300005563 | Bacteria | 1246 |
| 226 | Ga0068855_100766138 | 3300005563 | Bacteria | 1028 |
| 227 | Ga0068855_101179949 | 3300005563 | Unclassified | 797 |
| 228 | Ga0068855_101259301 | 3300005563 | Bacteria | 767 |
| 229 | Ga0068855_101311914 | 3300005563 | Unclassified | 749 |
| 230 | Ga0070664_100001066 | 3300005564 | Bacteria | 21588 |
| 231 | Ga0070664_100029709 | 3300005564 | Bacteria | 4558 |
| 232 | Ga0070664_100119798 | 3300005564 | Unclassified | 2303 |
| 233 | Ga0070664_100252441 | 3300005564 | Bacteria | 1586 |
| 234 | Ga0070664_100388693 | 3300005564 | Bacteria | 1274 |
| 235 | Ga0070664_100827448 | 3300005564 | Bacteria | 866 |
| 236 | Ga0070664_100954279 | 3300005564 | Bacteria | 805 |
| 237 | Ga0068857_100001057 | 3300005577 | Bacteria | 21331 |
| 238 | Ga0068857_100003942 | 3300005577 | Bacteria | 12490 |
| 239 | Ga0068857_100022395 | 3300005577 | Bacteria | 5559 |
| 240 | Ga0068857_101716391 | 3300005577 | Unclassified | 614 |
| 241 | Ga0068857_102374358 | 3300005577 | Unclassified | 521 |
| 242 | Ga0068854_100010521 | 3300005578 | Bacteria | 6003 |
| 243 | Ga0068854_100011741 | 3300005578 | Bacteria | 5716 |
| 244 | Ga0068854_100084442 | 3300005578 | Bacteria | 2350 |
| 245 | Ga0068854_100158173 | 3300005578 | Bacteria | 1753 |
| 246 | Ga0068854_100242714 | 3300005578 | Bacteria | 1435 |
| 247 | Ga0068854_100262369 | 3300005578 | Bacteria | 1384 |
| 248 | Ga0068854_100266704 | 3300005578 | Bacteria | 1373 |
| 249 | Ga0068854_100651293 | 3300005578 | Unclassified | 904 |
| 250 | Ga0068854_100941708 | 3300005578 | Bacteria | 761 |
| 251 | Ga0068854_101168435 | 3300005578 | Bacteria | 688 |
| 252 | Ga0068854_101356179 | 3300005578 | Unclassified | 642 |
| 253 | Ga0068856_100015155 | 3300005614 | Bacteria | 7446 |
| 254 | Ga0068856_100018315 | 3300005614 | Bacteria | 6789 |
| 255 | Ga0068856_100024765 | 3300005614 | Bacteria | 5845 |
| 256 | Ga0068856_100028509 | 3300005614 | Bacteria | 5452 |
| 257 | Ga0068856_100066000 | 3300005614 | Bacteria | 3576 |
| 258 | Ga0068856_100204351 | 3300005614 | Bacteria | 1990 |
| 259 | Ga0068856_101873958 | 3300005614 | Bacteria | 611 |
| 260 | Ga0070702_100182906 | 3300005615 | Bacteria | 1373 |
| 261 | Ga0070702_100283495 | 3300005615 | Bacteria | 1138 |
| 262 | Ga0070702_100434298 | 3300005615 | Bacteria | 948 |
| 263 | Ga0068852_100012728 | 3300005616 | Bacteria | 6404 |
| 264 | Ga0068852_100029598 | 3300005616 | Bacteria | 4501 |
| 265 | Ga0068852_100051706 | 3300005616 | Bacteria | 3528 |
| 266 | Ga0068852_100078470 | 3300005616 | Bacteria | 2921 |
| 267 | Ga0068852_100180422 | 3300005616 | Bacteria | 1985 |
| 268 | Ga0068852_100194051 | 3300005616 | Unclassified | 1918 |
| 269 | Ga0068852_100338360 | 3300005616 | Unclassified | 1466 |
| 270 | Ga0068852_100377238 | 3300005616 | Bacteria | 1390 |
| 271 | Ga0068852_100633175 | 3300005616 | Unclassified | 1076 |
| 272 | Ga0068852_101109938 | 3300005616 | Bacteria | 811 |
| 273 | Ga0068852_101219056 | 3300005616 | Unclassified | 774 |
| 274 | Ga0068859_100000013 | 3300005617 | Bacteria | 291126 |
| 275 | Ga0068859_100000639 | 3300005617 | Bacteria | 34980 |
| 276 | Ga0068859_100055079 | 3300005617 | Bacteria | 4001 |
| 277 | Ga0068859_100175210 | 3300005617 | Bacteria | 2226 |
| 278 | Ga0068859_100183557 | 3300005617 | Bacteria | 2175 |
| 279 | Ga0068859_100187862 | 3300005617 | Bacteria | 2150 |
| 280 | Ga0068859_100293344 | 3300005617 | Unclassified | 1719 |
| 281 | Ga0068859_100381394 | 3300005617 | Bacteria | 1505 |
| 282 | Ga0068859_100483639 | 3300005617 | Bacteria | 1333 |
| 283 | Ga0068859_100666247 | 3300005617 | Bacteria | 1132 |
| 284 | Ga0068859_101334001 | 3300005617 | Bacteria | 791 |
| 285 | Ga0068859_101633955 | 3300005617 | Bacteria | 712 |
| 286 | Ga0068864_100009105 | 3300005618 | Bacteria | 8183 |
| 287 | Ga0068864_100016110 | 3300005618 | Bacteria | 6220 |
| 288 | Ga0068864_100020436 | 3300005618 | Bacteria | 5539 |
| 289 | Ga0068864_100154359 | 3300005618 | Bacteria | 2082 |
| 290 | Ga0068864_100305141 | 3300005618 | Unclassified | 1491 |
| 291 | Ga0068864_100580627 | 3300005618 | Bacteria | 1086 |
| 292 | Ga0068864_101472288 | 3300005618 | Unclassified | 684 |
| 293 | Ga0068866_10020336 | 3300005718 | Bacteria | 3040 |
| 294 | Ga0068866_10046976 | 3300005718 | Bacteria | 2174 |
| 295 | Ga0068866_10071233 | 3300005718 | Bacteria | 1838 |
| 296 | Ga0068866_10852823 | 3300005718 | Unclassified | 637 |
| 297 | Ga0068861_100005999 | 3300005719 | Bacteria | 8258 |
| 298 | Ga0068861_100009631 | 3300005719 | Bacteria | 6674 |
| 299 | Ga0068861_100048796 | 3300005719 | Unclassified | 3202 |
| 300 | Ga0068861_100773731 | 3300005719 | Bacteria | 899 |
| 301 | Ga0068861_100970827 | 3300005719 | Bacteria | 809 |
| 302 | Ga0068861_101266007 | 3300005719 | Bacteria | 716 |
| 303 | Ga0068861_101582536 | 3300005719 | Bacteria | 645 |
| 304 | Ga0068851_10029488 | 3300005834 | Bacteria | 2717 |
| 305 | Ga0068851_10037594 | 3300005834 | Bacteria | 2427 |
| 306 | Ga0068851_10191517 | 3300005834 | Bacteria | 1137 |
| 307 | Ga0068851_10492987 | 3300005834 | Bacteria | 734 |
| 308 | Ga0068870_10053579 | 3300005840 | Bacteria | 2143 |
| 309 | Ga0068870_10148942 | 3300005840 | Unclassified | 1376 |
| 310 | Ga0068870_10388015 | 3300005840 | Unclassified | 906 |
| 311 | Ga0068870_10944720 | 3300005840 | Bacteria | 612 |
| 312 | Ga0068863_100021830 | 3300005841 | Bacteria | 6109 |
| 313 | Ga0068863_100053741 | 3300005841 | Bacteria | 3818 |
| 314 | Ga0068863_100085952 | 3300005841 | Bacteria | 2980 |
| 315 | Ga0068863_100088790 | 3300005841 | Bacteria | 2930 |
| 316 | Ga0068863_100301748 | 3300005841 | Bacteria | 1554 |
| 317 | Ga0068863_100519598 | 3300005841 | Bacteria | 1174 |
| 318 | Ga0068863_100722955 | 3300005841 | Bacteria | 990 |
| 319 | Ga0068863_100737661 | 3300005841 | Bacteria | 980 |
| 320 | Ga0068863_100922282 | 3300005841 | Bacteria | 874 |
| 321 | Ga0068863_101182205 | 3300005841 | Unclassified | 770 |
| 322 | Ga0068858_100005907 | 3300005842 | Bacteria | 11948 |
| 323 | Ga0068858_100338044 | 3300005842 | Bacteria | 1441 |
| 324 | Ga0068858_100691636 | 3300005842 | Bacteria | 992 |
| 325 | Ga0068858_102034380 | 3300005842 | Unclassified | 568 |
| 326 | Ga0068858_102448212 | 3300005842 | Bacteria | 516 |
| 327 | Ga0068860_100000040 | 3300005843 | Bacteria | 231652 |
| 328 | Ga0068860_100000983 | 3300005843 | Bacteria | 31545 |
| 329 | Ga0068860_100001891 | 3300005843 | Bacteria | 22247 |
| 330 | Ga0068860_100010037 | 3300005843 | Bacteria | 9386 |
| 331 | Ga0068860_100105606 | 3300005843 | Bacteria | 2690 |
| 332 | Ga0068860_100157340 | 3300005843 | Bacteria | 2190 |
| 333 | Ga0068860_100184676 | 3300005843 | Bacteria | 2016 |
| 334 | Ga0068860_100560381 | 3300005843 | Bacteria | 1145 |
| 335 | Ga0068860_101188348 | 3300005843 | Bacteria | 783 |
| 336 | Ga0068860_102738698 | 3300005843 | Bacteria | 511 |
| 337 | Ga0068862_100011991 | 3300005844 | Bacteria | 7160 |
| 338 | Ga0068862_100104234 | 3300005844 | Bacteria | 2484 |
| 339 | Ga0068862_100241412 | 3300005844 | Bacteria | 1643 |
| 340 | Ga0068862_100272501 | 3300005844 | Bacteria | 1548 |
| 341 | Ga0068862_100457640 | 3300005844 | Bacteria | 1204 |
| 342 | Ga0068862_100462750 | 3300005844 | Bacteria | 1197 |
| 343 | Ga0068862_100519660 | 3300005844 | Bacteria | 1133 |
| 344 | Ga0068862_100582879 | 3300005844 | Bacteria | 1072 |
| 345 | Ga0068862_100743716 | 3300005844 | Bacteria | 953 |
| 346 | Ga0068862_100806541 | 3300005844 | Bacteria | 917 |
| 347 | Ga0068862_100874323 | 3300005844 | Bacteria | 882 |
| 348 | Ga0068862_101039597 | 3300005844 | Bacteria | 812 |
| 349 | Ga0068862_101325943 | 3300005844 | Bacteria | 721 |
| 350 | Ga0068862_101425146 | 3300005844 | Bacteria | 696 |
| 351 | Ga0081455_10288424 | 3300005937 | Bacteria | 1183 |
| 352 | Ga0081540_1005650 | 3300005983 | Bacteria | 9302 |
| 353 | Ga0070715_10059278 | 3300006163 | Bacteria | 1674 |
| 354 | Ga0070716_100606135 | 3300006173 | Unclassified | 824 |
| 355 | Ga0075366_10003142 | 3300006195 | Bacteria | 8641 |
| 356 | Ga0075366_10026495 | 3300006195 | Bacteria | 3396 |
| 357 | Ga0075366_10520158 | 3300006195 | Bacteria | 736 |
| 358 | Ga0097621_100000129 | 3300006237 | Bacteria | 44253 |
| 359 | Ga0097621_100014645 | 3300006237 | Bacteria | 5876 |
| 360 | Ga0097621_100087369 | 3300006237 | Unclassified | 2603 |
| 361 | Ga0097621_100114659 | 3300006237 | Bacteria | 2280 |
| 362 | Ga0097621_100191304 | 3300006237 | Bacteria | 1772 |
| 363 | Ga0097621_100214249 | 3300006237 | Bacteria | 1676 |
| 364 | Ga0097621_100247317 | 3300006237 | Unclassified | 1561 |
| 365 | Ga0097621_100248526 | 3300006237 | Bacteria | 1557 |
| 366 | Ga0097621_100496976 | 3300006237 | Unclassified | 1104 |
| 367 | Ga0097621_101415196 | 3300006237 | Unclassified | 658 |
| 368 | Ga0097621_101797420 | 3300006237 | Unclassified | 584 |
| 369 | Ga0068871_100000075 | 3300006358 | Bacteria | 55346 |
| 370 | Ga0068871_100004743 | 3300006358 | Bacteria | 9504 |
| 371 | Ga0068871_100025379 | 3300006358 | Bacteria | 4610 |
| 372 | Ga0068871_100120003 | 3300006358 | Bacteria | 2220 |
| 373 | Ga0068871_100814179 | 3300006358 | Bacteria | 862 |
| 374 | Ga0068871_100829045 | 3300006358 | Bacteria | 854 |
| 375 | Ga0068871_100837359 | 3300006358 | Bacteria | 850 |
| 376 | Ga0068871_100897938 | 3300006358 | Bacteria | 821 |
| 377 | Ga0068871_100915456 | 3300006358 | Bacteria | 813 |
| 378 | Ga0068871_101271942 | 3300006358 | Bacteria | 691 |
| 379 | Ga0068871_101564166 | 3300006358 | Bacteria | 624 |
| 380 | Ga0075428_100180467 | 3300006844 | Bacteria | 2285 |
| 381 | Ga0075430_100000676 | 3300006846 | Bacteria | 26081 |
| 382 | Ga0075431_100934773 | 3300006847 | Bacteria | 836 |
| 383 | Ga0075434_100872779 | 3300006871 | Unclassified | 915 |
| 384 | Ga0068865_100117646 | 3300006881 | Bacteria | 1970 |
| 385 | Ga0068865_100337551 | 3300006881 | Bacteria | 1217 |
| 386 | Ga0068865_100339445 | 3300006881 | Bacteria | 1214 |
| 387 | Ga0068865_100501283 | 3300006881 | Unclassified | 1012 |
| 388 | Ga0068865_100638495 | 3300006881 | Unclassified | 904 |
| 389 | Ga0068865_100852616 | 3300006881 | Bacteria | 789 |
| 390 | Ga0068865_101225859 | 3300006881 | Bacteria | 665 |
| 391 | Ga0097620_100000013 | 3300006931 | Bacteria | 291126 |
| 392 | Ga0097620_100000639 | 3300006931 | Bacteria | 34980 |
| 393 | Ga0097620_100055081 | 3300006931 | Bacteria | 4001 |
| 394 | Ga0097620_100175212 | 3300006931 | Bacteria | 2226 |
| 395 | Ga0097620_100183561 | 3300006931 | Bacteria | 2175 |
| 396 | Ga0097620_100187862 | 3300006931 | Bacteria | 2150 |
| 397 | Ga0097620_100293313 | 3300006931 | Unclassified | 1719 |
| 398 | Ga0097620_100381375 | 3300006931 | Bacteria | 1505 |
| 399 | Ga0097620_100483630 | 3300006931 | Bacteria | 1333 |
| 400 | Ga0097620_100666318 | 3300006931 | Bacteria | 1132 |
| 401 | Ga0097620_101071754 | 3300006931 | Unclassified | 886 |
| 402 | Ga0097620_101334198 | 3300006931 | Bacteria | 791 |
| 403 | Ga0097620_101634133 | 3300006931 | Bacteria | 712 |
| 404 | Ga0097620_102522677 | 3300006931 | Bacteria | 566 |
| 405 | Ga0105240_10000764 | 3300009093 | Bacteria | 58488 |
| 406 | Ga0105240_10002370 | 3300009093 | Bacteria | 30393 |
| 407 | Ga0105240_10002578 | 3300009093 | Bacteria | 29041 |
| 408 | Ga0105240_10007820 | 3300009093 | Bacteria | 15434 |
| 409 | Ga0105240_10019592 | 3300009093 | Bacteria | 9036 |
| 410 | Ga0105240_10038122 | 3300009093 | Bacteria | 6169 |
| 411 | Ga0105240_10064938 | 3300009093 | Bacteria | 4533 |
| 412 | Ga0105240_10130284 | 3300009093 | Bacteria | 3018 |
| 413 | Ga0105240_10343323 | 3300009093 | Bacteria | 1695 |
| 414 | Ga0105240_10751443 | 3300009093 | Bacteria | 1060 |
| 415 | Ga0105240_11356873 | 3300009093 | Bacteria | 748 |
| 416 | Ga0105240_11891006 | 3300009093 | Bacteria | 621 |
| 417 | Ga0111539_10010650 | 3300009094 | Bacteria | 11580 |
| 418 | Ga0111539_10024107 | 3300009094 | Bacteria | 7472 |
| 419 | Ga0111539_10038247 | 3300009094 | Bacteria | 5788 |
| 420 | Ga0111539_10620595 | 3300009094 | Bacteria | 1259 |
| 421 | Ga0111539_10752117 | 3300009094 | Bacteria | 1134 |
| 422 | Ga0111539_11542746 | 3300009094 | Bacteria | 770 |
| 423 | Ga0111539_11613115 | 3300009094 | Unclassified | 752 |
| 424 | Ga0105245_12135209 | 3300009098 | Unclassified | 614 |
| 425 | Ga0105247_10092509 | 3300009101 | Unclassified | 1921 |
| 426 | Ga0105247_10149361 | 3300009101 | Bacteria | 1538 |
| 427 | Ga0105247_10209116 | 3300009101 | Bacteria | 1315 |
| 428 | Ga0114129_10010555 | 3300009147 | Bacteria | 13170 |
| 429 | Ga0114129_10404658 | 3300009147 | Bacteria | 1798 |
| 430 | Ga0105243_11071033 | 3300009148 | Unclassified | 813 |
| 431 | Ga0105243_12084698 | 3300009148 | Bacteria | 603 |
| 432 | Ga0105243_12395664 | 3300009148 | Bacteria | 566 |
| 433 | Ga0105241_10000732 | 3300009174 | Bacteria | 24909 |
| 434 | Ga0105241_10002606 | 3300009174 | Bacteria | 13525 |
| 435 | Ga0105241_10050299 | 3300009174 | Bacteria | 3176 |
| 436 | Ga0105241_10338327 | 3300009174 | Bacteria | 1303 |
| 437 | Ga0105241_10443202 | 3300009174 | Bacteria | 1147 |
| 438 | Ga0105241_10899933 | 3300009174 | Bacteria | 822 |
| 439 | Ga0105241_11070076 | 3300009174 | Bacteria | 758 |
| 440 | Ga0105241_11184997 | 3300009174 | Unclassified | 723 |
| 441 | Ga0105241_11218411 | 3300009174 | Bacteria | 714 |
| 442 | Ga0105241_11644760 | 3300009174 | Bacteria | 622 |
| 443 | Ga0105241_11652808 | 3300009174 | Unclassified | 621 |
| 444 | Ga0105241_11946741 | 3300009174 | Bacteria | 577 |
| 445 | Ga0105242_10091785 | 3300009176 | Unclassified | 2557 |
| 446 | Ga0105242_10126456 | 3300009176 | Bacteria | 2200 |
| 447 | Ga0105242_10161253 | 3300009176 | Bacteria | 1963 |
| 448 | Ga0105242_10193586 | 3300009176 | Bacteria | 1802 |
| 449 | Ga0105242_10198873 | 3300009176 | Bacteria | 1779 |
| 450 | Ga0105242_10298940 | 3300009176 | Bacteria | 1468 |
| 451 | Ga0105242_11480560 | 3300009176 | Bacteria | 709 |
| 452 | Ga0105242_12897450 | 3300009176 | Bacteria | 530 |
| 453 | Ga0105248_10161683 | 3300009177 | Bacteria | 2525 |
| 454 | Ga0105248_10612100 | 3300009177 | Bacteria | 1229 |
| 455 | Ga0105248_10841728 | 3300009177 | Bacteria | 1035 |
| 456 | Ga0105237_10000186 | 3300009545 | Bacteria | 87958 |
| 457 | Ga0105237_10003399 | 3300009545 | Bacteria | 18931 |
| 458 | Ga0105237_10011251 | 3300009545 | Bacteria | 9468 |
| 459 | Ga0105237_10016007 | 3300009545 | Bacteria | 7798 |
| 460 | Ga0105237_10020252 | 3300009545 | Bacteria | 6863 |
| 461 | Ga0105237_10027584 | 3300009545 | Bacteria | 5794 |
| 462 | Ga0105237_10089063 | 3300009545 | Bacteria | 3076 |
| 463 | Ga0105237_10235600 | 3300009545 | Bacteria | 1832 |
| 464 | Ga0105237_10252904 | 3300009545 | Bacteria | 1764 |
| 465 | Ga0105237_10390592 | 3300009545 | Bacteria | 1396 |
| 466 | Ga0105237_10502545 | 3300009545 | Bacteria | 1219 |
| 467 | Ga0105238_10000643 | 3300009551 | Bacteria | 36757 |
| 468 | Ga0105238_10150058 | 3300009551 | Bacteria | 2306 |
| 469 | Ga0105238_10243383 | 3300009551 | Bacteria | 1776 |
| 470 | Ga0105238_10275747 | 3300009551 | Bacteria | 1662 |
| 471 | Ga0105238_11256606 | 3300009551 | Unclassified | 766 |
| 472 | Ga0105238_12565333 | 3300009551 | Bacteria | 546 |
| 473 | Ga0105249_10004589 | 3300009553 | Bacteria | 11938 |
| 474 | Ga0105249_10014106 | 3300009553 | Bacteria | 7064 |
| 475 | Ga0105249_10022403 | 3300009553 | Bacteria | 5658 |
| 476 | Ga0105249_10036279 | 3300009553 | Unclassified | 4472 |
| 477 | Ga0105249_10057466 | 3300009553 | Bacteria | 3564 |
| 478 | Ga0105249_10194183 | 3300009553 | Unclassified | 1983 |
| 479 | Ga0105249_10250193 | 3300009553 | Bacteria | 1757 |
| 480 | Ga0105249_10287184 | 3300009553 | Bacteria | 1645 |
| 481 | Ga0105249_10308510 | 3300009553 | Unclassified | 1590 |
| 482 | Ga0105249_10309224 | 3300009553 | Bacteria | 1588 |
| 483 | Ga0105249_10448712 | 3300009553 | Bacteria | 1328 |
| 484 | Ga0105249_13013299 | 3300009553 | Bacteria | 541 |
| 485 | Ga0105239_10000383 | 3300010375 | Bacteria | 64504 |
| 486 | Ga0105239_10001834 | 3300010375 | Bacteria | 27813 |
| 487 | Ga0105239_10008051 | 3300010375 | Bacteria | 12032 |
| 488 | Ga0105239_10039487 | 3300010375 | Bacteria | 5171 |
| 489 | Ga0105239_10060253 | 3300010375 | Bacteria | 4166 |
| 490 | Ga0105239_10097423 | 3300010375 | Bacteria | 3250 |
| 491 | Ga0105239_10163526 | 3300010375 | Bacteria | 2488 |
| 492 | Ga0105239_10179684 | 3300010375 | Unclassified | 2367 |
| 493 | Ga0105239_10426545 | 3300010375 | Bacteria | 1503 |
| 494 | Ga0105239_10719850 | 3300010375 | Bacteria | 1142 |
| 495 | Ga0105246_10006585 | 3300011119 | Bacteria | 7094 |
| 496 | Ga0105246_10055121 | 3300011119 | Bacteria | 2742 |
| 497 | Ga0105246_10066259 | 3300011119 | Bacteria | 2528 |
| 498 | Ga0105246_11742649 | 3300011119 | Bacteria | 593 |
| 499 | Ga0105246_11846702 | 3300011119 | Unclassified | 579 |
| 500 | Ga0105246_12169707 | 3300011119 | Bacteria | 540 |
| 501 | Ga0157373_10007971 | 3300013100 | Bacteria | 7876 |
| 502 | Ga0157373_10053646 | 3300013100 | Bacteria | 2866 |
| 503 | Ga0157373_10054743 | 3300013100 | Bacteria | 2834 |
| 504 | Ga0157371_10009663 | 3300013102 | Bacteria | 7581 |
| 505 | Ga0157371_10011784 | 3300013102 | Bacteria | 6714 |
| 506 | Ga0157371_10062624 | 3300013102 | Unclassified | 2637 |
| 507 | Ga0157371_10104795 | 3300013102 | Unclassified | 2007 |
| 508 | Ga0157371_10342153 | 3300013102 | Bacteria | 1088 |
| 509 | Ga0157371_10581215 | 3300013102 | Bacteria | 832 |
| 510 | Ga0157370_10018760 | 3300013104 | Bacteria | 6956 |
| 511 | Ga0157370_10549996 | 3300013104 | Unclassified | 1058 |
| 512 | Ga0157370_10567836 | 3300013104 | Bacteria | 1040 |
| 513 | Ga0157370_10836725 | 3300013104 | Bacteria | 837 |
| 514 | Ga0157370_10843127 | 3300013104 | Bacteria | 833 |
| 515 | Ga0157370_11012291 | 3300013104 | Unclassified | 752 |
| 516 | Ga0157370_11069313 | 3300013104 | Bacteria | 729 |
| 517 | Ga0157369_10026694 | 3300013105 | Bacteria | 6404 |
| 518 | Ga0157369_10034847 | 3300013105 | Bacteria | 5521 |
| 519 | Ga0157369_10249499 | 3300013105 | Bacteria | 1852 |
| 520 | Ga0157369_11950828 | 3300013105 | Unclassified | 596 |
| 521 | Ga0157374_10000485 | 3300013296 | Bacteria | 36006 |
| 522 | Ga0157374_10287387 | 3300013296 | Bacteria | 1624 |
| 523 | Ga0157374_10355287 | 3300013296 | Bacteria | 1457 |
| 524 | Ga0157374_10882698 | 3300013296 | Bacteria | 912 |
| 525 | Ga0157374_11692089 | 3300013296 | Bacteria | 657 |
| 526 | Ga0157378_10010730 | 3300013297 | Bacteria | 8008 |
| 527 | Ga0157378_10100029 | 3300013297 | Bacteria | 2646 |
| 528 | Ga0157378_10158085 | 3300013297 | Bacteria | 2117 |
| 529 | Ga0157378_10279006 | 3300013297 | Bacteria | 1610 |
| 530 | Ga0157378_10305500 | 3300013297 | Bacteria | 1541 |
| 531 | Ga0157378_10649080 | 3300013297 | Unclassified | 1071 |
| 532 | Ga0157378_10907908 | 3300013297 | Bacteria | 912 |
| 533 | Ga0157378_11373109 | 3300013297 | Bacteria | 749 |
| 534 | Ga0157378_12212717 | 3300013297 | Unclassified | 601 |
| 535 | Ga0163162_10005361 | 3300013306 | Bacteria | 12380 |
| 536 | Ga0163162_10014884 | 3300013306 | Bacteria | 7596 |
| 537 | Ga0163162_10022034 | 3300013306 | Bacteria | 6277 |
| 538 | Ga0163162_10077353 | 3300013306 | Bacteria | 3390 |
| 539 | Ga0163162_10133770 | 3300013306 | Bacteria | 2590 |
| 540 | Ga0163162_10613436 | 3300013306 | Unclassified | 1213 |
| 541 | Ga0163162_11515685 | 3300013306 | Bacteria | 764 |
| 542 | Ga0163162_12296675 | 3300013306 | Unclassified | 620 |
| 543 | Ga0163162_13027777 | 3300013306 | Unclassified | 540 |
| 544 | Ga0157372_10001369 | 3300013307 | Bacteria | 26379 |
| 545 | Ga0157372_10002342 | 3300013307 | Bacteria | 20513 |
| 546 | Ga0157372_10118269 | 3300013307 | Bacteria | 3040 |
| 547 | Ga0157372_10176745 | 3300013307 | Bacteria | 2471 |
| 548 | Ga0157372_10197188 | 3300013307 | Bacteria | 2332 |
| 549 | Ga0157372_10277935 | 3300013307 | Bacteria | 1947 |
| 550 | Ga0157372_10474340 | 3300013307 | Bacteria | 1459 |
| 551 | Ga0157372_10500070 | 3300013307 | Bacteria | 1418 |
| 552 | Ga0157372_10612572 | 3300013307 | Bacteria | 1269 |
| 553 | Ga0157372_10902869 | 3300013307 | Bacteria | 1025 |
| 554 | Ga0157372_11346758 | 3300013307 | Unclassified | 823 |
| 555 | Ga0157372_12644117 | 3300013307 | Bacteria | 576 |
| 556 | Ga0157372_13434366 | 3300013307 | Unclassified | 504 |
| 557 | Ga0157375_10000327 | 3300013308 | Bacteria | 42691 |
| 558 | Ga0157375_10009353 | 3300013308 | Bacteria | 8601 |
| 559 | Ga0157375_10026118 | 3300013308 | Bacteria | 5438 |
| 560 | Ga0157375_10131513 | 3300013308 | Unclassified | 2622 |
| 561 | Ga0157375_10396732 | 3300013308 | Bacteria | 1546 |
| 562 | Ga0157375_10414792 | 3300013308 | Bacteria | 1513 |
| 563 | Ga0157375_10598489 | 3300013308 | Bacteria | 1262 |
| 564 | Ga0157375_10627404 | 3300013308 | Bacteria | 1232 |
| 565 | Ga0157375_10770751 | 3300013308 | Bacteria | 1112 |
| 566 | Ga0157375_11215167 | 3300013308 | Unclassified | 884 |
| 567 | Ga0157375_12247922 | 3300013308 | Bacteria | 650 |
| 568 | Ga0163163_10000191 | 3300014325 | Bacteria | 63102 |
| 569 | Ga0163163_10037365 | 3300014325 | Bacteria | 4724 |
| 570 | Ga0163163_10200929 | 3300014325 | Unclassified | 2041 |
| 571 | Ga0163163_10329138 | 3300014325 | Bacteria | 1582 |
| 572 | Ga0163163_10351791 | 3300014325 | Bacteria | 1530 |
| 573 | Ga0163163_10403893 | 3300014325 | Bacteria | 1424 |
| 574 | Ga0163163_10521090 | 3300014325 | Bacteria | 1251 |
| 575 | Ga0163163_10600772 | 3300014325 | Bacteria | 1163 |
| 576 | Ga0163163_10689848 | 3300014325 | Bacteria | 1085 |
| 577 | Ga0163163_12064237 | 3300014325 | Bacteria | 630 |
| 578 | Ga0157380_10006905 | 3300014326 | Bacteria | 8028 |
| 579 | Ga0157380_10035907 | 3300014326 | Bacteria | 3831 |
| 580 | Ga0157380_10076934 | 3300014326 | Bacteria | 2717 |
| 581 | Ga0157380_10201876 | 3300014326 | Unclassified | 1765 |
| 582 | Ga0157380_10782863 | 3300014326 | Unclassified | 969 |
| 583 | Ga0157380_10928265 | 3300014326 | Unclassified | 899 |
| 584 | Ga0157380_11289161 | 3300014326 | Bacteria | 777 |
| 585 | Ga0157380_11528996 | 3300014326 | Bacteria | 721 |
| 586 | Ga0157380_11993779 | 3300014326 | Bacteria | 642 |
| 587 | Ga0157380_12088468 | 3300014326 | Bacteria | 629 |
| 588 | Ga0157377_10002222 | 3300014745 | Bacteria | 8531 |
| 589 | Ga0157377_10252673 | 3300014745 | Bacteria | 1143 |
| 590 | Ga0157377_10272990 | 3300014745 | Bacteria | 1105 |
| 591 | Ga0157377_10348201 | 3300014745 | Bacteria | 993 |
| 592 | Ga0157377_10379779 | 3300014745 | Bacteria | 956 |
| 593 | Ga0157377_10492665 | 3300014745 | Bacteria | 855 |
| 594 | Ga0157377_11188573 | 3300014745 | Bacteria | 590 |
| 595 | Ga0157377_11570493 | 3300014745 | Unclassified | 526 |
| 596 | Ga0157379_10007948 | 3300014968 | Bacteria | 9198 |
| 597 | Ga0157379_10036364 | 3300014968 | Bacteria | 4392 |
| 598 | Ga0157379_10357621 | 3300014968 | Bacteria | 1338 |
| 599 | Ga0157379_10593386 | 3300014968 | Unclassified | 1033 |
| 600 | Ga0157379_10750551 | 3300014968 | Bacteria | 919 |
| 601 | Ga0157379_10838293 | 3300014968 | Bacteria | 869 |
| 602 | Ga0157379_11048765 | 3300014968 | Bacteria | 779 |
| 603 | Ga0157379_11086056 | 3300014968 | Bacteria | 766 |
| 604 | Ga0157379_11505074 | 3300014968 | Unclassified | 655 |
| 605 | Ga0157376_10000413 | 3300014969 | Bacteria | 27856 |
| 606 | Ga0157376_10000750 | 3300014969 | Bacteria | 21100 |
| 607 | Ga0157376_10076956 | 3300014969 | Bacteria | 2852 |
| 608 | Ga0157376_10081396 | 3300014969 | Bacteria | 2780 |
| 609 | Ga0157376_10331093 | 3300014969 | Bacteria | 1451 |
| 610 | Ga0157376_10427012 | 3300014969 | Unclassified | 1287 |
| 611 | Ga0157376_10973953 | 3300014969 | Unclassified | 870 |
| 612 | Ga0157376_11037100 | 3300014969 | Bacteria | 844 |
| 613 | Ga0157376_11894369 | 3300014969 | Bacteria | 633 |
| 614 | Ga0163161_10001316 | 3300017792 | Bacteria | 18501 |
| 615 | Ga0163161_10053296 | 3300017792 | Bacteria | 2933 |
| 616 | Ga0163161_10279383 | 3300017792 | Unclassified | 1309 |
| 617 | Ga0163161_10366417 | 3300017792 | Bacteria | 1149 |
| 618 | Ga0163161_10458618 | 3300017792 | Bacteria | 1031 |
| 619 | Ga0163161_10620831 | 3300017792 | Unclassified | 893 |
| 620 | Ga0163161_11228970 | 3300017792 | Bacteria | 649 |
| 621 | Ga0163161_11305371 | 3300017792 | Bacteria | 631 |
| 622 | Ga0206352_10827829 | 3300020078 | Bacteria | 734 |
| 623 | Ga0207666_1023067 | 3300025271 | Unclassified | 925 |
| 624 | Ga0207697_10023035 | 3300025315 | Bacteria | 2551 |
| 625 | Ga0207697_10110108 | 3300025315 | Bacteria | 1179 |
| 626 | Ga0207656_10086067 | 3300025321 | Unclassified | 1420 |
| 627 | Ga0207656_10134640 | 3300025321 | Bacteria | 1160 |
| 628 | Ga0207656_10159584 | 3300025321 | Bacteria | 1072 |
| 629 | Ga0207682_10028532 | 3300025893 | Bacteria | 2228 |
| 630 | Ga0207682_10034619 | 3300025893 | Bacteria | 2037 |
| 631 | Ga0207642_10007795 | 3300025899 | Bacteria | 3633 |
| 632 | Ga0207642_10147981 | 3300025899 | Bacteria | 1246 |
| 633 | Ga0207642_10206548 | 3300025899 | Bacteria | 1088 |
| 634 | Ga0207642_10424321 | 3300025899 | Bacteria | 800 |
| 635 | Ga0207642_10640105 | 3300025899 | Bacteria | 665 |
| 636 | Ga0207642_10808847 | 3300025899 | Bacteria | 596 |
| 637 | Ga0207710_10052057 | 3300025900 | Unclassified | 1840 |
| 638 | Ga0207680_10000094 | 3300025903 | Bacteria | 41323 |
| 639 | Ga0207680_10029123 | 3300025903 | Bacteria | 3098 |
| 640 | Ga0207680_11071843 | 3300025903 | Bacteria | 576 |
| 641 | Ga0207680_11272462 | 3300025903 | Unclassified | 523 |
| 642 | Ga0207647_10007614 | 3300025904 | Bacteria | 7804 |
| 643 | Ga0207647_10017600 | 3300025904 | Bacteria | 4856 |
| 644 | Ga0207647_10041035 | 3300025904 | Bacteria | 2912 |
| 645 | Ga0207647_10046603 | 3300025904 | Bacteria | 2701 |
| 646 | Ga0207647_10266544 | 3300025904 | Unclassified | 980 |
| 647 | Ga0207685_10027425 | 3300025905 | Bacteria | 1993 |
| 648 | Ga0207645_10084791 | 3300025907 | Bacteria | 2033 |
| 649 | Ga0207645_10216671 | 3300025907 | Bacteria | 1261 |
| 650 | Ga0207645_10557022 | 3300025907 | Bacteria | 778 |
| 651 | Ga0207645_10650883 | 3300025907 | Unclassified | 716 |
| 652 | Ga0207643_10007152 | 3300025908 | Bacteria | 5987 |
| 653 | Ga0207643_10025333 | 3300025908 | Bacteria | 3278 |
| 654 | Ga0207643_10059566 | 3300025908 | Bacteria | 2178 |
| 655 | Ga0207643_10113496 | 3300025908 | Bacteria | 1598 |
| 656 | Ga0207705_10008582 | 3300025909 | Bacteria | 7450 |
| 657 | Ga0207705_10055333 | 3300025909 | Bacteria | 2861 |
| 658 | Ga0207705_10166300 | 3300025909 | Bacteria | 1659 |
| 659 | Ga0207705_10280651 | 3300025909 | Bacteria | 1275 |
| 660 | Ga0207654_10003088 | 3300025911 | Bacteria | 8436 |
| 661 | Ga0207654_10184940 | 3300025911 | Bacteria | 1362 |
| 662 | Ga0207654_10330582 | 3300025911 | Bacteria | 1044 |
| 663 | Ga0207654_10828793 | 3300025911 | Bacteria | 669 |
| 664 | Ga0207654_11060440 | 3300025911 | Bacteria | 590 |
| 665 | Ga0207654_11323584 | 3300025911 | Bacteria | 525 |
| 666 | Ga0207707_10062557 | 3300025912 | Bacteria | 3239 |
| 667 | Ga0207707_10103916 | 3300025912 | Bacteria | 2483 |
| 668 | Ga0207707_10119337 | 3300025912 | Bacteria | 2305 |
| 669 | Ga0207707_10163448 | 3300025912 | Unclassified | 1946 |
| 670 | Ga0207695_10000146 | 3300025913 | Bacteria | 209416 |
| 671 | Ga0207695_10000260 | 3300025913 | Bacteria | 133317 |
| 672 | Ga0207695_10000710 | 3300025913 | Bacteria | 64886 |
| 673 | Ga0207695_10010090 | 3300025913 | Bacteria | 11599 |
| 674 | Ga0207695_10017182 | 3300025913 | Bacteria | 8431 |
| 675 | Ga0207695_10064382 | 3300025913 | Unclassified | 3775 |
| 676 | Ga0207695_10138314 | 3300025913 | Bacteria | 2387 |
| 677 | Ga0207695_10169135 | 3300025913 | Bacteria | 2112 |
| 678 | Ga0207671_10000521 | 3300025914 | Bacteria | 51898 |
| 679 | Ga0207671_10007458 | 3300025914 | Bacteria | 9488 |
| 680 | Ga0207671_10007953 | 3300025914 | Bacteria | 9088 |
| 681 | Ga0207671_10008591 | 3300025914 | Bacteria | 8635 |
| 682 | Ga0207671_10042530 | 3300025914 | Unclassified | 3362 |
| 683 | Ga0207671_10204854 | 3300025914 | Bacteria | 1541 |
| 684 | Ga0207671_10288215 | 3300025914 | Bacteria | 1296 |
| 685 | Ga0207671_10357069 | 3300025914 | Unclassified | 1159 |
| 686 | Ga0207671_11006390 | 3300025914 | Bacteria | 657 |
| 687 | Ga0207663_11184224 | 3300025916 | Bacteria | 615 |
| 688 | Ga0207663_11246156 | 3300025916 | Bacteria | 599 |
| 689 | Ga0207660_10433817 | 3300025917 | Bacteria | 1061 |
| 690 | Ga0207662_10069019 | 3300025918 | Bacteria | 2135 |
| 691 | Ga0207662_10610860 | 3300025918 | Unclassified | 759 |
| 692 | Ga0207657_10004587 | 3300025919 | Bacteria | 14598 |
| 693 | Ga0207657_10030587 | 3300025919 | Bacteria | 4885 |
| 694 | Ga0207657_10136984 | 3300025919 | Bacteria | 2002 |
| 695 | Ga0207649_10002980 | 3300025920 | Bacteria | 9328 |
| 696 | Ga0207652_10000600 | 3300025921 | Bacteria | 35986 |
| 697 | Ga0207652_10004269 | 3300025921 | Bacteria | 11660 |
| 698 | Ga0207652_10194077 | 3300025921 | Bacteria | 1826 |
| 699 | Ga0207646_10923997 | 3300025922 | Bacteria | 773 |
| 700 | Ga0207681_10015891 | 3300025923 | Unclassified | 4698 |
| 701 | Ga0207681_10199284 | 3300025923 | Bacteria | 1536 |
| 702 | Ga0207681_10376912 | 3300025923 | Unclassified | 1141 |
| 703 | Ga0207681_10849979 | 3300025923 | Bacteria | 763 |
| 704 | Ga0207694_10032101 | 3300025924 | Bacteria | 4017 |
| 705 | Ga0207694_10189298 | 3300025924 | Bacteria | 1671 |
| 706 | Ga0207694_10431327 | 3300025924 | Bacteria | 1099 |
| 707 | Ga0207694_11138995 | 3300025924 | Unclassified | 660 |
| 708 | Ga0207650_10022094 | 3300025925 | Unclassified | 4502 |
| 709 | Ga0207650_10097096 | 3300025925 | Bacteria | 2261 |
| 710 | Ga0207650_10120389 | 3300025925 | Bacteria | 2043 |
| 711 | Ga0207650_10161610 | 3300025925 | Bacteria | 1775 |
| 712 | Ga0207650_10300407 | 3300025925 | Bacteria | 1311 |
| 713 | Ga0207650_10361504 | 3300025925 | Unclassified | 1196 |
| 714 | Ga0207650_10374146 | 3300025925 | Unclassified | 1175 |
| 715 | Ga0207659_10004312 | 3300025926 | Bacteria | 8598 |
| 716 | Ga0207659_10074421 | 3300025926 | Bacteria | 2489 |
| 717 | Ga0207659_10119476 | 3300025926 | Bacteria | 2018 |
| 718 | Ga0207659_10125894 | 3300025926 | Bacteria | 1970 |
| 719 | Ga0207659_10275236 | 3300025926 | Bacteria | 1374 |
| 720 | Ga0207659_11462934 | 3300025926 | Bacteria | 585 |
| 721 | Ga0207644_10031425 | 3300025931 | Bacteria | 3699 |
| 722 | Ga0207644_10060503 | 3300025931 | Bacteria | 2741 |
| 723 | Ga0207644_10145291 | 3300025931 | Unclassified | 1831 |
| 724 | Ga0207644_10315365 | 3300025931 | Bacteria | 1263 |
| 725 | Ga0207644_11282226 | 3300025931 | Bacteria | 616 |
| 726 | Ga0207690_10043426 | 3300025932 | Bacteria | 2958 |
| 727 | Ga0207690_10270638 | 3300025932 | Bacteria | 1319 |
| 728 | Ga0207706_10037023 | 3300025933 | Unclassified | 4333 |
| 729 | Ga0207706_10043522 | 3300025933 | Unclassified | 3978 |
| 730 | Ga0207706_10065907 | 3300025933 | Bacteria | 3188 |
| 731 | Ga0207706_10601864 | 3300025933 | Bacteria | 944 |
| 732 | Ga0207686_10002929 | 3300025934 | Bacteria | 9191 |
| 733 | Ga0207686_10026838 | 3300025934 | Bacteria | 3365 |
| 734 | Ga0207686_10049961 | 3300025934 | Unclassified | 2599 |
| 735 | Ga0207686_10095030 | 3300025934 | Bacteria | 1977 |
| 736 | Ga0207686_10242052 | 3300025934 | Bacteria | 1313 |
| 737 | Ga0207686_10973273 | 3300025934 | Bacteria | 688 |
| 738 | Ga0207709_11228947 | 3300025935 | Bacteria | 618 |
| 739 | Ga0207670_10004053 | 3300025936 | Bacteria | 7839 |
| 740 | Ga0207670_10006091 | 3300025936 | Bacteria | 6664 |
| 741 | Ga0207670_10006843 | 3300025936 | Bacteria | 6344 |
| 742 | Ga0207670_10179379 | 3300025936 | Unclassified | 1594 |
| 743 | Ga0207670_10857610 | 3300025936 | Unclassified | 759 |
| 744 | Ga0207669_10889902 | 3300025937 | Unclassified | 743 |
| 745 | Ga0207704_10066278 | 3300025938 | Bacteria | 2265 |
| 746 | Ga0207704_10140609 | 3300025938 | Unclassified | 1688 |
| 747 | Ga0207704_10172845 | 3300025938 | Bacteria | 1552 |
| 748 | Ga0207704_10402528 | 3300025938 | Bacteria | 1080 |
| 749 | Ga0207704_10726967 | 3300025938 | Bacteria | 824 |
| 750 | Ga0207704_10870466 | 3300025938 | Unclassified | 756 |
| 751 | Ga0207665_10416459 | 3300025939 | Unclassified | 1026 |
| 752 | Ga0207691_10016246 | 3300025940 | Bacteria | 7066 |
| 753 | Ga0207691_10051879 | 3300025940 | Unclassified | 3748 |
| 754 | Ga0207691_10085361 | 3300025940 | Bacteria | 2833 |
| 755 | Ga0207691_10093266 | 3300025940 | Bacteria | 2696 |
| 756 | Ga0207691_10130759 | 3300025940 | Bacteria | 2218 |
| 757 | Ga0207691_10443869 | 3300025940 | Bacteria | 1104 |
| 758 | Ga0207691_10736646 | 3300025940 | Bacteria | 830 |
| 759 | Ga0207691_10994326 | 3300025940 | Bacteria | 700 |
| 760 | Ga0207691_11696769 | 3300025940 | Unclassified | 511 |
| 761 | Ga0207711_10933177 | 3300025941 | Bacteria | 806 |
| 762 | Ga0207689_10000782 | 3300025942 | Bacteria | 30527 |
| 763 | Ga0207689_10002426 | 3300025942 | Bacteria | 17350 |
| 764 | Ga0207689_10005675 | 3300025942 | Bacteria | 11104 |
| 765 | Ga0207689_10020924 | 3300025942 | Bacteria | 5499 |
| 766 | Ga0207689_10032975 | 3300025942 | Bacteria | 4305 |
| 767 | Ga0207689_10071899 | 3300025942 | Unclassified | 2841 |
| 768 | Ga0207689_10076621 | 3300025942 | Bacteria | 2749 |
| 769 | Ga0207689_10711214 | 3300025942 | Bacteria | 847 |
| 770 | Ga0207689_10960806 | 3300025942 | Bacteria | 721 |
| 771 | Ga0207689_11289314 | 3300025942 | Unclassified | 614 |
| 772 | Ga0207661_10000589 | 3300025944 | Bacteria | 23208 |
| 773 | Ga0207661_10416115 | 3300025944 | Bacteria | 1220 |
| 774 | Ga0207661_10643656 | 3300025944 | Unclassified | 974 |
| 775 | Ga0207679_10001213 | 3300025945 | Bacteria | 16399 |
| 776 | Ga0207679_10064596 | 3300025945 | Unclassified | 2736 |
| 777 | Ga0207679_10354224 | 3300025945 | Bacteria | 1280 |
| 778 | Ga0207679_10356516 | 3300025945 | Bacteria | 1276 |
| 779 | Ga0207679_10635645 | 3300025945 | Bacteria | 964 |
| 780 | Ga0207679_10658963 | 3300025945 | Unclassified | 947 |
| 781 | Ga0207667_10000412 | 3300025949 | Bacteria | 57917 |
| 782 | Ga0207667_10047903 | 3300025949 | Unclassified | 4521 |
| 783 | Ga0207667_10088889 | 3300025949 | Bacteria | 3194 |
| 784 | Ga0207667_10606063 | 3300025949 | Unclassified | 1104 |
| 785 | Ga0207667_10624159 | 3300025949 | Bacteria | 1085 |
| 786 | Ga0207667_11081112 | 3300025949 | Bacteria | 786 |
| 787 | Ga0207667_12147752 | 3300025949 | Unclassified | 516 |
| 788 | Ga0207651_10002163 | 3300025960 | Bacteria | 9299 |
| 789 | Ga0207651_10097924 | 3300025960 | Bacteria | 2167 |
| 790 | Ga0207651_10445227 | 3300025960 | Bacteria | 1110 |
| 791 | Ga0207651_10576251 | 3300025960 | Bacteria | 981 |
| 792 | Ga0207712_10000635 | 3300025961 | Bacteria | 27680 |
| 793 | Ga0207712_10001944 | 3300025961 | Bacteria | 13567 |
| 794 | Ga0207712_10032310 | 3300025961 | Bacteria | 3532 |
| 795 | Ga0207712_10040473 | 3300025961 | Bacteria | 3199 |
| 796 | Ga0207712_10193363 | 3300025961 | Unclassified | 1607 |
| 797 | Ga0207712_10205626 | 3300025961 | Bacteria | 1564 |
| 798 | Ga0207712_10335896 | 3300025961 | Unclassified | 1251 |
| 799 | Ga0207712_10384346 | 3300025961 | Bacteria | 1176 |
| 800 | Ga0207712_10481176 | 3300025961 | Bacteria | 1058 |
| 801 | Ga0207712_10622490 | 3300025961 | Bacteria | 936 |
| 802 | Ga0207712_10847547 | 3300025961 | Bacteria | 805 |
| 803 | Ga0207712_11691608 | 3300025961 | Bacteria | 567 |
| 804 | Ga0207668_10013093 | 3300025972 | Bacteria | 5099 |
| 805 | Ga0207668_10085088 | 3300025972 | Bacteria | 2306 |
| 806 | Ga0207668_10376977 | 3300025972 | Bacteria | 1193 |
| 807 | Ga0207668_10546780 | 3300025972 | Bacteria | 1002 |
| 808 | Ga0207668_10870197 | 3300025972 | Unclassified | 801 |
| 809 | Ga0207668_11928531 | 3300025972 | Bacteria | 532 |
| 810 | Ga0207640_10059030 | 3300025981 | Bacteria | 2530 |
| 811 | Ga0207640_10214935 | 3300025981 | Bacteria | 1468 |
| 812 | Ga0207640_10273732 | 3300025981 | Bacteria | 1322 |
| 813 | Ga0207640_10286367 | 3300025981 | Bacteria | 1297 |
| 814 | Ga0207640_10391302 | 3300025981 | Bacteria | 1129 |
| 815 | Ga0207640_10525298 | 3300025981 | Unclassified | 990 |
| 816 | Ga0207640_10658271 | 3300025981 | Bacteria | 893 |
| 817 | Ga0207640_10822602 | 3300025981 | Unclassified | 806 |
| 818 | Ga0207640_10996431 | 3300025981 | Bacteria | 737 |
| 819 | Ga0207640_11072794 | 3300025981 | Unclassified | 711 |
| 820 | Ga0207640_11244323 | 3300025981 | Bacteria | 663 |
| 821 | Ga0207658_10008642 | 3300025986 | Bacteria | 6926 |
| 822 | Ga0207658_10009222 | 3300025986 | Bacteria | 6689 |
| 823 | Ga0207658_10050007 | 3300025986 | Bacteria | 3074 |
| 824 | Ga0207658_10124032 | 3300025986 | Unclassified | 2064 |
| 825 | Ga0207658_10493565 | 3300025986 | Bacteria | 1090 |
| 826 | Ga0207658_10656993 | 3300025986 | Bacteria | 945 |
| 827 | Ga0207658_10752928 | 3300025986 | Bacteria | 882 |
| 828 | Ga0207658_10775605 | 3300025986 | Bacteria | 869 |
| 829 | Ga0207658_10866965 | 3300025986 | Bacteria | 821 |
| 830 | Ga0207658_11081913 | 3300025986 | Bacteria | 732 |
| 831 | Ga0207677_10028124 | 3300026023 | Bacteria | 3551 |
| 832 | Ga0207677_10264873 | 3300026023 | Bacteria | 1403 |
| 833 | Ga0207677_10285894 | 3300026023 | Bacteria | 1356 |
| 834 | Ga0207677_10740041 | 3300026023 | Unclassified | 875 |
| 835 | Ga0207677_10900687 | 3300026023 | Unclassified | 797 |
| 836 | Ga0207703_10178497 | 3300026035 | Bacteria | 1873 |
| 837 | Ga0207703_10407818 | 3300026035 | Bacteria | 1262 |
| 838 | Ga0207703_10652608 | 3300026035 | Bacteria | 998 |
| 839 | Ga0207703_11417227 | 3300026035 | Bacteria | 668 |
| 840 | Ga0207639_10006274 | 3300026041 | Bacteria | 8074 |
| 841 | Ga0207639_10012159 | 3300026041 | Bacteria | 5989 |
| 842 | Ga0207639_10012272 | 3300026041 | Bacteria | 5966 |
| 843 | Ga0207639_10143458 | 3300026041 | Bacteria | 1992 |
| 844 | Ga0207639_10275291 | 3300026041 | Bacteria | 1478 |
| 845 | Ga0207639_10340133 | 3300026041 | Bacteria | 1337 |
| 846 | Ga0207639_10563204 | 3300026041 | Bacteria | 1047 |
| 847 | Ga0207639_10781293 | 3300026041 | Bacteria | 889 |
| 848 | Ga0207639_10894867 | 3300026041 | Bacteria | 829 |
| 849 | Ga0207639_10926939 | 3300026041 | Unclassified | 815 |
| 850 | Ga0207678_10233492 | 3300026067 | Bacteria | 1575 |
| 851 | Ga0207678_10831594 | 3300026067 | Unclassified | 816 |
| 852 | Ga0207708_10023371 | 3300026075 | Bacteria | 4671 |
| 853 | Ga0207708_10117995 | 3300026075 | Bacteria | 2065 |
| 854 | Ga0207708_10172222 | 3300026075 | Bacteria | 1715 |
| 855 | Ga0207702_10016752 | 3300026078 | Bacteria | 6066 |
| 856 | Ga0207702_10026898 | 3300026078 | Bacteria | 4777 |
| 857 | Ga0207702_10032842 | 3300026078 | Bacteria | 4332 |
| 858 | Ga0207702_10046879 | 3300026078 | Bacteria | 3640 |
| 859 | Ga0207702_10058987 | 3300026078 | Bacteria | 3268 |
| 860 | Ga0207702_10237328 | 3300026078 | Bacteria | 1707 |
| 861 | Ga0207702_10359050 | 3300026078 | Unclassified | 1396 |
| 862 | Ga0207702_11851094 | 3300026078 | Bacteria | 595 |
| 863 | Ga0207641_10002898 | 3300026088 | Bacteria | 15523 |
| 864 | Ga0207641_10003127 | 3300026088 | Bacteria | 14880 |
| 865 | Ga0207641_10025697 | 3300026088 | Bacteria | 4855 |
| 866 | Ga0207641_10218543 | 3300026088 | Bacteria | 1766 |
| 867 | Ga0207641_10330202 | 3300026088 | Bacteria | 1448 |
| 868 | Ga0207641_10544938 | 3300026088 | Bacteria | 1131 |
| 869 | Ga0207641_10627508 | 3300026088 | Bacteria | 1054 |
| 870 | Ga0207641_10928272 | 3300026088 | Bacteria | 865 |
| 871 | Ga0207641_11113768 | 3300026088 | Unclassified | 788 |
| 872 | Ga0207641_11163787 | 3300026088 | Unclassified | 770 |
| 873 | Ga0207641_11759136 | 3300026088 | Bacteria | 622 |
| 874 | Ga0207648_10049504 | 3300026089 | Bacteria | 3676 |
| 875 | Ga0207648_10061500 | 3300026089 | Bacteria | 3274 |
| 876 | Ga0207648_10075260 | 3300026089 | Bacteria | 2943 |
| 877 | Ga0207648_10116683 | 3300026089 | Bacteria | 2346 |
| 878 | Ga0207648_10212798 | 3300026089 | Bacteria | 1716 |
| 879 | Ga0207648_10249807 | 3300026089 | Unclassified | 1581 |
| 880 | Ga0207648_10343100 | 3300026089 | Bacteria | 1345 |
| 881 | Ga0207648_10432438 | 3300026089 | Bacteria | 1196 |
| 882 | Ga0207648_10493260 | 3300026089 | Unclassified | 1120 |
| 883 | Ga0207648_10628988 | 3300026089 | Bacteria | 991 |
| 884 | Ga0207648_10652634 | 3300026089 | Unclassified | 972 |
| 885 | Ga0207648_10767574 | 3300026089 | Bacteria | 896 |
| 886 | Ga0207648_10868074 | 3300026089 | Bacteria | 842 |
| 887 | Ga0207676_10031626 | 3300026095 | Bacteria | 3981 |
| 888 | Ga0207676_10090389 | 3300026095 | Bacteria | 2512 |
| 889 | Ga0207676_10120513 | 3300026095 | Unclassified | 2211 |
| 890 | Ga0207676_10671460 | 3300026095 | Bacteria | 1001 |
| 891 | Ga0207676_11749376 | 3300026095 | Bacteria | 620 |
| 892 | Ga0207674_10002240 | 3300026116 | Bacteria | 24495 |
| 893 | Ga0207674_10007723 | 3300026116 | Bacteria | 12519 |
| 894 | Ga0207674_10033912 | 3300026116 | Bacteria | 5341 |
| 895 | Ga0207674_10042800 | 3300026116 | Bacteria | 4674 |
| 896 | Ga0207674_10201576 | 3300026116 | Bacteria | 1939 |
| 897 | Ga0207674_10236981 | 3300026116 | Bacteria | 1772 |
| 898 | Ga0207674_10522909 | 3300026116 | Bacteria | 1146 |
| 899 | Ga0207674_12028149 | 3300026116 | Unclassified | 540 |
| 900 | Ga0207675_100000272 | 3300026118 | Bacteria | 49071 |
| 901 | Ga0207675_100010822 | 3300026118 | Bacteria | 8547 |
| 902 | Ga0207675_100089068 | 3300026118 | Bacteria | 2899 |
| 903 | Ga0207675_100115741 | 3300026118 | Bacteria | 2533 |
| 904 | Ga0207675_100127065 | 3300026118 | Bacteria | 2416 |
| 905 | Ga0207675_100613690 | 3300026118 | Bacteria | 1092 |
| 906 | Ga0207675_101225265 | 3300026118 | Bacteria | 771 |
| 907 | Ga0207675_101600170 | 3300026118 | Unclassified | 672 |
| 908 | Ga0207683_10054829 | 3300026121 | Unclassified | 3495 |
| 909 | Ga0207683_10102454 | 3300026121 | Bacteria | 2556 |
| 910 | Ga0207683_10189131 | 3300026121 | Bacteria | 1869 |
| 911 | Ga0207683_10862777 | 3300026121 | Bacteria | 840 |
| 912 | Ga0207698_10044521 | 3300026142 | Bacteria | 3336 |
| 913 | Ga0207698_10047671 | 3300026142 | Unclassified | 3248 |
| 914 | Ga0207698_10139033 | 3300026142 | Bacteria | 2089 |
| 915 | Ga0207698_10141275 | 3300026142 | Bacteria | 2075 |
| 916 | Ga0207698_10193667 | 3300026142 | Unclassified | 1814 |
| 917 | Ga0207698_10226677 | 3300026142 | Bacteria | 1693 |
| 918 | Ga0207698_10399821 | 3300026142 | Bacteria | 1313 |
| 919 | Ga0207698_10442589 | 3300026142 | Bacteria | 1252 |
| 920 | Ga0207698_10640566 | 3300026142 | Unclassified | 1052 |
| 921 | Ga0207698_10668353 | 3300026142 | Unclassified | 1031 |
| 922 | Ga0207698_11966986 | 3300026142 | Unclassified | 599 |
| 923 | Ga0207698_12264387 | 3300026142 | Bacteria | 556 |
| 924 | Ga0207428_10074292 | 3300027907 | Bacteria | 2666 |
| 925 | Ga0207428_10096093 | 3300027907 | Bacteria | 2294 |
| 926 | Ga0207428_10501672 | 3300027907 | Bacteria | 881 |
| 927 | Ga0207428_10837399 | 3300027907 | Unclassified | 652 |
| 928 | Ga0268266_10000026 | 3300028379 | Bacteria | 434485 |
| 929 | Ga0268266_10050123 | 3300028379 | Bacteria | 3582 |
| 930 | Ga0268266_10322127 | 3300028379 | Bacteria | 1447 |
| 931 | Ga0268266_11651346 | 3300028379 | Bacteria | 616 |
| 932 | Ga0268265_10002020 | 3300028380 | Bacteria | 15920 |
| 933 | Ga0268265_10029555 | 3300028380 | Unclassified | 3935 |
| 934 | Ga0268265_10156390 | 3300028380 | Bacteria | 1930 |
| 935 | Ga0268265_10674948 | 3300028380 | Bacteria | 996 |
| 936 | Ga0268265_10810927 | 3300028380 | Bacteria | 913 |
| 937 | Ga0268265_10984990 | 3300028380 | Bacteria | 832 |
| 938 | Ga0268265_11102328 | 3300028380 | Bacteria | 788 |
| 939 | Ga0268265_11995093 | 3300028380 | Bacteria | 587 |
| 940 | Ga0268264_10000019 | 3300028381 | Bacteria | 488112 |
| 941 | Ga0268264_10001326 | 3300028381 | Bacteria | 23282 |
| 942 | Ga0268264_10008883 | 3300028381 | Bacteria | 8332 |
| 943 | Ga0268264_10021339 | 3300028381 | Bacteria | 5288 |
| 944 | Ga0268264_10072148 | 3300028381 | Bacteria | 2927 |
| 945 | Ga0268264_10097296 | 3300028381 | Bacteria | 2551 |
| 946 | Ga0268264_10132747 | 3300028381 | Bacteria | 2210 |
| 947 | Ga0268264_10500057 | 3300028381 | Bacteria | 1185 |
| 948 | Ga0268264_10679106 | 3300028381 | Bacteria | 1021 |
| 949 | Ga0268264_11026929 | 3300028381 | Bacteria | 831 |
| 950 | Ga0268264_11600630 | 3300028381 | Bacteria | 662 |
| 951 | Ga0268264_12211947 | 3300028381 | Bacteria | 558 |
| 952 | Ga0265318_10201464 | 3300028577 | Bacteria | 727 |
| 953 | Ga0307517_10011275 | 3300028786 | Bacteria | 12404 |
| 954 | Ga0307517_10093071 | 3300028786 | Bacteria | 2447 |
| 955 | Ga0307515_10575593 | 3300028794 | Bacteria | 736 |
| 956 | Ga0307511_10000104 | 3300030521 | Bacteria | 75069 |
| 957 | Ga0265327_10077528 | 3300031251 | Unclassified | 1648 |
| 958 | Ga0307509_10015435 | 3300031507 | Bacteria | 8910 |
| 959 | Ga0307516_10000496 | 3300031730 | Bacteria | 52327 |
| 960 | Ga0307413_10662502 | 3300031824 | Bacteria | 862 |
| 961 | Ga0307410_11056765 | 3300031852 | Unclassified | 702 |
| 962 | Ga0307410_11404459 | 3300031852 | Bacteria | 613 |
| 963 | Ga0307416_102500867 | 3300032002 | Unclassified | 615 |
| 964 | Ga0307414_10356658 | 3300032004 | Unclassified | 1257 |
| 965 | Ga0307411_10387126 | 3300032005 | Bacteria | 1152 |
| 966 | Ga0307415_100175945 | 3300032126 | Bacteria | 1674 |
| 967 | Ga0307510_10000165 | 3300033180 | Bacteria | 55957 |
| 968 | Ga0373932_0315769 | 3300035112 | Bacteria | 586 |
| 969 | Ga0373953_0234122 | 3300035117 | Bacteria | 797 |
| 970 | Ga0373955_0181131 | 3300035172 | Bacteria | 1250 |
| 971 | Ga0373924_0261027 | 3300035410 | Bacteria | 768 |
| 972 | Ga0373933_0373853 | 3300035724 | Bacteria | 928 |
| 973 | Ga0373947_0355700 | 3300035725 | Bacteria | 983 |
| 974 | Ga0373937_0084352 | 3300036401 | Bacteria | 2939 |
| 975 | Ga0395899_0252430 | 3300037312 | Bacteria | 1210 |
| 976 | Ga0395900_0014336 | 3300037418 | Bacteria | 8093 |
| 977 | Ga0395900_0074008 | 3300037418 | Bacteria | 3503 |
| 978 | Ga0395900_0367487 | 3300037418 | Bacteria | 1409 |
| 979 | Ga0395900_0632103 | 3300037418 | Bacteria | 1009 |
| 980 | Ga0395900_0882422 | 3300037418 | Bacteria | 818 |
| 981 | Ga0395898_0936932 | 3300037466 | Bacteria | 803 |
| 982 | Ga0395898_1084686 | 3300037466 | Bacteria | 734 |
| 983 | Ga0395905_0056220 | 3300037471 | Bacteria | 3682 |
| 984 | Ga0395905_0223658 | 3300037471 | Bacteria | 1761 |
| 985 | Ga0395905_0750103 | 3300037471 | Bacteria | 878 |
| 986 | Ga0395901_0113712 | 3300038443 | Bacteria | 2843 |
| 987 | Ga0436365_1454878 | 3300039437 | Unclassified | 1788 |
| 988 | Ga0439439_0121417 | 3300041406 | Unclassified | 729 |
| 989 | Ga0439439_0267459 | 3300041406 | Bacteria | 510 |
| 990 | Ga0451795_0932631 | 3300041456 | Bacteria | 564 |
| 991 | Ga0451798_0665617 | 3300041458 | Unclassified | 567 |
| 992 | Ga0451800_0522342 | 3300041459 | Bacteria | 677 |
| 993 | Ga0451800_0593180 | 3300041459 | Bacteria | 921 |
| 994 | Ga0451807_0527209 | 3300041486 | Bacteria | 1259 |
| 995 | Ga0451839_0813408 | 3300041496 | Unclassified | 754 |
| 996 | Ga0451851_0359937 | 3300041507 | Unclassified | 752 |
| 997 | Ga0451843_0340892 | 3300041509 | Bacteria | 1728 |
| 998 | Ga0439431_0000771 | 3300041997 | Bacteria | 6923 |
| 999 | Ga0439441_082506 | 3300042001 | Unclassified | 702 |
| 1000 | Ga0439445_0042376 | 3300042004 | Bacteria | 1212 |
| 1001 | Ga0450922_005365 | 3300042124 | Bacteria | 1187 |
| 1002 | Ga0451577_0043354 | 3300042876 | Bacteria | 4030 |
| 1003 | Ga0451577_1038663 | 3300042876 | Unclassified | 735 |
| 1004 | Ga0466972_0001642 | 3300044658 | Bacteria | 10936 |
| 1005 | Ga0453683_1090042 | 3300044673 | Bacteria | 532 |
| 1006 | Ga0466965_0394210 | 3300044683 | Bacteria | 764 |
| 1007 | Ga0466961_0035368 | 3300044693 | Bacteria | 3208 |
| 1008 | Ga0466963_0468403 | 3300044694 | Bacteria | 889 |
| 1009 | Ga0466964_0168709 | 3300044706 | Bacteria | 1029 |
| 1010 | Ga0466964_0198399 | 3300044706 | Bacteria | 962 |
| 1011 | Ga0453684_0088334 | 3300044712 | Bacteria | 3838 |
| 1012 | Ga0453684_0468358 | 3300044712 | Bacteria | 1400 |
| 1013 | Ga0466971_0085454 | 3300044719 | Bacteria | 1442 |
| 1014 | Ga0466971_0282457 | 3300044719 | Bacteria | 795 |
| 1015 | Ga0466968_0186458 | 3300044735 | Bacteria | 967 |
| 1016 | Ga0466970_0023973 | 3300044765 | Bacteria | 3190 |
| 1017 | Ga0466957_0240479 | 3300044842 | Bacteria | 1201 |
| 1018 | Ga0466959_0014957 | 3300045049 | Bacteria | 5655 |
| 1019 | Ga0466959_0112179 | 3300045049 | Bacteria | 1945 |
| 1020 | Ga0451576_0170624 | 3300045051 | Unclassified | 2271 |
| 1021 | Ga0495592_0238753 | 3300046454 | Bacteria | 1207 |
| 1022 | Ga0495650_0066329 | 3300046471 | Bacteria | 1429 |
| 1023 | Ga0495606_0002353 | 3300046507 | Bacteria | 22201 |
| 1024 | Ga0495618_0257935 | 3300046514 | Bacteria | 1092 |
| 1025 | Ga0495628_0042110 | 3300046516 | Bacteria | 3644 |
| 1026 | Ga0495632_0264974 | 3300046519 | Unclassified | 768 |
| 1027 | Ga0495643_0039688 | 3300046522 | Unclassified | 2574 |
| 1028 | Ga0495648_0003175 | 3300046524 | Bacteria | 14631 |
| 1029 | Ga0495648_0121581 | 3300046524 | Bacteria | 1403 |
| 1030 | Ga0495587_0409983 | 3300046536 | Bacteria | 753 |
| 1031 | Ga0495598_0455886 | 3300046537 | Bacteria | 507 |
| 1032 | Ga0495621_0179807 | 3300046539 | Bacteria | 844 |
| 1033 | Ga0495621_0287582 | 3300046539 | Bacteria | 679 |
| 1034 | Ga0495597_0278305 | 3300046542 | Unclassified | 652 |
| 1035 | Ga0495668_0000099 | 3300046616 | Bacteria | 137915 |
| 1036 | Ga0495611_0000072 | 3300046648 | Bacteria | 70916 |
| 1037 | Ga0495611_0278036 | 3300046648 | Unclassified | 774 |
| 1038 | Ga0495625_0331401 | 3300046660 | Unclassified | 967 |
| 1039 | Ga0495657_0248461 | 3300046675 | Unclassified | 1072 |
| 1040 | Ga0495613_0727141 | 3300046689 | Bacteria | 652 |
| 1041 | Ga0495671_0618973 | 3300046692 | Unclassified | 515 |
| 1042 | Ga0495649_0295955 | 3300046694 | Unclassified | 825 |
| 1043 | Ga0495636_0205653 | 3300047318 | Bacteria | 900 |
| 1044 | Ga0495674_0412029 | 3300047319 | Bacteria | 1090 |
| 1045 | Ga0495672_0089133 | 3300047320 | Bacteria | 1699 |
| 1046 | Ga0495672_0110762 | 3300047320 | Bacteria | 1474 |
| 1047 | Ga0495687_000058 | 3300047443 | Bacteria | 185830 |
| 1048 | Ga0495686_0000005 | 3300047472 | Bacteria | 827143 |
| 1049 | Ga0495686_0023576 | 3300047472 | Bacteria | 4058 |
| 1050 | Ga0495686_0024167 | 3300047472 | Bacteria | 3996 |
| 1051 | Ga0496100_0915876 | 3300048903 | Bacteria | 689 |
| 1052 | Ga0496100_1307316 | 3300048903 | Bacteria | 572 |
| 1053 | Ga0496101_0160962 | 3300048904 | Bacteria | 1721 |
| 1054 | Ga0496105_0452192 | 3300048908 | Bacteria | 1014 |
| 1055 | Ga0496108_1600443 | 3300048911 | Bacteria | 539 |
| 1056 | Ga0496114_0462096 | 3300048917 | Bacteria | 1124 |
| 1057 | Ga0496114_0870052 | 3300048917 | Unclassified | 782 |
| 1058 | Ga0496124_0208162 | 3300048927 | Unclassified | 1482 |
| 1059 | Ga0496126_1342862 | 3300048929 | Unclassified | 519 |
| 1060 | Ga0501302_024939 | 3300049525 | Unclassified | 539 |
| 1061 | Ga0501033_0036158 | 3300049570 | Bacteria | 3702 |
| 1062 | Ga0501033_0297994 | 3300049570 | Unclassified | 1136 |
| 1063 | Ga0501034_0009891 | 3300049571 | Bacteria | 9969 |
| 1064 | Ga0501034_0019453 | 3300049571 | Bacteria | 6946 |
| 1065 | Ga0501038_0387028 | 3300049574 | Bacteria | 1084 |
| 1066 | Ga0501043_0755437 | 3300049579 | Bacteria | 707 |
| 1067 | Ga0501047_1370972 | 3300049581 | Bacteria | 522 |
| 1068 | Ga0501070_1301951 | 3300049586 | Bacteria | 555 |
| 1069 | Ga0501201_010632 | 3300049651 | Bacteria | 903 |
| 1070 | Ga0501223_028028 | 3300049663 | Bacteria | 1096 |
| 1071 | Ga0501238_001961 | 3300049671 | Bacteria | 2413 |
| 1072 | Ga0501259_039154 | 3300049688 | Bacteria | 926 |
| 1073 | Ga0501225_0095077 | 3300049705 | Bacteria | 866 |
| 1074 | Ga0501080_0698503 | 3300049742 | Bacteria | 895 |
| 1075 | Ga0501044_0049938 | 3300049823 | Bacteria | 4318 |
| 1076 | Ga0501044_0151585 | 3300049823 | Unclassified | 2300 |
| 1077 | Ga0501044_1675554 | 3300049823 | Bacteria | 501 |
| 1078 | nmdc:mga0k408_2506_c1 | 3300050493 | Bacteria | 9769 |
| 1079 | nmdc:mga05p37_99959_c1 | 3300050507 | Bacteria | 3572 |
| 1080 | nmdc:mga06r32_1869738_c1 | 3300050510 | Bacteria | 535 |
| 1081 | nmdc:mga08y16_1119709_c1 | 3300050511 | Bacteria | 761 |
| 1082 | nmdc:mga08y16_31220_c1 | 3300050511 | Bacteria | 5605 |
| 1083 | nmdc:mga08y16_31670_c1 | 3300050511 | Bacteria | 5560 |
| 1084 | nmdc:mga08y16_335606_c1 | 3300050511 | Bacteria | 1554 |
| 1085 | nmdc:mga08y16_478500_c1 | 3300050511 | Bacteria | 1267 |
| 1086 | nmdc:mga08y16_680998_c1 | 3300050511 | Unclassified | 1030 |
| 1087 | nmdc:mga0n895_1414893_c1 | 3300050512 | Unclassified | 663 |
| 1088 | nmdc:mga0n895_263898_c1 | 3300050512 | Bacteria | 1747 |
| 1089 | Ga0500583_0001474 | 3300053092 | Bacteria | 6765 |
| 1090 | Ga0500583_0138969 | 3300053092 | Viruses | 1206 |
| 1091 | Ga0500562_000086 | 3300053108 | Bacteria | 38952 |
| 1092 | Ga0500594_0139425 | 3300053118 | Unclassified | 773 |
| 1093 | Ga0500621_213564 | 3300053126 | Bacteria | 674 |
| 1094 | Ga0500642_0004786 | 3300053130 | Unclassified | 4284 |
| 1095 | Ga0500568_0017273 | 3300053139 | Unclassified | 3189 |
| 1096 | Ga0500588_0060870 | 3300053146 | Bacteria | 1209 |
| 1097 | Ga0500616_0101068 | 3300053153 | Bacteria | 1409 |
| 1098 | Ga0500622_0002308 | 3300053156 | Bacteria | 13946 |
| 1099 | Ga0500637_0015463 | 3300053178 | Bacteria | 4046 |
| 1100 | Ga0500645_148775 | 3300053730 | Bacteria | 645 |
| 1101 | Ga0466962_0023375 | 3300061719 | Bacteria | 2971 |
| 1102 | 2819586342 | 2818991444 | Bacteria | 6968812 |
| 1103 | 2883069955 | 2883068021 | Bacteria | 6192739 |
| 1104 | 2929178258 | 2929177148 | Bacteria | 7883697 |
| 1105 | 2945980623 | 2945977869 | Bacteria | 7777518 |
| 1106 | 2946013513 | 2946013367 | Bacteria | 7766675 |
| 1107 | Ga0068862_100530265 | |||
| 1108 | SwRhRL3b_contig_2918446 | |||
| 1109 | JGI24744J21845_10026421 | |||
| 1110 | rootH1_10028407 | |||
| 1111 | rootH1_10141854 | |||
| 1112 | rootH2_10001899 | |||
| 1113 | rootH2_10020140 | |||
| 1114 | rootH2_10040793 | |||
| 1115 | rootH2_10136990 | |||
| 1116 | rootH2_10295585 | |||
| 1117 | rootH1_10153867 | |||
| 1118 | rootH1_10173844 | |||
| 1119 | Ga0065714_10037887 | |||
| 1120 | Ga0065714_10170248 | |||
| 1121 | Ga0065712_10000551 | |||
| 1122 | Ga0065712_10120229 | |||
| 1123 | Ga0065712_10344289 | |||
| 1124 | Ga0065712_10596010 | |||
| 1125 | Ga0065715_10109776 | |||
| 1126 | Ga0065715_10442593 | |||
| 1127 | Ga0065707_10094361 | |||
| 1128 | Ga0070658_10203021 | |||
| 1129 | Ga0070658_10216352 | |||
| 1130 | Ga0070658_10217779 | |||
| 1131 | Ga0070676_10053894 | |||
| 1132 | Ga0070676_10063787 | |||
| 1133 | Ga0070676_10190953 | |||
| 1134 | Ga0070683_100000690 | |||
| 1135 | Ga0070683_100008953 | |||
| 1136 | Ga0070683_100358092 | |||
| 1137 | Ga0070683_100914247 | |||
| 1138 | Ga0070683_101583656 | |||
| 1139 | Ga0070690_100022866 | |||
| 1140 | Ga0070690_100887562 | |||
| 1141 | Ga0070670_100027295 | |||
| 1142 | Ga0070670_100050041 | |||
| 1143 | Ga0070670_100080085 | |||
| 1144 | Ga0070670_100124164 | |||
| 1145 | Ga0070670_100128886 | |||
| 1146 | Ga0070670_100141443 | |||
| 1147 | Ga0070670_100340293 | |||
| 1148 | Ga0070670_100526442 | |||
| 1149 | Ga0070670_100903023 | |||
| 1150 | Ga0070677_10023701 | |||
| 1151 | Ga0070677_10051993 | |||
| 1152 | Ga0070677_10255936 | |||
| 1153 | Ga0070677_10472948 | |||
| 1154 | Ga0068869_100008462 | |||
| 1155 | Ga0068869_100013414 | |||
| 1156 | Ga0068869_100090117 | |||
| 1157 | Ga0068869_100099176 | |||
| 1158 | Ga0068869_100669985 | |||
| 1159 | Ga0068869_101492840 | |||
| 1160 | Ga0070666_10000019 | |||
| 1161 | Ga0070666_10008203 | |||
| 1162 | Ga0070680_100107808 | |||
| 1163 | Ga0070682_100017287 | |||
| 1164 | Ga0070682_100406239 | |||
| 1165 | Ga0070682_100451971 | |||
| 1166 | Ga0068868_100148510 | |||
| 1167 | Ga0068868_100156233 | |||
| 1168 | Ga0068868_100280714 | |||
| 1169 | Ga0068868_100523648 | |||
| 1170 | Ga0068868_100563530 | |||
| 1171 | Ga0068868_100807207 | |||
| 1172 | Ga0068868_100895310 | |||
| 1173 | Ga0068868_100914227 | |||
| 1174 | Ga0070660_100000201 | |||
| 1175 | Ga0070660_100022598 | |||
| 1176 | Ga0070689_100007906 | |||
| 1177 | Ga0070689_100023615 | |||
| 1178 | Ga0070689_100055775 | |||
| 1179 | Ga0070689_100136844 | |||
| 1180 | Ga0070689_100348245 | |||
| 1181 | Ga0070689_100435507 | |||
| 1182 | Ga0070689_101238980 | |||
| 1183 | Ga0070689_101439739 | |||
| 1184 | Ga0070687_100103775 | |||
| 1185 | Ga0070687_100694797 | |||
| 1186 | Ga0070661_100000615 | |||
| 1187 | Ga0070661_100417412 | |||
| 1188 | Ga0070692_11395091 | |||
| 1189 | Ga0070668_100008223 | |||
| 1190 | Ga0070668_100036616 | |||
| 1191 | Ga0070668_100491985 | |||
| 1192 | Ga0070668_100796953 | |||
| 1193 | Ga0070668_100861191 | |||
| 1194 | Ga0070668_101671483 | |||
| 1195 | Ga0070669_100005200 | |||
| 1196 | Ga0070669_100219718 | |||
| 1197 | Ga0070669_101001982 | |||
| 1198 | Ga0070669_101173485 | |||
| 1199 | Ga0070675_100000570 | |||
| 1200 | Ga0070675_100026342 | |||
| 1201 | Ga0070675_100081634 | |||
| 1202 | Ga0070675_100160819 | |||
| 1203 | Ga0070675_100255080 | |||
| 1204 | Ga0070675_101241691 | |||
| 1205 | Ga0070671_100010878 | |||
| 1206 | Ga0070671_100161541 | |||
| 1207 | Ga0070671_100486372 | |||
| 1208 | Ga0070671_100760091 | |||
| 1209 | Ga0070671_101115223 | |||
| 1210 | Ga0070671_101269865 | |||
| 1211 | Ga0070671_101485252 | |||
| 1212 | Ga0070674_100180336 | |||
| 1213 | Ga0070674_102143624 | |||
| 1214 | Ga0070673_100002308 | |||
| 1215 | Ga0070673_100037373 | |||
| 1216 | Ga0070673_100089173 | |||
| 1217 | Ga0070673_100117623 | |||
| 1218 | Ga0070673_100188339 | |||
| 1219 | Ga0070673_100197869 | |||
| 1220 | Ga0070673_100280322 | |||
| 1221 | Ga0070673_100295556 | |||
| 1222 | Ga0070673_101622291 | |||
| 1223 | Ga0070688_100004531 | |||
| 1224 | Ga0070688_100032676 | |||
| 1225 | Ga0070688_100052608 | |||
| 1226 | Ga0070688_100080173 | |||
| 1227 | Ga0070688_100312461 | |||
| 1228 | Ga0070659_100070740 | |||
| 1229 | Ga0070659_100353174 | |||
| 1230 | Ga0070659_100803191 | |||
| 1231 | Ga0070659_101094408 | |||
| 1232 | Ga0070667_100009050 | |||
| 1233 | Ga0070667_100022270 | |||
| 1234 | Ga0070667_100030514 | |||
| 1235 | Ga0070667_100131533 | |||
| 1236 | Ga0070667_100416701 | |||
| 1237 | Ga0070667_100518417 | |||
| 1238 | Ga0070667_100663595 | |||
| 1239 | Ga0070667_100775616 | |||
| 1240 | Ga0070667_100851702 | |||
| 1241 | Ga0070667_100963925 | |||
| 1242 | Ga0070701_10179937 | |||
| 1243 | Ga0070711_101473397 | |||
| 1244 | Ga0070700_100106236 | |||
| 1245 | Ga0070700_100225680 | |||
| 1246 | Ga0070700_101123423 | |||
| 1247 | Ga0070663_100372312 | |||
| 1248 | Ga0070678_100152840 | |||
| 1249 | Ga0070678_100394542 | |||
| 1250 | Ga0070678_100695642 | |||
| 1251 | Ga0070662_100009313 | |||
| 1252 | Ga0070662_100025234 | |||
| 1253 | Ga0070662_100033436 | |||
| 1254 | Ga0070662_100702802 | |||
| 1255 | Ga0070662_101404873 | |||
| 1256 | Ga0070681_10015835 | |||
| 1257 | Ga0070681_10023433 | |||
| 1258 | Ga0070681_10028151 | |||
| 1259 | Ga0070681_10228959 | |||
| 1260 | Ga0070681_10507055 | |||
| 1261 | Ga0068867_100018265 | |||
| 1262 | Ga0068867_100183940 | |||
| 1263 | Ga0068867_100201843 | |||
| 1264 | Ga0068867_100318698 | |||
| 1265 | Ga0068867_100375223 | |||
| 1266 | Ga0068867_100381808 | |||
| 1267 | Ga0068867_100519871 | |||
| 1268 | Ga0068867_100541096 | |||
| 1269 | Ga0068867_100735490 | |||
| 1270 | Ga0068867_100790677 | |||
| 1271 | Ga0068867_100817043 | |||
| 1272 | Ga0068867_100896634 | |||
| 1273 | Ga0068867_100970208 | |||
| 1274 | Ga0068867_101127932 | |||
| 1275 | Ga0068867_101747296 | |||
| 1276 | Ga0068867_101958035 | |||
| 1277 | Ga0068867_102222867 | |||
| 1278 | Ga0068867_102299252 | |||
| 1279 | Ga0070685_10046592 | |||
| 1280 | Ga0070685_10128593 | |||
| 1281 | Ga0070685_11164796 | |||
| 1282 | Ga0070706_100370030 | |||
| 1283 | Ga0070706_100677248 | |||
| 1284 | Ga0070707_101819369 | |||
| 1285 | Ga0070698_100000626 | |||
| 1286 | Ga0070698_100015308 | |||
| 1287 | Ga0070699_100629034 | |||
| 1288 | Ga0070699_101030075 | |||
| 1289 | Ga0070679_100006623 | |||
| 1290 | Ga0070679_100015006 | |||
| 1291 | Ga0070679_100027336 | |||
| 1292 | Ga0070684_100000986 | |||
| 1293 | Ga0070684_100348620 | |||
| 1294 | Ga0070684_101369325 | |||
| 1295 | Ga0068853_100007621 | |||
| 1296 | Ga0068853_100013072 | |||
| 1297 | Ga0068853_100028951 | |||
| 1298 | Ga0068853_100048315 | |||
| 1299 | Ga0068853_100049027 | |||
| 1300 | Ga0068853_100165373 | |||
| 1301 | Ga0068853_100628104 | |||
| 1302 | Ga0068853_100711557 | |||
| 1303 | Ga0068853_101308936 | |||
| 1304 | Ga0068853_101633770 | |||
| 1305 | Ga0068853_101914384 | |||
| 1306 | Ga0070672_100032907 | |||
| 1307 | Ga0070672_100046912 | |||
| 1308 | Ga0070672_100140227 | |||
| 1309 | Ga0070672_100422792 | |||
| 1310 | Ga0070672_100465889 | |||
| 1311 | Ga0070672_100639697 | |||
| 1312 | Ga0070672_100924105 | |||
| 1313 | Ga0070672_101187067 | |||
| 1314 | Ga0070672_101898759 | |||
| 1315 | Ga0070686_100116143 | |||
| 1316 | Ga0070686_100276979 | |||
| 1317 | Ga0070686_100493840 | |||
| 1318 | Ga0070693_100391828 | |||
| 1319 | Ga0070693_101467320 | |||
| 1320 | Ga0070665_100000018 | |||
| 1321 | Ga0070665_100134884 | |||
| 1322 | Ga0070665_100478209 | |||
| 1323 | Ga0070665_100801705 | |||
| 1324 | Ga0070665_101667838 | |||
| 1325 | Ga0070704_100076454 | |||
| 1326 | Ga0070704_100108037 | |||
| 1327 | Ga0068855_100044204 | |||
| 1328 | Ga0068855_100055967 | |||
| 1329 | Ga0068855_100061387 | |||
| 1330 | Ga0068855_100112496 | |||
| 1331 | Ga0068855_100552826 | |||
| 1332 | Ga0068855_100766138 | |||
| 1333 | Ga0068855_101179949 | |||
| 1334 | Ga0068855_101259301 | |||
| 1335 | Ga0068855_101311914 | |||
| 1336 | Ga0070664_100001066 | |||
| 1337 | Ga0070664_100029709 | |||
| 1338 | Ga0070664_100119798 | |||
| 1339 | Ga0070664_100252441 | |||
| 1340 | Ga0070664_100388693 | |||
| 1341 | Ga0070664_100827448 | |||
| 1342 | Ga0070664_100954279 | |||
| 1343 | Ga0068857_100001057 | |||
| 1344 | Ga0068857_100003942 | |||
| 1345 | Ga0068857_100022395 | |||
| 1346 | Ga0068857_101716391 | |||
| 1347 | Ga0068857_102374358 | |||
| 1348 | Ga0068854_100010521 | |||
| 1349 | Ga0068854_100011741 | |||
| 1350 | Ga0068854_100084442 | |||
| 1351 | Ga0068854_100158173 | |||
| 1352 | Ga0068854_100242714 | |||
| 1353 | Ga0068854_100262369 | |||
| 1354 | Ga0068854_100266704 | |||
| 1355 | Ga0068854_100651293 | |||
| 1356 | Ga0068854_100941708 | |||
| 1357 | Ga0068854_101168435 | |||
| 1358 | Ga0068854_101356179 | |||
| 1359 | Ga0068856_100015155 | |||
| 1360 | Ga0068856_100018315 | |||
| 1361 | Ga0068856_100024765 | |||
| 1362 | Ga0068856_100028509 | |||
| 1363 | Ga0068856_100066000 | |||
| 1364 | Ga0068856_100204351 | |||
| 1365 | Ga0068856_101873958 | |||
| 1366 | Ga0070702_100182906 | |||
| 1367 | Ga0070702_100283495 | |||
| 1368 | Ga0070702_100434298 | |||
| 1369 | Ga0068852_100012728 | |||
| 1370 | Ga0068852_100029598 | |||
| 1371 | Ga0068852_100051706 | |||
| 1372 | Ga0068852_100078470 | |||
| 1373 | Ga0068852_100180422 | |||
| 1374 | Ga0068852_100194051 | |||
| 1375 | Ga0068852_100338360 | |||
| 1376 | Ga0068852_100377238 | |||
| 1377 | Ga0068852_100633175 | |||
| 1378 | Ga0068852_101109938 | |||
| 1379 | Ga0068852_101219056 | |||
| 1380 | Ga0068859_100000013 | |||
| 1381 | Ga0068859_100000639 | |||
| 1382 | Ga0068859_100055079 | |||
| 1383 | Ga0068859_100175210 | |||
| 1384 | Ga0068859_100183557 | |||
| 1385 | Ga0068859_100187862 | |||
| 1386 | Ga0068859_100293344 | |||
| 1387 | Ga0068859_100381394 | |||
| 1388 | Ga0068859_100483639 | |||
| 1389 | Ga0068859_100666247 | |||
| 1390 | Ga0068859_101334001 | |||
| 1391 | Ga0068859_101633955 | |||
| 1392 | Ga0068864_100009105 | |||
| 1393 | Ga0068864_100016110 | |||
| 1394 | Ga0068864_100020436 | |||
| 1395 | Ga0068864_100154359 | |||
| 1396 | Ga0068864_100305141 | |||
| 1397 | Ga0068864_100580627 | |||
| 1398 | Ga0068864_101472288 | |||
| 1399 | Ga0068866_10020336 | |||
| 1400 | Ga0068866_10046976 | |||
| 1401 | Ga0068866_10071233 | |||
| 1402 | Ga0068866_10852823 | |||
| 1403 | Ga0068861_100005999 | |||
| 1404 | Ga0068861_100009631 | |||
| 1405 | Ga0068861_100048796 | |||
| 1406 | Ga0068861_100773731 | |||
| 1407 | Ga0068861_100970827 | |||
| 1408 | Ga0068861_101266007 | |||
| 1409 | Ga0068861_101582536 | |||
| 1410 | Ga0068851_10029488 | |||
| 1411 | Ga0068851_10037594 | |||
| 1412 | Ga0068851_10191517 | |||
| 1413 | Ga0068851_10492987 | |||
| 1414 | Ga0068870_10053579 | |||
| 1415 | Ga0068870_10148942 | |||
| 1416 | Ga0068870_10388015 | |||
| 1417 | Ga0068870_10944720 | |||
| 1418 | Ga0068863_100021830 | |||
| 1419 | Ga0068863_100053741 | |||
| 1420 | Ga0068863_100085952 | |||
| 1421 | Ga0068863_100088790 | |||
| 1422 | Ga0068863_100301748 | |||
| 1423 | Ga0068863_100519598 | |||
| 1424 | Ga0068863_100722955 | |||
| 1425 | Ga0068863_100737661 | |||
| 1426 | Ga0068863_100922282 | |||
| 1427 | Ga0068863_101182205 | |||
| 1428 | Ga0068858_100005907 | |||
| 1429 | Ga0068858_100338044 | |||
| 1430 | Ga0068858_100691636 | |||
| 1431 | Ga0068858_102034380 | |||
| 1432 | Ga0068858_102448212 | |||
| 1433 | Ga0068860_100000040 | |||
| 1434 | Ga0068860_100000983 | |||
| 1435 | Ga0068860_100001891 | |||
| 1436 | Ga0068860_100010037 | |||
| 1437 | Ga0068860_100105606 | |||
| 1438 | Ga0068860_100157340 | |||
| 1439 | Ga0068860_100184676 | |||
| 1440 | Ga0068860_100560381 | |||
| 1441 | Ga0068860_101188348 | |||
| 1442 | Ga0068860_102738698 | |||
| 1443 | Ga0068862_100011991 | |||
| 1444 | Ga0068862_100104234 | |||
| 1445 | Ga0068862_100241412 | |||
| 1446 | Ga0068862_100272501 | |||
| 1447 | Ga0068862_100457640 | |||
| 1448 | Ga0068862_100462750 | |||
| 1449 | Ga0068862_100519660 | |||
| 1450 | Ga0068862_100582879 | |||
| 1451 | Ga0068862_100743716 | |||
| 1452 | Ga0068862_100806541 | |||
| 1453 | Ga0068862_100874323 | |||
| 1454 | Ga0068862_101039597 | |||
| 1455 | Ga0068862_101325943 | |||
| 1456 | Ga0068862_101425146 | |||
| 1457 | Ga0081455_10288424 | |||
| 1458 | Ga0081540_1005650 | |||
| 1459 | Ga0070715_10059278 | |||
| 1460 | Ga0070716_100606135 | |||
| 1461 | Ga0075366_10003142 | |||
| 1462 | Ga0075366_10026495 | |||
| 1463 | Ga0075366_10520158 | |||
| 1464 | Ga0097621_100000129 | |||
| 1465 | Ga0097621_100014645 | |||
| 1466 | Ga0097621_100087369 | |||
| 1467 | Ga0097621_100114659 | |||
| 1468 | Ga0097621_100191304 | |||
| 1469 | Ga0097621_100214249 | |||
| 1470 | Ga0097621_100247317 | |||
| 1471 | Ga0097621_100248526 | |||
| 1472 | Ga0097621_100496976 | |||
| 1473 | Ga0097621_101415196 | |||
| 1474 | Ga0097621_101797420 | |||
| 1475 | Ga0068871_100000075 | |||
| 1476 | Ga0068871_100004743 | |||
| 1477 | Ga0068871_100025379 | |||
| 1478 | Ga0068871_100120003 | |||
| 1479 | Ga0068871_100814179 | |||
| 1480 | Ga0068871_100829045 | |||
| 1481 | Ga0068871_100837359 | |||
| 1482 | Ga0068871_100897938 | |||
| 1483 | Ga0068871_100915456 | |||
| 1484 | Ga0068871_101271942 | |||
| 1485 | Ga0068871_101564166 | |||
| 1486 | Ga0075428_100180467 | |||
| 1487 | Ga0075430_100000676 | |||
| 1488 | Ga0075431_100934773 | |||
| 1489 | Ga0075434_100872779 | |||
| 1490 | Ga0068865_100117646 | |||
| 1491 | Ga0068865_100337551 | |||
| 1492 | Ga0068865_100339445 | |||
| 1493 | Ga0068865_100501283 | |||
| 1494 | Ga0068865_100638495 | |||
| 1495 | Ga0068865_100852616 | |||
| 1496 | Ga0068865_101225859 | |||
| 1497 | Ga0097620_100000013 | |||
| 1498 | Ga0097620_100000639 | |||
| 1499 | Ga0097620_100055081 | |||
| 1500 | Ga0097620_100175212 | |||
| 1501 | Ga0097620_100183561 | |||
| 1502 | Ga0097620_100187862 | |||
| 1503 | Ga0097620_100293313 | |||
| 1504 | Ga0097620_100381375 | |||
| 1505 | Ga0097620_100483630 | |||
| 1506 | Ga0097620_100666318 | |||
| 1507 | Ga0097620_101071754 | |||
| 1508 | Ga0097620_101334198 | |||
| 1509 | Ga0097620_101634133 | |||
| 1510 | Ga0097620_102522677 | |||
| 1511 | Ga0105240_10000764 | |||
| 1512 | Ga0105240_10002370 | |||
| 1513 | Ga0105240_10002578 | |||
| 1514 | Ga0105240_10007820 | |||
| 1515 | Ga0105240_10019592 | |||
| 1516 | Ga0105240_10038122 | |||
| 1517 | Ga0105240_10064938 | |||
| 1518 | Ga0105240_10130284 | |||
| 1519 | Ga0105240_10343323 | |||
| 1520 | Ga0105240_10751443 | |||
| 1521 | Ga0105240_11356873 | |||
| 1522 | Ga0105240_11891006 | |||
| 1523 | Ga0111539_10010650 | |||
| 1524 | Ga0111539_10024107 | |||
| 1525 | Ga0111539_10038247 | |||
| 1526 | Ga0111539_10620595 | |||
| 1527 | Ga0111539_10752117 | |||
| 1528 | Ga0111539_11542746 | |||
| 1529 | Ga0111539_11613115 | |||
| 1530 | Ga0105245_12135209 | |||
| 1531 | Ga0105247_10092509 | |||
| 1532 | Ga0105247_10149361 | |||
| 1533 | Ga0105247_10209116 | |||
| 1534 | Ga0114129_10010555 | |||
| 1535 | Ga0114129_10404658 | |||
| 1536 | Ga0105243_11071033 | |||
| 1537 | Ga0105243_12084698 | |||
| 1538 | Ga0105243_12395664 | |||
| 1539 | Ga0105241_10000732 | |||
| 1540 | Ga0105241_10002606 | |||
| 1541 | Ga0105241_10050299 | |||
| 1542 | Ga0105241_10338327 | |||
| 1543 | Ga0105241_10443202 | |||
| 1544 | Ga0105241_10899933 | |||
| 1545 | Ga0105241_11070076 | |||
| 1546 | Ga0105241_11184997 | |||
| 1547 | Ga0105241_11218411 | |||
| 1548 | Ga0105241_11644760 | |||
| 1549 | Ga0105241_11652808 | |||
| 1550 | Ga0105241_11946741 | |||
| 1551 | Ga0105242_10091785 | |||
| 1552 | Ga0105242_10126456 | |||
| 1553 | Ga0105242_10161253 | |||
| 1554 | Ga0105242_10193586 | |||
| 1555 | Ga0105242_10198873 | |||
| 1556 | Ga0105242_10298940 | |||
| 1557 | Ga0105242_11480560 | |||
| 1558 | Ga0105242_12897450 | |||
| 1559 | Ga0105248_10161683 | |||
| 1560 | Ga0105248_10612100 | |||
| 1561 | Ga0105248_10841728 | |||
| 1562 | Ga0105237_10000186 | |||
| 1563 | Ga0105237_10003399 | |||
| 1564 | Ga0105237_10011251 | |||
| 1565 | Ga0105237_10016007 | |||
| 1566 | Ga0105237_10020252 | |||
| 1567 | Ga0105237_10027584 | |||
| 1568 | Ga0105237_10089063 | |||
| 1569 | Ga0105237_10235600 | |||
| 1570 | Ga0105237_10252904 | |||
| 1571 | Ga0105237_10390592 | |||
| 1572 | Ga0105237_10502545 | |||
| 1573 | Ga0105238_10000643 | |||
| 1574 | Ga0105238_10150058 | |||
| 1575 | Ga0105238_10243383 | |||
| 1576 | Ga0105238_10275747 | |||
| 1577 | Ga0105238_11256606 | |||
| 1578 | Ga0105238_12565333 | |||
| 1579 | Ga0105249_10004589 | |||
| 1580 | Ga0105249_10014106 | |||
| 1581 | Ga0105249_10022403 | |||
| 1582 | Ga0105249_10036279 | |||
| 1583 | Ga0105249_10057466 | |||
| 1584 | Ga0105249_10194183 | |||
| 1585 | Ga0105249_10250193 | |||
| 1586 | Ga0105249_10287184 | |||
| 1587 | Ga0105249_10308510 | |||
| 1588 | Ga0105249_10309224 | |||
| 1589 | Ga0105249_10448712 | |||
| 1590 | Ga0105249_13013299 | |||
| 1591 | Ga0105239_10000383 | |||
| 1592 | Ga0105239_10001834 | |||
| 1593 | Ga0105239_10008051 | |||
| 1594 | Ga0105239_10039487 | |||
| 1595 | Ga0105239_10060253 | |||
| 1596 | Ga0105239_10097423 | |||
| 1597 | Ga0105239_10163526 | |||
| 1598 | Ga0105239_10179684 | |||
| 1599 | Ga0105239_10426545 | |||
| 1600 | Ga0105239_10719850 | |||
| 1601 | Ga0105246_10006585 | |||
| 1602 | Ga0105246_10055121 | |||
| 1603 | Ga0105246_10066259 | |||
| 1604 | Ga0105246_11742649 | |||
| 1605 | Ga0105246_11846702 | |||
| 1606 | Ga0105246_12169707 | |||
| 1607 | Ga0157373_10007971 | |||
| 1608 | Ga0157373_10053646 | |||
| 1609 | Ga0157373_10054743 | |||
| 1610 | Ga0157371_10009663 | |||
| 1611 | Ga0157371_10011784 | |||
| 1612 | Ga0157371_10062624 | |||
| 1613 | Ga0157371_10104795 | |||
| 1614 | Ga0157371_10342153 | |||
| 1615 | Ga0157371_10581215 | |||
| 1616 | Ga0157370_10018760 | |||
| 1617 | Ga0157370_10549996 | |||
| 1618 | Ga0157370_10567836 | |||
| 1619 | Ga0157370_10836725 | |||
| 1620 | Ga0157370_10843127 | |||
| 1621 | Ga0157370_11012291 | |||
| 1622 | Ga0157370_11069313 | |||
| 1623 | Ga0157369_10026694 | |||
| 1624 | Ga0157369_10034847 | |||
| 1625 | Ga0157369_10249499 | |||
| 1626 | Ga0157369_11950828 | |||
| 1627 | Ga0157374_10000485 | |||
| 1628 | Ga0157374_10287387 | |||
| 1629 | Ga0157374_10355287 | |||
| 1630 | Ga0157374_10882698 | |||
| 1631 | Ga0157374_11692089 | |||
| 1632 | Ga0157378_10010730 | |||
| 1633 | Ga0157378_10100029 | |||
| 1634 | Ga0157378_10158085 | |||
| 1635 | Ga0157378_10279006 | |||
| 1636 | Ga0157378_10305500 | |||
| 1637 | Ga0157378_10649080 | |||
| 1638 | Ga0157378_10907908 | |||
| 1639 | Ga0157378_11373109 | |||
| 1640 | Ga0157378_12212717 | |||
| 1641 | Ga0163162_10005361 | |||
| 1642 | Ga0163162_10014884 | |||
| 1643 | Ga0163162_10022034 | |||
| 1644 | Ga0163162_10077353 | |||
| 1645 | Ga0163162_10133770 | |||
| 1646 | Ga0163162_10613436 | |||
| 1647 | Ga0163162_11515685 | |||
| 1648 | Ga0163162_12296675 | |||
| 1649 | Ga0163162_13027777 | |||
| 1650 | Ga0157372_10001369 | |||
| 1651 | Ga0157372_10002342 | |||
| 1652 | Ga0157372_10118269 | |||
| 1653 | Ga0157372_10176745 | |||
| 1654 | Ga0157372_10197188 | |||
| 1655 | Ga0157372_10277935 | |||
| 1656 | Ga0157372_10474340 | |||
| 1657 | Ga0157372_10500070 | |||
| 1658 | Ga0157372_10612572 | |||
| 1659 | Ga0157372_10902869 | |||
| 1660 | Ga0157372_11346758 | |||
| 1661 | Ga0157372_12644117 | |||
| 1662 | Ga0157372_13434366 | |||
| 1663 | Ga0157375_10000327 | |||
| 1664 | Ga0157375_10009353 | |||
| 1665 | Ga0157375_10026118 | |||
| 1666 | Ga0157375_10131513 | |||
| 1667 | Ga0157375_10396732 | |||
| 1668 | Ga0157375_10414792 | |||
| 1669 | Ga0157375_10598489 | |||
| 1670 | Ga0157375_10627404 | |||
| 1671 | Ga0157375_10770751 | |||
| 1672 | Ga0157375_11215167 | |||
| 1673 | Ga0157375_12247922 | |||
| 1674 | Ga0163163_10000191 | |||
| 1675 | Ga0163163_10037365 | |||
| 1676 | Ga0163163_10200929 | |||
| 1677 | Ga0163163_10329138 | |||
| 1678 | Ga0163163_10351791 | |||
| 1679 | Ga0163163_10403893 | |||
| 1680 | Ga0163163_10521090 | |||
| 1681 | Ga0163163_10600772 | |||
| 1682 | Ga0163163_10689848 | |||
| 1683 | Ga0163163_12064237 | |||
| 1684 | Ga0157380_10006905 | |||
| 1685 | Ga0157380_10035907 | |||
| 1686 | Ga0157380_10076934 | |||
| 1687 | Ga0157380_10201876 | |||
| 1688 | Ga0157380_10782863 | |||
| 1689 | Ga0157380_10928265 | |||
| 1690 | Ga0157380_11289161 | |||
| 1691 | Ga0157380_11528996 | |||
| 1692 | Ga0157380_11993779 | |||
| 1693 | Ga0157380_12088468 | |||
| 1694 | Ga0157377_10002222 | |||
| 1695 | Ga0157377_10252673 | |||
| 1696 | Ga0157377_10272990 | |||
| 1697 | Ga0157377_10348201 | |||
| 1698 | Ga0157377_10379779 | |||
| 1699 | Ga0157377_10492665 | |||
| 1700 | Ga0157377_11188573 | |||
| 1701 | Ga0157377_11570493 | |||
| 1702 | Ga0157379_10007948 | |||
| 1703 | Ga0157379_10036364 | |||
| 1704 | Ga0157379_10357621 | |||
| 1705 | Ga0157379_10593386 | |||
| 1706 | Ga0157379_10750551 | |||
| 1707 | Ga0157379_10838293 | |||
| 1708 | Ga0157379_11048765 | |||
| 1709 | Ga0157379_11086056 | |||
| 1710 | Ga0157379_11505074 | |||
| 1711 | Ga0157376_10000413 | |||
| 1712 | Ga0157376_10000750 | |||
| 1713 | Ga0157376_10076956 | |||
| 1714 | Ga0157376_10081396 | |||
| 1715 | Ga0157376_10331093 | |||
| 1716 | Ga0157376_10427012 | |||
| 1717 | Ga0157376_10973953 | |||
| 1718 | Ga0157376_11037100 | |||
| 1719 | Ga0157376_11894369 | |||
| 1720 | Ga0163161_10001316 | |||
| 1721 | Ga0163161_10053296 | |||
| 1722 | Ga0163161_10279383 | |||
| 1723 | Ga0163161_10366417 | |||
| 1724 | Ga0163161_10458618 | |||
| 1725 | Ga0163161_10620831 | |||
| 1726 | Ga0163161_11228970 | |||
| 1727 | Ga0163161_11305371 | |||
| 1728 | Ga0206352_10827829 | |||
| 1729 | Ga0207666_1023067 | |||
| 1730 | Ga0207697_10023035 | |||
| 1731 | Ga0207697_10110108 | |||
| 1732 | Ga0207656_10086067 | |||
| 1733 | Ga0207656_10134640 | |||
| 1734 | Ga0207656_10159584 | |||
| 1735 | Ga0207682_10028532 | |||
| 1736 | Ga0207682_10034619 | |||
| 1737 | Ga0207642_10007795 | |||
| 1738 | Ga0207642_10147981 | |||
| 1739 | Ga0207642_10206548 | |||
| 1740 | Ga0207642_10424321 | |||
| 1741 | Ga0207642_10640105 | |||
| 1742 | Ga0207642_10808847 | |||
| 1743 | Ga0207710_10052057 | |||
| 1744 | Ga0207680_10000094 | |||
| 1745 | Ga0207680_10029123 | |||
| 1746 | Ga0207680_11071843 | |||
| 1747 | Ga0207680_11272462 | |||
| 1748 | Ga0207647_10007614 | |||
| 1749 | Ga0207647_10017600 | |||
| 1750 | Ga0207647_10041035 | |||
| 1751 | Ga0207647_10046603 | |||
| 1752 | Ga0207647_10266544 | |||
| 1753 | Ga0207685_10027425 | |||
| 1754 | Ga0207645_10084791 | |||
| 1755 | Ga0207645_10216671 | |||
| 1756 | Ga0207645_10557022 | |||
| 1757 | Ga0207645_10650883 | |||
| 1758 | Ga0207643_10007152 | |||
| 1759 | Ga0207643_10025333 | |||
| 1760 | Ga0207643_10059566 | |||
| 1761 | Ga0207643_10113496 | |||
| 1762 | Ga0207705_10008582 | |||
| 1763 | Ga0207705_10055333 | |||
| 1764 | Ga0207705_10166300 | |||
| 1765 | Ga0207705_10280651 | |||
| 1766 | Ga0207654_10003088 | |||
| 1767 | Ga0207654_10184940 | |||
| 1768 | Ga0207654_10330582 | |||
| 1769 | Ga0207654_10828793 | |||
| 1770 | Ga0207654_11060440 | |||
| 1771 | Ga0207654_11323584 | |||
| 1772 | Ga0207707_10062557 | |||
| 1773 | Ga0207707_10103916 | |||
| 1774 | Ga0207707_10119337 | |||
| 1775 | Ga0207707_10163448 | |||
| 1776 | Ga0207695_10000146 | |||
| 1777 | Ga0207695_10000260 | |||
| 1778 | Ga0207695_10000710 | |||
| 1779 | Ga0207695_10010090 | |||
| 1780 | Ga0207695_10017182 | |||
| 1781 | Ga0207695_10064382 | |||
| 1782 | Ga0207695_10138314 | |||
| 1783 | Ga0207695_10169135 | |||
| 1784 | Ga0207671_10000521 | |||
| 1785 | Ga0207671_10007458 | |||
| 1786 | Ga0207671_10007953 | |||
| 1787 | Ga0207671_10008591 | |||
| 1788 | Ga0207671_10042530 | |||
| 1789 | Ga0207671_10204854 | |||
| 1790 | Ga0207671_10288215 | |||
| 1791 | Ga0207671_10357069 | |||
| 1792 | Ga0207671_11006390 | |||
| 1793 | Ga0207663_11184224 | |||
| 1794 | Ga0207663_11246156 | |||
| 1795 | Ga0207660_10433817 | |||
| 1796 | Ga0207662_10069019 | |||
| 1797 | Ga0207662_10610860 | |||
| 1798 | Ga0207657_10004587 | |||
| 1799 | Ga0207657_10030587 | |||
| 1800 | Ga0207657_10136984 | |||
| 1801 | Ga0207649_10002980 | |||
| 1802 | Ga0207652_10000600 | |||
| 1803 | Ga0207652_10004269 | |||
| 1804 | Ga0207652_10194077 | |||
| 1805 | Ga0207646_10923997 | |||
| 1806 | Ga0207681_10015891 | |||
| 1807 | Ga0207681_10199284 | |||
| 1808 | Ga0207681_10376912 | |||
| 1809 | Ga0207681_10849979 | |||
| 1810 | Ga0207694_10032101 | |||
| 1811 | Ga0207694_10189298 | |||
| 1812 | Ga0207694_10431327 | |||
| 1813 | Ga0207694_11138995 | |||
| 1814 | Ga0207650_10022094 | |||
| 1815 | Ga0207650_10097096 | |||
| 1816 | Ga0207650_10120389 | |||
| 1817 | Ga0207650_10161610 | |||
| 1818 | Ga0207650_10300407 | |||
| 1819 | Ga0207650_10361504 | |||
| 1820 | Ga0207650_10374146 | |||
| 1821 | Ga0207659_10004312 | |||
| 1822 | Ga0207659_10074421 | |||
| 1823 | Ga0207659_10119476 | |||
| 1824 | Ga0207659_10125894 | |||
| 1825 | Ga0207659_10275236 | |||
| 1826 | Ga0207659_11462934 | |||
| 1827 | Ga0207644_10031425 | |||
| 1828 | Ga0207644_10060503 | |||
| 1829 | Ga0207644_10145291 | |||
| 1830 | Ga0207644_10315365 | |||
| 1831 | Ga0207644_11282226 | |||
| 1832 | Ga0207690_10043426 | |||
| 1833 | Ga0207690_10270638 | |||
| 1834 | Ga0207706_10037023 | |||
| 1835 | Ga0207706_10043522 | |||
| 1836 | Ga0207706_10065907 | |||
| 1837 | Ga0207706_10601864 | |||
| 1838 | Ga0207686_10002929 | |||
| 1839 | Ga0207686_10026838 | |||
| 1840 | Ga0207686_10049961 | |||
| 1841 | Ga0207686_10095030 | |||
| 1842 | Ga0207686_10242052 | |||
| 1843 | Ga0207686_10973273 | |||
| 1844 | Ga0207709_11228947 | |||
| 1845 | Ga0207670_10004053 | |||
| 1846 | Ga0207670_10006091 | |||
| 1847 | Ga0207670_10006843 | |||
| 1848 | Ga0207670_10179379 | |||
| 1849 | Ga0207670_10857610 | |||
| 1850 | Ga0207669_10889902 | |||
| 1851 | Ga0207704_10066278 | |||
| 1852 | Ga0207704_10140609 | |||
| 1853 | Ga0207704_10172845 | |||
| 1854 | Ga0207704_10402528 | |||
| 1855 | Ga0207704_10726967 | |||
| 1856 | Ga0207704_10870466 | |||
| 1857 | Ga0207665_10416459 | |||
| 1858 | Ga0207691_10016246 | |||
| 1859 | Ga0207691_10051879 | |||
| 1860 | Ga0207691_10085361 | |||
| 1861 | Ga0207691_10093266 | |||
| 1862 | Ga0207691_10130759 | |||
| 1863 | Ga0207691_10443869 | |||
| 1864 | Ga0207691_10736646 | |||
| 1865 | Ga0207691_10994326 | |||
| 1866 | Ga0207691_11696769 | |||
| 1867 | Ga0207711_10933177 | |||
| 1868 | Ga0207689_10000782 | |||
| 1869 | Ga0207689_10002426 | |||
| 1870 | Ga0207689_10005675 | |||
| 1871 | Ga0207689_10020924 | |||
| 1872 | Ga0207689_10032975 | |||
| 1873 | Ga0207689_10071899 | |||
| 1874 | Ga0207689_10076621 | |||
| 1875 | Ga0207689_10711214 | |||
| 1876 | Ga0207689_10960806 | |||
| 1877 | Ga0207689_11289314 | |||
| 1878 | Ga0207661_10000589 | |||
| 1879 | Ga0207661_10416115 | |||
| 1880 | Ga0207661_10643656 | |||
| 1881 | Ga0207679_10001213 | |||
| 1882 | Ga0207679_10064596 | |||
| 1883 | Ga0207679_10354224 | |||
| 1884 | Ga0207679_10356516 | |||
| 1885 | Ga0207679_10635645 | |||
| 1886 | Ga0207679_10658963 | |||
| 1887 | Ga0207667_10000412 | |||
| 1888 | Ga0207667_10047903 | |||
| 1889 | Ga0207667_10088889 | |||
| 1890 | Ga0207667_10606063 | |||
| 1891 | Ga0207667_10624159 | |||
| 1892 | Ga0207667_11081112 | |||
| 1893 | Ga0207667_12147752 | |||
| 1894 | Ga0207651_10002163 | |||
| 1895 | Ga0207651_10097924 | |||
| 1896 | Ga0207651_10445227 | |||
| 1897 | Ga0207651_10576251 | |||
| 1898 | Ga0207712_10000635 | |||
| 1899 | Ga0207712_10001944 | |||
| 1900 | Ga0207712_10032310 | |||
| 1901 | Ga0207712_10040473 | |||
| 1902 | Ga0207712_10193363 | |||
| 1903 | Ga0207712_10205626 | |||
| 1904 | Ga0207712_10335896 | |||
| 1905 | Ga0207712_10384346 | |||
| 1906 | Ga0207712_10481176 | |||
| 1907 | Ga0207712_10622490 | |||
| 1908 | Ga0207712_10847547 | |||
| 1909 | Ga0207712_11691608 | |||
| 1910 | Ga0207668_10013093 | |||
| 1911 | Ga0207668_10085088 | |||
| 1912 | Ga0207668_10376977 | |||
| 1913 | Ga0207668_10546780 | |||
| 1914 | Ga0207668_10870197 | |||
| 1915 | Ga0207668_11928531 | |||
| 1916 | Ga0207640_10059030 | |||
| 1917 | Ga0207640_10214935 | |||
| 1918 | Ga0207640_10273732 | |||
| 1919 | Ga0207640_10286367 | |||
| 1920 | Ga0207640_10391302 | |||
| 1921 | Ga0207640_10525298 | |||
| 1922 | Ga0207640_10658271 | |||
| 1923 | Ga0207640_10822602 | |||
| 1924 | Ga0207640_10996431 | |||
| 1925 | Ga0207640_11072794 | |||
| 1926 | Ga0207640_11244323 | |||
| 1927 | Ga0207658_10008642 | |||
| 1928 | Ga0207658_10009222 | |||
| 1929 | Ga0207658_10050007 | |||
| 1930 | Ga0207658_10124032 | |||
| 1931 | Ga0207658_10493565 | |||
| 1932 | Ga0207658_10656993 | |||
| 1933 | Ga0207658_10752928 | |||
| 1934 | Ga0207658_10775605 | |||
| 1935 | Ga0207658_10866965 | |||
| 1936 | Ga0207658_11081913 | |||
| 1937 | Ga0207677_10028124 | |||
| 1938 | Ga0207677_10264873 | |||
| 1939 | Ga0207677_10285894 | |||
| 1940 | Ga0207677_10740041 | |||
| 1941 | Ga0207677_10900687 | |||
| 1942 | Ga0207703_10178497 | |||
| 1943 | Ga0207703_10407818 | |||
| 1944 | Ga0207703_10652608 | |||
| 1945 | Ga0207703_11417227 | |||
| 1946 | Ga0207639_10006274 | |||
| 1947 | Ga0207639_10012159 | |||
| 1948 | Ga0207639_10012272 | |||
| 1949 | Ga0207639_10143458 | |||
| 1950 | Ga0207639_10275291 | |||
| 1951 | Ga0207639_10340133 | |||
| 1952 | Ga0207639_10563204 | |||
| 1953 | Ga0207639_10781293 | |||
| 1954 | Ga0207639_10894867 | |||
| 1955 | Ga0207639_10926939 | |||
| 1956 | Ga0207678_10233492 | |||
| 1957 | Ga0207678_10831594 | |||
| 1958 | Ga0207708_10023371 | |||
| 1959 | Ga0207708_10117995 | |||
| 1960 | Ga0207708_10172222 | |||
| 1961 | Ga0207702_10016752 | |||
| 1962 | Ga0207702_10026898 | |||
| 1963 | Ga0207702_10032842 | |||
| 1964 | Ga0207702_10046879 | |||
| 1965 | Ga0207702_10058987 | |||
| 1966 | Ga0207702_10237328 | |||
| 1967 | Ga0207702_10359050 | |||
| 1968 | Ga0207702_11851094 | |||
| 1969 | Ga0207641_10002898 | |||
| 1970 | Ga0207641_10003127 | |||
| 1971 | Ga0207641_10025697 | |||
| 1972 | Ga0207641_10218543 | |||
| 1973 | Ga0207641_10330202 | |||
| 1974 | Ga0207641_10544938 | |||
| 1975 | Ga0207641_10627508 | |||
| 1976 | Ga0207641_10928272 | |||
| 1977 | Ga0207641_11113768 | |||
| 1978 | Ga0207641_11163787 | |||
| 1979 | Ga0207641_11759136 | |||
| 1980 | Ga0207648_10049504 | |||
| 1981 | Ga0207648_10061500 | |||
| 1982 | Ga0207648_10075260 | |||
| 1983 | Ga0207648_10116683 | |||
| 1984 | Ga0207648_10212798 | |||
| 1985 | Ga0207648_10249807 | |||
| 1986 | Ga0207648_10343100 | |||
| 1987 | Ga0207648_10432438 | |||
| 1988 | Ga0207648_10493260 | |||
| 1989 | Ga0207648_10628988 | |||
| 1990 | Ga0207648_10652634 | |||
| 1991 | Ga0207648_10767574 | |||
| 1992 | Ga0207648_10868074 | |||
| 1993 | Ga0207676_10031626 | |||
| 1994 | Ga0207676_10090389 | |||
| 1995 | Ga0207676_10120513 | |||
| 1996 | Ga0207676_10671460 | |||
| 1997 | Ga0207676_11749376 | |||
| 1998 | Ga0207674_10002240 | |||
| 1999 | Ga0207674_10007723 | |||
| 2000 | Ga0207674_10033912 | |||
| 2001 | Ga0207674_10042800 | |||
| 2002 | Ga0207674_10201576 | |||
| 2003 | Ga0207674_10236981 | |||
| 2004 | Ga0207674_10522909 | |||
| 2005 | Ga0207674_12028149 | |||
| 2006 | Ga0207675_100000272 | |||
| 2007 | Ga0207675_100010822 | |||
| 2008 | Ga0207675_100089068 | |||
| 2009 | Ga0207675_100115741 | |||
| 2010 | Ga0207675_100127065 | |||
| 2011 | Ga0207675_100613690 | |||
| 2012 | Ga0207675_101225265 | |||
| 2013 | Ga0207675_101600170 | |||
| 2014 | Ga0207683_10054829 | |||
| 2015 | Ga0207683_10102454 | |||
| 2016 | Ga0207683_10189131 | |||
| 2017 | Ga0207683_10862777 | |||
| 2018 | Ga0207698_10044521 | |||
| 2019 | Ga0207698_10047671 | |||
| 2020 | Ga0207698_10139033 | |||
| 2021 | Ga0207698_10141275 | |||
| 2022 | Ga0207698_10193667 | |||
| 2023 | Ga0207698_10226677 | |||
| 2024 | Ga0207698_10399821 | |||
| 2025 | Ga0207698_10442589 | |||
| 2026 | Ga0207698_10640566 | |||
| 2027 | Ga0207698_10668353 | |||
| 2028 | Ga0207698_11966986 | |||
| 2029 | Ga0207698_12264387 | |||
| 2030 | Ga0207428_10074292 | |||
| 2031 | Ga0207428_10096093 | |||
| 2032 | Ga0207428_10501672 | |||
| 2033 | Ga0207428_10837399 | |||
| 2034 | Ga0268266_10000026 | |||
| 2035 | Ga0268266_10050123 | |||
| 2036 | Ga0268266_10322127 | |||
| 2037 | Ga0268266_11651346 | |||
| 2038 | Ga0268265_10002020 | |||
| 2039 | Ga0268265_10029555 | |||
| 2040 | Ga0268265_10156390 | |||
| 2041 | Ga0268265_10674948 | |||
| 2042 | Ga0268265_10810927 | |||
| 2043 | Ga0268265_10984990 | |||
| 2044 | Ga0268265_11102328 | |||
| 2045 | Ga0268265_11995093 | |||
| 2046 | Ga0268264_10000019 | |||
| 2047 | Ga0268264_10001326 | |||
| 2048 | Ga0268264_10008883 | |||
| 2049 | Ga0268264_10021339 | |||
| 2050 | Ga0268264_10072148 | |||
| 2051 | Ga0268264_10097296 | |||
| 2052 | Ga0268264_10132747 | |||
| 2053 | Ga0268264_10500057 | |||
| 2054 | Ga0268264_10679106 | |||
| 2055 | Ga0268264_11026929 | |||
| 2056 | Ga0268264_11600630 | |||
| 2057 | Ga0268264_12211947 | |||
| 2058 | Ga0265318_10201464 | |||
| 2059 | Ga0307517_10011275 | |||
| 2060 | Ga0307517_10093071 | |||
| 2061 | Ga0307515_10575593 | |||
| 2062 | Ga0307511_10000104 | |||
| 2063 | Ga0265327_10077528 | |||
| 2064 | Ga0307509_10015435 | |||
| 2065 | Ga0307516_10000496 | |||
| 2066 | Ga0307413_10662502 | |||
| 2067 | Ga0307410_11056765 | |||
| 2068 | Ga0307410_11404459 | |||
| 2069 | Ga0307416_102500867 | |||
| 2070 | Ga0307414_10356658 | |||
| 2071 | Ga0307411_10387126 | |||
| 2072 | Ga0307415_100175945 | |||
| 2073 | Ga0307510_10000165 | |||
| 2074 | Ga0373932_0315769 | |||
| 2075 | Ga0373953_0234122 | |||
| 2076 | Ga0373955_0181131 | |||
| 2077 | Ga0373924_0261027 | |||
| 2078 | Ga0373933_0373853 | |||
| 2079 | Ga0373947_0355700 | |||
| 2080 | Ga0373937_0084352 | |||
| 2081 | Ga0395899_0252430 | |||
| 2082 | Ga0395900_0014336 | |||
| 2083 | Ga0395900_0074008 | |||
| 2084 | Ga0395900_0367487 | |||
| 2085 | Ga0395900_0632103 | |||
| 2086 | Ga0395900_0882422 | |||
| 2087 | Ga0395898_0936932 | |||
| 2088 | Ga0395898_1084686 | |||
| 2089 | Ga0395905_0056220 | |||
| 2090 | Ga0395905_0223658 | |||
| 2091 | Ga0395905_0750103 | |||
| 2092 | Ga0395901_0113712 | |||
| 2093 | Ga0436365_1454878 | |||
| 2094 | Ga0439439_0121417 | |||
| 2095 | Ga0439439_0267459 | |||
| 2096 | Ga0451795_0932631 | |||
| 2097 | Ga0451798_0665617 | |||
| 2098 | Ga0451800_0522342 | |||
| 2099 | Ga0451800_0593180 | |||
| 2100 | Ga0451807_0527209 | |||
| 2101 | Ga0451839_0813408 | |||
| 2102 | Ga0451851_0359937 | |||
| 2103 | Ga0451843_0340892 | |||
| 2104 | Ga0439431_0000771 | |||
| 2105 | Ga0439441_082506 | |||
| 2106 | Ga0439445_0042376 | |||
| 2107 | Ga0450922_005365 | |||
| 2108 | Ga0451577_0043354 | |||
| 2109 | Ga0451577_1038663 | |||
| 2110 | Ga0466972_0001642 | |||
| 2111 | Ga0453683_1090042 | |||
| 2112 | Ga0466965_0394210 | |||
| 2113 | Ga0466961_0035368 | |||
| 2114 | Ga0466963_0468403 | |||
| 2115 | Ga0466964_0168709 | |||
| 2116 | Ga0466964_0198399 | |||
| 2117 | Ga0453684_0088334 | |||
| 2118 | Ga0453684_0468358 | |||
| 2119 | Ga0466971_0085454 | |||
| 2120 | Ga0466971_0282457 | |||
| 2121 | Ga0466968_0186458 | |||
| 2122 | Ga0466970_0023973 | |||
| 2123 | Ga0466957_0240479 | |||
| 2124 | Ga0466959_0014957 | |||
| 2125 | Ga0466959_0112179 | |||
| 2126 | Ga0451576_0170624 | |||
| 2127 | Ga0495592_0238753 | |||
| 2128 | Ga0495650_0066329 | |||
| 2129 | Ga0495606_0002353 | |||
| 2130 | Ga0495618_0257935 | |||
| 2131 | Ga0495628_0042110 | |||
| 2132 | Ga0495632_0264974 | |||
| 2133 | Ga0495643_0039688 | |||
| 2134 | Ga0495648_0003175 | |||
| 2135 | Ga0495648_0121581 | |||
| 2136 | Ga0495587_0409983 | |||
| 2137 | Ga0495598_0455886 | |||
| 2138 | Ga0495621_0179807 | |||
| 2139 | Ga0495621_0287582 | |||
| 2140 | Ga0495597_0278305 | |||
| 2141 | Ga0495668_0000099 | |||
| 2142 | Ga0495611_0000072 | |||
| 2143 | Ga0495611_0278036 | |||
| 2144 | Ga0495625_0331401 | |||
| 2145 | Ga0495657_0248461 | |||
| 2146 | Ga0495613_0727141 | |||
| 2147 | Ga0495671_0618973 | |||
| 2148 | Ga0495649_0295955 | |||
| 2149 | Ga0495636_0205653 | |||
| 2150 | Ga0495674_0412029 | |||
| 2151 | Ga0495672_0089133 | |||
| 2152 | Ga0495672_0110762 | |||
| 2153 | Ga0495687_000058 | |||
| 2154 | Ga0495686_0000005 | |||
| 2155 | Ga0495686_0023576 | |||
| 2156 | Ga0495686_0024167 | |||
| 2157 | Ga0496100_0915876 | |||
| 2158 | Ga0496100_1307316 | |||
| 2159 | Ga0496101_0160962 | |||
| 2160 | Ga0496105_0452192 | |||
| 2161 | Ga0496108_1600443 | |||
| 2162 | Ga0496114_0462096 | |||
| 2163 | Ga0496114_0870052 | |||
| 2164 | Ga0496124_0208162 | |||
| 2165 | Ga0496126_1342862 | |||
| 2166 | Ga0501302_024939 | |||
| 2167 | Ga0501033_0036158 | |||
| 2168 | Ga0501033_0297994 | |||
| 2169 | Ga0501034_0009891 | |||
| 2170 | Ga0501034_0019453 | |||
| 2171 | Ga0501038_0387028 | |||
| 2172 | Ga0501043_0755437 | |||
| 2173 | Ga0501047_1370972 | |||
| 2174 | Ga0501070_1301951 | |||
| 2175 | Ga0501201_010632 | |||
| 2176 | Ga0501223_028028 | |||
| 2177 | Ga0501238_001961 | |||
| 2178 | Ga0501259_039154 | |||
| 2179 | Ga0501225_0095077 | |||
| 2180 | Ga0501080_0698503 | |||
| 2181 | Ga0501044_0049938 | |||
| 2182 | Ga0501044_0151585 | |||
| 2183 | Ga0501044_1675554 | |||
| 2184 | nmdc:mga0k408_2506_c1 | |||
| 2185 | nmdc:mga05p37_99959_c1 | |||
| 2186 | nmdc:mga06r32_1869738_c1 | |||
| 2187 | nmdc:mga08y16_1119709_c1 | |||
| 2188 | nmdc:mga08y16_31220_c1 | |||
| 2189 | nmdc:mga08y16_31670_c1 | |||
| 2190 | nmdc:mga08y16_335606_c1 | |||
| 2191 | nmdc:mga08y16_478500_c1 | |||
| 2192 | nmdc:mga08y16_680998_c1 | |||
| 2193 | nmdc:mga0n895_1414893_c1 | |||
| 2194 | nmdc:mga0n895_263898_c1 | |||
| 2195 | Ga0500583_0001474 | |||
| 2196 | Ga0500583_0138969 | |||
| 2197 | Ga0500562_000086 | |||
| 2198 | Ga0500594_0139425 | |||
| 2199 | Ga0500621_213564 | |||
| 2200 | Ga0500642_0004786 | |||
| 2201 | Ga0500568_0017273 | |||
| 2202 | Ga0500588_0060870 | |||
| 2203 | Ga0500616_0101068 | |||
| 2204 | Ga0500622_0002308 | |||
| 2205 | Ga0500637_0015463 | |||
| 2206 | Ga0500645_148775 | |||
| 2207 | Ga0466962_0023375 | |||
| 2208 | 2819586342 | |||
| 2209 | 2883069955 | |||
| 2210 | 2929178258 | |||
| 2211 | 2945980623 | |||
| 2212 | 2946013513 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3f72-assembly2.cif.gz_D | crystal structure of the staphylococcus aureus pi258 cadc metal binding site 2 mutant | 0.946 | 8 | 57 |
| 1ub9-assembly1.cif.gz_A-2 | structure of the transcriptional regulator homologue protein from pyrococcus horikoshii ot3 | 0.9458 | 8 | 94 |
| 2mlg-assembly1.cif.gz_A | stf76 from the sulfolobus islandicus plasmid-virus pssvx | 0.9288 | 11 | 75 |
| 5tjj-assembly1.cif.gz_B | crystal structure of icir transcriptional regulator from alicyclobacillus acidocaldarius | 0.903 | 13 | 59 |
| 1s3j-assembly1.cif.gz_B | x-ray crystal structure of yuso protein from bacillus subtilis | 0.8909 | 11 | 95 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P71977_12_75_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.973 | 13 | 57 | 1.10.10.10 |
| 3f72D00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.946 | 8 | 57 | 1.10.10.10 |
| 1ub9A00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9458 | 8 | 94 | 1.10.10.10 |
| 2xrnA01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9454 | 14 | 57 | 1.10.10.10 |
| af_Q57874_1_91_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9352 | 6 | 91 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A521UBQ1-F1-model_v4 | Transcriptional regulator | 0.9951 | 2 | 89 |
GO:0016020
|
| AF-E5UQD5-F1-model_v4 | deleted | 0.9925 | 4 | 91 |
|
| AF-A0A2I0NEC8-F1-model_v4 | HTH marR-type domain-containing protein | 0.992 | 5 | 96 |
GO:0003700
|
| AF-A0A838N259-F1-model_v4 | Transcriptional regulator | 0.9916 | 6 | 93 |
|
| AF-A0A4S2H9Y7-F1-model_v4 | Transcriptional regulator | 0.9905 | 5 | 94 |
|