F490192

General Info

Members Datasets Scaffolds Average Seq Length
1108 367 1108 234

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0086071|Ga0501047_0086071_1691_2566
Length 265
Sequence MKGESPVAVAEVAGKSPNHQISFGPREVNTMRKRGRKYEAARAQVDTDRMYTIEDAIPLVQKVKFAKFDETVELTLRLGVDPKHADQMVRGTVVLPHGLGKTKRVLAIAGGEKQKEAQDAGADFVGGEEVVERIMGGWTDFDAVVATPDMMRAVGRLGKVLGPRGLMPNPKTGTVSTDIRKAVQEIKAGKVEFRVDKTGIIHAPVGKTSFASESLVANAHALVDSIVKAKPAAAKGKYLKSITVSSTMGPGVAVDTMAVDAAVKH

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
10 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
40 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
78 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
84 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
85 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
86 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
87 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
88 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
89 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
90 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
91 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
92 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
93 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
95 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
96 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
97 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
98 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
99 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
100 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
101 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
102 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
103 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
104 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
106 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
107 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
108 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
109 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
111 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
112 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
114 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
115 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
116 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
117 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
118 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
119 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
120 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
121 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
122 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
123 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
124 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
125 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
126 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
127 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
128 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
129 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
188 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
189 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
190 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
196 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
197 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
198 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
199 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
200 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
201 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
202 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
203 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
204 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
205 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
206 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
207 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
208 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
209 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
210 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
211 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
212 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
213 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
214 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
215 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
216 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
217 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
218 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
219 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
220 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
221 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
222 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
223 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
224 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
225 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
226 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
227 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
228 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
229 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
230 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
231 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
232 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
233 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
234 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
235 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
236 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
237 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
238 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
239 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
240 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
241 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
242 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
243 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
244 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
245 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
246 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
247 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
248 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
249 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
250 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
251 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
252 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
253 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
254 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
255 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
256 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
257 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
258 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
259 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
260 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
261 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
262 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
263 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
264 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
265 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
266 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
267 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
268 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
269 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
270 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
271 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
272 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
273 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
274 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
275 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
276 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
277 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
278 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
279 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
280 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
281 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
282 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
283 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
284 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
285 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
286 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
287 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
288 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
289 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
290 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
291 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
292 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
293 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
294 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
295 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
296 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
297 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
298 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
299 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
300 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
301 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
302 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
303 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
304 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
321 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
322 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
323 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
324 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
325 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
326 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
327 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
328 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
329 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
330 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
331 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
332 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
333 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
334 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
335 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
338 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
339 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
340 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
341 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
342 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
343 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
344 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
345 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
346 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
347 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
348 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
349 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
350 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
351 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
352 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
353 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
354 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
355 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
356 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
357 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
358 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
359 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
360 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
361 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
362 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
363 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
364 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
365 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
366 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
367 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.92
Metatranscriptomes 1.08
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.98
Nodule 0
Rhizoplane 3.61
Rhizosphere 93.14
Stem 0
Stem Tuber 0
Unclassified 0.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_6987276 2162886011 Bacteria 1733
2 MBSR1b_contig_750255 2162886012 Bacteria 1962
3 JGI24742J22300_10008969 3300002244 Bacteria 1649
4 JGI24751J29686_10002254 3300002459 Bacteria 3905
5 JGI24751J29686_10012467 3300002459 Bacteria 1754
6 Ga0006759J45824_1071695 3300003163 Bacteria 1892
7 Ga0007417J51691_1063962 3300003544 Bacteria 1840
8 Ga0007409J51694_1063287 3300003575 Bacteria 1867
9 Ga0007416J51690_1063111 3300003577 Bacteria 3208
10 Ga0058859_11631144 3300004798 Bacteria 935
11 Ga0058861_12027855 3300004800 Bacteria 2411
12 Ga0058862_10054132 3300004803 Bacteria 3244
13 Ga0065712_10003155 3300005290 Bacteria 4050
14 Ga0065712_10003180 3300005290 Bacteria 5260
15 Ga0065712_10010412 3300005290 Bacteria 3191
16 Ga0065712_10016186 3300005290 Bacteria 1731
17 Ga0065712_10072555 3300005290 Bacteria 4707
18 Ga0065712_10076319 3300005290 Bacteria 3683
19 Ga0065715_10012525 3300005293 Bacteria 2123
20 Ga0065715_10018175 3300005293 Bacteria 3253
21 Ga0065715_10030346 3300005293 Bacteria 1486
22 Ga0065715_10134694 3300005293 Bacteria 1935
23 Ga0065715_10143024 3300005293 Bacteria 1826
24 Ga0065715_10147492 3300005293 Bacteria 1766
25 Ga0065715_10188267 3300005293 Bacteria 1431
26 Ga0065715_10268954 3300005293 Bacteria 1116
27 Ga0065715_10326421 3300005293 Bacteria 992
28 Ga0065715_10427148 3300005293 Bacteria 851
29 Ga0065707_10105294 3300005295 Bacteria 2651
30 Ga0065707_10142628 3300005295 Bacteria 1753
31 Ga0065707_10234509 3300005295 Bacteria 1177
32 Ga0065707_10251684 3300005295 Bacteria 1123
33 Ga0070658_10049558 3300005327 Bacteria 3402
34 Ga0070676_10006877 3300005328 Bacteria 6091
35 Ga0070676_10020758 3300005328 Bacteria 3672
36 Ga0070683_100022502 3300005329 Bacteria 5633
37 Ga0070683_100067471 3300005329 Bacteria 3332
38 Ga0070683_100143037 3300005329 Bacteria 2266
39 Ga0070683_100258581 3300005329 Bacteria 1656
40 Ga0070683_100284898 3300005329 Bacteria 1572
41 Ga0070690_100063688 3300005330 Bacteria 2380
42 Ga0070670_100032636 3300005331 Bacteria 4485
43 Ga0070670_100036649 3300005331 Bacteria 4220
44 Ga0070670_100042782 3300005331 Bacteria 3895
45 Ga0070670_100106489 3300005331 Bacteria 2416
46 Ga0070670_100242385 3300005331 Bacteria 1570
47 Ga0070670_100344019 3300005331 Bacteria 1309
48 Ga0070670_100825900 3300005331 Bacteria 838
49 Ga0068869_100226264 3300005334 Bacteria 1485
50 Ga0068869_100280484 3300005334 Bacteria 1340
51 Ga0068869_100350246 3300005334 Bacteria 1204
52 Ga0070666_10051301 3300005335 Bacteria 2777
53 Ga0070666_10298179 3300005335 Bacteria 1148
54 Ga0070680_100462572 3300005336 Bacteria 1084
55 Ga0070682_100319668 3300005337 Bacteria 1146
56 Ga0068868_100029640 3300005338 Bacteria 4192
57 Ga0068868_100078911 3300005338 Bacteria 2636
58 Ga0068868_100816285 3300005338 Bacteria 842
59 Ga0070660_100021355 3300005339 Bacteria 4773
60 Ga0070660_100281513 3300005339 Bacteria 1361
61 Ga0070689_100010275 3300005340 Bacteria 6669
62 Ga0070689_100035329 3300005340 Bacteria 3819
63 Ga0070689_100178217 3300005340 Bacteria 1725
64 Ga0070689_100461992 3300005340 Bacteria 1082
65 Ga0070691_10021653 3300005341 Bacteria 2976
66 Ga0070687_100010598 3300005343 Bacteria 3995
67 Ga0070687_100058939 3300005343 Bacteria 2019
68 Ga0070687_100269366 3300005343 Bacteria 1067
69 Ga0070687_100429411 3300005343 Bacteria 874
70 Ga0070661_100104558 3300005344 Bacteria 2110
71 Ga0070661_100169352 3300005344 Bacteria 1658
72 Ga0070668_100068984 3300005347 Bacteria 2749
73 Ga0070669_100012125 3300005353 Bacteria 6117
74 Ga0070669_100107040 3300005353 Bacteria 2118
75 Ga0070669_100114726 3300005353 Bacteria 2048
76 Ga0070669_100573711 3300005353 Bacteria 943
77 Ga0070669_100781276 3300005353 Bacteria 811
78 Ga0070675_100003283 3300005354 Bacteria 12267
79 Ga0070675_100058678 3300005354 Bacteria 3174
80 Ga0070675_100058711 3300005354 Bacteria 3173
81 Ga0070675_100069790 3300005354 Bacteria 2911
82 Ga0070675_100141131 3300005354 Bacteria 2059
83 Ga0070675_100280217 3300005354 Bacteria 1465
84 Ga0070675_100337921 3300005354 Bacteria 1333
85 Ga0070675_100616641 3300005354 Bacteria 985
86 Ga0070671_100019573 3300005355 Bacteria 5511
87 Ga0070671_100022293 3300005355 Bacteria 5172
88 Ga0070671_100069061 3300005355 Bacteria 2947
89 Ga0070671_100082165 3300005355 Bacteria 2694
90 Ga0070671_100142650 3300005355 Bacteria 2021
91 Ga0070671_100159531 3300005355 Bacteria 1906
92 Ga0070674_100011938 3300005356 Bacteria 5312
93 Ga0070674_100095868 3300005356 Bacteria 2151
94 Ga0070674_100176591 3300005356 Bacteria 1632
95 Ga0070674_100332866 3300005356 Bacteria 1221
96 Ga0070674_100420077 3300005356 Bacteria 1097
97 Ga0070673_100019034 3300005364 Bacteria 4924
98 Ga0070673_100031948 3300005364 Bacteria 3957
99 Ga0070673_100135160 3300005364 Bacteria 2074
100 Ga0070673_100137927 3300005364 Bacteria 2055
101 Ga0070673_100223833 3300005364 Bacteria 1629
102 Ga0070673_100258329 3300005364 Bacteria 1521
103 Ga0070673_100282747 3300005364 Bacteria 1455
104 Ga0070673_100472307 3300005364 Bacteria 1131
105 Ga0070688_100034074 3300005365 Bacteria 3081
106 Ga0070659_100070503 3300005366 Bacteria 2777
107 Ga0070659_100427545 3300005366 Bacteria 1121
108 Ga0070667_100268327 3300005367 Bacteria 1530
109 Ga0070667_100323696 3300005367 Bacteria 1391
110 Ga0070667_100374965 3300005367 Bacteria 1292
111 Ga0070703_10009170 3300005406 Bacteria 2791
112 Ga0070709_10046224 3300005434 Bacteria 2706
113 Ga0070709_10090197 3300005434 Bacteria 2020
114 Ga0070709_10185255 3300005434 Bacteria 1465
115 Ga0070709_10209858 3300005434 Bacteria 1384
116 Ga0070709_10381645 3300005434 Bacteria 1048
117 Ga0070714_100016727 3300005435 Bacteria 5930
118 Ga0070701_10008026 3300005438 Bacteria 4540
119 Ga0070701_10204590 3300005438 Bacteria 1169
120 Ga0070705_100008577 3300005440 Bacteria 5063
121 Ga0070705_100014714 3300005440 Bacteria 4032
122 Ga0070705_100087692 3300005440 Bacteria 1930
123 Ga0070705_100355430 3300005440 Bacteria 1070
124 Ga0070705_100441458 3300005440 Bacteria 974
125 Ga0070700_100054235 3300005441 Bacteria 2504
126 Ga0070700_100071481 3300005441 Bacteria 2215
127 Ga0070700_100121566 3300005441 Bacteria 1750
128 Ga0070694_100029135 3300005444 Bacteria 3600
129 Ga0070694_100079554 3300005444 Bacteria 2276
130 Ga0070694_100086832 3300005444 Bacteria 2187
131 Ga0070694_100171326 3300005444 Bacteria 1599
132 Ga0070708_100018355 3300005445 Bacteria 5855
133 Ga0070708_100037389 3300005445 Bacteria 4234
134 Ga0070708_100117345 3300005445 Bacteria 2451
135 Ga0070663_100075212 3300005455 Bacteria 2468
136 Ga0070663_100102519 3300005455 Bacteria 2138
137 Ga0070678_100021386 3300005456 Bacteria 4265
138 Ga0070678_100025537 3300005456 Bacteria 3977
139 Ga0070678_100073380 3300005456 Bacteria 2568
140 Ga0070678_100148080 3300005456 Bacteria 1887
141 Ga0070678_100503690 3300005456 Bacteria 1068
142 Ga0070662_100310444 3300005457 Bacteria 1284
143 Ga0070662_100313497 3300005457 Bacteria 1277
144 Ga0070662_100360579 3300005457 Bacteria 1193
145 Ga0070681_10036645 3300005458 Bacteria 4924
146 Ga0070681_10096625 3300005458 Bacteria 2902
147 Ga0068867_100024756 3300005459 Bacteria 4302
148 Ga0068867_100046871 3300005459 Bacteria 3176
149 Ga0070685_10068726 3300005466 Bacteria 2093
150 Ga0070706_100039283 3300005467 Bacteria 4368
151 Ga0070706_100446197 3300005467 Bacteria 1204
152 Ga0070698_100031163 3300005471 Bacteria 5528
153 Ga0070698_100045728 3300005471 Bacteria 4479
154 Ga0070698_100169372 3300005471 Bacteria 2125
155 Ga0070698_100458387 3300005471 Bacteria 1211
156 Ga0070699_100039862 3300005518 Bacteria 4068
157 Ga0070699_100099854 3300005518 Bacteria 2544
158 Ga0070699_100476066 3300005518 Bacteria 1133
159 Ga0070679_100331744 3300005530 Bacteria 1470
160 Ga0070684_100050464 3300005535 Bacteria 3614
161 Ga0070684_100227261 3300005535 Bacteria 1703
162 Ga0070684_100593368 3300005535 Bacteria 1030
163 Ga0070697_100006688 3300005536 Bacteria 8946
164 Ga0070697_100384124 3300005536 Bacteria 1216
165 Ga0068853_100401456 3300005539 Bacteria 1283
166 Ga0068853_100585276 3300005539 Bacteria 1059
167 Ga0070672_100035240 3300005543 Bacteria 3803
168 Ga0070672_100069103 3300005543 Bacteria 2803
169 Ga0070672_100090608 3300005543 Bacteria 2466
170 Ga0070672_100131380 3300005543 Bacteria 2058
171 Ga0070672_100149735 3300005543 Bacteria 1930
172 Ga0070672_100163998 3300005543 Bacteria 1845
173 Ga0070672_100222995 3300005543 Bacteria 1582
174 Ga0070672_100240827 3300005543 Bacteria 1521
175 Ga0070672_100547294 3300005543 Bacteria 1005
176 Ga0070686_100054834 3300005544 Bacteria 2551
177 Ga0070686_100101114 3300005544 Bacteria 1948
178 Ga0070695_100006978 3300005545 Bacteria 6690
179 Ga0070695_100027513 3300005545 Bacteria 3522
180 Ga0070695_100031080 3300005545 Bacteria 3327
181 Ga0070695_100389579 3300005545 Bacteria 1054
182 Ga0070696_100030063 3300005546 Bacteria 3717
183 Ga0070696_100064740 3300005546 Bacteria 2562
184 Ga0070696_100292081 3300005546 Bacteria 1246
185 Ga0070693_100000610 3300005547 Bacteria 15836
186 Ga0070693_100010528 3300005547 Bacteria 4636
187 Ga0070693_100025995 3300005547 Bacteria 3156
188 Ga0070693_100211067 3300005547 Bacteria 1267
189 Ga0070665_100001142 3300005548 Bacteria 32621
190 Ga0070665_100026504 3300005548 Bacteria 5836
191 Ga0070665_100043746 3300005548 Bacteria 4499
192 Ga0070665_100151522 3300005548 Bacteria 2321
193 Ga0070665_100442732 3300005548 Bacteria 1309
194 Ga0070665_100663561 3300005548 Bacteria 1056
195 Ga0070665_100846182 3300005548 Bacteria 928
196 Ga0070704_100002012 3300005549 Bacteria 11263
197 Ga0070704_100022139 3300005549 Bacteria 4132
198 Ga0070704_100036297 3300005549 Bacteria 3358
199 Ga0070704_100038836 3300005549 Bacteria 3264
200 Ga0070704_100085002 3300005549 Bacteria 2341
201 Ga0070704_100191163 3300005549 Bacteria 1646
202 Ga0070704_100299790 3300005549 Bacteria 1339
203 Ga0070704_100429123 3300005549 Bacteria 1133
204 Ga0070664_100000479 3300005564 Bacteria 30222
205 Ga0070664_100023901 3300005564 Bacteria 5049
206 Ga0070664_100345767 3300005564 Bacteria 1352
207 Ga0070664_100369425 3300005564 Bacteria 1307
208 Ga0070664_100801303 3300005564 Bacteria 881
209 Ga0068857_100088906 3300005577 Bacteria 2764
210 Ga0068857_100095854 3300005577 Bacteria 2659
211 Ga0068857_100702700 3300005577 Bacteria 961
212 Ga0068854_100030421 3300005578 Bacteria 3745
213 Ga0068856_100021502 3300005614 Bacteria 6269
214 Ga0070702_100069828 3300005615 Bacteria 2071
215 Ga0070702_100193094 3300005615 Bacteria 1341
216 Ga0068852_100156437 3300005616 Bacteria 2124
217 Ga0068852_100880250 3300005616 Bacteria 912
218 Ga0068859_100051119 3300005617 Bacteria 4153
219 Ga0068859_100052431 3300005617 Bacteria 4101
220 Ga0068859_100058170 3300005617 Bacteria 3894
221 Ga0068859_100060743 3300005617 Bacteria 3808
222 Ga0068859_100097924 3300005617 Bacteria 2986
223 Ga0068859_100116721 3300005617 Bacteria 2733
224 Ga0068859_100143147 3300005617 Bacteria 2464
225 Ga0068864_100020005 3300005618 Bacteria 5597
226 Ga0068864_100021918 3300005618 Bacteria 5355
227 Ga0068864_100041795 3300005618 Bacteria 3921
228 Ga0068864_100103104 3300005618 Bacteria 2532
229 Ga0068864_100340238 3300005618 Bacteria 1414
230 Ga0068866_10029809 3300005718 Bacteria 2612
231 Ga0068866_10141972 3300005718 Bacteria 1379
232 Ga0068861_100037825 3300005719 Bacteria 3588
233 Ga0068861_100075215 3300005719 Bacteria 2628
234 Ga0068861_100276293 3300005719 Bacteria 1445
235 Ga0068861_100280773 3300005719 Bacteria 1434
236 Ga0068851_10180931 3300005834 Bacteria 1168
237 Ga0068870_10018787 3300005840 Bacteria 3343
238 Ga0068863_100002641 3300005841 Bacteria 17739
239 Ga0068863_100101783 3300005841 Bacteria 2731
240 Ga0068863_100314856 3300005841 Bacteria 1519
241 Ga0068863_100448766 3300005841 Bacteria 1266
242 Ga0068858_100003549 3300005842 Bacteria 15439
243 Ga0068858_100108646 3300005842 Bacteria 2589
244 Ga0068858_100179900 3300005842 Bacteria 1996
245 Ga0068860_100031462 3300005843 Bacteria 5101
246 Ga0068860_100110727 3300005843 Bacteria 2625
247 Ga0068860_100146900 3300005843 Bacteria 2269
248 Ga0068860_100168973 3300005843 Bacteria 2112
249 Ga0068860_100308768 3300005843 Bacteria 1551
250 Ga0068860_100528742 3300005843 Bacteria 1180
251 Ga0068862_100037942 3300005844 Bacteria 4085
252 Ga0068862_100038643 3300005844 Bacteria 4049
253 Ga0068862_100119836 3300005844 Bacteria 2318
254 Ga0068862_100463520 3300005844 Bacteria 1196
255 Ga0081455_10052243 3300005937 Bacteria 3500
256 Ga0081455_10062519 3300005937 Bacteria 3129
257 Ga0081540_1071342 3300005983 Bacteria 1605
258 Ga0081539_10004143 3300005985 Bacteria 16485
259 Ga0075368_10010245 3300006042 Bacteria 3385
260 Ga0075363_100035548 3300006048 Bacteria 2608
261 Ga0075364_10473049 3300006051 Bacteria 856
262 Ga0075432_10066499 3300006058 Bacteria 1290
263 Ga0075362_10100835 3300006177 Bacteria 1350
264 Ga0075367_10027582 3300006178 Bacteria 3232
265 Ga0075367_10074056 3300006178 Bacteria 2053
266 Ga0075367_10128678 3300006178 Bacteria 1564
267 Ga0075367_10238896 3300006178 Bacteria 1138
268 Ga0075366_10010873 3300006195 Bacteria 5121
269 Ga0075366_10282549 3300006195 Bacteria 1014
270 Ga0075366_10291189 3300006195 Bacteria 998
271 Ga0097621_100012152 3300006237 Bacteria 6372
272 Ga0097621_100019408 3300006237 Bacteria 5216
273 Ga0097621_100050116 3300006237 Bacteria 3395
274 Ga0097621_100108636 3300006237 Bacteria 2342
275 Ga0097621_100163688 3300006237 Bacteria 1914
276 Ga0097621_100168154 3300006237 Bacteria 1888
277 Ga0075370_10329409 3300006353 Bacteria 910
278 Ga0068871_100016384 3300006358 Bacteria 5581
279 Ga0068871_100089011 3300006358 Bacteria 2569
280 Ga0068871_100358315 3300006358 Bacteria 1291
281 Ga0068871_100871149 3300006358 Bacteria 833
282 Ga0075428_100000017 3300006844 Bacteria 147833
283 Ga0075428_100059187 3300006844 Bacteria 4195
284 Ga0075428_100092394 3300006844 Bacteria 3299
285 Ga0075428_100101880 3300006844 Bacteria 3130
286 Ga0075428_100173346 3300006844 Bacteria 2337
287 Ga0075428_100542217 3300006844 Bacteria 1244
288 Ga0075428_100751183 3300006844 Bacteria 1038
289 Ga0075428_101101983 3300006844 Bacteria 839
290 Ga0075430_100032704 3300006846 Bacteria 4414
291 Ga0075430_100060590 3300006846 Bacteria 3180
292 Ga0075430_100328105 3300006846 Bacteria 1265
293 Ga0075431_100051337 3300006847 Bacteria 4253
294 Ga0075431_100054499 3300006847 Bacteria 4124
295 Ga0075431_100071897 3300006847 Bacteria 3569
296 Ga0075431_100078029 3300006847 Bacteria 3419
297 Ga0075431_100081544 3300006847 Bacteria 3340
298 Ga0075431_100139789 3300006847 Bacteria 2496
299 Ga0075431_100165453 3300006847 Bacteria 2273
300 Ga0075431_100239897 3300006847 Bacteria 1844
301 Ga0075431_100448333 3300006847 Bacteria 1286
302 Ga0075431_100806842 3300006847 Bacteria 911
303 Ga0075433_10146434 3300006852 Bacteria 2100
304 Ga0075433_10299581 3300006852 Bacteria 1424
305 Ga0075434_100008089 3300006871 Bacteria 9751
306 Ga0075434_100023274 3300006871 Bacteria 6034
307 Ga0075434_100030826 3300006871 Bacteria 5284
308 Ga0075434_100049389 3300006871 Bacteria 4177
309 Ga0075434_100052251 3300006871 Bacteria 4060
310 Ga0075434_100120927 3300006871 Bacteria 2634
311 Ga0075434_100163608 3300006871 Bacteria 2245
312 Ga0075434_100323067 3300006871 Bacteria 1564
313 Ga0075434_100458533 3300006871 Bacteria 1296
314 Ga0075429_100022950 3300006880 Bacteria 5409
315 Ga0075429_100061614 3300006880 Bacteria 3268
316 Ga0075429_100161465 3300006880 Bacteria 1962
317 Ga0075429_100249221 3300006880 Bacteria 1555
318 Ga0068865_100167247 3300006881 Bacteria 1682
319 Ga0068865_100254832 3300006881 Bacteria 1386
320 Ga0068865_100342560 3300006881 Bacteria 1208
321 Ga0068865_100568230 3300006881 Bacteria 954
322 Ga0075436_100013829 3300006914 Bacteria 5527
323 Ga0075436_100045093 3300006914 Bacteria 3041
324 Ga0075436_100061898 3300006914 Bacteria 2586
325 Ga0075436_100499804 3300006914 Bacteria 889
326 Ga0097620_100051121 3300006931 Bacteria 4153
327 Ga0097620_100052429 3300006931 Bacteria 4101
328 Ga0097620_100058168 3300006931 Bacteria 3894
329 Ga0097620_100060741 3300006931 Bacteria 3808
330 Ga0097620_100097925 3300006931 Bacteria 2986
331 Ga0097620_100116734 3300006931 Bacteria 2733
332 Ga0097620_100143146 3300006931 Bacteria 2464
333 Ga0075435_100006214 3300007076 Bacteria 8428
334 Ga0075435_100009940 3300007076 Bacteria 6929
335 Ga0075435_100010966 3300007076 Bacteria 6644
336 Ga0075435_100013746 3300007076 Bacteria 6032
337 Ga0075435_100018121 3300007076 Bacteria 5344
338 Ga0075435_100077607 3300007076 Bacteria 2723
339 Ga0075435_100111882 3300007076 Bacteria 2271
340 Ga0075435_100153841 3300007076 Bacteria 1935
341 Ga0075435_100210480 3300007076 Bacteria 1649
342 Ga0075435_100477185 3300007076 Bacteria 1077
343 Ga0099794_10020540 3300007265 Bacteria 2990
344 Ga0099794_10056389 3300007265 Bacteria 1901
345 Ga0099795_10062127 3300007788 Bacteria 1389
346 Ga0105240_10039744 3300009093 Bacteria 6021
347 Ga0105240_10517443 3300009093 Bacteria 1325
348 Ga0105240_10830910 3300009093 Bacteria 999
349 Ga0111539_10000002 3300009094 Bacteria 983359
350 Ga0111539_10050951 3300009094 Bacteria 4932
351 Ga0111539_10070960 3300009094 Bacteria 4111
352 Ga0111539_10071376 3300009094 Bacteria 4097
353 Ga0111539_10083713 3300009094 Bacteria 3751
354 Ga0111539_10162198 3300009094 Bacteria 2614
355 Ga0111539_10175332 3300009094 Bacteria 2504
356 Ga0111539_10454973 3300009094 Bacteria 1491
357 Ga0111539_10518014 3300009094 Bacteria 1389
358 Ga0111539_10569014 3300009094 Bacteria 1320
359 Ga0111539_10590377 3300009094 Bacteria 1293
360 Ga0105245_10475638 3300009098 Bacteria 1262
361 Ga0105247_10015895 3300009101 Bacteria 4506
362 Ga0105247_10338603 3300009101 Bacteria 1054
363 Ga0114129_10001925 3300009147 Bacteria 28355
364 Ga0114129_10037064 3300009147 Bacteria 6885
365 Ga0114129_10057496 3300009147 Bacteria 5442
366 Ga0114129_10082040 3300009147 Bacteria 4481
367 Ga0114129_10083262 3300009147 Bacteria 4445
368 Ga0114129_10088785 3300009147 Bacteria 4285
369 Ga0114129_10089356 3300009147 Bacteria 4270
370 Ga0114129_10090758 3300009147 Bacteria 4234
371 Ga0114129_10124117 3300009147 Bacteria 3551
372 Ga0114129_10175605 3300009147 Bacteria 2918
373 Ga0114129_10218741 3300009147 Bacteria 2571
374 Ga0114129_10319563 3300009147 Bacteria 2064
375 Ga0105243_10043926 3300009148 Bacteria 3504
376 Ga0105243_10063738 3300009148 Bacteria 2954
377 Ga0105243_10723962 3300009148 Bacteria 973
378 Ga0105241_10070577 3300009174 Bacteria 2711
379 Ga0105241_10239476 3300009174 Bacteria 1533
380 Ga0105242_10033180 3300009176 Bacteria 4133
381 Ga0105242_10204657 3300009176 Bacteria 1755
382 Ga0105242_10509381 3300009176 Bacteria 1146
383 Ga0105248_10058749 3300009177 Bacteria 4319
384 Ga0105248_10091410 3300009177 Bacteria 3428
385 Ga0105248_10115515 3300009177 Bacteria 3027
386 Ga0105248_10137242 3300009177 Bacteria 2759
387 Ga0105248_10174972 3300009177 Bacteria 2419
388 Ga0105248_10303600 3300009177 Bacteria 1797
389 Ga0105248_10365917 3300009177 Bacteria 1623
390 Ga0105248_11319378 3300009177 Bacteria 816
391 Ga0105237_10818557 3300009545 Bacteria 938
392 Ga0105238_10213858 3300009551 Bacteria 1904
393 Ga0105238_10518896 3300009551 Bacteria 1194
394 Ga0105249_10047141 3300009553 Bacteria 3925
395 Ga0105249_10432333 3300009553 Bacteria 1352
396 Ga0157369_10199512 3300013105 Bacteria 2100
397 Ga0157374_10070935 3300013296 Bacteria 3284
398 Ga0157374_10196172 3300013296 Bacteria 1976
399 Ga0157374_10278710 3300013296 Bacteria 1650
400 Ga0157378_10000704 3300013297 Bacteria 31326
401 Ga0157378_10111251 3300013297 Bacteria 2511
402 Ga0157378_10122509 3300013297 Bacteria 2399
403 Ga0163162_10012245 3300013306 Bacteria 8370
404 Ga0163162_10055553 3300013306 Bacteria 3987
405 Ga0163162_10082782 3300013306 Bacteria 3281
406 Ga0157375_10224479 3300013308 Bacteria 2037
407 Ga0163163_10019918 3300014325 Bacteria 6310
408 Ga0163163_10034316 3300014325 Bacteria 4912
409 Ga0163163_10238824 3300014325 Bacteria 1867
410 Ga0163163_10513724 3300014325 Bacteria 1260
411 Ga0157380_10090303 3300014326 Bacteria 2526
412 Ga0157380_10213298 3300014326 Bacteria 1722
413 Ga0157380_10493336 3300014326 Bacteria 1188
414 Ga0157380_10960479 3300014326 Bacteria 885
415 Ga0157379_10087694 3300014968 Bacteria 2790
416 Ga0157379_10127107 3300014968 Bacteria 2294
417 Ga0157379_10645930 3300014968 Bacteria 990
418 Ga0157376_10244614 3300014969 Bacteria 1673
419 Ga0157376_10324727 3300014969 Bacteria 1464
420 Ga0157376_10432527 3300014969 Bacteria 1279
421 Ga0157376_10618666 3300014969 Bacteria 1080
422 Ga0207697_10006737 3300025315 Bacteria 5169
423 Ga0207697_10049267 3300025315 Bacteria 1739
424 Ga0207697_10063571 3300025315 Bacteria 1538
425 Ga0207653_10003613 3300025885 Bacteria 4871
426 Ga0207682_10057577 3300025893 Bacteria 1621
427 Ga0207682_10231348 3300025893 Bacteria 857
428 Ga0207642_10114509 3300025899 Bacteria 1379
429 Ga0207710_10073604 3300025900 Bacteria 1571
430 Ga0207710_10263789 3300025900 Bacteria 864
431 Ga0207680_10086181 3300025903 Bacteria 1985
432 Ga0207680_10167783 3300025903 Bacteria 1476
433 Ga0207680_10222653 3300025903 Bacteria 1294
434 Ga0207647_10020837 3300025904 Bacteria 4388
435 Ga0207699_10038979 3300025906 Bacteria 2727
436 Ga0207699_10069863 3300025906 Bacteria 2143
437 Ga0207699_10160286 3300025906 Bacteria 1497
438 Ga0207699_10229896 3300025906 Bacteria 1270
439 Ga0207645_10022529 3300025907 Bacteria 4097
440 Ga0207645_10024118 3300025907 Bacteria 3947
441 Ga0207645_10488157 3300025907 Bacteria 833
442 Ga0207643_10039470 3300025908 Bacteria 2656
443 Ga0207643_10212788 3300025908 Bacteria 1180
444 Ga0207684_10012006 3300025910 Bacteria 7543
445 Ga0207684_10050513 3300025910 Bacteria 3528
446 Ga0207684_10300332 3300025910 Bacteria 1384
447 Ga0207654_10066422 3300025911 Bacteria 2127
448 Ga0207654_10289253 3300025911 Bacteria 1111
449 Ga0207707_10031478 3300025912 Bacteria 4642
450 Ga0207707_10075131 3300025912 Bacteria 2948
451 Ga0207707_10098331 3300025912 Bacteria 2558
452 Ga0207695_10136434 3300025913 Bacteria 2406
453 Ga0207695_10732804 3300025913 Bacteria 869
454 Ga0207663_10133573 3300025916 Bacteria 1718
455 Ga0207663_10302828 3300025916 Bacteria 1195
456 Ga0207660_10399279 3300025917 Bacteria 1107
457 Ga0207662_10045759 3300025918 Bacteria 2587
458 Ga0207662_10115019 3300025918 Bacteria 1681
459 Ga0207662_10121296 3300025918 Bacteria 1640
460 Ga0207657_10083516 3300025919 Bacteria 2679
461 Ga0207649_10238303 3300025920 Bacteria 1305
462 Ga0207649_10288881 3300025920 Bacteria 1195
463 Ga0207646_10096455 3300025922 Bacteria 2649
464 Ga0207646_10432458 3300025922 Bacteria 1188
465 Ga0207681_10099023 3300025923 Bacteria 2098
466 Ga0207681_10171250 3300025923 Bacteria 1646
467 Ga0207681_10225089 3300025923 Bacteria 1453
468 Ga0207681_10271701 3300025923 Bacteria 1331
469 Ga0207681_10321576 3300025923 Bacteria 1230
470 Ga0207681_10341396 3300025923 Bacteria 1196
471 Ga0207694_10602381 3300025924 Bacteria 924
472 Ga0207650_10024531 3300025925 Bacteria 4288
473 Ga0207650_10054709 3300025925 Bacteria 2961
474 Ga0207650_10081604 3300025925 Bacteria 2453
475 Ga0207650_10211568 3300025925 Bacteria 1557
476 Ga0207650_10264885 3300025925 Bacteria 1395
477 Ga0207650_10355854 3300025925 Bacteria 1205
478 Ga0207659_10002281 3300025926 Bacteria 11427
479 Ga0207659_10022090 3300025926 Bacteria 4233
480 Ga0207659_10075534 3300025926 Bacteria 2473
481 Ga0207659_10288692 3300025926 Bacteria 1343
482 Ga0207659_10399579 3300025926 Bacteria 1149
483 Ga0207659_10433300 3300025926 Bacteria 1105
484 Ga0207659_10531041 3300025926 Bacteria 998
485 Ga0207687_10171415 3300025927 Bacteria 1674
486 Ga0207687_10408057 3300025927 Bacteria 1119
487 Ga0207700_10924622 3300025928 Bacteria 781
488 Ga0207664_10024634 3300025929 Bacteria 4523
489 Ga0207664_10296002 3300025929 Bacteria 1423
490 Ga0207644_10006250 3300025931 Bacteria 7761
491 Ga0207644_10013745 3300025931 Bacteria 5405
492 Ga0207644_10066753 3300025931 Bacteria 2620
493 Ga0207644_10135879 3300025931 Bacteria 1888
494 Ga0207644_10157657 3300025931 Bacteria 1762
495 Ga0207644_10247228 3300025931 Bacteria 1422
496 Ga0207644_10261013 3300025931 Bacteria 1385
497 Ga0207644_10496618 3300025931 Bacteria 1006
498 Ga0207706_10061580 3300025933 Bacteria 3305
499 Ga0207706_10077839 3300025933 Bacteria 2916
500 Ga0207686_10026234 3300025934 Bacteria 3398
501 Ga0207686_10042760 3300025934 Bacteria 2772
502 Ga0207686_10382956 3300025934 Bacteria 1067
503 Ga0207709_10057765 3300025935 Bacteria 2408
504 Ga0207709_10130334 3300025935 Bacteria 1713
505 Ga0207670_10032793 3300025936 Bacteria 3343
506 Ga0207670_10070285 3300025936 Bacteria 2417
507 Ga0207670_10077619 3300025936 Bacteria 2314
508 Ga0207670_10208154 3300025936 Bacteria 1490
509 Ga0207669_10097789 3300025937 Bacteria 1931
510 Ga0207669_10128917 3300025937 Bacteria 1734
511 Ga0207669_10196919 3300025937 Bacteria 1459
512 Ga0207669_10294840 3300025937 Bacteria 1230
513 Ga0207669_10316644 3300025937 Bacteria 1192
514 Ga0207669_10503623 3300025937 Bacteria 969
515 Ga0207669_10750250 3300025937 Bacteria 806
516 Ga0207704_10090084 3300025938 Bacteria 2012
517 Ga0207665_10220209 3300025939 Bacteria 1391
518 Ga0207691_10057475 3300025940 Bacteria 3540
519 Ga0207691_10059070 3300025940 Bacteria 3488
520 Ga0207691_10075386 3300025940 Bacteria 3042
521 Ga0207691_10089812 3300025940 Bacteria 2754
522 Ga0207691_10126513 3300025940 Bacteria 2261
523 Ga0207691_10154885 3300025940 Bacteria 2013
524 Ga0207691_10167555 3300025940 Bacteria 1925
525 Ga0207691_10205619 3300025940 Bacteria 1712
526 Ga0207691_10215919 3300025940 Bacteria 1664
527 Ga0207691_10261739 3300025940 Bacteria 1491
528 Ga0207691_10385659 3300025940 Bacteria 1196
529 Ga0207691_10427391 3300025940 Bacteria 1128
530 Ga0207691_10540080 3300025940 Bacteria 989
531 Ga0207711_10046720 3300025941 Bacteria 3699
532 Ga0207711_10060938 3300025941 Bacteria 3253
533 Ga0207711_10127929 3300025941 Bacteria 2274
534 Ga0207711_10140160 3300025941 Bacteria 2175
535 Ga0207711_10159678 3300025941 Bacteria 2039
536 Ga0207711_10276586 3300025941 Bacteria 1545
537 Ga0207711_10744733 3300025941 Bacteria 913
538 Ga0207689_10142740 3300025942 Bacteria 1973
539 Ga0207689_10146058 3300025942 Bacteria 1949
540 Ga0207689_10327625 3300025942 Bacteria 1271
541 Ga0207661_10052153 3300025944 Bacteria 3267
542 Ga0207661_10136329 3300025944 Bacteria 2108
543 Ga0207661_10145992 3300025944 Bacteria 2041
544 Ga0207679_10007830 3300025945 Bacteria 6789
545 Ga0207679_10031159 3300025945 Bacteria 3731
546 Ga0207679_10063554 3300025945 Bacteria 2756
547 Ga0207679_10081867 3300025945 Bacteria 2470
548 Ga0207679_10203418 3300025945 Bacteria 1655
549 Ga0207679_10470877 3300025945 Bacteria 1117
550 Ga0207651_10012876 3300025960 Bacteria 4756
551 Ga0207651_10032332 3300025960 Bacteria 3359
552 Ga0207651_10133750 3300025960 Bacteria 1903
553 Ga0207651_10342075 3300025960 Bacteria 1257
554 Ga0207651_10360489 3300025960 Bacteria 1227
555 Ga0207651_10558974 3300025960 Bacteria 996
556 Ga0207712_10030658 3300025961 Bacteria 3617
557 Ga0207712_10091557 3300025961 Bacteria 2240
558 Ga0207640_10018870 3300025981 Bacteria 4062
559 Ga0207640_10021255 3300025981 Bacteria 3866
560 Ga0207640_10371834 3300025981 Bacteria 1155
561 Ga0207640_10632071 3300025981 Bacteria 910
562 Ga0207658_10057390 3300025986 Bacteria 2893
563 Ga0207658_10064322 3300025986 Bacteria 2751
564 Ga0207658_10125681 3300025986 Bacteria 2052
565 Ga0207658_10308453 3300025986 Bacteria 1366
566 Ga0207677_10063437 3300026023 Bacteria 2569
567 Ga0207677_10101490 3300026023 Bacteria 2119
568 Ga0207677_10130122 3300026023 Bacteria 1909
569 Ga0207677_10668529 3300026023 Bacteria 918
570 Ga0207703_10037322 3300026035 Bacteria 3870
571 Ga0207703_10053472 3300026035 Bacteria 3282
572 Ga0207703_10087961 3300026035 Bacteria 2606
573 Ga0207703_10115187 3300026035 Bacteria 2300
574 Ga0207703_10510384 3300026035 Bacteria 1129
575 Ga0207639_10384205 3300026041 Bacteria 1261
576 Ga0207678_10118278 3300026067 Bacteria 2261
577 Ga0207678_10122540 3300026067 Bacteria 2218
578 Ga0207678_10223804 3300026067 Bacteria 1611
579 Ga0207708_10035399 3300026075 Bacteria 3800
580 Ga0207708_10091673 3300026075 Bacteria 2344
581 Ga0207708_10094953 3300026075 Bacteria 2303
582 Ga0207708_10105780 3300026075 Bacteria 2181
583 Ga0207708_10325494 3300026075 Bacteria 1255
584 Ga0207708_10445131 3300026075 Bacteria 1078
585 Ga0207702_10598141 3300026078 Bacteria 1082
586 Ga0207641_10006730 3300026088 Bacteria 9631
587 Ga0207641_10040192 3300026088 Bacteria 3915
588 Ga0207641_10268257 3300026088 Bacteria 1601
589 Ga0207648_10040419 3300026089 Bacteria 4098
590 Ga0207648_10108973 3300026089 Bacteria 2431
591 Ga0207648_10115354 3300026089 Bacteria 2360
592 Ga0207648_10178924 3300026089 Bacteria 1876
593 Ga0207648_10523384 3300026089 Bacteria 1087
594 Ga0207676_10090307 3300026095 Bacteria 2513
595 Ga0207676_10114833 3300026095 Bacteria 2259
596 Ga0207676_11178537 3300026095 Bacteria 759
597 Ga0207674_10017732 3300026116 Bacteria 7759
598 Ga0207674_10101649 3300026116 Bacteria 2855
599 Ga0207674_10511690 3300026116 Bacteria 1160
600 Ga0207675_100031657 3300026118 Bacteria 4928
601 Ga0207675_100037707 3300026118 Bacteria 4509
602 Ga0207675_100042150 3300026118 Bacteria 4260
603 Ga0207675_100136795 3300026118 Bacteria 2325
604 Ga0207675_100158686 3300026118 Bacteria 2156
605 Ga0207675_100325465 3300026118 Bacteria 1501
606 Ga0207683_10015965 3300026121 Bacteria 6390
607 Ga0207683_10062914 3300026121 Bacteria 3269
608 Ga0207683_10100072 3300026121 Bacteria 2588
609 Ga0207683_10186750 3300026121 Bacteria 1881
610 Ga0207683_10241586 3300026121 Bacteria 1647
611 Ga0207698_10135357 3300026142 Bacteria 2113
612 Ga0207698_10784869 3300026142 Bacteria 954
613 Ga0209588_1014818 3300027671 Bacteria 2392
614 Ga0209588_1019378 3300027671 Bacteria 2123
615 Ga0209813_10037870 3300027866 Bacteria 1455
616 Ga0209813_10050128 3300027866 Bacteria 1302
617 Ga0207428_10000004 3300027907 Bacteria 727800
618 Ga0207428_10018173 3300027907 Bacteria 6012
619 Ga0207428_10021152 3300027907 Bacteria 5510
620 Ga0207428_10037083 3300027907 Bacteria 3968
621 Ga0207428_10047174 3300027907 Bacteria 3460
622 Ga0207428_10062710 3300027907 Bacteria 2939
623 Ga0207428_10071803 3300027907 Bacteria 2718
624 Ga0207428_10073958 3300027907 Bacteria 2673
625 Ga0207428_10152288 3300027907 Bacteria 1760
626 Ga0207428_10329439 3300027907 Bacteria 1126
627 Ga0265354_1000867 3300028016 Bacteria 4848
628 Ga0268266_10006985 3300028379 Bacteria 10262
629 Ga0268266_10139169 3300028379 Bacteria 2177
630 Ga0268266_10285861 3300028379 Bacteria 1535
631 Ga0268266_10437845 3300028379 Bacteria 1241
632 Ga0268266_10684856 3300028379 Bacteria 988
633 Ga0268265_10078111 3300028380 Bacteria 2602
634 Ga0268265_10548436 3300028380 Bacteria 1097
635 Ga0268265_10652652 3300028380 Bacteria 1011
636 Ga0268264_10108239 3300028381 Bacteria 2429
637 Ga0268264_10244329 3300028381 Bacteria 1664
638 Ga0268264_10383910 3300028381 Bacteria 1346
639 Ga0268264_10425538 3300028381 Bacteria 1281
640 Ga0268264_10539066 3300028381 Bacteria 1143
641 Ga0268264_10636739 3300028381 Bacteria 1054
642 Ga0268264_11019828 3300028381 Bacteria 834
643 Ga0265770_1015124 3300030878 Bacteria 1171
644 Ga0265760_10009102 3300031090 Bacteria 2837
645 Ga0265760_10073772 3300031090 Bacteria 1049
646 Ga0307513_10592853 3300031456 Bacteria 818
647 Ga0307408_100015092 3300031548 Bacteria 5140
648 Ga0307408_100056513 3300031548 Bacteria 2846
649 Ga0307408_100069819 3300031548 Bacteria 2592
650 Ga0307408_100177761 3300031548 Bacteria 1704
651 Ga0307408_100212416 3300031548 Bacteria 1573
652 Ga0307408_100220124 3300031548 Bacteria 1548
653 Ga0307408_100258313 3300031548 Bacteria 1440
654 Ga0307405_10132438 3300031731 Bacteria 1725
655 Ga0307405_10160354 3300031731 Bacteria 1592
656 Ga0307405_10176253 3300031731 Bacteria 1530
657 Ga0307413_10035015 3300031824 Bacteria 2876
658 Ga0307413_10052063 3300031824 Bacteria 2471
659 Ga0307413_10765416 3300031824 Bacteria 808
660 Ga0307410_10014184 3300031852 Bacteria 4679
661 Ga0307410_10044243 3300031852 Bacteria 2956
662 Ga0307410_10267751 3300031852 Bacteria 1335
663 Ga0307410_10322649 3300031852 Bacteria 1226
664 Ga0307410_10715375 3300031852 Bacteria 845
665 Ga0307406_10309340 3300031901 Bacteria 1217
666 Ga0307406_10325596 3300031901 Bacteria 1191
667 Ga0307406_10717586 3300031901 Bacteria 836
668 Ga0307407_10006748 3300031903 Bacteria 5136
669 Ga0307407_10107454 3300031903 Bacteria 1745
670 Ga0307412_10106226 3300031911 Bacteria 1996
671 Ga0307412_10108579 3300031911 Bacteria 1977
672 Ga0307412_10124288 3300031911 Bacteria 1863
673 Ga0307412_10140018 3300031911 Bacteria 1770
674 Ga0307412_10199510 3300031911 Bacteria 1518
675 Ga0307409_100008285 3300031995 Bacteria 6297
676 Ga0307409_100032545 3300031995 Bacteria 3782
677 Ga0307409_100109203 3300031995 Bacteria 2316
678 Ga0307409_100148469 3300031995 Bacteria 2031
679 Ga0307409_100297217 3300031995 Bacteria 1500
680 Ga0307409_100302374 3300031995 Bacteria 1489
681 Ga0307416_100009329 3300032002 Bacteria 6416
682 Ga0307416_100016235 3300032002 Bacteria 5168
683 Ga0307416_100023389 3300032002 Bacteria 4483
684 Ga0307416_100071517 3300032002 Bacteria 2882
685 Ga0307416_100081275 3300032002 Bacteria 2739
686 Ga0307416_100196156 3300032002 Bacteria 1910
687 Ga0307416_100343099 3300032002 Bacteria 1507
688 Ga0307416_100409672 3300032002 Bacteria 1396
689 Ga0307416_100453952 3300032002 Bacteria 1335
690 Ga0307416_100642174 3300032002 Bacteria 1145
691 Ga0307416_100684915 3300032002 Bacteria 1113
692 Ga0307416_100771646 3300032002 Bacteria 1055
693 Ga0307414_10031493 3300032004 Bacteria 3480
694 Ga0307414_10224910 3300032004 Bacteria 1543
695 Ga0307414_10382949 3300032004 Bacteria 1217
696 Ga0307414_10859977 3300032004 Bacteria 830
697 Ga0307414_10863805 3300032004 Bacteria 828
698 Ga0307411_10027976 3300032005 Bacteria 3421
699 Ga0307411_10036028 3300032005 Bacteria 3096
700 Ga0307411_10037127 3300032005 Bacteria 3060
701 Ga0307411_10060259 3300032005 Bacteria 2519
702 Ga0307411_10071737 3300032005 Bacteria 2349
703 Ga0307411_10072865 3300032005 Bacteria 2334
704 Ga0307411_10085700 3300032005 Bacteria 2183
705 Ga0307411_10092303 3300032005 Bacteria 2117
706 Ga0307411_10189555 3300032005 Bacteria 1569
707 Ga0307411_10424864 3300032005 Bacteria 1105
708 Ga0307415_100017833 3300032126 Bacteria 4267
709 Ga0307415_100070727 3300032126 Bacteria 2451
710 Ga0373938_0000588 3300034957 Bacteria 5871
711 Ga0373928_0007331 3300035084 Bacteria 2126
712 Ga0373929_0000498 3300035085 Bacteria 7492
713 Ga0373929_0041471 3300035085 Bacteria 1023
714 Ga0373934_0193373 3300035086 Bacteria 837
715 Ga0373940_0001234 3300035088 Bacteria 4527
716 Ga0373949_0001772 3300035090 Bacteria 5943
717 Ga0373951_0000520 3300035091 Bacteria 10956
718 Ga0373951_0074382 3300035091 Bacteria 870
719 Ga0373923_0118330 3300035111 Bacteria 1182
720 Ga0373923_0270722 3300035111 Bacteria 799
721 Ga0373932_0000492 3300035112 Bacteria 12172
722 Ga0373939_0015291 3300035114 Bacteria 2006
723 Ga0373941_0000603 3300035115 Bacteria 7264
724 Ga0373941_0030086 3300035115 Bacteria 1607
725 Ga0373945_0019159 3300035116 Bacteria 2334
726 Ga0373954_0037597 3300035118 Bacteria 2250
727 Ga0373956_0109075 3300035119 Bacteria 1288
728 Ga0373957_0083157 3300035120 Bacteria 1266
729 Ga0373960_0000207 3300035121 Bacteria 10770
730 Ga0373943_0007836 3300035170 Bacteria 4797
731 Ga0373946_0028290 3300035171 Bacteria 2223
732 Ga0373955_0041481 3300035172 Bacteria 2467
733 Ga0373942_0001108 3300035207 Bacteria 7173
734 Ga0373961_0006147 3300035241 Bacteria 2885
735 Ga0373962_0003292 3300035242 Bacteria 3884
736 Ga0373924_0083647 3300035410 Bacteria 1360
737 Ga0373924_0107574 3300035410 Bacteria 1203
738 Ga0373931_0010417 3300035691 Bacteria 4467
739 Ga0373931_0054554 3300035691 Bacteria 2136
740 Ga0373931_0067984 3300035691 Bacteria 1938
741 Ga0373933_0325216 3300035724 Bacteria 997
742 Ga0373933_0479462 3300035724 Bacteria 814
743 Ga0373947_0056371 3300035725 Bacteria 2375
744 Ga0373937_0037988 3300036401 Bacteria 4389
745 Ga0373937_0121007 3300036401 Bacteria 2439
746 Ga0373937_0230640 3300036401 Bacteria 1744
747 Ga0373937_0298647 3300036401 Bacteria 1522
748 Ga0373937_0795541 3300036401 Unclassified 893
749 Ga0373925_0049612 3300037068 Bacteria 3129
750 Ga0373925_0146349 3300037068 Bacteria 1852
751 Ga0373925_0296252 3300037068 Bacteria 1305
752 Ga0436365_1133449 3300039437 Bacteria 1965
753 Ga0439436_0027609 3300041404 Bacteria 1660
754 Ga0439431_0033613 3300041997 Bacteria 1283
755 Ga0439433_0056506 3300041999 Bacteria 931
756 Ga0439449_0073224 3300042007 Bacteria 1262
757 Ga0439450_011567 3300042008 Bacteria 1732
758 Ga0439451_029653 3300042009 Bacteria 1101
759 Ga0439456_057636 3300042013 Bacteria 852
760 Ga0450923_003629 3300042125 Bacteria 2353
761 Ga0450896_002037 3300042133 Bacteria 2571
762 Ga0439446_0032896 3300042156 Bacteria 1506
763 Ga0439446_0041694 3300042156 Bacteria 1354
764 Ga0439464_0031586 3300042439 Bacteria 1486
765 Ga0439464_0102316 3300042439 Bacteria 871
766 Ga0450893_0011972 3300042532 Bacteria 1437
767 Ga0451577_0328861 3300042876 Bacteria 1386
768 Ga0451577_0674870 3300042876 Bacteria 937
769 Ga0453683_0381884 3300044673 Bacteria 907
770 Ga0453684_0024329 3300044712 Bacteria 8857
771 Ga0451576_0009891 3300045051 Bacteria 11016
772 Ga0451576_0275906 3300045051 Bacteria 1758
773 Ga0451576_0586042 3300045051 Bacteria 1172
774 Ga0451576_0808552 3300045051 Bacteria 984
775 Ga0495592_0028300 3300046454 Bacteria 4245
776 Ga0495603_0016917 3300046455 Bacteria 4413
777 Ga0495638_0015590 3300046460 Bacteria 5102
778 Ga0495638_0170701 3300046460 Bacteria 1248
779 Ga0495580_0015407 3300046472 Bacteria 5766
780 Ga0495580_0191064 3300046472 Bacteria 1412
781 Ga0495580_0249190 3300046472 Bacteria 1216
782 Ga0495582_0147266 3300046473 Bacteria 1336
783 Ga0495608_0017777 3300046511 Bacteria 4916
784 Ga0495608_0113728 3300046511 Bacteria 1739
785 Ga0495618_0221069 3300046514 Bacteria 1195
786 Ga0495628_0055499 3300046516 Bacteria 3121
787 Ga0495630_0021767 3300046517 Bacteria 4735
788 Ga0495643_0073682 3300046522 Bacteria 1789
789 Ga0495642_0096846 3300046528 Bacteria 1253
790 Ga0495652_0142327 3300046529 Bacteria 1885
791 Ga0495586_0189637 3300046535 Bacteria 1164
792 Ga0495587_0082171 3300046536 Bacteria 1867
793 Ga0495587_0182521 3300046536 Bacteria 1189
794 Ga0495621_0096887 3300046539 Bacteria 1118
795 Ga0495645_0009873 3300046543 Bacteria 6681
796 Ga0495633_0012872 3300046558 Bacteria 4429
797 Ga0495656_0180639 3300046615 Bacteria 1037
798 Ga0495656_0244875 3300046615 Bacteria 904
799 Ga0495634_0053535 3300046642 Bacteria 2703
800 Ga0495635_0403272 3300046663 Bacteria 908
801 Ga0495659_0007506 3300046664 Bacteria 3460
802 Ga0495588_0080299 3300046674 Bacteria 1702
803 Ga0495657_0280200 3300046675 Bacteria 998
804 Ga0495599_0043040 3300046678 Bacteria 2834
805 Ga0495658_0147865 3300046683 Bacteria 1441
806 Ga0495669_0030390 3300046684 Bacteria 2372
807 Ga0495669_0111431 3300046684 Bacteria 1278
808 Ga0495613_0014914 3300046689 Bacteria 5767
809 Ga0495613_0083081 3300046689 Bacteria 2326
810 Ga0495670_0115442 3300046691 Bacteria 1392
811 Ga0495589_0248876 3300046794 Bacteria 831
812 Ga0495604_0182373 3300047317 Bacteria 1467
813 Ga0495604_0452314 3300047317 Bacteria 839
814 Ga0495636_0214872 3300047318 Bacteria 881
815 Ga0495674_0118370 3300047319 Bacteria 2240
816 Ga0495674_0288352 3300047319 Bacteria 1343
817 Ga0495674_0622938 3300047319 Bacteria 853
818 Ga0495672_0033778 3300047320 Bacteria 3167
819 Ga0495675_0123218 3300047444 Bacteria 1614
820 Ga0495684_0008118 3300047471 Bacteria 8118
821 Ga0495602_0061934 3300048088 Bacteria 3249
822 Ga0495602_0293386 3300048088 Bacteria 1193
823 Ga0495602_0415876 3300048088 Bacteria 956
824 Ga0496100_0182592 3300048903 Bacteria 1518
825 Ga0496100_0464573 3300048903 Bacteria 972
826 Ga0496101_0212867 3300048904 Bacteria 1498
827 Ga0496101_0251514 3300048904 Bacteria 1377
828 Ga0496101_0260201 3300048904 Bacteria 1353
829 Ga0496102_0069466 3300048905 Bacteria 3233
830 Ga0496102_0082744 3300048905 Bacteria 2961
831 Ga0496102_0243158 3300048905 Bacteria 1697
832 Ga0496102_0646366 3300048905 Bacteria 981
833 Ga0496102_0756689 3300048905 Bacteria 894
834 Ga0496103_0363353 3300048906 Bacteria 931
835 Ga0496104_0004897 3300048907 Bacteria 11678
836 Ga0496104_0095500 3300048907 Bacteria 2844
837 Ga0496104_0372470 3300048907 Bacteria 1341
838 Ga0496106_0025726 3300048909 Bacteria 4381
839 Ga0496106_0077272 3300048909 Bacteria 2553
840 Ga0496107_0296569 3300048910 Bacteria 1203
841 Ga0496108_0000658 3300048911 Bacteria 26635
842 Ga0496108_0099597 3300048911 Bacteria 2478
843 Ga0496109_0011768 3300048912 Bacteria 7529
844 Ga0496109_0121316 3300048912 Bacteria 2436
845 Ga0496109_0132789 3300048912 Bacteria 2325
846 Ga0496109_0139996 3300048912 Bacteria 2262
847 Ga0496109_0234069 3300048912 Bacteria 1729
848 Ga0496109_0409612 3300048912 Bacteria 1281
849 Ga0496109_0629953 3300048912 Bacteria 1009
850 Ga0496110_0033880 3300048913 Bacteria 4420
851 Ga0496110_0046805 3300048913 Bacteria 3785
852 Ga0496110_0274681 3300048913 Bacteria 1534
853 Ga0496110_0511469 3300048913 Bacteria 1093
854 Ga0496112_0009883 3300048915 Bacteria 8625
855 Ga0496112_0073890 3300048915 Bacteria 3370
856 Ga0496112_0074263 3300048915 Bacteria 3362
857 Ga0496112_0202732 3300048915 Bacteria 1942
858 Ga0496112_0320491 3300048915 Bacteria 1494
859 Ga0496112_0385448 3300048915 Bacteria 1342
860 Ga0496113_0213031 3300048916 Bacteria 1538
861 Ga0496114_0160689 3300048917 Bacteria 1953
862 Ga0496114_0690835 3300048917 Bacteria 895
863 Ga0496115_0060668 3300048918 Bacteria 3048
864 Ga0501297_009693 3300049520 Bacteria 1081
865 Ga0501324_009773 3300049540 Bacteria 865
866 Ga0501031_0147439 3300049568 Bacteria 1537
867 Ga0501032_0074211 3300049569 Bacteria 2266
868 Ga0501032_0113711 3300049569 Bacteria 1790
869 Ga0501032_0126259 3300049569 Bacteria 1690
870 Ga0501033_0018683 3300049570 Bacteria 5239
871 Ga0501033_0074743 3300049570 Bacteria 2487
872 Ga0501034_0037393 3300049571 Bacteria 4914
873 Ga0501034_0071835 3300049571 Bacteria 3469
874 Ga0501034_0072478 3300049571 Bacteria 3453
875 Ga0501034_0140910 3300049571 Bacteria 2391
876 Ga0501034_0250752 3300049571 Bacteria 1714
877 Ga0501034_0259060 3300049571 Bacteria 1682
878 Ga0501036_0032096 3300049572 Bacteria 4437
879 Ga0501036_0089317 3300049572 Bacteria 2604
880 Ga0501036_0142435 3300049572 Bacteria 2022
881 Ga0501036_0201968 3300049572 Bacteria 1672
882 Ga0501036_0353765 3300049572 Bacteria 1226
883 Ga0501037_0074291 3300049573 Bacteria 2470
884 Ga0501037_0117625 3300049573 Bacteria 1912
885 Ga0501038_0190899 3300049574 Bacteria 1648
886 Ga0501038_0224718 3300049574 Bacteria 1496
887 Ga0501038_0387895 3300049574 Bacteria 1082
888 Ga0501038_0614018 3300049574 Bacteria 822
889 Ga0501039_0035361 3300049575 Bacteria 3855
890 Ga0501039_0128245 3300049575 Bacteria 1990
891 Ga0501039_0449037 3300049575 Bacteria 1012
892 Ga0501040_0013689 3300049576 Bacteria 5335
893 Ga0501040_0133727 3300049576 Bacteria 1745
894 Ga0501041_0030844 3300049577 Bacteria 3236
895 Ga0501041_0055825 3300049577 Bacteria 2412
896 Ga0501042_0054369 3300049578 Bacteria 2855
897 Ga0501042_0173385 3300049578 Bacteria 1556
898 Ga0501042_0275046 3300049578 Bacteria 1216
899 Ga0501043_0027314 3300049579 Bacteria 4481
900 Ga0501043_0208316 3300049579 Bacteria 1515
901 Ga0501043_0367696 3300049579 Bacteria 1090
902 Ga0501046_0002275 3300049580 Bacteria 18106
903 Ga0501046_0018619 3300049580 Bacteria 5772
904 Ga0501046_0058667 3300049580 Bacteria 3016
905 Ga0501046_0078328 3300049580 Bacteria 2556
906 Ga0501046_0202015 3300049580 Bacteria 1479
907 Ga0501046_0424535 3300049580 Bacteria 958
908 Ga0501047_0025147 3300049581 Bacteria 5720
909 Ga0501047_0052430 3300049581 Bacteria 3943
910 Ga0501047_0064532 3300049581 Bacteria 3532
911 Ga0501047_0086071 3300049581 Bacteria 3020
912 Ga0501048_0026794 3300049582 Bacteria 4195
913 Ga0501048_0033526 3300049582 Bacteria 3709
914 Ga0501048_0140230 3300049582 Bacteria 1709
915 Ga0501048_0217979 3300049582 Bacteria 1353
916 Ga0501067_0006917 3300049583 Bacteria 6294
917 Ga0501067_0068438 3300049583 Bacteria 1965
918 Ga0501067_0115584 3300049583 Bacteria 1492
919 Ga0501067_0155966 3300049583 Bacteria 1272
920 Ga0501067_0167051 3300049583 Bacteria 1225
921 Ga0501068_0069240 3300049584 Bacteria 2151
922 Ga0501068_0072213 3300049584 Bacteria 2107
923 Ga0501068_0180750 3300049584 Bacteria 1333
924 Ga0501069_0005228 3300049585 Bacteria 6745
925 Ga0501069_0045955 3300049585 Bacteria 2420
926 Ga0501069_0301657 3300049585 Bacteria 939
927 Ga0501070_0013474 3300049586 Bacteria 6893
928 Ga0501070_0100061 3300049586 Bacteria 2398
929 Ga0501070_0556823 3300049586 Bacteria 917
930 Ga0501071_0018416 3300049587 Bacteria 4834
931 Ga0501071_0027667 3300049587 Bacteria 3991
932 Ga0501071_0068927 3300049587 Bacteria 2575
933 Ga0501071_0210170 3300049587 Bacteria 1463
934 Ga0501071_0558170 3300049587 Bacteria 880
935 Ga0501072_0122132 3300049588 Bacteria 2075
936 Ga0501072_0242205 3300049588 Bacteria 1436
937 Ga0501072_0683916 3300049588 Bacteria 807
938 Ga0501073_0027272 3300049589 Bacteria 4086
939 Ga0501073_0301994 3300049589 Bacteria 1104
940 Ga0501073_0516279 3300049589 Bacteria 826
941 Ga0501074_0022318 3300049590 Bacteria 4598
942 Ga0501074_0046591 3300049590 Bacteria 3134
943 Ga0501074_0074785 3300049590 Bacteria 2432
944 Ga0501075_0001529 3300049591 Bacteria 15085
945 Ga0501075_0086770 3300049591 Bacteria 2371
946 Ga0501075_0145847 3300049591 Bacteria 1804
947 Ga0501075_0316002 3300049591 Bacteria 1190
948 Ga0501075_0375192 3300049591 Bacteria 1084
949 Ga0501076_0002067 3300049592 Bacteria 13745
950 Ga0501076_0034815 3300049592 Bacteria 3939
951 Ga0501076_0046065 3300049592 Bacteria 3445
952 Ga0501076_0058187 3300049592 Bacteria 3071
953 Ga0501076_0075602 3300049592 Bacteria 2700
954 Ga0501077_0135947 3300049593 Bacteria 1559
955 Ga0501077_0213136 3300049593 Bacteria 1227
956 Ga0501077_0218782 3300049593 Bacteria 1210
957 Ga0501079_0001902 3300049741 Bacteria 14973
958 Ga0501079_0017412 3300049741 Bacteria 5488
959 Ga0501079_0049715 3300049741 Bacteria 3236
960 Ga0501079_0252649 3300049741 Bacteria 1378
961 Ga0501080_0197934 3300049742 Bacteria 1845
962 Ga0501080_0214485 3300049742 Bacteria 1763
963 Ga0501080_0237012 3300049742 Bacteria 1666
964 Ga0501080_0260097 3300049742 Bacteria 1581
965 Ga0501080_0657211 3300049742 Bacteria 927
966 Ga0501081_0061259 3300049743 Bacteria 2609
967 Ga0501081_0109942 3300049743 Bacteria 1956
968 Ga0501081_0112059 3300049743 Bacteria 1937
969 Ga0501081_0190602 3300049743 Bacteria 1485
970 Ga0501083_0022768 3300049744 Bacteria 4347
971 Ga0501083_0041524 3300049744 Bacteria 3119
972 Ga0501083_0164071 3300049744 Bacteria 1452
973 Ga0501083_0254237 3300049744 Bacteria 1143
974 Ga0501035_0042303 3300049822 Bacteria 4109
975 Ga0501035_0223589 3300049822 Bacteria 1606
976 Ga0501035_0243448 3300049822 Bacteria 1529
977 Ga0501035_0411067 3300049822 Bacteria 1124
978 Ga0501044_0021080 3300049823 Bacteria 6957
979 Ga0501044_0029768 3300049823 Bacteria 5756
980 Ga0501044_0142201 3300049823 Bacteria 2387
981 Ga0501044_0205449 3300049823 Bacteria 1926
982 Ga0501044_0354059 3300049823 Bacteria 1387
983 Ga0501044_0461503 3300049823 Bacteria 1175
984 Ga0501045_0008126 3300049824 Bacteria 7308
985 Ga0501045_0042915 3300049824 Bacteria 3292
986 Ga0501045_0086150 3300049824 Bacteria 2319
987 Ga0501045_0372966 3300049824 Bacteria 1062
988 Ga0501045_0410113 3300049824 Bacteria 1008
989 nmdc:mga03n38_282840_c1 3300050490 Bacteria 886
990 nmdc:mga00v17_64576_c1 3300050491 Bacteria 2256
991 nmdc:mga00v17_98918_c1 3300050491 Bacteria 1840
992 nmdc:mga0k408_110761_c1 3300050493 Bacteria 1623
993 nmdc:mga0k408_126883_c1 3300050493 Bacteria 1514
994 nmdc:mga0k408_14708_c1 3300050493 Bacteria 4318
995 nmdc:mga0k408_99516_c1 3300050493 Bacteria 1714
996 nmdc:mga06z11_118965_c1 3300050494 Bacteria 1472
997 nmdc:mga06z11_161560_c1 3300050494 Bacteria 1281
998 nmdc:mga06z11_31694_c1 3300050494 Bacteria 2571
999 nmdc:mga06z11_77643_c1 3300050494 Bacteria 1774
1000 nmdc:mga06z11_94303_c1 3300050494 Bacteria 1631
1001 nmdc:mga04h51_20005_c1 3300050495 Bacteria 1992
1002 nmdc:mga04h51_45238_c1 3300050495 Bacteria 1455
1003 nmdc:mga07m45_82966_c1 3300050496 Bacteria 1831
1004 nmdc:mga05p37_120124_c1 3300050507 Bacteria 3228
1005 nmdc:mga05p37_146498_c1 3300050507 Bacteria 2891
1006 nmdc:mga05p37_167051_c1 3300050507 Bacteria 2685
1007 nmdc:mga05p37_19272_c1 3300050507 Bacteria 8252
1008 nmdc:mga05p37_1991_c1 3300050507 Bacteria 23842
1009 nmdc:mga05p37_24767_c1 3300050507 Bacteria 7295
1010 nmdc:mga05p37_295663_c1 3300050507 Bacteria 1926
1011 nmdc:mga05p37_43028_c1 3300050507 Bacteria 5553
1012 nmdc:mga05p37_433650_c1 3300050507 Bacteria 1526
1013 nmdc:mga05p37_44395_c1 3300050507 Bacteria 5468
1014 nmdc:mga05p37_52287_c1 3300050507 Bacteria 5024
1015 nmdc:mga05p37_59927_c1 3300050507 Bacteria 4687
1016 nmdc:mga05p37_64450_c1 3300050507 Bacteria 4509
1017 nmdc:mga05p37_69189_c1 3300050507 Bacteria 4342
1018 nmdc:mga05p37_833607_c1 3300050507 Bacteria 1004
1019 nmdc:mga09592_125191_c1 3300050508 Bacteria 2209
1020 nmdc:mga09592_130065_c1 3300050508 Bacteria 2166
1021 nmdc:mga09592_34324_c1 3300050508 Bacteria 4240
1022 nmdc:mga09592_43035_c1 3300050508 Bacteria 3800
1023 nmdc:mga0qj67_151112_c1 3300050509 Bacteria 1884
1024 nmdc:mga0qj67_29761_c1 3300050509 Bacteria 4243
1025 nmdc:mga0qj67_33544_c1 3300050509 Bacteria 4006
1026 nmdc:mga0qj67_437915_c1 3300050509 Bacteria 1053
1027 nmdc:mga06r32_131021_c1 3300050510 Bacteria 2480
1028 nmdc:mga06r32_249618_c1 3300050510 Bacteria 1762
1029 nmdc:mga06r32_29409_c1 3300050510 Bacteria 5149
1030 nmdc:mga06r32_356837_c1 3300050510 Bacteria 1446
1031 nmdc:mga06r32_373571_c1 3300050510 Bacteria 1409
1032 nmdc:mga06r32_44234_c1 3300050510 Bacteria 4239
1033 nmdc:mga06r32_48449_c1 3300050510 Bacteria 4061
1034 nmdc:mga06r32_59131_c1 3300050510 Bacteria 3685
1035 nmdc:mga06r32_661759_c1 3300050510 Bacteria 1012
1036 nmdc:mga06r32_9782_c1 3300050510 Bacteria 8657
1037 nmdc:mga08y16_127224_c1 3300050511 Bacteria 2650
1038 nmdc:mga08y16_196207_c1 3300050511 Bacteria 2092
1039 nmdc:mga08y16_29105_c1 3300050511 Bacteria 5822
1040 nmdc:mga08y16_2_c1 3300050511 Bacteria 983367
1041 nmdc:mga08y16_31371_c1 3300050511 Bacteria 5166
1042 nmdc:mga08y16_372185_c1 3300050511 Bacteria 1465
1043 nmdc:mga08y16_43775_c1 3300050511 Bacteria 4692
1044 nmdc:mga08y16_610186_c1 3300050511 Bacteria 1099
1045 nmdc:mga08y16_612888_c1 3300050511 Bacteria 1096
1046 nmdc:mga08y16_68367_c1 3300050511 Bacteria 3704
1047 nmdc:mga08y16_76758_c1 3300050511 Bacteria 3483
1048 nmdc:mga08y16_8354_c1 3300050511 Bacteria 10833
1049 nmdc:mga08y16_87298_c1 3300050511 Bacteria 3250
1050 nmdc:mga0n895_11464_c1 3300050512 Bacteria 7910
1051 nmdc:mga0n895_11831_c1 3300050512 Bacteria 7804
1052 nmdc:mga0n895_137187_c1 3300050512 Bacteria 2473
1053 nmdc:mga0n895_21827_c1 3300050512 Bacteria 5994
1054 nmdc:mga0n895_227_c1 3300050512 Bacteria 35542
1055 nmdc:mga0n895_288504_c1 3300050512 Bacteria 1664
1056 nmdc:mga0n895_35341_c1 3300050512 Bacteria 4817
1057 nmdc:mga0n895_4474_c1 3300050512 Bacteria 11485
1058 nmdc:mga0n895_8678_c1 3300050512 Bacteria 8826
1059 nmdc:mga0rr50_12816_c1 3300050513 Bacteria 5433
1060 nmdc:mga0rr50_161712_c1 3300050513 Bacteria 1818
1061 nmdc:mga0rr50_175_c1 3300050513 Bacteria 34417
1062 nmdc:mga0rr50_328378_c1 3300050513 Bacteria 1284
1063 nmdc:mga0rr50_36190_c1 3300050513 Bacteria 3553
1064 nmdc:mga0rr50_4207_c1 3300050513 Bacteria 8415
1065 nmdc:mga0rr50_6399_c1 3300050513 Bacteria 7165
1066 nmdc:mga0rr50_750348_c1 3300050513 Bacteria 833
1067 nmdc:mga0rr50_9834_c1 3300050513 Bacteria 6041
1068 nmdc:mga08x19_1177_c1 3300050514 Bacteria 16391
1069 nmdc:mga08x19_78190_c1 3300050514 Bacteria 2168
1070 nmdc:mga08x19_83427_c1 3300050514 Bacteria 2101
1071 nmdc:mga08x19_97097_c1 3300050514 Bacteria 1951
1072 nmdc:mga0a205_206193_c1 3300050515 Bacteria 1855
1073 nmdc:mga0a205_26771_c1 3300050515 Bacteria 5503
1074 nmdc:mga0a205_279122_c1 3300050515 Bacteria 1546
1075 Ga0495601_0142718 3300053077 Bacteria 1562
1076 Ga0495601_0580165 3300053077 Bacteria 720
1077 Ga0495595_0060382 3300053084 Bacteria 1774
1078 Ga0495595_0089139 3300053084 Bacteria 1478
1079 Ga0495619_0023881 3300053085 Bacteria 3920
1080 Ga0495619_0169987 3300053085 Bacteria 1507
1081 Ga0500592_009690 3300053116 Bacteria 1532
1082 Ga0500628_093471 3300053129 Bacteria 787
1083 Ga0500568_0008697 3300053139 Bacteria 4871
1084 Ga0500645_002436 3300053730 Bacteria 8287
1085 Ga0501084_0013715 3300054114 Bacteria 6708
1086 Ga0501084_0028474 3300054114 Bacteria 4670
1087 Ga0501084_0076124 3300054114 Bacteria 2812
1088 Ga0501084_0199112 3300054114 Bacteria 1690
1089 Ga0501084_0452287 3300054114 Bacteria 1086
1090 Ga0501084_0650630 3300054114 Bacteria 890
1091 Ga0590071_000639 3300059421 Bacteria 9941
1092 Ga0590071_000996 3300059421 Bacteria 7735
1093 Ga0590071_038043 3300059421 Bacteria 1155
1094 Ga0590074_000990 3300059423 Bacteria 4468
1095 Ga0590074_004534 3300059423 Bacteria 2300
1096 Ga0590075_000405 3300059424 Bacteria 11801
1097 Ga0590075_012446 3300059424 Bacteria 2067
1098 Ga0590077_000732 3300059426 Bacteria 8606
1099 Ga0590077_006869 3300059426 Bacteria 2331
1100 Ga0587088_030624 3300059508 Bacteria 959
1101 Ga0501082_0001088 3300060353 Bacteria 24065
1102 Ga0501082_0025450 3300060353 Bacteria 5099
1103 Ga0501082_0299014 3300060353 Bacteria 1401
1104 Ga0501082_0325312 3300060353 Bacteria 1339
1105 Ga0501082_0455563 3300060353 Bacteria 1118
1106 Ga0501082_0640026 3300060353 Bacteria 930
1107 Ga0530510_0024932 3300061734 Bacteria 4274
1108 Ga0530510_0727720 3300061734 Bacteria 756

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028379 Ga0268266_10684856 Ga0268266_106848561 214
2 3300049822 Ga0501035_0411067 Ga0501035_0411067_320_973 214
3 3300035111 Ga0373923_0270722 Ga0373923_0270722_121_783 216
4 3300053077 Ga0495601_0580165 Ga0495601_0580165_29_691 216
5 3300009148 Ga0105243_10723962 Ga0105243_107239621 217
6 3300049589 Ga0501073_0516279 Ga0501073_0516279_146_808 217
7 3300053129 Ga0500628_093471 Ga0500628_093471_13_675 217
8 3300005617 Ga0068859_100097924 Ga0068859_1000979244 223
9 3300006931 Ga0097620_100097925 Ga0097620_1000979254 223
10 3300009094 Ga0111539_10518014 Ga0111539_105180142 223
11 3300047317 Ga0495604_0452314 Ga0495604_0452314_60_764 223
12 3300050511 nmdc:mga08y16_76758_c1 nmdc:mga08y16_76758_c1_2632_3336 223
13 3300026095 Ga0207676_11178537 Ga0207676_111785371 226
14 3300005295 Ga0065707_10105294 Ga0065707_101052943 227
15 3300005295 Ga0065707_10251684 Ga0065707_102516842 227
16 3300005331 Ga0070670_100344019 Ga0070670_1003440191 227
17 3300005340 Ga0070689_100461992 Ga0070689_1004619921 227
18 3300005353 Ga0070669_100781276 Ga0070669_1007812761 227
19 3300005354 Ga0070675_100337921 Ga0070675_1003379211 227
20 3300005356 Ga0070674_100095868 Ga0070674_1000958682 227
21 3300005356 Ga0070674_100332866 Ga0070674_1003328661 227
22 3300005364 Ga0070673_100472307 Ga0070673_1004723071 227
23 3300005440 Ga0070705_100087692 Ga0070705_1000876922 227
24 3300005444 Ga0070694_100029135 Ga0070694_1000291352 227
25 3300005467 Ga0070706_100039283 Ga0070706_1000392834 227
26 3300005543 Ga0070672_100547294 Ga0070672_1005472941 227
27 3300005577 Ga0068857_100702700 Ga0068857_1007027002 227
28 3300005617 Ga0068859_100051119 Ga0068859_1000511194 227
29 3300005618 Ga0068864_100340238 Ga0068864_1003402381 227
30 3300005719 Ga0068861_100075215 Ga0068861_1000752153 227
31 3300005843 Ga0068860_100528742 Ga0068860_1005287421 227
32 3300005844 Ga0068862_100037942 Ga0068862_1000379424 227
33 3300005844 Ga0068862_100119836 Ga0068862_1001198363 227
34 3300006844 Ga0075428_100000017 Ga0075428_1000000174 227
35 3300006931 Ga0097620_100051121 Ga0097620_1000511214 227
36 3300009094 Ga0111539_10000002 Ga0111539_10000002434 227
37 3300025910 Ga0207684_10050513 Ga0207684_100505134 227
38 3300025923 Ga0207681_10171250 Ga0207681_101712502 227
39 3300025925 Ga0207650_10264885 Ga0207650_102648852 227
40 3300025926 Ga0207659_10531041 Ga0207659_105310411 227
41 3300025931 Ga0207644_10135879 Ga0207644_101358792 227
42 3300025937 Ga0207669_10128917 Ga0207669_101289172 227
43 3300025937 Ga0207669_10316644 Ga0207669_103166442 227
44 3300025940 Ga0207691_10261739 Ga0207691_102617392 227
45 3300025940 Ga0207691_10385659 Ga0207691_103856591 227
46 3300025960 Ga0207651_10360489 Ga0207651_103604891 227
47 3300026116 Ga0207674_10511690 Ga0207674_105116901 227
48 3300026118 Ga0207675_100042150 Ga0207675_1000421504 227
49 3300026118 Ga0207675_100136795 Ga0207675_1001367953 227
50 3300027907 Ga0207428_10000004 Ga0207428_10000004222 227
51 3300028381 Ga0268264_11019828 Ga0268264_110198281 227
52 3300031824 Ga0307413_10052063 Ga0307413_100520632 227
53 3300032005 Ga0307411_10071737 Ga0307411_100717373 227
54 3300042009 Ga0439451_029653 Ga0439451_029653_60_755 227
55 3300042013 Ga0439456_057636 Ga0439456_057636_22_717 227
56 3300049569 Ga0501032_0126259 Ga0501032_0126259_58_753 227
57 3300049572 Ga0501036_0032096 Ga0501036_0032096_3082_3777 227
58 3300049574 Ga0501038_0614018 Ga0501038_0614018_28_723 227
59 3300049575 Ga0501039_0035361 Ga0501039_0035361_3104_3799 227
60 3300049576 Ga0501040_0013689 Ga0501040_0013689_28_723 227
61 3300049577 Ga0501041_0030844 Ga0501041_0030844_1945_2640 227
62 3300049580 Ga0501046_0002275 Ga0501046_0002275_651_1346 227
63 3300049587 Ga0501071_0018416 Ga0501071_0018416_2569_3264 227
64 3300049591 Ga0501075_0001529 Ga0501075_0001529_1879_2574 227
65 3300049592 Ga0501076_0002067 Ga0501076_0002067_1926_2621 227
66 3300049741 Ga0501079_0001902 Ga0501079_0001902_13894_14589 227
67 3300049742 Ga0501080_0197934 Ga0501080_0197934_118_813 227
68 3300049743 Ga0501081_0061259 Ga0501081_0061259_143_838 227
69 3300049824 Ga0501045_0008126 Ga0501045_0008126_5536_6231 227
70 3300050509 nmdc:mga0qj67_151112_c1 nmdc:mga0qj67_151112_c1_183_878 227
71 3300050511 nmdc:mga08y16_2_c1 nmdc:mga08y16_2_c1_481703_482398 227
72 3300054114 Ga0501084_0013715 Ga0501084_0013715_2766_3461 227
73 3300060353 Ga0501082_0001088 Ga0501082_0001088_15695_16390 227
74 3300061734 Ga0530510_0024932 Ga0530510_0024932_1265_1960 227
75 3300003575 Ga0007409J51694_1063287 Ga0007409J51694_10632873 228
76 3300005331 Ga0070670_100106489 Ga0070670_1001064892 228
77 3300005334 Ga0068869_100350246 Ga0068869_1003502462 228
78 3300005338 Ga0068868_100078911 Ga0068868_1000789117 228
79 3300005353 Ga0070669_100573711 Ga0070669_1005737111 228
80 3300005354 Ga0070675_100069790 Ga0070675_1000697902 228
81 3300005355 Ga0070671_100142650 Ga0070671_1001426502 228
82 3300005356 Ga0070674_100420077 Ga0070674_1004200771 228
83 3300005364 Ga0070673_100031948 Ga0070673_1000319485 228
84 3300005406 Ga0070703_10009170 Ga0070703_100091704 228
85 3300005434 Ga0070709_10090197 Ga0070709_100901972 228
86 3300005434 Ga0070709_10209858 Ga0070709_102098582 228
87 3300005440 Ga0070705_100008577 Ga0070705_1000085774 228
88 3300005440 Ga0070705_100441458 Ga0070705_1004414581 228
89 3300005445 Ga0070708_100018355 Ga0070708_1000183557 228
90 3300005445 Ga0070708_100117345 Ga0070708_1001173453 228
91 3300005456 Ga0070678_100073380 Ga0070678_1000733804 228
92 3300005457 Ga0070662_100360579 Ga0070662_1003605791 228
93 3300005458 Ga0070681_10096625 Ga0070681_100966253 228
94 3300005467 Ga0070706_100446197 Ga0070706_1004461971 228
95 3300005518 Ga0070699_100099854 Ga0070699_1000998541 228
96 3300005518 Ga0070699_100476066 Ga0070699_1004760661 228
97 3300005536 Ga0070697_100006688 Ga0070697_1000066885 228
98 3300005536 Ga0070697_100384124 Ga0070697_1003841242 228
99 3300005543 Ga0070672_100069103 Ga0070672_1000691035 228
100 3300005545 Ga0070695_100006978 Ga0070695_1000069787 228
101 3300005545 Ga0070695_100389579 Ga0070695_1003895791 228
102 3300005546 Ga0070696_100030063 Ga0070696_1000300634 228
103 3300005546 Ga0070696_100064740 Ga0070696_1000647404 228
104 3300005547 Ga0070693_100000610 Ga0070693_1000006107 228
105 3300005548 Ga0070665_100026504 Ga0070665_10002650412 228
106 3300005548 Ga0070665_100442732 Ga0070665_1004427321 228
107 3300005549 Ga0070704_100002012 Ga0070704_10000201217 228
108 3300005549 Ga0070704_100036297 Ga0070704_1000362975 228
109 3300005564 Ga0070664_100369425 Ga0070664_1003694252 228
110 3300005618 Ga0068864_100041795 Ga0068864_1000417955 228
111 3300005719 Ga0068861_100276293 Ga0068861_1002762932 228
112 3300005840 Ga0068870_10018787 Ga0068870_100187872 228
113 3300005843 Ga0068860_100031462 Ga0068860_1000314625 228
114 3300005843 Ga0068860_100168973 Ga0068860_1001689731 228
115 3300006048 Ga0075363_100035548 Ga0075363_1000355482 228
116 3300006051 Ga0075364_10473049 Ga0075364_104730491 228
117 3300006177 Ga0075362_10100835 Ga0075362_101008352 228
118 3300006178 Ga0075367_10238896 Ga0075367_102388962 228
119 3300006195 Ga0075366_10010873 Ga0075366_1001087311 228
120 3300006195 Ga0075366_10282549 Ga0075366_102825492 228
121 3300006195 Ga0075366_10291189 Ga0075366_102911892 228
122 3300006353 Ga0075370_10329409 Ga0075370_103294091 228
123 3300006881 Ga0068865_100254832 Ga0068865_1002548321 228
124 3300007265 Ga0099794_10020540 Ga0099794_100205403 228
125 3300007265 Ga0099794_10056389 Ga0099794_100563892 228
126 3300007788 Ga0099795_10062127 Ga0099795_100621272 228
127 3300009098 Ga0105245_10475638 Ga0105245_104756382 228
128 3300009177 Ga0105248_10091410 Ga0105248_100914107 228
129 3300009177 Ga0105248_10115515 Ga0105248_101155154 228
130 3300013297 Ga0157378_10000704 Ga0157378_1000070422 228
131 3300013306 Ga0163162_10012245 Ga0163162_100122455 228
132 3300014969 Ga0157376_10432527 Ga0157376_104325272 228
133 3300025885 Ga0207653_10003613 Ga0207653_100036134 228
134 3300025893 Ga0207682_10231348 Ga0207682_102313481 228
135 3300025900 Ga0207710_10073604 Ga0207710_100736042 228
136 3300025906 Ga0207699_10069863 Ga0207699_100698633 228
137 3300025908 Ga0207643_10039470 Ga0207643_100394704 228
138 3300025910 Ga0207684_10012006 Ga0207684_100120062 228
139 3300025912 Ga0207707_10098331 Ga0207707_100983313 228
140 3300025925 Ga0207650_10211568 Ga0207650_102115682 228
141 3300025926 Ga0207659_10022090 Ga0207659_1002209010 228
142 3300025927 Ga0207687_10408057 Ga0207687_104080572 228
143 3300025929 Ga0207664_10296002 Ga0207664_102960021 228
144 3300025933 Ga0207706_10077839 Ga0207706_100778395 228
145 3300025937 Ga0207669_10503623 Ga0207669_105036232 228
146 3300025940 Ga0207691_10075386 Ga0207691_100753864 228
147 3300025941 Ga0207711_10060938 Ga0207711_100609383 228
148 3300025941 Ga0207711_10276586 Ga0207711_102765861 228
149 3300025960 Ga0207651_10558974 Ga0207651_105589742 228
150 3300025986 Ga0207658_10057390 Ga0207658_100573904 228
151 3300026023 Ga0207677_10130122 Ga0207677_101301222 228
152 3300026067 Ga0207678_10122540 Ga0207678_101225402 228
153 3300026075 Ga0207708_10091673 Ga0207708_100916733 228
154 3300026075 Ga0207708_10445131 Ga0207708_104451312 228
155 3300026118 Ga0207675_100158686 Ga0207675_1001586862 228
156 3300026118 Ga0207675_100325465 Ga0207675_1003254652 228
157 3300026121 Ga0207683_10186750 Ga0207683_101867503 228
158 3300027671 Ga0209588_1014818 Ga0209588_10148181 228
159 3300027671 Ga0209588_1019378 Ga0209588_10193784 228
160 3300027866 Ga0209813_10037870 Ga0209813_100378702 228
161 3300027866 Ga0209813_10050128 Ga0209813_100501282 228
162 3300028016 Ga0265354_1000867 Ga0265354_10008674 228
163 3300028379 Ga0268266_10139169 Ga0268266_101391693 228
164 3300028379 Ga0268266_10285861 Ga0268266_102858612 228
165 3300028379 Ga0268266_10437845 Ga0268266_104378451 228
166 3300028381 Ga0268264_10108239 Ga0268264_101082392 228
167 3300030878 Ga0265770_1015124 Ga0265770_10151242 228
168 3300031090 Ga0265760_10009102 Ga0265760_100091024 228
169 3300031090 Ga0265760_10073772 Ga0265760_100737722 228
170 3300031548 Ga0307408_100212416 Ga0307408_1002124162 228
171 3300032005 Ga0307411_10072865 Ga0307411_100728652 228
172 3300035111 Ga0373923_0118330 Ga0373923_0118330_71_781 228
173 3300035118 Ga0373954_0037597 Ga0373954_0037597_39_749 228
174 3300035172 Ga0373955_0041481 Ga0373955_0041481_1669_2379 228
175 3300036401 Ga0373937_0037988 Ga0373937_0037988_203_913 228
176 3300042133 Ga0450896_002037 Ga0450896_002037_1184_1876 228
177 3300046472 Ga0495580_0249190 Ga0495580_0249190_28_738 228
178 3300047319 Ga0495674_0118370 Ga0495674_0118370_723_1433 228
179 3300048904 Ga0496101_0260201 Ga0496101_0260201_572_1279 228
180 3300048905 Ga0496102_0082744 Ga0496102_0082744_1830_2537 228
181 3300048905 Ga0496102_0756689 Ga0496102_0756689_10_702 228
182 3300048909 Ga0496106_0025726 Ga0496106_0025726_1364_2071 228
183 3300049588 Ga0501072_0683916 Ga0501072_0683916_29_724 228
184 3300050490 nmdc:mga03n38_282840_c1 nmdc:mga03n38_282840_c1_142_837 228
185 3300050491 nmdc:mga00v17_98918_c1 nmdc:mga00v17_98918_c1_509_1201 228
186 3300050493 nmdc:mga0k408_110761_c1 nmdc:mga0k408_110761_c1_470_1162 228
187 3300050493 nmdc:mga0k408_126883_c1 nmdc:mga0k408_126883_c1_473_1165 228
188 3300050493 nmdc:mga0k408_14708_c1 nmdc:mga0k408_14708_c1_1924_2619 228
189 3300050493 nmdc:mga0k408_99516_c1 nmdc:mga0k408_99516_c1_670_1362 228
190 3300050494 nmdc:mga06z11_118965_c1 nmdc:mga06z11_118965_c1_564_1256 228
191 3300050494 nmdc:mga06z11_161560_c1 nmdc:mga06z11_161560_c1_411_1106 228
192 3300050494 nmdc:mga06z11_77643_c1 nmdc:mga06z11_77643_c1_522_1214 228
193 3300050495 nmdc:mga04h51_45238_c1 nmdc:mga04h51_45238_c1_253_945 228
194 3300050496 nmdc:mga07m45_82966_c1 nmdc:mga07m45_82966_c1_427_1119 228
195 3300054114 Ga0501084_0452287 Ga0501084_0452287_308_1003 228
196 3300059421 Ga0590071_038043 Ga0590071_038043_17_715 228
197 3300006178 Ga0075367_10027582 Ga0075367_100275822 229
198 3300046460 Ga0495638_0015590 Ga0495638_0015590_3105_3800 229
199 3300049591 Ga0501075_0145847 Ga0501075_0145847_866_1558 229
200 3300053116 Ga0500592_009690 Ga0500592_009690_194_889 229
201 3300060353 Ga0501082_0455563 Ga0501082_0455563_64_756 229
202 3300025945 Ga0207679_10081867 Ga0207679_100818673 230
203 3300049540 Ga0501324_009773 Ga0501324_009773_32_736 230
204 3300049572 Ga0501036_0201968 Ga0501036_0201968_709_1410 230
205 3300049580 Ga0501046_0424535 Ga0501046_0424535_22_723 230
206 3300049582 Ga0501048_0217979 Ga0501048_0217979_89_790 230
207 3300049583 Ga0501067_0155966 Ga0501067_0155966_543_1244 230
208 3300049587 Ga0501071_0068927 Ga0501071_0068927_1072_1773 230
209 3300049588 Ga0501072_0122132 Ga0501072_0122132_338_1039 230
210 3300049592 Ga0501076_0046065 Ga0501076_0046065_1041_1742 230
211 3300049743 Ga0501081_0190602 Ga0501081_0190602_522_1223 230
212 3300053730 Ga0500645_002436 Ga0500645_002436_5457_6155 230
213 3300054114 Ga0501084_0199112 Ga0501084_0199112_734_1435 230
214 2162886011 MRS1b_contig_6987276 MRS1b_0785.00002030 231
215 2162886012 MBSR1b_contig_750255 MBSR1b_0584.00005650 231
216 3300002244 JGI24742J22300_10008969 JGI24742J22300_100089692 231
217 3300002459 JGI24751J29686_10002254 JGI24751J29686_100022544 231
218 3300002459 JGI24751J29686_10012467 JGI24751J29686_100124671 231
219 3300003163 Ga0006759J45824_1071695 Ga0006759J45824_10716953 231
220 3300003544 Ga0007417J51691_1063962 Ga0007417J51691_10639623 231
221 3300003577 Ga0007416J51690_1063111 Ga0007416J51690_10631114 231
222 3300004798 Ga0058859_11631144 Ga0058859_116311441 231
223 3300004800 Ga0058861_12027855 Ga0058861_120278552 231
224 3300004803 Ga0058862_10054132 Ga0058862_100541326 231
225 3300005290 Ga0065712_10003155 Ga0065712_100031557 231
226 3300005290 Ga0065712_10003180 Ga0065712_100031804 231
227 3300005290 Ga0065712_10010412 Ga0065712_100104123 231
228 3300005290 Ga0065712_10016186 Ga0065712_100161863 231
229 3300005290 Ga0065712_10072555 Ga0065712_100725554 231
230 3300005290 Ga0065712_10076319 Ga0065712_100763193 231
231 3300005293 Ga0065715_10012525 Ga0065715_100125253 231
232 3300005293 Ga0065715_10018175 Ga0065715_100181752 231
233 3300005293 Ga0065715_10030346 Ga0065715_100303461 231
234 3300005293 Ga0065715_10134694 Ga0065715_101346941 231
235 3300005293 Ga0065715_10143024 Ga0065715_101430243 231
236 3300005293 Ga0065715_10147492 Ga0065715_101474921 231
237 3300005293 Ga0065715_10188267 Ga0065715_101882672 231
238 3300005293 Ga0065715_10268954 Ga0065715_102689541 231
239 3300005293 Ga0065715_10326421 Ga0065715_103264212 231
240 3300005293 Ga0065715_10427148 Ga0065715_104271481 231
241 3300005295 Ga0065707_10142628 Ga0065707_101426283 231
242 3300005295 Ga0065707_10234509 Ga0065707_102345092 231
243 3300005327 Ga0070658_10049558 Ga0070658_100495581 231
244 3300005328 Ga0070676_10006877 Ga0070676_1000687711 231
245 3300005328 Ga0070676_10020758 Ga0070676_100207582 231
246 3300005329 Ga0070683_100022502 Ga0070683_1000225024 231
247 3300005329 Ga0070683_100067471 Ga0070683_1000674717 231
248 3300005329 Ga0070683_100143037 Ga0070683_1001430372 231
249 3300005329 Ga0070683_100258581 Ga0070683_1002585813 231
250 3300005329 Ga0070683_100284898 Ga0070683_1002848982 231
251 3300005330 Ga0070690_100063688 Ga0070690_1000636883 231
252 3300005331 Ga0070670_100032636 Ga0070670_1000326364 231
253 3300005331 Ga0070670_100036649 Ga0070670_1000366496 231
254 3300005331 Ga0070670_100042782 Ga0070670_1000427824 231
255 3300005331 Ga0070670_100242385 Ga0070670_1002423852 231
256 3300005331 Ga0070670_100825900 Ga0070670_1008259001 231
257 3300005334 Ga0068869_100226264 Ga0068869_1002262642 231
258 3300005334 Ga0068869_100280484 Ga0068869_1002804842 231
259 3300005335 Ga0070666_10051301 Ga0070666_100513016 231
260 3300005335 Ga0070666_10298179 Ga0070666_102981791 231
261 3300005336 Ga0070680_100462572 Ga0070680_1004625722 231
262 3300005337 Ga0070682_100319668 Ga0070682_1003196681 231
263 3300005338 Ga0068868_100029640 Ga0068868_10002964011 231
264 3300005338 Ga0068868_100816285 Ga0068868_1008162851 231
265 3300005339 Ga0070660_100021355 Ga0070660_1000213554 231
266 3300005339 Ga0070660_100281513 Ga0070660_1002815131 231
267 3300005340 Ga0070689_100010275 Ga0070689_1000102753 231
268 3300005340 Ga0070689_100035329 Ga0070689_1000353297 231
269 3300005340 Ga0070689_100178217 Ga0070689_1001782173 231
270 3300005341 Ga0070691_10021653 Ga0070691_100216535 231
271 3300005343 Ga0070687_100010598 Ga0070687_1000105985 231
272 3300005343 Ga0070687_100058939 Ga0070687_1000589392 231
273 3300005343 Ga0070687_100269366 Ga0070687_1002693662 231
274 3300005343 Ga0070687_100429411 Ga0070687_1004294112 231
275 3300005344 Ga0070661_100104558 Ga0070661_1001045583 231
276 3300005344 Ga0070661_100169352 Ga0070661_1001693522 231
277 3300005347 Ga0070668_100068984 Ga0070668_1000689844 231
278 3300005353 Ga0070669_100012125 Ga0070669_10001212510 231
279 3300005353 Ga0070669_100107040 Ga0070669_1001070402 231
280 3300005353 Ga0070669_100114726 Ga0070669_1001147263 231
281 3300005354 Ga0070675_100003283 Ga0070675_10000328316 231
282 3300005354 Ga0070675_100058678 Ga0070675_1000586783 231
283 3300005354 Ga0070675_100058711 Ga0070675_1000587112 231
284 3300005354 Ga0070675_100141131 Ga0070675_1001411311 231
285 3300005354 Ga0070675_100280217 Ga0070675_1002802172 231
286 3300005354 Ga0070675_100616641 Ga0070675_1006166411 231
287 3300005355 Ga0070671_100019573 Ga0070671_1000195736 231
288 3300005355 Ga0070671_100022293 Ga0070671_1000222934 231
289 3300005355 Ga0070671_100069061 Ga0070671_1000690612 231
290 3300005355 Ga0070671_100082165 Ga0070671_1000821654 231
291 3300005355 Ga0070671_100159531 Ga0070671_1001595313 231
292 3300005356 Ga0070674_100011938 Ga0070674_1000119383 231
293 3300005356 Ga0070674_100176591 Ga0070674_1001765913 231
294 3300005364 Ga0070673_100019034 Ga0070673_1000190342 231
295 3300005364 Ga0070673_100135160 Ga0070673_1001351602 231
296 3300005364 Ga0070673_100137927 Ga0070673_1001379273 231
297 3300005364 Ga0070673_100223833 Ga0070673_1002238331 231
298 3300005364 Ga0070673_100258329 Ga0070673_1002583291 231
299 3300005364 Ga0070673_100282747 Ga0070673_1002827472 231
300 3300005365 Ga0070688_100034074 Ga0070688_1000340744 231
301 3300005366 Ga0070659_100070503 Ga0070659_1000705033 231
302 3300005366 Ga0070659_100427545 Ga0070659_1004275452 231
303 3300005367 Ga0070667_100268327 Ga0070667_1002683271 231
304 3300005367 Ga0070667_100323696 Ga0070667_1003236962 231
305 3300005367 Ga0070667_100374965 Ga0070667_1003749652 231
306 3300005434 Ga0070709_10046224 Ga0070709_100462246 231
307 3300005434 Ga0070709_10185255 Ga0070709_101852552 231
308 3300005434 Ga0070709_10381645 Ga0070709_103816451 231
309 3300005435 Ga0070714_100016727 Ga0070714_10001672712 231
310 3300005438 Ga0070701_10008026 Ga0070701_100080264 231
311 3300005438 Ga0070701_10204590 Ga0070701_102045901 231
312 3300005440 Ga0070705_100014714 Ga0070705_1000147144 231
313 3300005440 Ga0070705_100355430 Ga0070705_1003554301 231
314 3300005441 Ga0070700_100054235 Ga0070700_1000542352 231
315 3300005441 Ga0070700_100071481 Ga0070700_1000714813 231
316 3300005441 Ga0070700_100121566 Ga0070700_1001215663 231
317 3300005444 Ga0070694_100079554 Ga0070694_1000795543 231
318 3300005444 Ga0070694_100086832 Ga0070694_1000868322 231
319 3300005444 Ga0070694_100171326 Ga0070694_1001713261 231
320 3300005445 Ga0070708_100037389 Ga0070708_1000373894 231
321 3300005455 Ga0070663_100075212 Ga0070663_1000752123 231
322 3300005455 Ga0070663_100102519 Ga0070663_1001025192 231
323 3300005456 Ga0070678_100021386 Ga0070678_1000213864 231
324 3300005456 Ga0070678_100025537 Ga0070678_1000255377 231
325 3300005456 Ga0070678_100148080 Ga0070678_1001480803 231
326 3300005456 Ga0070678_100503690 Ga0070678_1005036901 231
327 3300005457 Ga0070662_100310444 Ga0070662_1003104441 231
328 3300005457 Ga0070662_100313497 Ga0070662_1003134972 231
329 3300005458 Ga0070681_10036645 Ga0070681_100366454 231
330 3300005459 Ga0068867_100024756 Ga0068867_1000247564 231
331 3300005459 Ga0068867_100046871 Ga0068867_1000468715 231
332 3300005466 Ga0070685_10068726 Ga0070685_100687264 231
333 3300005471 Ga0070698_100031163 Ga0070698_1000311634 231
334 3300005471 Ga0070698_100045728 Ga0070698_1000457286 231
335 3300005471 Ga0070698_100169372 Ga0070698_1001693724 231
336 3300005471 Ga0070698_100458387 Ga0070698_1004583872 231
337 3300005518 Ga0070699_100039862 Ga0070699_1000398624 231
338 3300005530 Ga0070679_100331744 Ga0070679_1003317441 231
339 3300005535 Ga0070684_100050464 Ga0070684_1000504646 231
340 3300005535 Ga0070684_100227261 Ga0070684_1002272612 231
341 3300005535 Ga0070684_100593368 Ga0070684_1005933682 231
342 3300005539 Ga0068853_100401456 Ga0068853_1004014562 231
343 3300005539 Ga0068853_100585276 Ga0068853_1005852761 231
344 3300005543 Ga0070672_100035240 Ga0070672_1000352404 231
345 3300005543 Ga0070672_100090608 Ga0070672_1000906084 231
346 3300005543 Ga0070672_100131380 Ga0070672_1001313802 231
347 3300005543 Ga0070672_100149735 Ga0070672_1001497353 231
348 3300005543 Ga0070672_100163998 Ga0070672_1001639982 231
349 3300005543 Ga0070672_100222995 Ga0070672_1002229952 231
350 3300005543 Ga0070672_100240827 Ga0070672_1002408271 231
351 3300005544 Ga0070686_100054834 Ga0070686_1000548343 231
352 3300005544 Ga0070686_100101114 Ga0070686_1001011142 231
353 3300005545 Ga0070695_100027513 Ga0070695_1000275137 231
354 3300005545 Ga0070695_100031080 Ga0070695_1000310804 231
355 3300005546 Ga0070696_100292081 Ga0070696_1002920812 231
356 3300005547 Ga0070693_100010528 Ga0070693_1000105287 231
357 3300005547 Ga0070693_100025995 Ga0070693_1000259952 231
358 3300005547 Ga0070693_100211067 Ga0070693_1002110671 231
359 3300005548 Ga0070665_100001142 Ga0070665_1000011424 231
360 3300005548 Ga0070665_100043746 Ga0070665_1000437467 231
361 3300005548 Ga0070665_100151522 Ga0070665_1001515221 231
362 3300005548 Ga0070665_100663561 Ga0070665_1006635612 231
363 3300005548 Ga0070665_100846182 Ga0070665_1008461821 231
364 3300005549 Ga0070704_100022139 Ga0070704_1000221394 231
365 3300005549 Ga0070704_100038836 Ga0070704_1000388363 231
366 3300005549 Ga0070704_100085002 Ga0070704_1000850024 231
367 3300005549 Ga0070704_100191163 Ga0070704_1001911633 231
368 3300005549 Ga0070704_100299790 Ga0070704_1002997901 231
369 3300005549 Ga0070704_100429123 Ga0070704_1004291232 231
370 3300005564 Ga0070664_100000479 Ga0070664_10000047937 231
371 3300005564 Ga0070664_100023901 Ga0070664_1000239014 231
372 3300005564 Ga0070664_100345767 Ga0070664_1003457672 231
373 3300005564 Ga0070664_100801303 Ga0070664_1008013032 231
374 3300005577 Ga0068857_100088906 Ga0068857_1000889062 231
375 3300005577 Ga0068857_100095854 Ga0068857_1000958544 231
376 3300005578 Ga0068854_100030421 Ga0068854_1000304213 231
377 3300005614 Ga0068856_100021502 Ga0068856_1000215024 231
378 3300005615 Ga0070702_100069828 Ga0070702_1000698283 231
379 3300005615 Ga0070702_100193094 Ga0070702_1001930942 231
380 3300005616 Ga0068852_100156437 Ga0068852_1001564374 231
381 3300005616 Ga0068852_100880250 Ga0068852_1008802501 231
382 3300005617 Ga0068859_100052431 Ga0068859_1000524314 231
383 3300005617 Ga0068859_100058170 Ga0068859_1000581705 231
384 3300005617 Ga0068859_100060743 Ga0068859_1000607434 231
385 3300005617 Ga0068859_100116721 Ga0068859_1001167212 231
386 3300005617 Ga0068859_100143147 Ga0068859_1001431473 231
387 3300005618 Ga0068864_100020005 Ga0068864_1000200054 231
388 3300005618 Ga0068864_100021918 Ga0068864_1000219184 231
389 3300005618 Ga0068864_100103104 Ga0068864_1001031043 231
390 3300005718 Ga0068866_10029809 Ga0068866_100298093 231
391 3300005718 Ga0068866_10141972 Ga0068866_101419722 231
392 3300005719 Ga0068861_100037825 Ga0068861_1000378255 231
393 3300005719 Ga0068861_100280773 Ga0068861_1002807732 231
394 3300005834 Ga0068851_10180931 Ga0068851_101809311 231
395 3300005841 Ga0068863_100002641 Ga0068863_1000026414 231
396 3300005841 Ga0068863_100101783 Ga0068863_1001017832 231
397 3300005841 Ga0068863_100314856 Ga0068863_1003148563 231
398 3300005841 Ga0068863_100448766 Ga0068863_1004487662 231
399 3300005842 Ga0068858_100003549 Ga0068858_1000035493 231
400 3300005842 Ga0068858_100108646 Ga0068858_1001086464 231
401 3300005842 Ga0068858_100179900 Ga0068858_1001799003 231
402 3300005843 Ga0068860_100110727 Ga0068860_1001107273 231
403 3300005843 Ga0068860_100146900 Ga0068860_1001469004 231
404 3300005843 Ga0068860_100308768 Ga0068860_1003087682 231
405 3300005844 Ga0068862_100038643 Ga0068862_1000386437 231
406 3300005844 Ga0068862_100463520 Ga0068862_1004635202 231
407 3300005937 Ga0081455_10052243 Ga0081455_100522433 231
408 3300005937 Ga0081455_10062519 Ga0081455_100625193 231
409 3300005983 Ga0081540_1071342 Ga0081540_10713423 231
410 3300005985 Ga0081539_10004143 Ga0081539_100041434 231
411 3300006042 Ga0075368_10010245 Ga0075368_100102454 231
412 3300006058 Ga0075432_10066499 Ga0075432_100664992 231
413 3300006178 Ga0075367_10074056 Ga0075367_100740563 231
414 3300006178 Ga0075367_10128678 Ga0075367_101286782 231
415 3300006237 Ga0097621_100012152 Ga0097621_10001215211 231
416 3300006237 Ga0097621_100019408 Ga0097621_1000194084 231
417 3300006237 Ga0097621_100050116 Ga0097621_1000501166 231
418 3300006237 Ga0097621_100108636 Ga0097621_1001086362 231
419 3300006237 Ga0097621_100163688 Ga0097621_1001636882 231
420 3300006237 Ga0097621_100168154 Ga0097621_1001681543 231
421 3300006358 Ga0068871_100016384 Ga0068871_1000163844 231
422 3300006358 Ga0068871_100089011 Ga0068871_1000890114 231
423 3300006358 Ga0068871_100358315 Ga0068871_1003583152 231
424 3300006358 Ga0068871_100871149 Ga0068871_1008711491 231
425 3300006844 Ga0075428_100059187 Ga0075428_1000591877 231
426 3300006844 Ga0075428_100092394 Ga0075428_1000923942 231
427 3300006844 Ga0075428_100101880 Ga0075428_1001018806 231
428 3300006844 Ga0075428_100173346 Ga0075428_1001733464 231
429 3300006844 Ga0075428_100542217 Ga0075428_1005422172 231
430 3300006844 Ga0075428_100751183 Ga0075428_1007511832 231
431 3300006844 Ga0075428_101101983 Ga0075428_1011019832 231
432 3300006846 Ga0075430_100032704 Ga0075430_1000327044 231
433 3300006846 Ga0075430_100060590 Ga0075430_1000605904 231
434 3300006846 Ga0075430_100328105 Ga0075430_1003281052 231
435 3300006847 Ga0075431_100051337 Ga0075431_1000513372 231
436 3300006847 Ga0075431_100054499 Ga0075431_1000544992 231
437 3300006847 Ga0075431_100071897 Ga0075431_1000718972 231
438 3300006847 Ga0075431_100078029 Ga0075431_1000780292 231
439 3300006847 Ga0075431_100081544 Ga0075431_1000815447 231
440 3300006847 Ga0075431_100139789 Ga0075431_1001397892 231
441 3300006847 Ga0075431_100165453 Ga0075431_1001654533 231
442 3300006847 Ga0075431_100239897 Ga0075431_1002398971 231
443 3300006847 Ga0075431_100448333 Ga0075431_1004483332 231
444 3300006847 Ga0075431_100806842 Ga0075431_1008068422 231
445 3300006852 Ga0075433_10146434 Ga0075433_101464342 231
446 3300006852 Ga0075433_10299581 Ga0075433_102995812 231
447 3300006871 Ga0075434_100008089 Ga0075434_1000080894 231
448 3300006871 Ga0075434_100023274 Ga0075434_10002327411 231
449 3300006871 Ga0075434_100030826 Ga0075434_1000308264 231
450 3300006871 Ga0075434_100049389 Ga0075434_1000493894 231
451 3300006871 Ga0075434_100052251 Ga0075434_1000522517 231
452 3300006871 Ga0075434_100120927 Ga0075434_1001209271 231
453 3300006871 Ga0075434_100163608 Ga0075434_1001636083 231
454 3300006871 Ga0075434_100323067 Ga0075434_1003230673 231
455 3300006871 Ga0075434_100458533 Ga0075434_1004585332 231
456 3300006880 Ga0075429_100022950 Ga0075429_1000229508 231
457 3300006880 Ga0075429_100061614 Ga0075429_1000616143 231
458 3300006880 Ga0075429_100161465 Ga0075429_1001614652 231
459 3300006880 Ga0075429_100249221 Ga0075429_1002492213 231
460 3300006881 Ga0068865_100167247 Ga0068865_1001672471 231
461 3300006881 Ga0068865_100342560 Ga0068865_1003425602 231
462 3300006881 Ga0068865_100568230 Ga0068865_1005682301 231
463 3300006914 Ga0075436_100013829 Ga0075436_1000138293 231
464 3300006914 Ga0075436_100045093 Ga0075436_1000450933 231
465 3300006914 Ga0075436_100061898 Ga0075436_1000618981 231
466 3300006914 Ga0075436_100499804 Ga0075436_1004998041 231
467 3300006931 Ga0097620_100052429 Ga0097620_1000524293 231
468 3300006931 Ga0097620_100058168 Ga0097620_1000581685 231
469 3300006931 Ga0097620_100060741 Ga0097620_1000607412 231
470 3300006931 Ga0097620_100116734 Ga0097620_1001167342 231
471 3300006931 Ga0097620_100143146 Ga0097620_1001431463 231
472 3300007076 Ga0075435_100006214 Ga0075435_1000062141 231
473 3300007076 Ga0075435_100009940 Ga0075435_1000099408 231
474 3300007076 Ga0075435_100010966 Ga0075435_1000109664 231
475 3300007076 Ga0075435_100013746 Ga0075435_10001374611 231
476 3300007076 Ga0075435_100018121 Ga0075435_1000181217 231
477 3300007076 Ga0075435_100077607 Ga0075435_1000776072 231
478 3300007076 Ga0075435_100111882 Ga0075435_1001118824 231
479 3300007076 Ga0075435_100153841 Ga0075435_1001538413 231
480 3300007076 Ga0075435_100210480 Ga0075435_1002104802 231
481 3300007076 Ga0075435_100477185 Ga0075435_1004771852 231
482 3300009093 Ga0105240_10039744 Ga0105240_100397444 231
483 3300009093 Ga0105240_10517443 Ga0105240_105174432 231
484 3300009093 Ga0105240_10830910 Ga0105240_108309102 231
485 3300009094 Ga0111539_10050951 Ga0111539_100509517 231
486 3300009094 Ga0111539_10070960 Ga0111539_100709604 231
487 3300009094 Ga0111539_10071376 Ga0111539_100713765 231
488 3300009094 Ga0111539_10083713 Ga0111539_100837134 231
489 3300009094 Ga0111539_10162198 Ga0111539_101621982 231
490 3300009094 Ga0111539_10175332 Ga0111539_101753325 231
491 3300009094 Ga0111539_10454973 Ga0111539_104549732 231
492 3300009094 Ga0111539_10569014 Ga0111539_105690142 231
493 3300009094 Ga0111539_10590377 Ga0111539_105903771 231
494 3300009101 Ga0105247_10015895 Ga0105247_1001589510 231
495 3300009101 Ga0105247_10338603 Ga0105247_103386031 231
496 3300009147 Ga0114129_10001925 Ga0114129_100019254 231
497 3300009147 Ga0114129_10037064 Ga0114129_1003706412 231
498 3300009147 Ga0114129_10057496 Ga0114129_100574964 231
499 3300009147 Ga0114129_10082040 Ga0114129_100820406 231
500 3300009147 Ga0114129_10083262 Ga0114129_100832623 231
501 3300009147 Ga0114129_10088785 Ga0114129_100887854 231
502 3300009147 Ga0114129_10089356 Ga0114129_100893562 231
503 3300009147 Ga0114129_10090758 Ga0114129_100907583 231
504 3300009147 Ga0114129_10124117 Ga0114129_101241172 231
505 3300009147 Ga0114129_10175605 Ga0114129_101756054 231
506 3300009147 Ga0114129_10218741 Ga0114129_102187412 231
507 3300009147 Ga0114129_10319563 Ga0114129_103195632 231
508 3300009148 Ga0105243_10043926 Ga0105243_100439265 231
509 3300009148 Ga0105243_10063738 Ga0105243_100637383 231
510 3300009174 Ga0105241_10070577 Ga0105241_100705772 231
511 3300009174 Ga0105241_10239476 Ga0105241_102394762 231
512 3300009176 Ga0105242_10033180 Ga0105242_100331807 231
513 3300009176 Ga0105242_10204657 Ga0105242_102046573 231
514 3300009176 Ga0105242_10509381 Ga0105242_105093811 231
515 3300009177 Ga0105248_10058749 Ga0105248_100587493 231
516 3300009177 Ga0105248_10137242 Ga0105248_101372422 231
517 3300009177 Ga0105248_10174972 Ga0105248_101749723 231
518 3300009177 Ga0105248_10303600 Ga0105248_103036003 231
519 3300009177 Ga0105248_10365917 Ga0105248_103659172 231
520 3300009177 Ga0105248_11319378 Ga0105248_113193781 231
521 3300009545 Ga0105237_10818557 Ga0105237_108185572 231
522 3300009551 Ga0105238_10213858 Ga0105238_102138583 231
523 3300009551 Ga0105238_10518896 Ga0105238_105188961 231
524 3300009553 Ga0105249_10047141 Ga0105249_100471412 231
525 3300009553 Ga0105249_10432333 Ga0105249_104323332 231
526 3300013105 Ga0157369_10199512 Ga0157369_101995122 231
527 3300013296 Ga0157374_10070935 Ga0157374_100709354 231
528 3300013296 Ga0157374_10196172 Ga0157374_101961722 231
529 3300013296 Ga0157374_10278710 Ga0157374_102787102 231
530 3300013297 Ga0157378_10111251 Ga0157378_101112514 231
531 3300013297 Ga0157378_10122509 Ga0157378_101225092 231
532 3300013306 Ga0163162_10055553 Ga0163162_100555534 231
533 3300013306 Ga0163162_10082782 Ga0163162_100827827 231
534 3300013308 Ga0157375_10224479 Ga0157375_102244793 231
535 3300014325 Ga0163163_10019918 Ga0163163_100199184 231
536 3300014325 Ga0163163_10034316 Ga0163163_100343163 231
537 3300014325 Ga0163163_10238824 Ga0163163_102388242 231
538 3300014325 Ga0163163_10513724 Ga0163163_105137242 231
539 3300014326 Ga0157380_10090303 Ga0157380_100903033 231
540 3300014326 Ga0157380_10213298 Ga0157380_102132982 231
541 3300014326 Ga0157380_10493336 Ga0157380_104933362 231
542 3300014326 Ga0157380_10960479 Ga0157380_109604791 231
543 3300014968 Ga0157379_10087694 Ga0157379_100876944 231
544 3300014968 Ga0157379_10127107 Ga0157379_101271074 231
545 3300014968 Ga0157379_10645930 Ga0157379_106459301 231
546 3300014969 Ga0157376_10244614 Ga0157376_102446142 231
547 3300014969 Ga0157376_10324727 Ga0157376_103247273 231
548 3300014969 Ga0157376_10618666 Ga0157376_106186662 231
549 3300025315 Ga0207697_10006737 Ga0207697_100067374 231
550 3300025315 Ga0207697_10049267 Ga0207697_100492672 231
551 3300025315 Ga0207697_10063571 Ga0207697_100635712 231
552 3300025893 Ga0207682_10057577 Ga0207682_100575772 231
553 3300025899 Ga0207642_10114509 Ga0207642_101145091 231
554 3300025900 Ga0207710_10263789 Ga0207710_102637891 231
555 3300025903 Ga0207680_10086181 Ga0207680_100861812 231
556 3300025903 Ga0207680_10167783 Ga0207680_101677831 231
557 3300025903 Ga0207680_10222653 Ga0207680_102226531 231
558 3300025904 Ga0207647_10020837 Ga0207647_100208374 231
559 3300025906 Ga0207699_10038979 Ga0207699_100389796 231
560 3300025906 Ga0207699_10160286 Ga0207699_101602862 231
561 3300025906 Ga0207699_10229896 Ga0207699_102298962 231
562 3300025907 Ga0207645_10022529 Ga0207645_100225293 231
563 3300025907 Ga0207645_10024118 Ga0207645_100241184 231
564 3300025907 Ga0207645_10488157 Ga0207645_104881572 231
565 3300025908 Ga0207643_10212788 Ga0207643_102127882 231
566 3300025910 Ga0207684_10300332 Ga0207684_103003321 231
567 3300025911 Ga0207654_10066422 Ga0207654_100664222 231
568 3300025911 Ga0207654_10289253 Ga0207654_102892532 231
569 3300025912 Ga0207707_10031478 Ga0207707_100314787 231
570 3300025912 Ga0207707_10075131 Ga0207707_100751312 231
571 3300025913 Ga0207695_10136434 Ga0207695_101364341 231
572 3300025913 Ga0207695_10732804 Ga0207695_107328041 231
573 3300025916 Ga0207663_10133573 Ga0207663_101335732 231
574 3300025916 Ga0207663_10302828 Ga0207663_103028282 231
575 3300025917 Ga0207660_10399279 Ga0207660_103992792 231
576 3300025918 Ga0207662_10045759 Ga0207662_100457595 231
577 3300025918 Ga0207662_10115019 Ga0207662_101150193 231
578 3300025918 Ga0207662_10121296 Ga0207662_101212963 231
579 3300025919 Ga0207657_10083516 Ga0207657_100835162 231
580 3300025920 Ga0207649_10238303 Ga0207649_102383032 231
581 3300025920 Ga0207649_10288881 Ga0207649_102888812 231
582 3300025922 Ga0207646_10096455 Ga0207646_100964553 231
583 3300025922 Ga0207646_10432458 Ga0207646_104324582 231
584 3300025923 Ga0207681_10099023 Ga0207681_100990231 231
585 3300025923 Ga0207681_10225089 Ga0207681_102250892 231
586 3300025923 Ga0207681_10271701 Ga0207681_102717012 231
587 3300025923 Ga0207681_10321576 Ga0207681_103215762 231
588 3300025923 Ga0207681_10341396 Ga0207681_103413962 231
589 3300025924 Ga0207694_10602381 Ga0207694_106023811 231
590 3300025925 Ga0207650_10024531 Ga0207650_100245313 231
591 3300025925 Ga0207650_10054709 Ga0207650_100547094 231
592 3300025925 Ga0207650_10081604 Ga0207650_100816044 231
593 3300025925 Ga0207650_10355854 Ga0207650_103558542 231
594 3300025926 Ga0207659_10002281 Ga0207659_1000228116 231
595 3300025926 Ga0207659_10075534 Ga0207659_100755343 231
596 3300025926 Ga0207659_10288692 Ga0207659_102886922 231
597 3300025926 Ga0207659_10399579 Ga0207659_103995792 231
598 3300025926 Ga0207659_10433300 Ga0207659_104333002 231
599 3300025927 Ga0207687_10171415 Ga0207687_101714151 231
600 3300025928 Ga0207700_10924622 Ga0207700_109246221 231
601 3300025929 Ga0207664_10024634 Ga0207664_100246344 231
602 3300025931 Ga0207644_10006250 Ga0207644_100062504 231
603 3300025931 Ga0207644_10013745 Ga0207644_100137454 231
604 3300025931 Ga0207644_10066753 Ga0207644_100667532 231
605 3300025931 Ga0207644_10157657 Ga0207644_101576573 231
606 3300025931 Ga0207644_10247228 Ga0207644_102472282 231
607 3300025931 Ga0207644_10261013 Ga0207644_102610132 231
608 3300025931 Ga0207644_10496618 Ga0207644_104966182 231
609 3300025933 Ga0207706_10061580 Ga0207706_100615803 231
610 3300025934 Ga0207686_10026234 Ga0207686_100262344 231
611 3300025934 Ga0207686_10042760 Ga0207686_100427604 231
612 3300025934 Ga0207686_10382956 Ga0207686_103829562 231
613 3300025935 Ga0207709_10057765 Ga0207709_100577654 231
614 3300025935 Ga0207709_10130334 Ga0207709_101303342 231
615 3300025936 Ga0207670_10032793 Ga0207670_100327933 231
616 3300025936 Ga0207670_10070285 Ga0207670_100702854 231
617 3300025936 Ga0207670_10077619 Ga0207670_100776191 231
618 3300025936 Ga0207670_10208154 Ga0207670_102081542 231
619 3300025937 Ga0207669_10097789 Ga0207669_100977892 231
620 3300025937 Ga0207669_10196919 Ga0207669_101969191 231
621 3300025937 Ga0207669_10294840 Ga0207669_102948402 231
622 3300025937 Ga0207669_10750250 Ga0207669_107502502 231
623 3300025938 Ga0207704_10090084 Ga0207704_100900841 231
624 3300025939 Ga0207665_10220209 Ga0207665_102202092 231
625 3300025940 Ga0207691_10057475 Ga0207691_100574754 231
626 3300025940 Ga0207691_10059070 Ga0207691_100590704 231
627 3300025940 Ga0207691_10089812 Ga0207691_100898123 231
628 3300025940 Ga0207691_10126513 Ga0207691_101265133 231
629 3300025940 Ga0207691_10154885 Ga0207691_101548852 231
630 3300025940 Ga0207691_10167555 Ga0207691_101675552 231
631 3300025940 Ga0207691_10205619 Ga0207691_102056193 231
632 3300025940 Ga0207691_10215919 Ga0207691_102159192 231
633 3300025940 Ga0207691_10427391 Ga0207691_104273911 231
634 3300025940 Ga0207691_10540080 Ga0207691_105400802 231
635 3300025941 Ga0207711_10046720 Ga0207711_100467201 231
636 3300025941 Ga0207711_10127929 Ga0207711_101279294 231
637 3300025941 Ga0207711_10140160 Ga0207711_101401603 231
638 3300025941 Ga0207711_10159678 Ga0207711_101596781 231
639 3300025941 Ga0207711_10744733 Ga0207711_107447331 231
640 3300025942 Ga0207689_10142740 Ga0207689_101427402 231
641 3300025942 Ga0207689_10146058 Ga0207689_101460583 231
642 3300025942 Ga0207689_10327625 Ga0207689_103276252 231
643 3300025944 Ga0207661_10052153 Ga0207661_100521534 231
644 3300025944 Ga0207661_10136329 Ga0207661_101363294 231
645 3300025944 Ga0207661_10145992 Ga0207661_101459922 231
646 3300025945 Ga0207679_10007830 Ga0207679_100078304 231
647 3300025945 Ga0207679_10031159 Ga0207679_100311594 231
648 3300025945 Ga0207679_10063554 Ga0207679_100635544 231
649 3300025945 Ga0207679_10203418 Ga0207679_102034181 231
650 3300025945 Ga0207679_10470877 Ga0207679_104708772 231
651 3300025960 Ga0207651_10012876 Ga0207651_100128762 231
652 3300025960 Ga0207651_10032332 Ga0207651_100323327 231
653 3300025960 Ga0207651_10133750 Ga0207651_101337503 231
654 3300025960 Ga0207651_10342075 Ga0207651_103420752 231
655 3300025961 Ga0207712_10030658 Ga0207712_100306581 231
656 3300025961 Ga0207712_10091557 Ga0207712_100915572 231
657 3300025981 Ga0207640_10018870 Ga0207640_100188704 231
658 3300025981 Ga0207640_10021255 Ga0207640_100212557 231
659 3300025981 Ga0207640_10371834 Ga0207640_103718341 231
660 3300025981 Ga0207640_10632071 Ga0207640_106320711 231
661 3300025986 Ga0207658_10064322 Ga0207658_100643222 231
662 3300025986 Ga0207658_10125681 Ga0207658_101256814 231
663 3300025986 Ga0207658_10308453 Ga0207658_103084532 231
664 3300026023 Ga0207677_10063437 Ga0207677_100634372 231
665 3300026023 Ga0207677_10101490 Ga0207677_101014901 231
666 3300026023 Ga0207677_10668529 Ga0207677_106685291 231
667 3300026035 Ga0207703_10037322 Ga0207703_100373222 231
668 3300026035 Ga0207703_10053472 Ga0207703_100534726 231
669 3300026035 Ga0207703_10087961 Ga0207703_100879611 231
670 3300026035 Ga0207703_10115187 Ga0207703_101151873 231
671 3300026035 Ga0207703_10510384 Ga0207703_105103842 231
672 3300026041 Ga0207639_10384205 Ga0207639_103842052 231
673 3300026067 Ga0207678_10118278 Ga0207678_101182783 231
674 3300026067 Ga0207678_10223804 Ga0207678_102238041 231
675 3300026075 Ga0207708_10035399 Ga0207708_100353997 231
676 3300026075 Ga0207708_10094953 Ga0207708_100949532 231
677 3300026075 Ga0207708_10105780 Ga0207708_101057803 231
678 3300026075 Ga0207708_10325494 Ga0207708_103254942 231
679 3300026078 Ga0207702_10598141 Ga0207702_105981411 231
680 3300026088 Ga0207641_10006730 Ga0207641_100067304 231
681 3300026088 Ga0207641_10040192 Ga0207641_100401927 231
682 3300026088 Ga0207641_10268257 Ga0207641_102682572 231
683 3300026089 Ga0207648_10040419 Ga0207648_100404194 231
684 3300026089 Ga0207648_10108973 Ga0207648_101089732 231
685 3300026089 Ga0207648_10115354 Ga0207648_101153543 231
686 3300026089 Ga0207648_10178924 Ga0207648_101789241 231
687 3300026089 Ga0207648_10523384 Ga0207648_105233842 231
688 3300026095 Ga0207676_10090307 Ga0207676_100903071 231
689 3300026095 Ga0207676_10114833 Ga0207676_101148333 231
690 3300026116 Ga0207674_10017732 Ga0207674_100177323 231
691 3300026116 Ga0207674_10101649 Ga0207674_101016494 231
692 3300026118 Ga0207675_100031657 Ga0207675_1000316577 231
693 3300026118 Ga0207675_100037707 Ga0207675_1000377074 231
694 3300026121 Ga0207683_10015965 Ga0207683_100159654 231
695 3300026121 Ga0207683_10062914 Ga0207683_100629146 231
696 3300026121 Ga0207683_10100072 Ga0207683_101000722 231
697 3300026121 Ga0207683_10241586 Ga0207683_102415863 231
698 3300026142 Ga0207698_10135357 Ga0207698_101353572 231
699 3300026142 Ga0207698_10784869 Ga0207698_107848692 231
700 3300027907 Ga0207428_10018173 Ga0207428_100181737 231
701 3300027907 Ga0207428_10021152 Ga0207428_100211527 231
702 3300027907 Ga0207428_10037083 Ga0207428_100370834 231
703 3300027907 Ga0207428_10047174 Ga0207428_100471744 231
704 3300027907 Ga0207428_10062710 Ga0207428_100627104 231
705 3300027907 Ga0207428_10071803 Ga0207428_100718033 231
706 3300027907 Ga0207428_10073958 Ga0207428_100739584 231
707 3300027907 Ga0207428_10152288 Ga0207428_101522881 231
708 3300027907 Ga0207428_10329439 Ga0207428_103294392 231
709 3300028379 Ga0268266_10006985 Ga0268266_100069855 231
710 3300028380 Ga0268265_10078111 Ga0268265_100781114 231
711 3300028380 Ga0268265_10548436 Ga0268265_105484362 231
712 3300028380 Ga0268265_10652652 Ga0268265_106526521 231
713 3300028381 Ga0268264_10244329 Ga0268264_102443293 231
714 3300028381 Ga0268264_10383910 Ga0268264_103839102 231
715 3300028381 Ga0268264_10425538 Ga0268264_104255382 231
716 3300028381 Ga0268264_10539066 Ga0268264_105390662 231
717 3300028381 Ga0268264_10636739 Ga0268264_106367392 231
718 3300031456 Ga0307513_10592853 Ga0307513_105928531 231
719 3300031548 Ga0307408_100015092 Ga0307408_1000150924 231
720 3300031548 Ga0307408_100056513 Ga0307408_1000565132 231
721 3300031548 Ga0307408_100069819 Ga0307408_1000698192 231
722 3300031548 Ga0307408_100177761 Ga0307408_1001777612 231
723 3300031548 Ga0307408_100220124 Ga0307408_1002201242 231
724 3300031548 Ga0307408_100258313 Ga0307408_1002583132 231
725 3300031731 Ga0307405_10132438 Ga0307405_101324382 231
726 3300031731 Ga0307405_10160354 Ga0307405_101603543 231
727 3300031731 Ga0307405_10176253 Ga0307405_101762532 231
728 3300031824 Ga0307413_10035015 Ga0307413_100350154 231
729 3300031824 Ga0307413_10765416 Ga0307413_107654161 231
730 3300031852 Ga0307410_10014184 Ga0307410_100141843 231
731 3300031852 Ga0307410_10044243 Ga0307410_100442435 231
732 3300031852 Ga0307410_10267751 Ga0307410_102677511 231
733 3300031852 Ga0307410_10322649 Ga0307410_103226491 231
734 3300031852 Ga0307410_10715375 Ga0307410_107153752 231
735 3300031901 Ga0307406_10309340 Ga0307406_103093402 231
736 3300031901 Ga0307406_10325596 Ga0307406_103255961 231
737 3300031901 Ga0307406_10717586 Ga0307406_107175861 231
738 3300031903 Ga0307407_10006748 Ga0307407_100067484 231
739 3300031903 Ga0307407_10107454 Ga0307407_101074542 231
740 3300031911 Ga0307412_10106226 Ga0307412_101062262 231
741 3300031911 Ga0307412_10108579 Ga0307412_101085793 231
742 3300031911 Ga0307412_10124288 Ga0307412_101242882 231
743 3300031911 Ga0307412_10140018 Ga0307412_101400182 231
744 3300031911 Ga0307412_10199510 Ga0307412_101995102 231
745 3300031995 Ga0307409_100008285 Ga0307409_1000082854 231
746 3300031995 Ga0307409_100032545 Ga0307409_1000325455 231
747 3300031995 Ga0307409_100109203 Ga0307409_1001092034 231
748 3300031995 Ga0307409_100148469 Ga0307409_1001484691 231
749 3300031995 Ga0307409_100297217 Ga0307409_1002972172 231
750 3300031995 Ga0307409_100302374 Ga0307409_1003023743 231
751 3300032002 Ga0307416_100009329 Ga0307416_1000093297 231
752 3300032002 Ga0307416_100016235 Ga0307416_1000162354 231
753 3300032002 Ga0307416_100023389 Ga0307416_1000233894 231
754 3300032002 Ga0307416_100071517 Ga0307416_1000715172 231
755 3300032002 Ga0307416_100081275 Ga0307416_1000812752 231
756 3300032002 Ga0307416_100196156 Ga0307416_1001961562 231
757 3300032002 Ga0307416_100343099 Ga0307416_1003430991 231
758 3300032002 Ga0307416_100409672 Ga0307416_1004096722 231
759 3300032002 Ga0307416_100453952 Ga0307416_1004539522 231
760 3300032002 Ga0307416_100642174 Ga0307416_1006421742 231
761 3300032002 Ga0307416_100684915 Ga0307416_1006849152 231
762 3300032002 Ga0307416_100771646 Ga0307416_1007716461 231
763 3300032004 Ga0307414_10031493 Ga0307414_100314933 231
764 3300032004 Ga0307414_10224910 Ga0307414_102249101 231
765 3300032004 Ga0307414_10382949 Ga0307414_103829491 231
766 3300032004 Ga0307414_10859977 Ga0307414_108599772 231
767 3300032004 Ga0307414_10863805 Ga0307414_108638051 231
768 3300032005 Ga0307411_10027976 Ga0307411_100279764 231
769 3300032005 Ga0307411_10036028 Ga0307411_100360283 231
770 3300032005 Ga0307411_10037127 Ga0307411_100371272 231
771 3300032005 Ga0307411_10060259 Ga0307411_100602593 231
772 3300032005 Ga0307411_10085700 Ga0307411_100857003 231
773 3300032005 Ga0307411_10092303 Ga0307411_100923032 231
774 3300032005 Ga0307411_10189555 Ga0307411_101895552 231
775 3300032005 Ga0307411_10424864 Ga0307411_104248642 231
776 3300032126 Ga0307415_100017833 Ga0307415_1000178333 231
777 3300032126 Ga0307415_100070727 Ga0307415_1000707273 231
778 3300034957 Ga0373938_0000588 Ga0373938_0000588_3191_3898 231
779 3300035084 Ga0373928_0007331 Ga0373928_0007331_396_1103 231
780 3300035085 Ga0373929_0000498 Ga0373929_0000498_2740_3447 231
781 3300035085 Ga0373929_0041471 Ga0373929_0041471_64_768 231
782 3300035086 Ga0373934_0193373 Ga0373934_0193373_43_750 231
783 3300035088 Ga0373940_0001234 Ga0373940_0001234_2136_2843 231
784 3300035090 Ga0373949_0001772 Ga0373949_0001772_1907_2614 231
785 3300035091 Ga0373951_0000520 Ga0373951_0000520_7942_8649 231
786 3300035091 Ga0373951_0074382 Ga0373951_0074382_113_820 231
787 3300035112 Ga0373932_0000492 Ga0373932_0000492_7684_8391 231
788 3300035114 Ga0373939_0015291 Ga0373939_0015291_535_1239 231
789 3300035115 Ga0373941_0000603 Ga0373941_0000603_41_748 231
790 3300035115 Ga0373941_0030086 Ga0373941_0030086_439_1143 231
791 3300035116 Ga0373945_0019159 Ga0373945_0019159_272_979 231
792 3300035119 Ga0373956_0109075 Ga0373956_0109075_75_782 231
793 3300035120 Ga0373957_0083157 Ga0373957_0083157_546_1253 231
794 3300035121 Ga0373960_0000207 Ga0373960_0000207_596_1303 231
795 3300035170 Ga0373943_0007836 Ga0373943_0007836_2705_3412 231
796 3300035171 Ga0373946_0028290 Ga0373946_0028290_396_1103 231
797 3300035207 Ga0373942_0001108 Ga0373942_0001108_298_1005 231
798 3300035241 Ga0373961_0006147 Ga0373961_0006147_1953_2660 231
799 3300035242 Ga0373962_0003292 Ga0373962_0003292_1365_2072 231
800 3300035410 Ga0373924_0083647 Ga0373924_0083647_487_1194 231
801 3300035410 Ga0373924_0107574 Ga0373924_0107574_202_909 231
802 3300035691 Ga0373931_0010417 Ga0373931_0010417_3637_4344 231
803 3300035691 Ga0373931_0054554 Ga0373931_0054554_576_1280 231
804 3300035691 Ga0373931_0067984 Ga0373931_0067984_214_921 231
805 3300035724 Ga0373933_0325216 Ga0373933_0325216_89_796 231
806 3300035724 Ga0373933_0479462 Ga0373933_0479462_38_745 231
807 3300035725 Ga0373947_0056371 Ga0373947_0056371_845_1552 231
808 3300036401 Ga0373937_0121007 Ga0373937_0121007_67_774 231
809 3300036401 Ga0373937_0230640 Ga0373937_0230640_139_843 231
810 3300036401 Ga0373937_0298647 Ga0373937_0298647_283_990 231
811 3300036401 Ga0373937_0795541 Ga0373937_0795541_175_882 231
812 3300037068 Ga0373925_0049612 Ga0373925_0049612_975_1682 231
813 3300037068 Ga0373925_0146349 Ga0373925_0146349_533_1240 231
814 3300037068 Ga0373925_0296252 Ga0373925_0296252_555_1262 231
815 3300039437 Ga0436365_1133449 Ga0436365_1133449_1056_1760 231
816 3300041404 Ga0439436_0027609 Ga0439436_0027609_122_829 231
817 3300041997 Ga0439431_0033613 Ga0439431_0033613_178_882 231
818 3300041999 Ga0439433_0056506 Ga0439433_0056506_135_839 231
819 3300042007 Ga0439449_0073224 Ga0439449_0073224_471_1175 231
820 3300042008 Ga0439450_011567 Ga0439450_011567_27_731 231
821 3300042125 Ga0450923_003629 Ga0450923_003629_1241_1945 231
822 3300042156 Ga0439446_0032896 Ga0439446_0032896_260_964 231
823 3300042156 Ga0439446_0041694 Ga0439446_0041694_162_866 231
824 3300042439 Ga0439464_0031586 Ga0439464_0031586_436_1140 231
825 3300042439 Ga0439464_0102316 Ga0439464_0102316_62_766 231
826 3300042532 Ga0450893_0011972 Ga0450893_0011972_362_1066 231
827 3300042876 Ga0451577_0328861 Ga0451577_0328861_519_1220 231
828 3300042876 Ga0451577_0674870 Ga0451577_0674870_88_795 231
829 3300044673 Ga0453683_0381884 Ga0453683_0381884_62_769 231
830 3300044712 Ga0453684_0024329 Ga0453684_0024329_6257_6958 231
831 3300045051 Ga0451576_0009891 Ga0451576_0009891_4446_5153 231
832 3300045051 Ga0451576_0275906 Ga0451576_0275906_772_1476 231
833 3300045051 Ga0451576_0586042 Ga0451576_0586042_32_736 231
834 3300045051 Ga0451576_0808552 Ga0451576_0808552_110_805 231
835 3300046454 Ga0495592_0028300 Ga0495592_0028300_2587_3294 231
836 3300046455 Ga0495603_0016917 Ga0495603_0016917_2933_3637 231
837 3300046460 Ga0495638_0170701 Ga0495638_0170701_332_1036 231
838 3300046472 Ga0495580_0015407 Ga0495580_0015407_239_946 231
839 3300046472 Ga0495580_0191064 Ga0495580_0191064_79_783 231
840 3300046473 Ga0495582_0147266 Ga0495582_0147266_531_1238 231
841 3300046511 Ga0495608_0017777 Ga0495608_0017777_2783_3490 231
842 3300046511 Ga0495608_0113728 Ga0495608_0113728_833_1540 231
843 3300046514 Ga0495618_0221069 Ga0495618_0221069_345_1052 231
844 3300046516 Ga0495628_0055499 Ga0495628_0055499_496_1203 231
845 3300046517 Ga0495630_0021767 Ga0495630_0021767_3481_4188 231
846 3300046522 Ga0495643_0073682 Ga0495643_0073682_418_1122 231
847 3300046528 Ga0495642_0096846 Ga0495642_0096846_87_794 231
848 3300046529 Ga0495652_0142327 Ga0495652_0142327_240_947 231
849 3300046535 Ga0495586_0189637 Ga0495586_0189637_384_1091 231
850 3300046536 Ga0495587_0082171 Ga0495587_0082171_877_1584 231
851 3300046536 Ga0495587_0182521 Ga0495587_0182521_389_1096 231
852 3300046539 Ga0495621_0096887 Ga0495621_0096887_352_1056 231
853 3300046543 Ga0495645_0009873 Ga0495645_0009873_4395_5102 231
854 3300046558 Ga0495633_0012872 Ga0495633_0012872_1501_2205 231
855 3300046615 Ga0495656_0180639 Ga0495656_0180639_276_980 231
856 3300046615 Ga0495656_0244875 Ga0495656_0244875_78_782 231
857 3300046642 Ga0495634_0053535 Ga0495634_0053535_547_1254 231
858 3300046663 Ga0495635_0403272 Ga0495635_0403272_63_770 231
859 3300046664 Ga0495659_0007506 Ga0495659_0007506_680_1384 231
860 3300046674 Ga0495588_0080299 Ga0495588_0080299_345_1061 231
861 3300046675 Ga0495657_0280200 Ga0495657_0280200_98_805 231
862 3300046678 Ga0495599_0043040 Ga0495599_0043040_1748_2455 231
863 3300046683 Ga0495658_0147865 Ga0495658_0147865_180_884 231
864 3300046684 Ga0495669_0030390 Ga0495669_0030390_1569_2276 231
865 3300046684 Ga0495669_0111431 Ga0495669_0111431_252_959 231
866 3300046689 Ga0495613_0014914 Ga0495613_0014914_3395_4102 231
867 3300046689 Ga0495613_0083081 Ga0495613_0083081_366_1070 231
868 3300046691 Ga0495670_0115442 Ga0495670_0115442_592_1299 231
869 3300046794 Ga0495589_0248876 Ga0495589_0248876_43_747 231
870 3300047317 Ga0495604_0182373 Ga0495604_0182373_719_1426 231
871 3300047318 Ga0495636_0214872 Ga0495636_0214872_88_795 231
872 3300047319 Ga0495674_0288352 Ga0495674_0288352_106_813 231
873 3300047319 Ga0495674_0622938 Ga0495674_0622938_79_786 231
874 3300047320 Ga0495672_0033778 Ga0495672_0033778_1016_1720 231
875 3300047444 Ga0495675_0123218 Ga0495675_0123218_86_793 231
876 3300047471 Ga0495684_0008118 Ga0495684_0008118_6858_7565 231
877 3300048088 Ga0495602_0061934 Ga0495602_0061934_1171_1878 231
878 3300048088 Ga0495602_0293386 Ga0495602_0293386_81_788 231
879 3300048088 Ga0495602_0415876 Ga0495602_0415876_229_936 231
880 3300048903 Ga0496100_0182592 Ga0496100_0182592_754_1458 231
881 3300048903 Ga0496100_0464573 Ga0496100_0464573_195_902 231
882 3300048904 Ga0496101_0212867 Ga0496101_0212867_762_1469 231
883 3300048904 Ga0496101_0251514 Ga0496101_0251514_483_1187 231
884 3300048905 Ga0496102_0069466 Ga0496102_0069466_1508_2212 231
885 3300048905 Ga0496102_0243158 Ga0496102_0243158_188_895 231
886 3300048905 Ga0496102_0646366 Ga0496102_0646366_38_742 231
887 3300048906 Ga0496103_0363353 Ga0496103_0363353_15_716 231
888 3300048907 Ga0496104_0004897 Ga0496104_0004897_4706_5410 231
889 3300048907 Ga0496104_0095500 Ga0496104_0095500_1084_1791 231
890 3300048907 Ga0496104_0372470 Ga0496104_0372470_336_1043 231
891 3300048909 Ga0496106_0077272 Ga0496106_0077272_823_1530 231
892 3300048910 Ga0496107_0296569 Ga0496107_0296569_207_914 231
893 3300048911 Ga0496108_0000658 Ga0496108_0000658_3491_4195 231
894 3300048911 Ga0496108_0099597 Ga0496108_0099597_193_897 231
895 3300048912 Ga0496109_0011768 Ga0496109_0011768_4966_5670 231
896 3300048912 Ga0496109_0121316 Ga0496109_0121316_994_1698 231
897 3300048912 Ga0496109_0132789 Ga0496109_0132789_855_1562 231
898 3300048912 Ga0496109_0139996 Ga0496109_0139996_959_1663 231
899 3300048912 Ga0496109_0234069 Ga0496109_0234069_600_1304 231
900 3300048912 Ga0496109_0409612 Ga0496109_0409612_482_1186 231
901 3300048912 Ga0496109_0629953 Ga0496109_0629953_109_813 231
902 3300048913 Ga0496110_0033880 Ga0496110_0033880_686_1390 231
903 3300048913 Ga0496110_0046805 Ga0496110_0046805_698_1402 231
904 3300048913 Ga0496110_0274681 Ga0496110_0274681_756_1463 231
905 3300048913 Ga0496110_0511469 Ga0496110_0511469_12_719 231
906 3300048915 Ga0496112_0009883 Ga0496112_0009883_3028_3732 231
907 3300048915 Ga0496112_0073890 Ga0496112_0073890_2052_2759 231
908 3300048915 Ga0496112_0074263 Ga0496112_0074263_1885_2589 231
909 3300048915 Ga0496112_0202732 Ga0496112_0202732_1170_1877 231
910 3300048915 Ga0496112_0320491 Ga0496112_0320491_53_757 231
911 3300048915 Ga0496112_0385448 Ga0496112_0385448_359_1063 231
912 3300048916 Ga0496113_0213031 Ga0496113_0213031_640_1344 231
913 3300048917 Ga0496114_0160689 Ga0496114_0160689_45_752 231
914 3300048917 Ga0496114_0690835 Ga0496114_0690835_69_776 231
915 3300048918 Ga0496115_0060668 Ga0496115_0060668_200_907 231
916 3300049520 Ga0501297_009693 Ga0501297_009693_23_727 231
917 3300049568 Ga0501031_0147439 Ga0501031_0147439_476_1180 231
918 3300049569 Ga0501032_0074211 Ga0501032_0074211_1093_1797 231
919 3300049569 Ga0501032_0113711 Ga0501032_0113711_335_1039 231
920 3300049570 Ga0501033_0018683 Ga0501033_0018683_2061_2765 231
921 3300049570 Ga0501033_0074743 Ga0501033_0074743_466_1170 231
922 3300049571 Ga0501034_0037393 Ga0501034_0037393_3074_3778 231
923 3300049571 Ga0501034_0071835 Ga0501034_0071835_549_1253 231
924 3300049571 Ga0501034_0072478 Ga0501034_0072478_2710_3417 231
925 3300049571 Ga0501034_0140910 Ga0501034_0140910_740_1447 231
926 3300049571 Ga0501034_0250752 Ga0501034_0250752_483_1187 231
927 3300049571 Ga0501034_0259060 Ga0501034_0259060_787_1491 231
928 3300049572 Ga0501036_0089317 Ga0501036_0089317_317_1021 231
929 3300049572 Ga0501036_0142435 Ga0501036_0142435_841_1545 231
930 3300049572 Ga0501036_0353765 Ga0501036_0353765_125_829 231
931 3300049573 Ga0501037_0074291 Ga0501037_0074291_1750_2454 231
932 3300049573 Ga0501037_0117625 Ga0501037_0117625_177_881 231
933 3300049574 Ga0501038_0190899 Ga0501038_0190899_738_1442 231
934 3300049574 Ga0501038_0224718 Ga0501038_0224718_448_1152 231
935 3300049574 Ga0501038_0387895 Ga0501038_0387895_166_870 231
936 3300049575 Ga0501039_0128245 Ga0501039_0128245_1139_1843 231
937 3300049575 Ga0501039_0449037 Ga0501039_0449037_180_884 231
938 3300049576 Ga0501040_0133727 Ga0501040_0133727_527_1231 231
939 3300049577 Ga0501041_0055825 Ga0501041_0055825_937_1641 231
940 3300049578 Ga0501042_0054369 Ga0501042_0054369_926_1630 231
941 3300049578 Ga0501042_0173385 Ga0501042_0173385_128_832 231
942 3300049578 Ga0501042_0275046 Ga0501042_0275046_286_990 231
943 3300049579 Ga0501043_0027314 Ga0501043_0027314_705_1409 231
944 3300049579 Ga0501043_0208316 Ga0501043_0208316_462_1166 231
945 3300049579 Ga0501043_0367696 Ga0501043_0367696_284_988 231
946 3300049580 Ga0501046_0018619 Ga0501046_0018619_1115_1819 231
947 3300049580 Ga0501046_0058667 Ga0501046_0058667_724_1428 231
948 3300049580 Ga0501046_0078328 Ga0501046_0078328_582_1286 231
949 3300049580 Ga0501046_0202015 Ga0501046_0202015_358_1062 231
950 3300049581 Ga0501047_0025147 Ga0501047_0025147_1143_1847 231
951 3300049581 Ga0501047_0052430 Ga0501047_0052430_1467_2174 231
952 3300049581 Ga0501047_0064532 Ga0501047_0064532_1570_2274 231
953 3300049581 Ga0501047_0086071 Ga0501047_0086071_1691_2566 231
954 3300049582 Ga0501048_0026794 Ga0501048_0026794_526_1230 231
955 3300049582 Ga0501048_0033526 Ga0501048_0033526_1323_2027 231
956 3300049582 Ga0501048_0140230 Ga0501048_0140230_528_1232 231
957 3300049583 Ga0501067_0006917 Ga0501067_0006917_3386_4090 231
958 3300049583 Ga0501067_0068438 Ga0501067_0068438_685_1389 231
959 3300049583 Ga0501067_0115584 Ga0501067_0115584_193_897 231
960 3300049583 Ga0501067_0167051 Ga0501067_0167051_109_813 231
961 3300049584 Ga0501068_0069240 Ga0501068_0069240_260_964 231
962 3300049584 Ga0501068_0072213 Ga0501068_0072213_1127_1831 231
963 3300049584 Ga0501068_0180750 Ga0501068_0180750_478_1182 231
964 3300049585 Ga0501069_0005228 Ga0501069_0005228_3339_4043 231
965 3300049585 Ga0501069_0045955 Ga0501069_0045955_1260_1964 231
966 3300049585 Ga0501069_0301657 Ga0501069_0301657_135_839 231
967 3300049586 Ga0501070_0013474 Ga0501070_0013474_4917_5621 231
968 3300049586 Ga0501070_0100061 Ga0501070_0100061_450_1154 231
969 3300049586 Ga0501070_0556823 Ga0501070_0556823_200_904 231
970 3300049587 Ga0501071_0027667 Ga0501071_0027667_2106_2810 231
971 3300049587 Ga0501071_0210170 Ga0501071_0210170_602_1306 231
972 3300049587 Ga0501071_0558170 Ga0501071_0558170_20_727 231
973 3300049588 Ga0501072_0242205 Ga0501072_0242205_196_900 231
974 3300049589 Ga0501073_0027272 Ga0501073_0027272_2983_3687 231
975 3300049589 Ga0501073_0301994 Ga0501073_0301994_20_727 231
976 3300049590 Ga0501074_0022318 Ga0501074_0022318_2975_3679 231
977 3300049590 Ga0501074_0046591 Ga0501074_0046591_1146_1850 231
978 3300049590 Ga0501074_0074785 Ga0501074_0074785_1448_2152 231
979 3300049591 Ga0501075_0086770 Ga0501075_0086770_194_898 231
980 3300049591 Ga0501075_0316002 Ga0501075_0316002_44_748 231
981 3300049591 Ga0501075_0375192 Ga0501075_0375192_86_790 231
982 3300049592 Ga0501076_0034815 Ga0501076_0034815_1863_2567 231
983 3300049592 Ga0501076_0058187 Ga0501076_0058187_1438_2142 231
984 3300049592 Ga0501076_0075602 Ga0501076_0075602_1709_2413 231
985 3300049593 Ga0501077_0135947 Ga0501077_0135947_519_1223 231
986 3300049593 Ga0501077_0213136 Ga0501077_0213136_59_766 231
987 3300049593 Ga0501077_0218782 Ga0501077_0218782_210_914 231
988 3300049741 Ga0501079_0017412 Ga0501079_0017412_3503_4207 231
989 3300049741 Ga0501079_0049715 Ga0501079_0049715_1529_2233 231
990 3300049741 Ga0501079_0252649 Ga0501079_0252649_30_734 231
991 3300049742 Ga0501080_0214485 Ga0501080_0214485_712_1416 231
992 3300049742 Ga0501080_0237012 Ga0501080_0237012_757_1461 231
993 3300049742 Ga0501080_0260097 Ga0501080_0260097_478_1182 231
994 3300049742 Ga0501080_0657211 Ga0501080_0657211_120_824 231
995 3300049743 Ga0501081_0109942 Ga0501081_0109942_508_1212 231
996 3300049743 Ga0501081_0112059 Ga0501081_0112059_534_1241 231
997 3300049744 Ga0501083_0022768 Ga0501083_0022768_1226_1930 231
998 3300049744 Ga0501083_0041524 Ga0501083_0041524_1146_1850 231
999 3300049744 Ga0501083_0164071 Ga0501083_0164071_488_1192 231
1000 3300049744 Ga0501083_0254237 Ga0501083_0254237_293_997 231
1001 3300049822 Ga0501035_0042303 Ga0501035_0042303_3006_3710 231
1002 3300049822 Ga0501035_0223589 Ga0501035_0223589_615_1319 231
1003 3300049822 Ga0501035_0243448 Ga0501035_0243448_477_1181 231
1004 3300049823 Ga0501044_0021080 Ga0501044_0021080_626_1330 231
1005 3300049823 Ga0501044_0029768 Ga0501044_0029768_3840_4544 231
1006 3300049823 Ga0501044_0142201 Ga0501044_0142201_467_1171 231
1007 3300049823 Ga0501044_0205449 Ga0501044_0205449_452_1156 231
1008 3300049823 Ga0501044_0354059 Ga0501044_0354059_537_1244 231
1009 3300049823 Ga0501044_0461503 Ga0501044_0461503_20_724 231
1010 3300049824 Ga0501045_0042915 Ga0501045_0042915_808_1512 231
1011 3300049824 Ga0501045_0086150 Ga0501045_0086150_1368_2072 231
1012 3300049824 Ga0501045_0372966 Ga0501045_0372966_291_995 231
1013 3300049824 Ga0501045_0410113 Ga0501045_0410113_167_871 231
1014 3300050491 nmdc:mga00v17_64576_c1 nmdc:mga00v17_64576_c1_952_1656 231
1015 3300050494 nmdc:mga06z11_31694_c1 nmdc:mga06z11_31694_c1_1594_2298 231
1016 3300050494 nmdc:mga06z11_94303_c1 nmdc:mga06z11_94303_c1_432_1136 231
1017 3300050495 nmdc:mga04h51_20005_c1 nmdc:mga04h51_20005_c1_857_1561 231
1018 3300050507 nmdc:mga05p37_120124_c1 nmdc:mga05p37_120124_c1_1393_2100 231
1019 3300050507 nmdc:mga05p37_146498_c1 nmdc:mga05p37_146498_c1_689_1396 231
1020 3300050507 nmdc:mga05p37_167051_c1 nmdc:mga05p37_167051_c1_1767_2474 231
1021 3300050507 nmdc:mga05p37_19272_c1 nmdc:mga05p37_19272_c1_3998_4702 231
1022 3300050507 nmdc:mga05p37_1991_c1 nmdc:mga05p37_1991_c1_4930_5634 231
1023 3300050507 nmdc:mga05p37_24767_c1 nmdc:mga05p37_24767_c1_3096_3803 231
1024 3300050507 nmdc:mga05p37_295663_c1 nmdc:mga05p37_295663_c1_861_1568 231
1025 3300050507 nmdc:mga05p37_43028_c1 nmdc:mga05p37_43028_c1_2235_2939 231
1026 3300050507 nmdc:mga05p37_433650_c1 nmdc:mga05p37_433650_c1_672_1376 231
1027 3300050507 nmdc:mga05p37_44395_c1 nmdc:mga05p37_44395_c1_1640_2335 231
1028 3300050507 nmdc:mga05p37_52287_c1 nmdc:mga05p37_52287_c1_2779_3486 231
1029 3300050507 nmdc:mga05p37_59927_c1 nmdc:mga05p37_59927_c1_2692_3399 231
1030 3300050507 nmdc:mga05p37_64450_c1 nmdc:mga05p37_64450_c1_1026_1733 231
1031 3300050507 nmdc:mga05p37_69189_c1 nmdc:mga05p37_69189_c1_1896_2600 231
1032 3300050507 nmdc:mga05p37_833607_c1 nmdc:mga05p37_833607_c1_157_861 231
1033 3300050508 nmdc:mga09592_125191_c1 nmdc:mga09592_125191_c1_251_958 231
1034 3300050508 nmdc:mga09592_130065_c1 nmdc:mga09592_130065_c1_1367_2074 231
1035 3300050508 nmdc:mga09592_34324_c1 nmdc:mga09592_34324_c1_73_768 231
1036 3300050508 nmdc:mga09592_43035_c1 nmdc:mga09592_43035_c1_444_1148 231
1037 3300050509 nmdc:mga0qj67_29761_c1 nmdc:mga0qj67_29761_c1_1857_2561 231
1038 3300050509 nmdc:mga0qj67_33544_c1 nmdc:mga0qj67_33544_c1_1823_2518 231
1039 3300050509 nmdc:mga0qj67_437915_c1 nmdc:mga0qj67_437915_c1_271_975 231
1040 3300050510 nmdc:mga06r32_131021_c1 nmdc:mga06r32_131021_c1_1353_2057 231
1041 3300050510 nmdc:mga06r32_249618_c1 nmdc:mga06r32_249618_c1_165_869 231
1042 3300050510 nmdc:mga06r32_29409_c1 nmdc:mga06r32_29409_c1_2095_2799 231
1043 3300050510 nmdc:mga06r32_356837_c1 nmdc:mga06r32_356837_c1_116_823 231
1044 3300050510 nmdc:mga06r32_373571_c1 nmdc:mga06r32_373571_c1_35_739 231
1045 3300050510 nmdc:mga06r32_44234_c1 nmdc:mga06r32_44234_c1_2722_3426 231
1046 3300050510 nmdc:mga06r32_48449_c1 nmdc:mga06r32_48449_c1_817_1521 231
1047 3300050510 nmdc:mga06r32_59131_c1 nmdc:mga06r32_59131_c1_1013_1720 231
1048 3300050510 nmdc:mga06r32_661759_c1 nmdc:mga06r32_661759_c1_205_900 231
1049 3300050510 nmdc:mga06r32_9782_c1 nmdc:mga06r32_9782_c1_6344_7039 231
1050 3300050511 nmdc:mga08y16_127224_c1 nmdc:mga08y16_127224_c1_475_1179 231
1051 3300050511 nmdc:mga08y16_196207_c1 nmdc:mga08y16_196207_c1_275_970 231
1052 3300050511 nmdc:mga08y16_29105_c1 nmdc:mga08y16_29105_c1_2519_3223 231
1053 3300050511 nmdc:mga08y16_31371_c1 nmdc:mga08y16_31371_c1_2725_3429 231
1054 3300050511 nmdc:mga08y16_372185_c1 nmdc:mga08y16_372185_c1_440_1147 231
1055 3300050511 nmdc:mga08y16_43775_c1 nmdc:mga08y16_43775_c1_2251_2961 231
1056 3300050511 nmdc:mga08y16_610186_c1 nmdc:mga08y16_610186_c1_164_871 231
1057 3300050511 nmdc:mga08y16_612888_c1 nmdc:mga08y16_612888_c1_79_783 231
1058 3300050511 nmdc:mga08y16_68367_c1 nmdc:mga08y16_68367_c1_1052_1756 231
1059 3300050511 nmdc:mga08y16_8354_c1 nmdc:mga08y16_8354_c1_1867_2574 231
1060 3300050511 nmdc:mga08y16_87298_c1 nmdc:mga08y16_87298_c1_752_1456 231
1061 3300050512 nmdc:mga0n895_11464_c1 nmdc:mga0n895_11464_c1_2599_3303 231
1062 3300050512 nmdc:mga0n895_11831_c1 nmdc:mga0n895_11831_c1_3411_4118 231
1063 3300050512 nmdc:mga0n895_137187_c1 nmdc:mga0n895_137187_c1_1231_1935 231
1064 3300050512 nmdc:mga0n895_21827_c1 nmdc:mga0n895_21827_c1_1816_2523 231
1065 3300050512 nmdc:mga0n895_227_c1 nmdc:mga0n895_227_c1_2272_2979 231
1066 3300050512 nmdc:mga0n895_288504_c1 nmdc:mga0n895_288504_c1_462_1166 231
1067 3300050512 nmdc:mga0n895_35341_c1 nmdc:mga0n895_35341_c1_2459_3163 231
1068 3300050512 nmdc:mga0n895_4474_c1 nmdc:mga0n895_4474_c1_8884_9579 231
1069 3300050512 nmdc:mga0n895_8678_c1 nmdc:mga0n895_8678_c1_3769_4476 231
1070 3300050513 nmdc:mga0rr50_12816_c1 nmdc:mga0rr50_12816_c1_3433_4137 231
1071 3300050513 nmdc:mga0rr50_161712_c1 nmdc:mga0rr50_161712_c1_75_782 231
1072 3300050513 nmdc:mga0rr50_175_c1 nmdc:mga0rr50_175_c1_30856_31563 231
1073 3300050513 nmdc:mga0rr50_328378_c1 nmdc:mga0rr50_328378_c1_284_991 231
1074 3300050513 nmdc:mga0rr50_36190_c1 nmdc:mga0rr50_36190_c1_267_974 231
1075 3300050513 nmdc:mga0rr50_4207_c1 nmdc:mga0rr50_4207_c1_3891_4595 231
1076 3300050513 nmdc:mga0rr50_6399_c1 nmdc:mga0rr50_6399_c1_2807_3514 231
1077 3300050513 nmdc:mga0rr50_750348_c1 nmdc:mga0rr50_750348_c1_97_801 231
1078 3300050513 nmdc:mga0rr50_9834_c1 nmdc:mga0rr50_9834_c1_1466_2173 231
1079 3300050514 nmdc:mga08x19_1177_c1 nmdc:mga08x19_1177_c1_1473_2180 231
1080 3300050514 nmdc:mga08x19_78190_c1 nmdc:mga08x19_78190_c1_711_1418 231
1081 3300050514 nmdc:mga08x19_83427_c1 nmdc:mga08x19_83427_c1_774_1481 231
1082 3300050514 nmdc:mga08x19_97097_c1 nmdc:mga08x19_97097_c1_539_1246 231
1083 3300050515 nmdc:mga0a205_206193_c1 nmdc:mga0a205_206193_c1_704_1408 231
1084 3300050515 nmdc:mga0a205_26771_c1 nmdc:mga0a205_26771_c1_1899_2606 231
1085 3300050515 nmdc:mga0a205_279122_c1 nmdc:mga0a205_279122_c1_623_1327 231
1086 3300053077 Ga0495601_0142718 Ga0495601_0142718_543_1250 231
1087 3300053084 Ga0495595_0060382 Ga0495595_0060382_278_985 231
1088 3300053084 Ga0495595_0089139 Ga0495595_0089139_558_1265 231
1089 3300053085 Ga0495619_0023881 Ga0495619_0023881_483_1190 231
1090 3300053085 Ga0495619_0169987 Ga0495619_0169987_215_922 231
1091 3300053139 Ga0500568_0008697 Ga0500568_0008697_2072_2776 231
1092 3300054114 Ga0501084_0028474 Ga0501084_0028474_804_1508 231
1093 3300054114 Ga0501084_0076124 Ga0501084_0076124_432_1136 231
1094 3300054114 Ga0501084_0650630 Ga0501084_0650630_58_762 231
1095 3300059421 Ga0590071_000639 Ga0590071_000639_7017_7721 231
1096 3300059421 Ga0590071_000996 Ga0590071_000996_777_1481 231
1097 3300059423 Ga0590074_000990 Ga0590074_000990_2074_2778 231
1098 3300059423 Ga0590074_004534 Ga0590074_004534_157_861 231
1099 3300059424 Ga0590075_000405 Ga0590075_000405_7252_7956 231
1100 3300059424 Ga0590075_012446 Ga0590075_012446_119_823 231
1101 3300059426 Ga0590077_000732 Ga0590077_000732_5685_6389 231
1102 3300059426 Ga0590077_006869 Ga0590077_006869_913_1617 231
1103 3300059508 Ga0587088_030624 Ga0587088_030624_22_729 231
1104 3300060353 Ga0501082_0025450 Ga0501082_0025450_2716_3420 231
1105 3300060353 Ga0501082_0299014 Ga0501082_0299014_123_827 231
1106 3300060353 Ga0501082_0325312 Ga0501082_0325312_97_801 231
1107 3300060353 Ga0501082_0640026 Ga0501082_0640026_153_857 231
1108 3300061734 Ga0530510_0727720 Ga0530510_0727720_25_729 231

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00687

Ribosomal_L1

Ribosomal protein L1p/L10e family

60

250

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vpl-assembly1.cif.gz_A the structure of the complex between the first domain of l1 protein from thermus thermophilus and mrna from methanococcus jannaschii 0.9393 5 224
4wpo-assembly1.cif.gz_AC crystal structure of the thermus thermophilus 70s ribosome in complex with elongation factor g in the pre-translocational state 0.936 5 224
5j8b-assembly1.cif.gz_C crystal structure of elongation factor 4 (ef-4/lepa) in complex with gdpcp bound to the thermus thermophilus 70s ribosome 0.921 5 224
4wpo-assembly1.cif.gz_AC crystal structure of the thermus thermophilus 70s ribosome in complex with elongation factor g in the pre-translocational state 0.9163 5 224
2ov7-assembly3.cif.gz_C the first domain of the ribosomal protein l1 from thermus thermophilus 0.9153 12 224
ID Description Score Start End Superfamily
2wrrC01 Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain 0.9395 18 224 3.30.190.20
2wrrC01 Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain 0.8875 18 224 3.30.190.20
af_Q60E59_194_280_3.40.50.790 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Ribosomal protein L1/L10, domain II 0.8731 73 158 3.40.50.790
af_I1L5L1_126_340_3.30.190.20 Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain 0.873 17 231 3.30.190.20
af_I1L5L1_126_340_3.30.190.20 Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain 0.8693 17 231 3.30.190.20
ID Description Score Start End GO Terms
AF-A0A660VFQ9-F1-model_v4 Large ribosomal subunit protein uL1 0.9177 1 224 GO:0000049
GO:0003735
GO:0006412
GO:0006417
GO:0015934
GO:0019843
AF-A0A2H0LTR9-F1-model_v4 Ribosomal protein 0.9122 57 224 GO:0003735
GO:0006412
GO:0006417
GO:0015934
GO:0019843
AF-A0A1F4W0B7-F1-model_v4 Ribosomal protein 0.9047 5 224 GO:0003735
GO:0006412
GO:0006417
GO:0015934
GO:0019843
AF-A0A356KI38-F1-model_v4 Large ribosomal subunit protein uL1 0.9036 2 227 GO:0000049
GO:0003735
GO:0006412
GO:0006417
GO:0015934
GO:0019843
AF-A0A2H0LTR9-F1-model_v4 Ribosomal protein 0.9021 57 224 GO:0003735
GO:0006412
GO:0006417
GO:0015934
GO:0019843

Feature Viewer

pLDDT pTM Quality
78.71 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map