F490192
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1108 | 367 | 1108 | 234 |
Family's Representative Sequence
| Representative Sequence | 3300049581|Ga0501047_0086071|Ga0501047_0086071_1691_2566 |
| Length | 265 |
| Sequence | MKGESPVAVAEVAGKSPNHQISFGPREVNTMRKRGRKYEAARAQVDTDRMYTIEDAIPLVQKVKFAKFDETVELTLRLGVDPKHADQMVRGTVVLPHGLGKTKRVLAIAGGEKQKEAQDAGADFVGGEEVVERIMGGWTDFDAVVATPDMMRAVGRLGKVLGPRGLMPNPKTGTVSTDIRKAVQEIKAGKVEFRVDKTGIIHAPVGKTSFASESLVANAHALVDSIVKAKPAAAKGKYLKSITVSSTMGPGVAVDTMAVDAAVKH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 4 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 5 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 6 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 7 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 8 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 9 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 10 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 11 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 12 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 13 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 60 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 69 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 70 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 71 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 73 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 74 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 75 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 76 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 77 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 78 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 79 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 80 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 81 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 82 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 83 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 84 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 85 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 86 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 87 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 88 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 89 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 90 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 91 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 92 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 93 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 95 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 96 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 97 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 98 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 99 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 100 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 101 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 102 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 103 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 104 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 106 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 107 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 108 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 189 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 190 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 194 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 195 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 196 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 197 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 198 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 199 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 200 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 201 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 202 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 203 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 204 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 205 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 206 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 207 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 208 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 209 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 210 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 211 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 212 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 213 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 214 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 215 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 216 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 217 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 218 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 219 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 220 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 221 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 222 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 223 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 224 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 225 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 226 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 227 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 229 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 230 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 231 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 232 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 233 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 234 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 236 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 237 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 238 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 239 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 240 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 241 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 242 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 243 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 244 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 245 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 246 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 247 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 248 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 249 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 250 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 251 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 252 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 253 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 292 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 293 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 294 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 295 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 296 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 298 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 299 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 300 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 301 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 302 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 303 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 304 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 305 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 339 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 340 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 341 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 342 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 343 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 344 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 357 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 358 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 359 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 360 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 362 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 363 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 364 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 365 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 366 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.92 |
| Metatranscriptomes | 1.08 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.98 |
| Nodule | 0 |
| Rhizoplane | 3.61 |
| Rhizosphere | 93.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.27 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS1b_contig_6987276 | 2162886011 | Bacteria | 1733 |
| 2 | MBSR1b_contig_750255 | 2162886012 | Bacteria | 1962 |
| 3 | JGI24742J22300_10008969 | 3300002244 | Bacteria | 1649 |
| 4 | JGI24751J29686_10002254 | 3300002459 | Bacteria | 3905 |
| 5 | JGI24751J29686_10012467 | 3300002459 | Bacteria | 1754 |
| 6 | Ga0006759J45824_1071695 | 3300003163 | Bacteria | 1892 |
| 7 | Ga0007417J51691_1063962 | 3300003544 | Bacteria | 1840 |
| 8 | Ga0007409J51694_1063287 | 3300003575 | Bacteria | 1867 |
| 9 | Ga0007416J51690_1063111 | 3300003577 | Bacteria | 3208 |
| 10 | Ga0058859_11631144 | 3300004798 | Bacteria | 935 |
| 11 | Ga0058861_12027855 | 3300004800 | Bacteria | 2411 |
| 12 | Ga0058862_10054132 | 3300004803 | Bacteria | 3244 |
| 13 | Ga0065712_10003155 | 3300005290 | Bacteria | 4050 |
| 14 | Ga0065712_10003180 | 3300005290 | Bacteria | 5260 |
| 15 | Ga0065712_10010412 | 3300005290 | Bacteria | 3191 |
| 16 | Ga0065712_10016186 | 3300005290 | Bacteria | 1731 |
| 17 | Ga0065712_10072555 | 3300005290 | Bacteria | 4707 |
| 18 | Ga0065712_10076319 | 3300005290 | Bacteria | 3683 |
| 19 | Ga0065715_10012525 | 3300005293 | Bacteria | 2123 |
| 20 | Ga0065715_10018175 | 3300005293 | Bacteria | 3253 |
| 21 | Ga0065715_10030346 | 3300005293 | Bacteria | 1486 |
| 22 | Ga0065715_10134694 | 3300005293 | Bacteria | 1935 |
| 23 | Ga0065715_10143024 | 3300005293 | Bacteria | 1826 |
| 24 | Ga0065715_10147492 | 3300005293 | Bacteria | 1766 |
| 25 | Ga0065715_10188267 | 3300005293 | Bacteria | 1431 |
| 26 | Ga0065715_10268954 | 3300005293 | Bacteria | 1116 |
| 27 | Ga0065715_10326421 | 3300005293 | Bacteria | 992 |
| 28 | Ga0065715_10427148 | 3300005293 | Bacteria | 851 |
| 29 | Ga0065707_10105294 | 3300005295 | Bacteria | 2651 |
| 30 | Ga0065707_10142628 | 3300005295 | Bacteria | 1753 |
| 31 | Ga0065707_10234509 | 3300005295 | Bacteria | 1177 |
| 32 | Ga0065707_10251684 | 3300005295 | Bacteria | 1123 |
| 33 | Ga0070658_10049558 | 3300005327 | Bacteria | 3402 |
| 34 | Ga0070676_10006877 | 3300005328 | Bacteria | 6091 |
| 35 | Ga0070676_10020758 | 3300005328 | Bacteria | 3672 |
| 36 | Ga0070683_100022502 | 3300005329 | Bacteria | 5633 |
| 37 | Ga0070683_100067471 | 3300005329 | Bacteria | 3332 |
| 38 | Ga0070683_100143037 | 3300005329 | Bacteria | 2266 |
| 39 | Ga0070683_100258581 | 3300005329 | Bacteria | 1656 |
| 40 | Ga0070683_100284898 | 3300005329 | Bacteria | 1572 |
| 41 | Ga0070690_100063688 | 3300005330 | Bacteria | 2380 |
| 42 | Ga0070670_100032636 | 3300005331 | Bacteria | 4485 |
| 43 | Ga0070670_100036649 | 3300005331 | Bacteria | 4220 |
| 44 | Ga0070670_100042782 | 3300005331 | Bacteria | 3895 |
| 45 | Ga0070670_100106489 | 3300005331 | Bacteria | 2416 |
| 46 | Ga0070670_100242385 | 3300005331 | Bacteria | 1570 |
| 47 | Ga0070670_100344019 | 3300005331 | Bacteria | 1309 |
| 48 | Ga0070670_100825900 | 3300005331 | Bacteria | 838 |
| 49 | Ga0068869_100226264 | 3300005334 | Bacteria | 1485 |
| 50 | Ga0068869_100280484 | 3300005334 | Bacteria | 1340 |
| 51 | Ga0068869_100350246 | 3300005334 | Bacteria | 1204 |
| 52 | Ga0070666_10051301 | 3300005335 | Bacteria | 2777 |
| 53 | Ga0070666_10298179 | 3300005335 | Bacteria | 1148 |
| 54 | Ga0070680_100462572 | 3300005336 | Bacteria | 1084 |
| 55 | Ga0070682_100319668 | 3300005337 | Bacteria | 1146 |
| 56 | Ga0068868_100029640 | 3300005338 | Bacteria | 4192 |
| 57 | Ga0068868_100078911 | 3300005338 | Bacteria | 2636 |
| 58 | Ga0068868_100816285 | 3300005338 | Bacteria | 842 |
| 59 | Ga0070660_100021355 | 3300005339 | Bacteria | 4773 |
| 60 | Ga0070660_100281513 | 3300005339 | Bacteria | 1361 |
| 61 | Ga0070689_100010275 | 3300005340 | Bacteria | 6669 |
| 62 | Ga0070689_100035329 | 3300005340 | Bacteria | 3819 |
| 63 | Ga0070689_100178217 | 3300005340 | Bacteria | 1725 |
| 64 | Ga0070689_100461992 | 3300005340 | Bacteria | 1082 |
| 65 | Ga0070691_10021653 | 3300005341 | Bacteria | 2976 |
| 66 | Ga0070687_100010598 | 3300005343 | Bacteria | 3995 |
| 67 | Ga0070687_100058939 | 3300005343 | Bacteria | 2019 |
| 68 | Ga0070687_100269366 | 3300005343 | Bacteria | 1067 |
| 69 | Ga0070687_100429411 | 3300005343 | Bacteria | 874 |
| 70 | Ga0070661_100104558 | 3300005344 | Bacteria | 2110 |
| 71 | Ga0070661_100169352 | 3300005344 | Bacteria | 1658 |
| 72 | Ga0070668_100068984 | 3300005347 | Bacteria | 2749 |
| 73 | Ga0070669_100012125 | 3300005353 | Bacteria | 6117 |
| 74 | Ga0070669_100107040 | 3300005353 | Bacteria | 2118 |
| 75 | Ga0070669_100114726 | 3300005353 | Bacteria | 2048 |
| 76 | Ga0070669_100573711 | 3300005353 | Bacteria | 943 |
| 77 | Ga0070669_100781276 | 3300005353 | Bacteria | 811 |
| 78 | Ga0070675_100003283 | 3300005354 | Bacteria | 12267 |
| 79 | Ga0070675_100058678 | 3300005354 | Bacteria | 3174 |
| 80 | Ga0070675_100058711 | 3300005354 | Bacteria | 3173 |
| 81 | Ga0070675_100069790 | 3300005354 | Bacteria | 2911 |
| 82 | Ga0070675_100141131 | 3300005354 | Bacteria | 2059 |
| 83 | Ga0070675_100280217 | 3300005354 | Bacteria | 1465 |
| 84 | Ga0070675_100337921 | 3300005354 | Bacteria | 1333 |
| 85 | Ga0070675_100616641 | 3300005354 | Bacteria | 985 |
| 86 | Ga0070671_100019573 | 3300005355 | Bacteria | 5511 |
| 87 | Ga0070671_100022293 | 3300005355 | Bacteria | 5172 |
| 88 | Ga0070671_100069061 | 3300005355 | Bacteria | 2947 |
| 89 | Ga0070671_100082165 | 3300005355 | Bacteria | 2694 |
| 90 | Ga0070671_100142650 | 3300005355 | Bacteria | 2021 |
| 91 | Ga0070671_100159531 | 3300005355 | Bacteria | 1906 |
| 92 | Ga0070674_100011938 | 3300005356 | Bacteria | 5312 |
| 93 | Ga0070674_100095868 | 3300005356 | Bacteria | 2151 |
| 94 | Ga0070674_100176591 | 3300005356 | Bacteria | 1632 |
| 95 | Ga0070674_100332866 | 3300005356 | Bacteria | 1221 |
| 96 | Ga0070674_100420077 | 3300005356 | Bacteria | 1097 |
| 97 | Ga0070673_100019034 | 3300005364 | Bacteria | 4924 |
| 98 | Ga0070673_100031948 | 3300005364 | Bacteria | 3957 |
| 99 | Ga0070673_100135160 | 3300005364 | Bacteria | 2074 |
| 100 | Ga0070673_100137927 | 3300005364 | Bacteria | 2055 |
| 101 | Ga0070673_100223833 | 3300005364 | Bacteria | 1629 |
| 102 | Ga0070673_100258329 | 3300005364 | Bacteria | 1521 |
| 103 | Ga0070673_100282747 | 3300005364 | Bacteria | 1455 |
| 104 | Ga0070673_100472307 | 3300005364 | Bacteria | 1131 |
| 105 | Ga0070688_100034074 | 3300005365 | Bacteria | 3081 |
| 106 | Ga0070659_100070503 | 3300005366 | Bacteria | 2777 |
| 107 | Ga0070659_100427545 | 3300005366 | Bacteria | 1121 |
| 108 | Ga0070667_100268327 | 3300005367 | Bacteria | 1530 |
| 109 | Ga0070667_100323696 | 3300005367 | Bacteria | 1391 |
| 110 | Ga0070667_100374965 | 3300005367 | Bacteria | 1292 |
| 111 | Ga0070703_10009170 | 3300005406 | Bacteria | 2791 |
| 112 | Ga0070709_10046224 | 3300005434 | Bacteria | 2706 |
| 113 | Ga0070709_10090197 | 3300005434 | Bacteria | 2020 |
| 114 | Ga0070709_10185255 | 3300005434 | Bacteria | 1465 |
| 115 | Ga0070709_10209858 | 3300005434 | Bacteria | 1384 |
| 116 | Ga0070709_10381645 | 3300005434 | Bacteria | 1048 |
| 117 | Ga0070714_100016727 | 3300005435 | Bacteria | 5930 |
| 118 | Ga0070701_10008026 | 3300005438 | Bacteria | 4540 |
| 119 | Ga0070701_10204590 | 3300005438 | Bacteria | 1169 |
| 120 | Ga0070705_100008577 | 3300005440 | Bacteria | 5063 |
| 121 | Ga0070705_100014714 | 3300005440 | Bacteria | 4032 |
| 122 | Ga0070705_100087692 | 3300005440 | Bacteria | 1930 |
| 123 | Ga0070705_100355430 | 3300005440 | Bacteria | 1070 |
| 124 | Ga0070705_100441458 | 3300005440 | Bacteria | 974 |
| 125 | Ga0070700_100054235 | 3300005441 | Bacteria | 2504 |
| 126 | Ga0070700_100071481 | 3300005441 | Bacteria | 2215 |
| 127 | Ga0070700_100121566 | 3300005441 | Bacteria | 1750 |
| 128 | Ga0070694_100029135 | 3300005444 | Bacteria | 3600 |
| 129 | Ga0070694_100079554 | 3300005444 | Bacteria | 2276 |
| 130 | Ga0070694_100086832 | 3300005444 | Bacteria | 2187 |
| 131 | Ga0070694_100171326 | 3300005444 | Bacteria | 1599 |
| 132 | Ga0070708_100018355 | 3300005445 | Bacteria | 5855 |
| 133 | Ga0070708_100037389 | 3300005445 | Bacteria | 4234 |
| 134 | Ga0070708_100117345 | 3300005445 | Bacteria | 2451 |
| 135 | Ga0070663_100075212 | 3300005455 | Bacteria | 2468 |
| 136 | Ga0070663_100102519 | 3300005455 | Bacteria | 2138 |
| 137 | Ga0070678_100021386 | 3300005456 | Bacteria | 4265 |
| 138 | Ga0070678_100025537 | 3300005456 | Bacteria | 3977 |
| 139 | Ga0070678_100073380 | 3300005456 | Bacteria | 2568 |
| 140 | Ga0070678_100148080 | 3300005456 | Bacteria | 1887 |
| 141 | Ga0070678_100503690 | 3300005456 | Bacteria | 1068 |
| 142 | Ga0070662_100310444 | 3300005457 | Bacteria | 1284 |
| 143 | Ga0070662_100313497 | 3300005457 | Bacteria | 1277 |
| 144 | Ga0070662_100360579 | 3300005457 | Bacteria | 1193 |
| 145 | Ga0070681_10036645 | 3300005458 | Bacteria | 4924 |
| 146 | Ga0070681_10096625 | 3300005458 | Bacteria | 2902 |
| 147 | Ga0068867_100024756 | 3300005459 | Bacteria | 4302 |
| 148 | Ga0068867_100046871 | 3300005459 | Bacteria | 3176 |
| 149 | Ga0070685_10068726 | 3300005466 | Bacteria | 2093 |
| 150 | Ga0070706_100039283 | 3300005467 | Bacteria | 4368 |
| 151 | Ga0070706_100446197 | 3300005467 | Bacteria | 1204 |
| 152 | Ga0070698_100031163 | 3300005471 | Bacteria | 5528 |
| 153 | Ga0070698_100045728 | 3300005471 | Bacteria | 4479 |
| 154 | Ga0070698_100169372 | 3300005471 | Bacteria | 2125 |
| 155 | Ga0070698_100458387 | 3300005471 | Bacteria | 1211 |
| 156 | Ga0070699_100039862 | 3300005518 | Bacteria | 4068 |
| 157 | Ga0070699_100099854 | 3300005518 | Bacteria | 2544 |
| 158 | Ga0070699_100476066 | 3300005518 | Bacteria | 1133 |
| 159 | Ga0070679_100331744 | 3300005530 | Bacteria | 1470 |
| 160 | Ga0070684_100050464 | 3300005535 | Bacteria | 3614 |
| 161 | Ga0070684_100227261 | 3300005535 | Bacteria | 1703 |
| 162 | Ga0070684_100593368 | 3300005535 | Bacteria | 1030 |
| 163 | Ga0070697_100006688 | 3300005536 | Bacteria | 8946 |
| 164 | Ga0070697_100384124 | 3300005536 | Bacteria | 1216 |
| 165 | Ga0068853_100401456 | 3300005539 | Bacteria | 1283 |
| 166 | Ga0068853_100585276 | 3300005539 | Bacteria | 1059 |
| 167 | Ga0070672_100035240 | 3300005543 | Bacteria | 3803 |
| 168 | Ga0070672_100069103 | 3300005543 | Bacteria | 2803 |
| 169 | Ga0070672_100090608 | 3300005543 | Bacteria | 2466 |
| 170 | Ga0070672_100131380 | 3300005543 | Bacteria | 2058 |
| 171 | Ga0070672_100149735 | 3300005543 | Bacteria | 1930 |
| 172 | Ga0070672_100163998 | 3300005543 | Bacteria | 1845 |
| 173 | Ga0070672_100222995 | 3300005543 | Bacteria | 1582 |
| 174 | Ga0070672_100240827 | 3300005543 | Bacteria | 1521 |
| 175 | Ga0070672_100547294 | 3300005543 | Bacteria | 1005 |
| 176 | Ga0070686_100054834 | 3300005544 | Bacteria | 2551 |
| 177 | Ga0070686_100101114 | 3300005544 | Bacteria | 1948 |
| 178 | Ga0070695_100006978 | 3300005545 | Bacteria | 6690 |
| 179 | Ga0070695_100027513 | 3300005545 | Bacteria | 3522 |
| 180 | Ga0070695_100031080 | 3300005545 | Bacteria | 3327 |
| 181 | Ga0070695_100389579 | 3300005545 | Bacteria | 1054 |
| 182 | Ga0070696_100030063 | 3300005546 | Bacteria | 3717 |
| 183 | Ga0070696_100064740 | 3300005546 | Bacteria | 2562 |
| 184 | Ga0070696_100292081 | 3300005546 | Bacteria | 1246 |
| 185 | Ga0070693_100000610 | 3300005547 | Bacteria | 15836 |
| 186 | Ga0070693_100010528 | 3300005547 | Bacteria | 4636 |
| 187 | Ga0070693_100025995 | 3300005547 | Bacteria | 3156 |
| 188 | Ga0070693_100211067 | 3300005547 | Bacteria | 1267 |
| 189 | Ga0070665_100001142 | 3300005548 | Bacteria | 32621 |
| 190 | Ga0070665_100026504 | 3300005548 | Bacteria | 5836 |
| 191 | Ga0070665_100043746 | 3300005548 | Bacteria | 4499 |
| 192 | Ga0070665_100151522 | 3300005548 | Bacteria | 2321 |
| 193 | Ga0070665_100442732 | 3300005548 | Bacteria | 1309 |
| 194 | Ga0070665_100663561 | 3300005548 | Bacteria | 1056 |
| 195 | Ga0070665_100846182 | 3300005548 | Bacteria | 928 |
| 196 | Ga0070704_100002012 | 3300005549 | Bacteria | 11263 |
| 197 | Ga0070704_100022139 | 3300005549 | Bacteria | 4132 |
| 198 | Ga0070704_100036297 | 3300005549 | Bacteria | 3358 |
| 199 | Ga0070704_100038836 | 3300005549 | Bacteria | 3264 |
| 200 | Ga0070704_100085002 | 3300005549 | Bacteria | 2341 |
| 201 | Ga0070704_100191163 | 3300005549 | Bacteria | 1646 |
| 202 | Ga0070704_100299790 | 3300005549 | Bacteria | 1339 |
| 203 | Ga0070704_100429123 | 3300005549 | Bacteria | 1133 |
| 204 | Ga0070664_100000479 | 3300005564 | Bacteria | 30222 |
| 205 | Ga0070664_100023901 | 3300005564 | Bacteria | 5049 |
| 206 | Ga0070664_100345767 | 3300005564 | Bacteria | 1352 |
| 207 | Ga0070664_100369425 | 3300005564 | Bacteria | 1307 |
| 208 | Ga0070664_100801303 | 3300005564 | Bacteria | 881 |
| 209 | Ga0068857_100088906 | 3300005577 | Bacteria | 2764 |
| 210 | Ga0068857_100095854 | 3300005577 | Bacteria | 2659 |
| 211 | Ga0068857_100702700 | 3300005577 | Bacteria | 961 |
| 212 | Ga0068854_100030421 | 3300005578 | Bacteria | 3745 |
| 213 | Ga0068856_100021502 | 3300005614 | Bacteria | 6269 |
| 214 | Ga0070702_100069828 | 3300005615 | Bacteria | 2071 |
| 215 | Ga0070702_100193094 | 3300005615 | Bacteria | 1341 |
| 216 | Ga0068852_100156437 | 3300005616 | Bacteria | 2124 |
| 217 | Ga0068852_100880250 | 3300005616 | Bacteria | 912 |
| 218 | Ga0068859_100051119 | 3300005617 | Bacteria | 4153 |
| 219 | Ga0068859_100052431 | 3300005617 | Bacteria | 4101 |
| 220 | Ga0068859_100058170 | 3300005617 | Bacteria | 3894 |
| 221 | Ga0068859_100060743 | 3300005617 | Bacteria | 3808 |
| 222 | Ga0068859_100097924 | 3300005617 | Bacteria | 2986 |
| 223 | Ga0068859_100116721 | 3300005617 | Bacteria | 2733 |
| 224 | Ga0068859_100143147 | 3300005617 | Bacteria | 2464 |
| 225 | Ga0068864_100020005 | 3300005618 | Bacteria | 5597 |
| 226 | Ga0068864_100021918 | 3300005618 | Bacteria | 5355 |
| 227 | Ga0068864_100041795 | 3300005618 | Bacteria | 3921 |
| 228 | Ga0068864_100103104 | 3300005618 | Bacteria | 2532 |
| 229 | Ga0068864_100340238 | 3300005618 | Bacteria | 1414 |
| 230 | Ga0068866_10029809 | 3300005718 | Bacteria | 2612 |
| 231 | Ga0068866_10141972 | 3300005718 | Bacteria | 1379 |
| 232 | Ga0068861_100037825 | 3300005719 | Bacteria | 3588 |
| 233 | Ga0068861_100075215 | 3300005719 | Bacteria | 2628 |
| 234 | Ga0068861_100276293 | 3300005719 | Bacteria | 1445 |
| 235 | Ga0068861_100280773 | 3300005719 | Bacteria | 1434 |
| 236 | Ga0068851_10180931 | 3300005834 | Bacteria | 1168 |
| 237 | Ga0068870_10018787 | 3300005840 | Bacteria | 3343 |
| 238 | Ga0068863_100002641 | 3300005841 | Bacteria | 17739 |
| 239 | Ga0068863_100101783 | 3300005841 | Bacteria | 2731 |
| 240 | Ga0068863_100314856 | 3300005841 | Bacteria | 1519 |
| 241 | Ga0068863_100448766 | 3300005841 | Bacteria | 1266 |
| 242 | Ga0068858_100003549 | 3300005842 | Bacteria | 15439 |
| 243 | Ga0068858_100108646 | 3300005842 | Bacteria | 2589 |
| 244 | Ga0068858_100179900 | 3300005842 | Bacteria | 1996 |
| 245 | Ga0068860_100031462 | 3300005843 | Bacteria | 5101 |
| 246 | Ga0068860_100110727 | 3300005843 | Bacteria | 2625 |
| 247 | Ga0068860_100146900 | 3300005843 | Bacteria | 2269 |
| 248 | Ga0068860_100168973 | 3300005843 | Bacteria | 2112 |
| 249 | Ga0068860_100308768 | 3300005843 | Bacteria | 1551 |
| 250 | Ga0068860_100528742 | 3300005843 | Bacteria | 1180 |
| 251 | Ga0068862_100037942 | 3300005844 | Bacteria | 4085 |
| 252 | Ga0068862_100038643 | 3300005844 | Bacteria | 4049 |
| 253 | Ga0068862_100119836 | 3300005844 | Bacteria | 2318 |
| 254 | Ga0068862_100463520 | 3300005844 | Bacteria | 1196 |
| 255 | Ga0081455_10052243 | 3300005937 | Bacteria | 3500 |
| 256 | Ga0081455_10062519 | 3300005937 | Bacteria | 3129 |
| 257 | Ga0081540_1071342 | 3300005983 | Bacteria | 1605 |
| 258 | Ga0081539_10004143 | 3300005985 | Bacteria | 16485 |
| 259 | Ga0075368_10010245 | 3300006042 | Bacteria | 3385 |
| 260 | Ga0075363_100035548 | 3300006048 | Bacteria | 2608 |
| 261 | Ga0075364_10473049 | 3300006051 | Bacteria | 856 |
| 262 | Ga0075432_10066499 | 3300006058 | Bacteria | 1290 |
| 263 | Ga0075362_10100835 | 3300006177 | Bacteria | 1350 |
| 264 | Ga0075367_10027582 | 3300006178 | Bacteria | 3232 |
| 265 | Ga0075367_10074056 | 3300006178 | Bacteria | 2053 |
| 266 | Ga0075367_10128678 | 3300006178 | Bacteria | 1564 |
| 267 | Ga0075367_10238896 | 3300006178 | Bacteria | 1138 |
| 268 | Ga0075366_10010873 | 3300006195 | Bacteria | 5121 |
| 269 | Ga0075366_10282549 | 3300006195 | Bacteria | 1014 |
| 270 | Ga0075366_10291189 | 3300006195 | Bacteria | 998 |
| 271 | Ga0097621_100012152 | 3300006237 | Bacteria | 6372 |
| 272 | Ga0097621_100019408 | 3300006237 | Bacteria | 5216 |
| 273 | Ga0097621_100050116 | 3300006237 | Bacteria | 3395 |
| 274 | Ga0097621_100108636 | 3300006237 | Bacteria | 2342 |
| 275 | Ga0097621_100163688 | 3300006237 | Bacteria | 1914 |
| 276 | Ga0097621_100168154 | 3300006237 | Bacteria | 1888 |
| 277 | Ga0075370_10329409 | 3300006353 | Bacteria | 910 |
| 278 | Ga0068871_100016384 | 3300006358 | Bacteria | 5581 |
| 279 | Ga0068871_100089011 | 3300006358 | Bacteria | 2569 |
| 280 | Ga0068871_100358315 | 3300006358 | Bacteria | 1291 |
| 281 | Ga0068871_100871149 | 3300006358 | Bacteria | 833 |
| 282 | Ga0075428_100000017 | 3300006844 | Bacteria | 147833 |
| 283 | Ga0075428_100059187 | 3300006844 | Bacteria | 4195 |
| 284 | Ga0075428_100092394 | 3300006844 | Bacteria | 3299 |
| 285 | Ga0075428_100101880 | 3300006844 | Bacteria | 3130 |
| 286 | Ga0075428_100173346 | 3300006844 | Bacteria | 2337 |
| 287 | Ga0075428_100542217 | 3300006844 | Bacteria | 1244 |
| 288 | Ga0075428_100751183 | 3300006844 | Bacteria | 1038 |
| 289 | Ga0075428_101101983 | 3300006844 | Bacteria | 839 |
| 290 | Ga0075430_100032704 | 3300006846 | Bacteria | 4414 |
| 291 | Ga0075430_100060590 | 3300006846 | Bacteria | 3180 |
| 292 | Ga0075430_100328105 | 3300006846 | Bacteria | 1265 |
| 293 | Ga0075431_100051337 | 3300006847 | Bacteria | 4253 |
| 294 | Ga0075431_100054499 | 3300006847 | Bacteria | 4124 |
| 295 | Ga0075431_100071897 | 3300006847 | Bacteria | 3569 |
| 296 | Ga0075431_100078029 | 3300006847 | Bacteria | 3419 |
| 297 | Ga0075431_100081544 | 3300006847 | Bacteria | 3340 |
| 298 | Ga0075431_100139789 | 3300006847 | Bacteria | 2496 |
| 299 | Ga0075431_100165453 | 3300006847 | Bacteria | 2273 |
| 300 | Ga0075431_100239897 | 3300006847 | Bacteria | 1844 |
| 301 | Ga0075431_100448333 | 3300006847 | Bacteria | 1286 |
| 302 | Ga0075431_100806842 | 3300006847 | Bacteria | 911 |
| 303 | Ga0075433_10146434 | 3300006852 | Bacteria | 2100 |
| 304 | Ga0075433_10299581 | 3300006852 | Bacteria | 1424 |
| 305 | Ga0075434_100008089 | 3300006871 | Bacteria | 9751 |
| 306 | Ga0075434_100023274 | 3300006871 | Bacteria | 6034 |
| 307 | Ga0075434_100030826 | 3300006871 | Bacteria | 5284 |
| 308 | Ga0075434_100049389 | 3300006871 | Bacteria | 4177 |
| 309 | Ga0075434_100052251 | 3300006871 | Bacteria | 4060 |
| 310 | Ga0075434_100120927 | 3300006871 | Bacteria | 2634 |
| 311 | Ga0075434_100163608 | 3300006871 | Bacteria | 2245 |
| 312 | Ga0075434_100323067 | 3300006871 | Bacteria | 1564 |
| 313 | Ga0075434_100458533 | 3300006871 | Bacteria | 1296 |
| 314 | Ga0075429_100022950 | 3300006880 | Bacteria | 5409 |
| 315 | Ga0075429_100061614 | 3300006880 | Bacteria | 3268 |
| 316 | Ga0075429_100161465 | 3300006880 | Bacteria | 1962 |
| 317 | Ga0075429_100249221 | 3300006880 | Bacteria | 1555 |
| 318 | Ga0068865_100167247 | 3300006881 | Bacteria | 1682 |
| 319 | Ga0068865_100254832 | 3300006881 | Bacteria | 1386 |
| 320 | Ga0068865_100342560 | 3300006881 | Bacteria | 1208 |
| 321 | Ga0068865_100568230 | 3300006881 | Bacteria | 954 |
| 322 | Ga0075436_100013829 | 3300006914 | Bacteria | 5527 |
| 323 | Ga0075436_100045093 | 3300006914 | Bacteria | 3041 |
| 324 | Ga0075436_100061898 | 3300006914 | Bacteria | 2586 |
| 325 | Ga0075436_100499804 | 3300006914 | Bacteria | 889 |
| 326 | Ga0097620_100051121 | 3300006931 | Bacteria | 4153 |
| 327 | Ga0097620_100052429 | 3300006931 | Bacteria | 4101 |
| 328 | Ga0097620_100058168 | 3300006931 | Bacteria | 3894 |
| 329 | Ga0097620_100060741 | 3300006931 | Bacteria | 3808 |
| 330 | Ga0097620_100097925 | 3300006931 | Bacteria | 2986 |
| 331 | Ga0097620_100116734 | 3300006931 | Bacteria | 2733 |
| 332 | Ga0097620_100143146 | 3300006931 | Bacteria | 2464 |
| 333 | Ga0075435_100006214 | 3300007076 | Bacteria | 8428 |
| 334 | Ga0075435_100009940 | 3300007076 | Bacteria | 6929 |
| 335 | Ga0075435_100010966 | 3300007076 | Bacteria | 6644 |
| 336 | Ga0075435_100013746 | 3300007076 | Bacteria | 6032 |
| 337 | Ga0075435_100018121 | 3300007076 | Bacteria | 5344 |
| 338 | Ga0075435_100077607 | 3300007076 | Bacteria | 2723 |
| 339 | Ga0075435_100111882 | 3300007076 | Bacteria | 2271 |
| 340 | Ga0075435_100153841 | 3300007076 | Bacteria | 1935 |
| 341 | Ga0075435_100210480 | 3300007076 | Bacteria | 1649 |
| 342 | Ga0075435_100477185 | 3300007076 | Bacteria | 1077 |
| 343 | Ga0099794_10020540 | 3300007265 | Bacteria | 2990 |
| 344 | Ga0099794_10056389 | 3300007265 | Bacteria | 1901 |
| 345 | Ga0099795_10062127 | 3300007788 | Bacteria | 1389 |
| 346 | Ga0105240_10039744 | 3300009093 | Bacteria | 6021 |
| 347 | Ga0105240_10517443 | 3300009093 | Bacteria | 1325 |
| 348 | Ga0105240_10830910 | 3300009093 | Bacteria | 999 |
| 349 | Ga0111539_10000002 | 3300009094 | Bacteria | 983359 |
| 350 | Ga0111539_10050951 | 3300009094 | Bacteria | 4932 |
| 351 | Ga0111539_10070960 | 3300009094 | Bacteria | 4111 |
| 352 | Ga0111539_10071376 | 3300009094 | Bacteria | 4097 |
| 353 | Ga0111539_10083713 | 3300009094 | Bacteria | 3751 |
| 354 | Ga0111539_10162198 | 3300009094 | Bacteria | 2614 |
| 355 | Ga0111539_10175332 | 3300009094 | Bacteria | 2504 |
| 356 | Ga0111539_10454973 | 3300009094 | Bacteria | 1491 |
| 357 | Ga0111539_10518014 | 3300009094 | Bacteria | 1389 |
| 358 | Ga0111539_10569014 | 3300009094 | Bacteria | 1320 |
| 359 | Ga0111539_10590377 | 3300009094 | Bacteria | 1293 |
| 360 | Ga0105245_10475638 | 3300009098 | Bacteria | 1262 |
| 361 | Ga0105247_10015895 | 3300009101 | Bacteria | 4506 |
| 362 | Ga0105247_10338603 | 3300009101 | Bacteria | 1054 |
| 363 | Ga0114129_10001925 | 3300009147 | Bacteria | 28355 |
| 364 | Ga0114129_10037064 | 3300009147 | Bacteria | 6885 |
| 365 | Ga0114129_10057496 | 3300009147 | Bacteria | 5442 |
| 366 | Ga0114129_10082040 | 3300009147 | Bacteria | 4481 |
| 367 | Ga0114129_10083262 | 3300009147 | Bacteria | 4445 |
| 368 | Ga0114129_10088785 | 3300009147 | Bacteria | 4285 |
| 369 | Ga0114129_10089356 | 3300009147 | Bacteria | 4270 |
| 370 | Ga0114129_10090758 | 3300009147 | Bacteria | 4234 |
| 371 | Ga0114129_10124117 | 3300009147 | Bacteria | 3551 |
| 372 | Ga0114129_10175605 | 3300009147 | Bacteria | 2918 |
| 373 | Ga0114129_10218741 | 3300009147 | Bacteria | 2571 |
| 374 | Ga0114129_10319563 | 3300009147 | Bacteria | 2064 |
| 375 | Ga0105243_10043926 | 3300009148 | Bacteria | 3504 |
| 376 | Ga0105243_10063738 | 3300009148 | Bacteria | 2954 |
| 377 | Ga0105243_10723962 | 3300009148 | Bacteria | 973 |
| 378 | Ga0105241_10070577 | 3300009174 | Bacteria | 2711 |
| 379 | Ga0105241_10239476 | 3300009174 | Bacteria | 1533 |
| 380 | Ga0105242_10033180 | 3300009176 | Bacteria | 4133 |
| 381 | Ga0105242_10204657 | 3300009176 | Bacteria | 1755 |
| 382 | Ga0105242_10509381 | 3300009176 | Bacteria | 1146 |
| 383 | Ga0105248_10058749 | 3300009177 | Bacteria | 4319 |
| 384 | Ga0105248_10091410 | 3300009177 | Bacteria | 3428 |
| 385 | Ga0105248_10115515 | 3300009177 | Bacteria | 3027 |
| 386 | Ga0105248_10137242 | 3300009177 | Bacteria | 2759 |
| 387 | Ga0105248_10174972 | 3300009177 | Bacteria | 2419 |
| 388 | Ga0105248_10303600 | 3300009177 | Bacteria | 1797 |
| 389 | Ga0105248_10365917 | 3300009177 | Bacteria | 1623 |
| 390 | Ga0105248_11319378 | 3300009177 | Bacteria | 816 |
| 391 | Ga0105237_10818557 | 3300009545 | Bacteria | 938 |
| 392 | Ga0105238_10213858 | 3300009551 | Bacteria | 1904 |
| 393 | Ga0105238_10518896 | 3300009551 | Bacteria | 1194 |
| 394 | Ga0105249_10047141 | 3300009553 | Bacteria | 3925 |
| 395 | Ga0105249_10432333 | 3300009553 | Bacteria | 1352 |
| 396 | Ga0157369_10199512 | 3300013105 | Bacteria | 2100 |
| 397 | Ga0157374_10070935 | 3300013296 | Bacteria | 3284 |
| 398 | Ga0157374_10196172 | 3300013296 | Bacteria | 1976 |
| 399 | Ga0157374_10278710 | 3300013296 | Bacteria | 1650 |
| 400 | Ga0157378_10000704 | 3300013297 | Bacteria | 31326 |
| 401 | Ga0157378_10111251 | 3300013297 | Bacteria | 2511 |
| 402 | Ga0157378_10122509 | 3300013297 | Bacteria | 2399 |
| 403 | Ga0163162_10012245 | 3300013306 | Bacteria | 8370 |
| 404 | Ga0163162_10055553 | 3300013306 | Bacteria | 3987 |
| 405 | Ga0163162_10082782 | 3300013306 | Bacteria | 3281 |
| 406 | Ga0157375_10224479 | 3300013308 | Bacteria | 2037 |
| 407 | Ga0163163_10019918 | 3300014325 | Bacteria | 6310 |
| 408 | Ga0163163_10034316 | 3300014325 | Bacteria | 4912 |
| 409 | Ga0163163_10238824 | 3300014325 | Bacteria | 1867 |
| 410 | Ga0163163_10513724 | 3300014325 | Bacteria | 1260 |
| 411 | Ga0157380_10090303 | 3300014326 | Bacteria | 2526 |
| 412 | Ga0157380_10213298 | 3300014326 | Bacteria | 1722 |
| 413 | Ga0157380_10493336 | 3300014326 | Bacteria | 1188 |
| 414 | Ga0157380_10960479 | 3300014326 | Bacteria | 885 |
| 415 | Ga0157379_10087694 | 3300014968 | Bacteria | 2790 |
| 416 | Ga0157379_10127107 | 3300014968 | Bacteria | 2294 |
| 417 | Ga0157379_10645930 | 3300014968 | Bacteria | 990 |
| 418 | Ga0157376_10244614 | 3300014969 | Bacteria | 1673 |
| 419 | Ga0157376_10324727 | 3300014969 | Bacteria | 1464 |
| 420 | Ga0157376_10432527 | 3300014969 | Bacteria | 1279 |
| 421 | Ga0157376_10618666 | 3300014969 | Bacteria | 1080 |
| 422 | Ga0207697_10006737 | 3300025315 | Bacteria | 5169 |
| 423 | Ga0207697_10049267 | 3300025315 | Bacteria | 1739 |
| 424 | Ga0207697_10063571 | 3300025315 | Bacteria | 1538 |
| 425 | Ga0207653_10003613 | 3300025885 | Bacteria | 4871 |
| 426 | Ga0207682_10057577 | 3300025893 | Bacteria | 1621 |
| 427 | Ga0207682_10231348 | 3300025893 | Bacteria | 857 |
| 428 | Ga0207642_10114509 | 3300025899 | Bacteria | 1379 |
| 429 | Ga0207710_10073604 | 3300025900 | Bacteria | 1571 |
| 430 | Ga0207710_10263789 | 3300025900 | Bacteria | 864 |
| 431 | Ga0207680_10086181 | 3300025903 | Bacteria | 1985 |
| 432 | Ga0207680_10167783 | 3300025903 | Bacteria | 1476 |
| 433 | Ga0207680_10222653 | 3300025903 | Bacteria | 1294 |
| 434 | Ga0207647_10020837 | 3300025904 | Bacteria | 4388 |
| 435 | Ga0207699_10038979 | 3300025906 | Bacteria | 2727 |
| 436 | Ga0207699_10069863 | 3300025906 | Bacteria | 2143 |
| 437 | Ga0207699_10160286 | 3300025906 | Bacteria | 1497 |
| 438 | Ga0207699_10229896 | 3300025906 | Bacteria | 1270 |
| 439 | Ga0207645_10022529 | 3300025907 | Bacteria | 4097 |
| 440 | Ga0207645_10024118 | 3300025907 | Bacteria | 3947 |
| 441 | Ga0207645_10488157 | 3300025907 | Bacteria | 833 |
| 442 | Ga0207643_10039470 | 3300025908 | Bacteria | 2656 |
| 443 | Ga0207643_10212788 | 3300025908 | Bacteria | 1180 |
| 444 | Ga0207684_10012006 | 3300025910 | Bacteria | 7543 |
| 445 | Ga0207684_10050513 | 3300025910 | Bacteria | 3528 |
| 446 | Ga0207684_10300332 | 3300025910 | Bacteria | 1384 |
| 447 | Ga0207654_10066422 | 3300025911 | Bacteria | 2127 |
| 448 | Ga0207654_10289253 | 3300025911 | Bacteria | 1111 |
| 449 | Ga0207707_10031478 | 3300025912 | Bacteria | 4642 |
| 450 | Ga0207707_10075131 | 3300025912 | Bacteria | 2948 |
| 451 | Ga0207707_10098331 | 3300025912 | Bacteria | 2558 |
| 452 | Ga0207695_10136434 | 3300025913 | Bacteria | 2406 |
| 453 | Ga0207695_10732804 | 3300025913 | Bacteria | 869 |
| 454 | Ga0207663_10133573 | 3300025916 | Bacteria | 1718 |
| 455 | Ga0207663_10302828 | 3300025916 | Bacteria | 1195 |
| 456 | Ga0207660_10399279 | 3300025917 | Bacteria | 1107 |
| 457 | Ga0207662_10045759 | 3300025918 | Bacteria | 2587 |
| 458 | Ga0207662_10115019 | 3300025918 | Bacteria | 1681 |
| 459 | Ga0207662_10121296 | 3300025918 | Bacteria | 1640 |
| 460 | Ga0207657_10083516 | 3300025919 | Bacteria | 2679 |
| 461 | Ga0207649_10238303 | 3300025920 | Bacteria | 1305 |
| 462 | Ga0207649_10288881 | 3300025920 | Bacteria | 1195 |
| 463 | Ga0207646_10096455 | 3300025922 | Bacteria | 2649 |
| 464 | Ga0207646_10432458 | 3300025922 | Bacteria | 1188 |
| 465 | Ga0207681_10099023 | 3300025923 | Bacteria | 2098 |
| 466 | Ga0207681_10171250 | 3300025923 | Bacteria | 1646 |
| 467 | Ga0207681_10225089 | 3300025923 | Bacteria | 1453 |
| 468 | Ga0207681_10271701 | 3300025923 | Bacteria | 1331 |
| 469 | Ga0207681_10321576 | 3300025923 | Bacteria | 1230 |
| 470 | Ga0207681_10341396 | 3300025923 | Bacteria | 1196 |
| 471 | Ga0207694_10602381 | 3300025924 | Bacteria | 924 |
| 472 | Ga0207650_10024531 | 3300025925 | Bacteria | 4288 |
| 473 | Ga0207650_10054709 | 3300025925 | Bacteria | 2961 |
| 474 | Ga0207650_10081604 | 3300025925 | Bacteria | 2453 |
| 475 | Ga0207650_10211568 | 3300025925 | Bacteria | 1557 |
| 476 | Ga0207650_10264885 | 3300025925 | Bacteria | 1395 |
| 477 | Ga0207650_10355854 | 3300025925 | Bacteria | 1205 |
| 478 | Ga0207659_10002281 | 3300025926 | Bacteria | 11427 |
| 479 | Ga0207659_10022090 | 3300025926 | Bacteria | 4233 |
| 480 | Ga0207659_10075534 | 3300025926 | Bacteria | 2473 |
| 481 | Ga0207659_10288692 | 3300025926 | Bacteria | 1343 |
| 482 | Ga0207659_10399579 | 3300025926 | Bacteria | 1149 |
| 483 | Ga0207659_10433300 | 3300025926 | Bacteria | 1105 |
| 484 | Ga0207659_10531041 | 3300025926 | Bacteria | 998 |
| 485 | Ga0207687_10171415 | 3300025927 | Bacteria | 1674 |
| 486 | Ga0207687_10408057 | 3300025927 | Bacteria | 1119 |
| 487 | Ga0207700_10924622 | 3300025928 | Bacteria | 781 |
| 488 | Ga0207664_10024634 | 3300025929 | Bacteria | 4523 |
| 489 | Ga0207664_10296002 | 3300025929 | Bacteria | 1423 |
| 490 | Ga0207644_10006250 | 3300025931 | Bacteria | 7761 |
| 491 | Ga0207644_10013745 | 3300025931 | Bacteria | 5405 |
| 492 | Ga0207644_10066753 | 3300025931 | Bacteria | 2620 |
| 493 | Ga0207644_10135879 | 3300025931 | Bacteria | 1888 |
| 494 | Ga0207644_10157657 | 3300025931 | Bacteria | 1762 |
| 495 | Ga0207644_10247228 | 3300025931 | Bacteria | 1422 |
| 496 | Ga0207644_10261013 | 3300025931 | Bacteria | 1385 |
| 497 | Ga0207644_10496618 | 3300025931 | Bacteria | 1006 |
| 498 | Ga0207706_10061580 | 3300025933 | Bacteria | 3305 |
| 499 | Ga0207706_10077839 | 3300025933 | Bacteria | 2916 |
| 500 | Ga0207686_10026234 | 3300025934 | Bacteria | 3398 |
| 501 | Ga0207686_10042760 | 3300025934 | Bacteria | 2772 |
| 502 | Ga0207686_10382956 | 3300025934 | Bacteria | 1067 |
| 503 | Ga0207709_10057765 | 3300025935 | Bacteria | 2408 |
| 504 | Ga0207709_10130334 | 3300025935 | Bacteria | 1713 |
| 505 | Ga0207670_10032793 | 3300025936 | Bacteria | 3343 |
| 506 | Ga0207670_10070285 | 3300025936 | Bacteria | 2417 |
| 507 | Ga0207670_10077619 | 3300025936 | Bacteria | 2314 |
| 508 | Ga0207670_10208154 | 3300025936 | Bacteria | 1490 |
| 509 | Ga0207669_10097789 | 3300025937 | Bacteria | 1931 |
| 510 | Ga0207669_10128917 | 3300025937 | Bacteria | 1734 |
| 511 | Ga0207669_10196919 | 3300025937 | Bacteria | 1459 |
| 512 | Ga0207669_10294840 | 3300025937 | Bacteria | 1230 |
| 513 | Ga0207669_10316644 | 3300025937 | Bacteria | 1192 |
| 514 | Ga0207669_10503623 | 3300025937 | Bacteria | 969 |
| 515 | Ga0207669_10750250 | 3300025937 | Bacteria | 806 |
| 516 | Ga0207704_10090084 | 3300025938 | Bacteria | 2012 |
| 517 | Ga0207665_10220209 | 3300025939 | Bacteria | 1391 |
| 518 | Ga0207691_10057475 | 3300025940 | Bacteria | 3540 |
| 519 | Ga0207691_10059070 | 3300025940 | Bacteria | 3488 |
| 520 | Ga0207691_10075386 | 3300025940 | Bacteria | 3042 |
| 521 | Ga0207691_10089812 | 3300025940 | Bacteria | 2754 |
| 522 | Ga0207691_10126513 | 3300025940 | Bacteria | 2261 |
| 523 | Ga0207691_10154885 | 3300025940 | Bacteria | 2013 |
| 524 | Ga0207691_10167555 | 3300025940 | Bacteria | 1925 |
| 525 | Ga0207691_10205619 | 3300025940 | Bacteria | 1712 |
| 526 | Ga0207691_10215919 | 3300025940 | Bacteria | 1664 |
| 527 | Ga0207691_10261739 | 3300025940 | Bacteria | 1491 |
| 528 | Ga0207691_10385659 | 3300025940 | Bacteria | 1196 |
| 529 | Ga0207691_10427391 | 3300025940 | Bacteria | 1128 |
| 530 | Ga0207691_10540080 | 3300025940 | Bacteria | 989 |
| 531 | Ga0207711_10046720 | 3300025941 | Bacteria | 3699 |
| 532 | Ga0207711_10060938 | 3300025941 | Bacteria | 3253 |
| 533 | Ga0207711_10127929 | 3300025941 | Bacteria | 2274 |
| 534 | Ga0207711_10140160 | 3300025941 | Bacteria | 2175 |
| 535 | Ga0207711_10159678 | 3300025941 | Bacteria | 2039 |
| 536 | Ga0207711_10276586 | 3300025941 | Bacteria | 1545 |
| 537 | Ga0207711_10744733 | 3300025941 | Bacteria | 913 |
| 538 | Ga0207689_10142740 | 3300025942 | Bacteria | 1973 |
| 539 | Ga0207689_10146058 | 3300025942 | Bacteria | 1949 |
| 540 | Ga0207689_10327625 | 3300025942 | Bacteria | 1271 |
| 541 | Ga0207661_10052153 | 3300025944 | Bacteria | 3267 |
| 542 | Ga0207661_10136329 | 3300025944 | Bacteria | 2108 |
| 543 | Ga0207661_10145992 | 3300025944 | Bacteria | 2041 |
| 544 | Ga0207679_10007830 | 3300025945 | Bacteria | 6789 |
| 545 | Ga0207679_10031159 | 3300025945 | Bacteria | 3731 |
| 546 | Ga0207679_10063554 | 3300025945 | Bacteria | 2756 |
| 547 | Ga0207679_10081867 | 3300025945 | Bacteria | 2470 |
| 548 | Ga0207679_10203418 | 3300025945 | Bacteria | 1655 |
| 549 | Ga0207679_10470877 | 3300025945 | Bacteria | 1117 |
| 550 | Ga0207651_10012876 | 3300025960 | Bacteria | 4756 |
| 551 | Ga0207651_10032332 | 3300025960 | Bacteria | 3359 |
| 552 | Ga0207651_10133750 | 3300025960 | Bacteria | 1903 |
| 553 | Ga0207651_10342075 | 3300025960 | Bacteria | 1257 |
| 554 | Ga0207651_10360489 | 3300025960 | Bacteria | 1227 |
| 555 | Ga0207651_10558974 | 3300025960 | Bacteria | 996 |
| 556 | Ga0207712_10030658 | 3300025961 | Bacteria | 3617 |
| 557 | Ga0207712_10091557 | 3300025961 | Bacteria | 2240 |
| 558 | Ga0207640_10018870 | 3300025981 | Bacteria | 4062 |
| 559 | Ga0207640_10021255 | 3300025981 | Bacteria | 3866 |
| 560 | Ga0207640_10371834 | 3300025981 | Bacteria | 1155 |
| 561 | Ga0207640_10632071 | 3300025981 | Bacteria | 910 |
| 562 | Ga0207658_10057390 | 3300025986 | Bacteria | 2893 |
| 563 | Ga0207658_10064322 | 3300025986 | Bacteria | 2751 |
| 564 | Ga0207658_10125681 | 3300025986 | Bacteria | 2052 |
| 565 | Ga0207658_10308453 | 3300025986 | Bacteria | 1366 |
| 566 | Ga0207677_10063437 | 3300026023 | Bacteria | 2569 |
| 567 | Ga0207677_10101490 | 3300026023 | Bacteria | 2119 |
| 568 | Ga0207677_10130122 | 3300026023 | Bacteria | 1909 |
| 569 | Ga0207677_10668529 | 3300026023 | Bacteria | 918 |
| 570 | Ga0207703_10037322 | 3300026035 | Bacteria | 3870 |
| 571 | Ga0207703_10053472 | 3300026035 | Bacteria | 3282 |
| 572 | Ga0207703_10087961 | 3300026035 | Bacteria | 2606 |
| 573 | Ga0207703_10115187 | 3300026035 | Bacteria | 2300 |
| 574 | Ga0207703_10510384 | 3300026035 | Bacteria | 1129 |
| 575 | Ga0207639_10384205 | 3300026041 | Bacteria | 1261 |
| 576 | Ga0207678_10118278 | 3300026067 | Bacteria | 2261 |
| 577 | Ga0207678_10122540 | 3300026067 | Bacteria | 2218 |
| 578 | Ga0207678_10223804 | 3300026067 | Bacteria | 1611 |
| 579 | Ga0207708_10035399 | 3300026075 | Bacteria | 3800 |
| 580 | Ga0207708_10091673 | 3300026075 | Bacteria | 2344 |
| 581 | Ga0207708_10094953 | 3300026075 | Bacteria | 2303 |
| 582 | Ga0207708_10105780 | 3300026075 | Bacteria | 2181 |
| 583 | Ga0207708_10325494 | 3300026075 | Bacteria | 1255 |
| 584 | Ga0207708_10445131 | 3300026075 | Bacteria | 1078 |
| 585 | Ga0207702_10598141 | 3300026078 | Bacteria | 1082 |
| 586 | Ga0207641_10006730 | 3300026088 | Bacteria | 9631 |
| 587 | Ga0207641_10040192 | 3300026088 | Bacteria | 3915 |
| 588 | Ga0207641_10268257 | 3300026088 | Bacteria | 1601 |
| 589 | Ga0207648_10040419 | 3300026089 | Bacteria | 4098 |
| 590 | Ga0207648_10108973 | 3300026089 | Bacteria | 2431 |
| 591 | Ga0207648_10115354 | 3300026089 | Bacteria | 2360 |
| 592 | Ga0207648_10178924 | 3300026089 | Bacteria | 1876 |
| 593 | Ga0207648_10523384 | 3300026089 | Bacteria | 1087 |
| 594 | Ga0207676_10090307 | 3300026095 | Bacteria | 2513 |
| 595 | Ga0207676_10114833 | 3300026095 | Bacteria | 2259 |
| 596 | Ga0207676_11178537 | 3300026095 | Bacteria | 759 |
| 597 | Ga0207674_10017732 | 3300026116 | Bacteria | 7759 |
| 598 | Ga0207674_10101649 | 3300026116 | Bacteria | 2855 |
| 599 | Ga0207674_10511690 | 3300026116 | Bacteria | 1160 |
| 600 | Ga0207675_100031657 | 3300026118 | Bacteria | 4928 |
| 601 | Ga0207675_100037707 | 3300026118 | Bacteria | 4509 |
| 602 | Ga0207675_100042150 | 3300026118 | Bacteria | 4260 |
| 603 | Ga0207675_100136795 | 3300026118 | Bacteria | 2325 |
| 604 | Ga0207675_100158686 | 3300026118 | Bacteria | 2156 |
| 605 | Ga0207675_100325465 | 3300026118 | Bacteria | 1501 |
| 606 | Ga0207683_10015965 | 3300026121 | Bacteria | 6390 |
| 607 | Ga0207683_10062914 | 3300026121 | Bacteria | 3269 |
| 608 | Ga0207683_10100072 | 3300026121 | Bacteria | 2588 |
| 609 | Ga0207683_10186750 | 3300026121 | Bacteria | 1881 |
| 610 | Ga0207683_10241586 | 3300026121 | Bacteria | 1647 |
| 611 | Ga0207698_10135357 | 3300026142 | Bacteria | 2113 |
| 612 | Ga0207698_10784869 | 3300026142 | Bacteria | 954 |
| 613 | Ga0209588_1014818 | 3300027671 | Bacteria | 2392 |
| 614 | Ga0209588_1019378 | 3300027671 | Bacteria | 2123 |
| 615 | Ga0209813_10037870 | 3300027866 | Bacteria | 1455 |
| 616 | Ga0209813_10050128 | 3300027866 | Bacteria | 1302 |
| 617 | Ga0207428_10000004 | 3300027907 | Bacteria | 727800 |
| 618 | Ga0207428_10018173 | 3300027907 | Bacteria | 6012 |
| 619 | Ga0207428_10021152 | 3300027907 | Bacteria | 5510 |
| 620 | Ga0207428_10037083 | 3300027907 | Bacteria | 3968 |
| 621 | Ga0207428_10047174 | 3300027907 | Bacteria | 3460 |
| 622 | Ga0207428_10062710 | 3300027907 | Bacteria | 2939 |
| 623 | Ga0207428_10071803 | 3300027907 | Bacteria | 2718 |
| 624 | Ga0207428_10073958 | 3300027907 | Bacteria | 2673 |
| 625 | Ga0207428_10152288 | 3300027907 | Bacteria | 1760 |
| 626 | Ga0207428_10329439 | 3300027907 | Bacteria | 1126 |
| 627 | Ga0265354_1000867 | 3300028016 | Bacteria | 4848 |
| 628 | Ga0268266_10006985 | 3300028379 | Bacteria | 10262 |
| 629 | Ga0268266_10139169 | 3300028379 | Bacteria | 2177 |
| 630 | Ga0268266_10285861 | 3300028379 | Bacteria | 1535 |
| 631 | Ga0268266_10437845 | 3300028379 | Bacteria | 1241 |
| 632 | Ga0268266_10684856 | 3300028379 | Bacteria | 988 |
| 633 | Ga0268265_10078111 | 3300028380 | Bacteria | 2602 |
| 634 | Ga0268265_10548436 | 3300028380 | Bacteria | 1097 |
| 635 | Ga0268265_10652652 | 3300028380 | Bacteria | 1011 |
| 636 | Ga0268264_10108239 | 3300028381 | Bacteria | 2429 |
| 637 | Ga0268264_10244329 | 3300028381 | Bacteria | 1664 |
| 638 | Ga0268264_10383910 | 3300028381 | Bacteria | 1346 |
| 639 | Ga0268264_10425538 | 3300028381 | Bacteria | 1281 |
| 640 | Ga0268264_10539066 | 3300028381 | Bacteria | 1143 |
| 641 | Ga0268264_10636739 | 3300028381 | Bacteria | 1054 |
| 642 | Ga0268264_11019828 | 3300028381 | Bacteria | 834 |
| 643 | Ga0265770_1015124 | 3300030878 | Bacteria | 1171 |
| 644 | Ga0265760_10009102 | 3300031090 | Bacteria | 2837 |
| 645 | Ga0265760_10073772 | 3300031090 | Bacteria | 1049 |
| 646 | Ga0307513_10592853 | 3300031456 | Bacteria | 818 |
| 647 | Ga0307408_100015092 | 3300031548 | Bacteria | 5140 |
| 648 | Ga0307408_100056513 | 3300031548 | Bacteria | 2846 |
| 649 | Ga0307408_100069819 | 3300031548 | Bacteria | 2592 |
| 650 | Ga0307408_100177761 | 3300031548 | Bacteria | 1704 |
| 651 | Ga0307408_100212416 | 3300031548 | Bacteria | 1573 |
| 652 | Ga0307408_100220124 | 3300031548 | Bacteria | 1548 |
| 653 | Ga0307408_100258313 | 3300031548 | Bacteria | 1440 |
| 654 | Ga0307405_10132438 | 3300031731 | Bacteria | 1725 |
| 655 | Ga0307405_10160354 | 3300031731 | Bacteria | 1592 |
| 656 | Ga0307405_10176253 | 3300031731 | Bacteria | 1530 |
| 657 | Ga0307413_10035015 | 3300031824 | Bacteria | 2876 |
| 658 | Ga0307413_10052063 | 3300031824 | Bacteria | 2471 |
| 659 | Ga0307413_10765416 | 3300031824 | Bacteria | 808 |
| 660 | Ga0307410_10014184 | 3300031852 | Bacteria | 4679 |
| 661 | Ga0307410_10044243 | 3300031852 | Bacteria | 2956 |
| 662 | Ga0307410_10267751 | 3300031852 | Bacteria | 1335 |
| 663 | Ga0307410_10322649 | 3300031852 | Bacteria | 1226 |
| 664 | Ga0307410_10715375 | 3300031852 | Bacteria | 845 |
| 665 | Ga0307406_10309340 | 3300031901 | Bacteria | 1217 |
| 666 | Ga0307406_10325596 | 3300031901 | Bacteria | 1191 |
| 667 | Ga0307406_10717586 | 3300031901 | Bacteria | 836 |
| 668 | Ga0307407_10006748 | 3300031903 | Bacteria | 5136 |
| 669 | Ga0307407_10107454 | 3300031903 | Bacteria | 1745 |
| 670 | Ga0307412_10106226 | 3300031911 | Bacteria | 1996 |
| 671 | Ga0307412_10108579 | 3300031911 | Bacteria | 1977 |
| 672 | Ga0307412_10124288 | 3300031911 | Bacteria | 1863 |
| 673 | Ga0307412_10140018 | 3300031911 | Bacteria | 1770 |
| 674 | Ga0307412_10199510 | 3300031911 | Bacteria | 1518 |
| 675 | Ga0307409_100008285 | 3300031995 | Bacteria | 6297 |
| 676 | Ga0307409_100032545 | 3300031995 | Bacteria | 3782 |
| 677 | Ga0307409_100109203 | 3300031995 | Bacteria | 2316 |
| 678 | Ga0307409_100148469 | 3300031995 | Bacteria | 2031 |
| 679 | Ga0307409_100297217 | 3300031995 | Bacteria | 1500 |
| 680 | Ga0307409_100302374 | 3300031995 | Bacteria | 1489 |
| 681 | Ga0307416_100009329 | 3300032002 | Bacteria | 6416 |
| 682 | Ga0307416_100016235 | 3300032002 | Bacteria | 5168 |
| 683 | Ga0307416_100023389 | 3300032002 | Bacteria | 4483 |
| 684 | Ga0307416_100071517 | 3300032002 | Bacteria | 2882 |
| 685 | Ga0307416_100081275 | 3300032002 | Bacteria | 2739 |
| 686 | Ga0307416_100196156 | 3300032002 | Bacteria | 1910 |
| 687 | Ga0307416_100343099 | 3300032002 | Bacteria | 1507 |
| 688 | Ga0307416_100409672 | 3300032002 | Bacteria | 1396 |
| 689 | Ga0307416_100453952 | 3300032002 | Bacteria | 1335 |
| 690 | Ga0307416_100642174 | 3300032002 | Bacteria | 1145 |
| 691 | Ga0307416_100684915 | 3300032002 | Bacteria | 1113 |
| 692 | Ga0307416_100771646 | 3300032002 | Bacteria | 1055 |
| 693 | Ga0307414_10031493 | 3300032004 | Bacteria | 3480 |
| 694 | Ga0307414_10224910 | 3300032004 | Bacteria | 1543 |
| 695 | Ga0307414_10382949 | 3300032004 | Bacteria | 1217 |
| 696 | Ga0307414_10859977 | 3300032004 | Bacteria | 830 |
| 697 | Ga0307414_10863805 | 3300032004 | Bacteria | 828 |
| 698 | Ga0307411_10027976 | 3300032005 | Bacteria | 3421 |
| 699 | Ga0307411_10036028 | 3300032005 | Bacteria | 3096 |
| 700 | Ga0307411_10037127 | 3300032005 | Bacteria | 3060 |
| 701 | Ga0307411_10060259 | 3300032005 | Bacteria | 2519 |
| 702 | Ga0307411_10071737 | 3300032005 | Bacteria | 2349 |
| 703 | Ga0307411_10072865 | 3300032005 | Bacteria | 2334 |
| 704 | Ga0307411_10085700 | 3300032005 | Bacteria | 2183 |
| 705 | Ga0307411_10092303 | 3300032005 | Bacteria | 2117 |
| 706 | Ga0307411_10189555 | 3300032005 | Bacteria | 1569 |
| 707 | Ga0307411_10424864 | 3300032005 | Bacteria | 1105 |
| 708 | Ga0307415_100017833 | 3300032126 | Bacteria | 4267 |
| 709 | Ga0307415_100070727 | 3300032126 | Bacteria | 2451 |
| 710 | Ga0373938_0000588 | 3300034957 | Bacteria | 5871 |
| 711 | Ga0373928_0007331 | 3300035084 | Bacteria | 2126 |
| 712 | Ga0373929_0000498 | 3300035085 | Bacteria | 7492 |
| 713 | Ga0373929_0041471 | 3300035085 | Bacteria | 1023 |
| 714 | Ga0373934_0193373 | 3300035086 | Bacteria | 837 |
| 715 | Ga0373940_0001234 | 3300035088 | Bacteria | 4527 |
| 716 | Ga0373949_0001772 | 3300035090 | Bacteria | 5943 |
| 717 | Ga0373951_0000520 | 3300035091 | Bacteria | 10956 |
| 718 | Ga0373951_0074382 | 3300035091 | Bacteria | 870 |
| 719 | Ga0373923_0118330 | 3300035111 | Bacteria | 1182 |
| 720 | Ga0373923_0270722 | 3300035111 | Bacteria | 799 |
| 721 | Ga0373932_0000492 | 3300035112 | Bacteria | 12172 |
| 722 | Ga0373939_0015291 | 3300035114 | Bacteria | 2006 |
| 723 | Ga0373941_0000603 | 3300035115 | Bacteria | 7264 |
| 724 | Ga0373941_0030086 | 3300035115 | Bacteria | 1607 |
| 725 | Ga0373945_0019159 | 3300035116 | Bacteria | 2334 |
| 726 | Ga0373954_0037597 | 3300035118 | Bacteria | 2250 |
| 727 | Ga0373956_0109075 | 3300035119 | Bacteria | 1288 |
| 728 | Ga0373957_0083157 | 3300035120 | Bacteria | 1266 |
| 729 | Ga0373960_0000207 | 3300035121 | Bacteria | 10770 |
| 730 | Ga0373943_0007836 | 3300035170 | Bacteria | 4797 |
| 731 | Ga0373946_0028290 | 3300035171 | Bacteria | 2223 |
| 732 | Ga0373955_0041481 | 3300035172 | Bacteria | 2467 |
| 733 | Ga0373942_0001108 | 3300035207 | Bacteria | 7173 |
| 734 | Ga0373961_0006147 | 3300035241 | Bacteria | 2885 |
| 735 | Ga0373962_0003292 | 3300035242 | Bacteria | 3884 |
| 736 | Ga0373924_0083647 | 3300035410 | Bacteria | 1360 |
| 737 | Ga0373924_0107574 | 3300035410 | Bacteria | 1203 |
| 738 | Ga0373931_0010417 | 3300035691 | Bacteria | 4467 |
| 739 | Ga0373931_0054554 | 3300035691 | Bacteria | 2136 |
| 740 | Ga0373931_0067984 | 3300035691 | Bacteria | 1938 |
| 741 | Ga0373933_0325216 | 3300035724 | Bacteria | 997 |
| 742 | Ga0373933_0479462 | 3300035724 | Bacteria | 814 |
| 743 | Ga0373947_0056371 | 3300035725 | Bacteria | 2375 |
| 744 | Ga0373937_0037988 | 3300036401 | Bacteria | 4389 |
| 745 | Ga0373937_0121007 | 3300036401 | Bacteria | 2439 |
| 746 | Ga0373937_0230640 | 3300036401 | Bacteria | 1744 |
| 747 | Ga0373937_0298647 | 3300036401 | Bacteria | 1522 |
| 748 | Ga0373937_0795541 | 3300036401 | Unclassified | 893 |
| 749 | Ga0373925_0049612 | 3300037068 | Bacteria | 3129 |
| 750 | Ga0373925_0146349 | 3300037068 | Bacteria | 1852 |
| 751 | Ga0373925_0296252 | 3300037068 | Bacteria | 1305 |
| 752 | Ga0436365_1133449 | 3300039437 | Bacteria | 1965 |
| 753 | Ga0439436_0027609 | 3300041404 | Bacteria | 1660 |
| 754 | Ga0439431_0033613 | 3300041997 | Bacteria | 1283 |
| 755 | Ga0439433_0056506 | 3300041999 | Bacteria | 931 |
| 756 | Ga0439449_0073224 | 3300042007 | Bacteria | 1262 |
| 757 | Ga0439450_011567 | 3300042008 | Bacteria | 1732 |
| 758 | Ga0439451_029653 | 3300042009 | Bacteria | 1101 |
| 759 | Ga0439456_057636 | 3300042013 | Bacteria | 852 |
| 760 | Ga0450923_003629 | 3300042125 | Bacteria | 2353 |
| 761 | Ga0450896_002037 | 3300042133 | Bacteria | 2571 |
| 762 | Ga0439446_0032896 | 3300042156 | Bacteria | 1506 |
| 763 | Ga0439446_0041694 | 3300042156 | Bacteria | 1354 |
| 764 | Ga0439464_0031586 | 3300042439 | Bacteria | 1486 |
| 765 | Ga0439464_0102316 | 3300042439 | Bacteria | 871 |
| 766 | Ga0450893_0011972 | 3300042532 | Bacteria | 1437 |
| 767 | Ga0451577_0328861 | 3300042876 | Bacteria | 1386 |
| 768 | Ga0451577_0674870 | 3300042876 | Bacteria | 937 |
| 769 | Ga0453683_0381884 | 3300044673 | Bacteria | 907 |
| 770 | Ga0453684_0024329 | 3300044712 | Bacteria | 8857 |
| 771 | Ga0451576_0009891 | 3300045051 | Bacteria | 11016 |
| 772 | Ga0451576_0275906 | 3300045051 | Bacteria | 1758 |
| 773 | Ga0451576_0586042 | 3300045051 | Bacteria | 1172 |
| 774 | Ga0451576_0808552 | 3300045051 | Bacteria | 984 |
| 775 | Ga0495592_0028300 | 3300046454 | Bacteria | 4245 |
| 776 | Ga0495603_0016917 | 3300046455 | Bacteria | 4413 |
| 777 | Ga0495638_0015590 | 3300046460 | Bacteria | 5102 |
| 778 | Ga0495638_0170701 | 3300046460 | Bacteria | 1248 |
| 779 | Ga0495580_0015407 | 3300046472 | Bacteria | 5766 |
| 780 | Ga0495580_0191064 | 3300046472 | Bacteria | 1412 |
| 781 | Ga0495580_0249190 | 3300046472 | Bacteria | 1216 |
| 782 | Ga0495582_0147266 | 3300046473 | Bacteria | 1336 |
| 783 | Ga0495608_0017777 | 3300046511 | Bacteria | 4916 |
| 784 | Ga0495608_0113728 | 3300046511 | Bacteria | 1739 |
| 785 | Ga0495618_0221069 | 3300046514 | Bacteria | 1195 |
| 786 | Ga0495628_0055499 | 3300046516 | Bacteria | 3121 |
| 787 | Ga0495630_0021767 | 3300046517 | Bacteria | 4735 |
| 788 | Ga0495643_0073682 | 3300046522 | Bacteria | 1789 |
| 789 | Ga0495642_0096846 | 3300046528 | Bacteria | 1253 |
| 790 | Ga0495652_0142327 | 3300046529 | Bacteria | 1885 |
| 791 | Ga0495586_0189637 | 3300046535 | Bacteria | 1164 |
| 792 | Ga0495587_0082171 | 3300046536 | Bacteria | 1867 |
| 793 | Ga0495587_0182521 | 3300046536 | Bacteria | 1189 |
| 794 | Ga0495621_0096887 | 3300046539 | Bacteria | 1118 |
| 795 | Ga0495645_0009873 | 3300046543 | Bacteria | 6681 |
| 796 | Ga0495633_0012872 | 3300046558 | Bacteria | 4429 |
| 797 | Ga0495656_0180639 | 3300046615 | Bacteria | 1037 |
| 798 | Ga0495656_0244875 | 3300046615 | Bacteria | 904 |
| 799 | Ga0495634_0053535 | 3300046642 | Bacteria | 2703 |
| 800 | Ga0495635_0403272 | 3300046663 | Bacteria | 908 |
| 801 | Ga0495659_0007506 | 3300046664 | Bacteria | 3460 |
| 802 | Ga0495588_0080299 | 3300046674 | Bacteria | 1702 |
| 803 | Ga0495657_0280200 | 3300046675 | Bacteria | 998 |
| 804 | Ga0495599_0043040 | 3300046678 | Bacteria | 2834 |
| 805 | Ga0495658_0147865 | 3300046683 | Bacteria | 1441 |
| 806 | Ga0495669_0030390 | 3300046684 | Bacteria | 2372 |
| 807 | Ga0495669_0111431 | 3300046684 | Bacteria | 1278 |
| 808 | Ga0495613_0014914 | 3300046689 | Bacteria | 5767 |
| 809 | Ga0495613_0083081 | 3300046689 | Bacteria | 2326 |
| 810 | Ga0495670_0115442 | 3300046691 | Bacteria | 1392 |
| 811 | Ga0495589_0248876 | 3300046794 | Bacteria | 831 |
| 812 | Ga0495604_0182373 | 3300047317 | Bacteria | 1467 |
| 813 | Ga0495604_0452314 | 3300047317 | Bacteria | 839 |
| 814 | Ga0495636_0214872 | 3300047318 | Bacteria | 881 |
| 815 | Ga0495674_0118370 | 3300047319 | Bacteria | 2240 |
| 816 | Ga0495674_0288352 | 3300047319 | Bacteria | 1343 |
| 817 | Ga0495674_0622938 | 3300047319 | Bacteria | 853 |
| 818 | Ga0495672_0033778 | 3300047320 | Bacteria | 3167 |
| 819 | Ga0495675_0123218 | 3300047444 | Bacteria | 1614 |
| 820 | Ga0495684_0008118 | 3300047471 | Bacteria | 8118 |
| 821 | Ga0495602_0061934 | 3300048088 | Bacteria | 3249 |
| 822 | Ga0495602_0293386 | 3300048088 | Bacteria | 1193 |
| 823 | Ga0495602_0415876 | 3300048088 | Bacteria | 956 |
| 824 | Ga0496100_0182592 | 3300048903 | Bacteria | 1518 |
| 825 | Ga0496100_0464573 | 3300048903 | Bacteria | 972 |
| 826 | Ga0496101_0212867 | 3300048904 | Bacteria | 1498 |
| 827 | Ga0496101_0251514 | 3300048904 | Bacteria | 1377 |
| 828 | Ga0496101_0260201 | 3300048904 | Bacteria | 1353 |
| 829 | Ga0496102_0069466 | 3300048905 | Bacteria | 3233 |
| 830 | Ga0496102_0082744 | 3300048905 | Bacteria | 2961 |
| 831 | Ga0496102_0243158 | 3300048905 | Bacteria | 1697 |
| 832 | Ga0496102_0646366 | 3300048905 | Bacteria | 981 |
| 833 | Ga0496102_0756689 | 3300048905 | Bacteria | 894 |
| 834 | Ga0496103_0363353 | 3300048906 | Bacteria | 931 |
| 835 | Ga0496104_0004897 | 3300048907 | Bacteria | 11678 |
| 836 | Ga0496104_0095500 | 3300048907 | Bacteria | 2844 |
| 837 | Ga0496104_0372470 | 3300048907 | Bacteria | 1341 |
| 838 | Ga0496106_0025726 | 3300048909 | Bacteria | 4381 |
| 839 | Ga0496106_0077272 | 3300048909 | Bacteria | 2553 |
| 840 | Ga0496107_0296569 | 3300048910 | Bacteria | 1203 |
| 841 | Ga0496108_0000658 | 3300048911 | Bacteria | 26635 |
| 842 | Ga0496108_0099597 | 3300048911 | Bacteria | 2478 |
| 843 | Ga0496109_0011768 | 3300048912 | Bacteria | 7529 |
| 844 | Ga0496109_0121316 | 3300048912 | Bacteria | 2436 |
| 845 | Ga0496109_0132789 | 3300048912 | Bacteria | 2325 |
| 846 | Ga0496109_0139996 | 3300048912 | Bacteria | 2262 |
| 847 | Ga0496109_0234069 | 3300048912 | Bacteria | 1729 |
| 848 | Ga0496109_0409612 | 3300048912 | Bacteria | 1281 |
| 849 | Ga0496109_0629953 | 3300048912 | Bacteria | 1009 |
| 850 | Ga0496110_0033880 | 3300048913 | Bacteria | 4420 |
| 851 | Ga0496110_0046805 | 3300048913 | Bacteria | 3785 |
| 852 | Ga0496110_0274681 | 3300048913 | Bacteria | 1534 |
| 853 | Ga0496110_0511469 | 3300048913 | Bacteria | 1093 |
| 854 | Ga0496112_0009883 | 3300048915 | Bacteria | 8625 |
| 855 | Ga0496112_0073890 | 3300048915 | Bacteria | 3370 |
| 856 | Ga0496112_0074263 | 3300048915 | Bacteria | 3362 |
| 857 | Ga0496112_0202732 | 3300048915 | Bacteria | 1942 |
| 858 | Ga0496112_0320491 | 3300048915 | Bacteria | 1494 |
| 859 | Ga0496112_0385448 | 3300048915 | Bacteria | 1342 |
| 860 | Ga0496113_0213031 | 3300048916 | Bacteria | 1538 |
| 861 | Ga0496114_0160689 | 3300048917 | Bacteria | 1953 |
| 862 | Ga0496114_0690835 | 3300048917 | Bacteria | 895 |
| 863 | Ga0496115_0060668 | 3300048918 | Bacteria | 3048 |
| 864 | Ga0501297_009693 | 3300049520 | Bacteria | 1081 |
| 865 | Ga0501324_009773 | 3300049540 | Bacteria | 865 |
| 866 | Ga0501031_0147439 | 3300049568 | Bacteria | 1537 |
| 867 | Ga0501032_0074211 | 3300049569 | Bacteria | 2266 |
| 868 | Ga0501032_0113711 | 3300049569 | Bacteria | 1790 |
| 869 | Ga0501032_0126259 | 3300049569 | Bacteria | 1690 |
| 870 | Ga0501033_0018683 | 3300049570 | Bacteria | 5239 |
| 871 | Ga0501033_0074743 | 3300049570 | Bacteria | 2487 |
| 872 | Ga0501034_0037393 | 3300049571 | Bacteria | 4914 |
| 873 | Ga0501034_0071835 | 3300049571 | Bacteria | 3469 |
| 874 | Ga0501034_0072478 | 3300049571 | Bacteria | 3453 |
| 875 | Ga0501034_0140910 | 3300049571 | Bacteria | 2391 |
| 876 | Ga0501034_0250752 | 3300049571 | Bacteria | 1714 |
| 877 | Ga0501034_0259060 | 3300049571 | Bacteria | 1682 |
| 878 | Ga0501036_0032096 | 3300049572 | Bacteria | 4437 |
| 879 | Ga0501036_0089317 | 3300049572 | Bacteria | 2604 |
| 880 | Ga0501036_0142435 | 3300049572 | Bacteria | 2022 |
| 881 | Ga0501036_0201968 | 3300049572 | Bacteria | 1672 |
| 882 | Ga0501036_0353765 | 3300049572 | Bacteria | 1226 |
| 883 | Ga0501037_0074291 | 3300049573 | Bacteria | 2470 |
| 884 | Ga0501037_0117625 | 3300049573 | Bacteria | 1912 |
| 885 | Ga0501038_0190899 | 3300049574 | Bacteria | 1648 |
| 886 | Ga0501038_0224718 | 3300049574 | Bacteria | 1496 |
| 887 | Ga0501038_0387895 | 3300049574 | Bacteria | 1082 |
| 888 | Ga0501038_0614018 | 3300049574 | Bacteria | 822 |
| 889 | Ga0501039_0035361 | 3300049575 | Bacteria | 3855 |
| 890 | Ga0501039_0128245 | 3300049575 | Bacteria | 1990 |
| 891 | Ga0501039_0449037 | 3300049575 | Bacteria | 1012 |
| 892 | Ga0501040_0013689 | 3300049576 | Bacteria | 5335 |
| 893 | Ga0501040_0133727 | 3300049576 | Bacteria | 1745 |
| 894 | Ga0501041_0030844 | 3300049577 | Bacteria | 3236 |
| 895 | Ga0501041_0055825 | 3300049577 | Bacteria | 2412 |
| 896 | Ga0501042_0054369 | 3300049578 | Bacteria | 2855 |
| 897 | Ga0501042_0173385 | 3300049578 | Bacteria | 1556 |
| 898 | Ga0501042_0275046 | 3300049578 | Bacteria | 1216 |
| 899 | Ga0501043_0027314 | 3300049579 | Bacteria | 4481 |
| 900 | Ga0501043_0208316 | 3300049579 | Bacteria | 1515 |
| 901 | Ga0501043_0367696 | 3300049579 | Bacteria | 1090 |
| 902 | Ga0501046_0002275 | 3300049580 | Bacteria | 18106 |
| 903 | Ga0501046_0018619 | 3300049580 | Bacteria | 5772 |
| 904 | Ga0501046_0058667 | 3300049580 | Bacteria | 3016 |
| 905 | Ga0501046_0078328 | 3300049580 | Bacteria | 2556 |
| 906 | Ga0501046_0202015 | 3300049580 | Bacteria | 1479 |
| 907 | Ga0501046_0424535 | 3300049580 | Bacteria | 958 |
| 908 | Ga0501047_0025147 | 3300049581 | Bacteria | 5720 |
| 909 | Ga0501047_0052430 | 3300049581 | Bacteria | 3943 |
| 910 | Ga0501047_0064532 | 3300049581 | Bacteria | 3532 |
| 911 | Ga0501047_0086071 | 3300049581 | Bacteria | 3020 |
| 912 | Ga0501048_0026794 | 3300049582 | Bacteria | 4195 |
| 913 | Ga0501048_0033526 | 3300049582 | Bacteria | 3709 |
| 914 | Ga0501048_0140230 | 3300049582 | Bacteria | 1709 |
| 915 | Ga0501048_0217979 | 3300049582 | Bacteria | 1353 |
| 916 | Ga0501067_0006917 | 3300049583 | Bacteria | 6294 |
| 917 | Ga0501067_0068438 | 3300049583 | Bacteria | 1965 |
| 918 | Ga0501067_0115584 | 3300049583 | Bacteria | 1492 |
| 919 | Ga0501067_0155966 | 3300049583 | Bacteria | 1272 |
| 920 | Ga0501067_0167051 | 3300049583 | Bacteria | 1225 |
| 921 | Ga0501068_0069240 | 3300049584 | Bacteria | 2151 |
| 922 | Ga0501068_0072213 | 3300049584 | Bacteria | 2107 |
| 923 | Ga0501068_0180750 | 3300049584 | Bacteria | 1333 |
| 924 | Ga0501069_0005228 | 3300049585 | Bacteria | 6745 |
| 925 | Ga0501069_0045955 | 3300049585 | Bacteria | 2420 |
| 926 | Ga0501069_0301657 | 3300049585 | Bacteria | 939 |
| 927 | Ga0501070_0013474 | 3300049586 | Bacteria | 6893 |
| 928 | Ga0501070_0100061 | 3300049586 | Bacteria | 2398 |
| 929 | Ga0501070_0556823 | 3300049586 | Bacteria | 917 |
| 930 | Ga0501071_0018416 | 3300049587 | Bacteria | 4834 |
| 931 | Ga0501071_0027667 | 3300049587 | Bacteria | 3991 |
| 932 | Ga0501071_0068927 | 3300049587 | Bacteria | 2575 |
| 933 | Ga0501071_0210170 | 3300049587 | Bacteria | 1463 |
| 934 | Ga0501071_0558170 | 3300049587 | Bacteria | 880 |
| 935 | Ga0501072_0122132 | 3300049588 | Bacteria | 2075 |
| 936 | Ga0501072_0242205 | 3300049588 | Bacteria | 1436 |
| 937 | Ga0501072_0683916 | 3300049588 | Bacteria | 807 |
| 938 | Ga0501073_0027272 | 3300049589 | Bacteria | 4086 |
| 939 | Ga0501073_0301994 | 3300049589 | Bacteria | 1104 |
| 940 | Ga0501073_0516279 | 3300049589 | Bacteria | 826 |
| 941 | Ga0501074_0022318 | 3300049590 | Bacteria | 4598 |
| 942 | Ga0501074_0046591 | 3300049590 | Bacteria | 3134 |
| 943 | Ga0501074_0074785 | 3300049590 | Bacteria | 2432 |
| 944 | Ga0501075_0001529 | 3300049591 | Bacteria | 15085 |
| 945 | Ga0501075_0086770 | 3300049591 | Bacteria | 2371 |
| 946 | Ga0501075_0145847 | 3300049591 | Bacteria | 1804 |
| 947 | Ga0501075_0316002 | 3300049591 | Bacteria | 1190 |
| 948 | Ga0501075_0375192 | 3300049591 | Bacteria | 1084 |
| 949 | Ga0501076_0002067 | 3300049592 | Bacteria | 13745 |
| 950 | Ga0501076_0034815 | 3300049592 | Bacteria | 3939 |
| 951 | Ga0501076_0046065 | 3300049592 | Bacteria | 3445 |
| 952 | Ga0501076_0058187 | 3300049592 | Bacteria | 3071 |
| 953 | Ga0501076_0075602 | 3300049592 | Bacteria | 2700 |
| 954 | Ga0501077_0135947 | 3300049593 | Bacteria | 1559 |
| 955 | Ga0501077_0213136 | 3300049593 | Bacteria | 1227 |
| 956 | Ga0501077_0218782 | 3300049593 | Bacteria | 1210 |
| 957 | Ga0501079_0001902 | 3300049741 | Bacteria | 14973 |
| 958 | Ga0501079_0017412 | 3300049741 | Bacteria | 5488 |
| 959 | Ga0501079_0049715 | 3300049741 | Bacteria | 3236 |
| 960 | Ga0501079_0252649 | 3300049741 | Bacteria | 1378 |
| 961 | Ga0501080_0197934 | 3300049742 | Bacteria | 1845 |
| 962 | Ga0501080_0214485 | 3300049742 | Bacteria | 1763 |
| 963 | Ga0501080_0237012 | 3300049742 | Bacteria | 1666 |
| 964 | Ga0501080_0260097 | 3300049742 | Bacteria | 1581 |
| 965 | Ga0501080_0657211 | 3300049742 | Bacteria | 927 |
| 966 | Ga0501081_0061259 | 3300049743 | Bacteria | 2609 |
| 967 | Ga0501081_0109942 | 3300049743 | Bacteria | 1956 |
| 968 | Ga0501081_0112059 | 3300049743 | Bacteria | 1937 |
| 969 | Ga0501081_0190602 | 3300049743 | Bacteria | 1485 |
| 970 | Ga0501083_0022768 | 3300049744 | Bacteria | 4347 |
| 971 | Ga0501083_0041524 | 3300049744 | Bacteria | 3119 |
| 972 | Ga0501083_0164071 | 3300049744 | Bacteria | 1452 |
| 973 | Ga0501083_0254237 | 3300049744 | Bacteria | 1143 |
| 974 | Ga0501035_0042303 | 3300049822 | Bacteria | 4109 |
| 975 | Ga0501035_0223589 | 3300049822 | Bacteria | 1606 |
| 976 | Ga0501035_0243448 | 3300049822 | Bacteria | 1529 |
| 977 | Ga0501035_0411067 | 3300049822 | Bacteria | 1124 |
| 978 | Ga0501044_0021080 | 3300049823 | Bacteria | 6957 |
| 979 | Ga0501044_0029768 | 3300049823 | Bacteria | 5756 |
| 980 | Ga0501044_0142201 | 3300049823 | Bacteria | 2387 |
| 981 | Ga0501044_0205449 | 3300049823 | Bacteria | 1926 |
| 982 | Ga0501044_0354059 | 3300049823 | Bacteria | 1387 |
| 983 | Ga0501044_0461503 | 3300049823 | Bacteria | 1175 |
| 984 | Ga0501045_0008126 | 3300049824 | Bacteria | 7308 |
| 985 | Ga0501045_0042915 | 3300049824 | Bacteria | 3292 |
| 986 | Ga0501045_0086150 | 3300049824 | Bacteria | 2319 |
| 987 | Ga0501045_0372966 | 3300049824 | Bacteria | 1062 |
| 988 | Ga0501045_0410113 | 3300049824 | Bacteria | 1008 |
| 989 | nmdc:mga03n38_282840_c1 | 3300050490 | Bacteria | 886 |
| 990 | nmdc:mga00v17_64576_c1 | 3300050491 | Bacteria | 2256 |
| 991 | nmdc:mga00v17_98918_c1 | 3300050491 | Bacteria | 1840 |
| 992 | nmdc:mga0k408_110761_c1 | 3300050493 | Bacteria | 1623 |
| 993 | nmdc:mga0k408_126883_c1 | 3300050493 | Bacteria | 1514 |
| 994 | nmdc:mga0k408_14708_c1 | 3300050493 | Bacteria | 4318 |
| 995 | nmdc:mga0k408_99516_c1 | 3300050493 | Bacteria | 1714 |
| 996 | nmdc:mga06z11_118965_c1 | 3300050494 | Bacteria | 1472 |
| 997 | nmdc:mga06z11_161560_c1 | 3300050494 | Bacteria | 1281 |
| 998 | nmdc:mga06z11_31694_c1 | 3300050494 | Bacteria | 2571 |
| 999 | nmdc:mga06z11_77643_c1 | 3300050494 | Bacteria | 1774 |
| 1000 | nmdc:mga06z11_94303_c1 | 3300050494 | Bacteria | 1631 |
| 1001 | nmdc:mga04h51_20005_c1 | 3300050495 | Bacteria | 1992 |
| 1002 | nmdc:mga04h51_45238_c1 | 3300050495 | Bacteria | 1455 |
| 1003 | nmdc:mga07m45_82966_c1 | 3300050496 | Bacteria | 1831 |
| 1004 | nmdc:mga05p37_120124_c1 | 3300050507 | Bacteria | 3228 |
| 1005 | nmdc:mga05p37_146498_c1 | 3300050507 | Bacteria | 2891 |
| 1006 | nmdc:mga05p37_167051_c1 | 3300050507 | Bacteria | 2685 |
| 1007 | nmdc:mga05p37_19272_c1 | 3300050507 | Bacteria | 8252 |
| 1008 | nmdc:mga05p37_1991_c1 | 3300050507 | Bacteria | 23842 |
| 1009 | nmdc:mga05p37_24767_c1 | 3300050507 | Bacteria | 7295 |
| 1010 | nmdc:mga05p37_295663_c1 | 3300050507 | Bacteria | 1926 |
| 1011 | nmdc:mga05p37_43028_c1 | 3300050507 | Bacteria | 5553 |
| 1012 | nmdc:mga05p37_433650_c1 | 3300050507 | Bacteria | 1526 |
| 1013 | nmdc:mga05p37_44395_c1 | 3300050507 | Bacteria | 5468 |
| 1014 | nmdc:mga05p37_52287_c1 | 3300050507 | Bacteria | 5024 |
| 1015 | nmdc:mga05p37_59927_c1 | 3300050507 | Bacteria | 4687 |
| 1016 | nmdc:mga05p37_64450_c1 | 3300050507 | Bacteria | 4509 |
| 1017 | nmdc:mga05p37_69189_c1 | 3300050507 | Bacteria | 4342 |
| 1018 | nmdc:mga05p37_833607_c1 | 3300050507 | Bacteria | 1004 |
| 1019 | nmdc:mga09592_125191_c1 | 3300050508 | Bacteria | 2209 |
| 1020 | nmdc:mga09592_130065_c1 | 3300050508 | Bacteria | 2166 |
| 1021 | nmdc:mga09592_34324_c1 | 3300050508 | Bacteria | 4240 |
| 1022 | nmdc:mga09592_43035_c1 | 3300050508 | Bacteria | 3800 |
| 1023 | nmdc:mga0qj67_151112_c1 | 3300050509 | Bacteria | 1884 |
| 1024 | nmdc:mga0qj67_29761_c1 | 3300050509 | Bacteria | 4243 |
| 1025 | nmdc:mga0qj67_33544_c1 | 3300050509 | Bacteria | 4006 |
| 1026 | nmdc:mga0qj67_437915_c1 | 3300050509 | Bacteria | 1053 |
| 1027 | nmdc:mga06r32_131021_c1 | 3300050510 | Bacteria | 2480 |
| 1028 | nmdc:mga06r32_249618_c1 | 3300050510 | Bacteria | 1762 |
| 1029 | nmdc:mga06r32_29409_c1 | 3300050510 | Bacteria | 5149 |
| 1030 | nmdc:mga06r32_356837_c1 | 3300050510 | Bacteria | 1446 |
| 1031 | nmdc:mga06r32_373571_c1 | 3300050510 | Bacteria | 1409 |
| 1032 | nmdc:mga06r32_44234_c1 | 3300050510 | Bacteria | 4239 |
| 1033 | nmdc:mga06r32_48449_c1 | 3300050510 | Bacteria | 4061 |
| 1034 | nmdc:mga06r32_59131_c1 | 3300050510 | Bacteria | 3685 |
| 1035 | nmdc:mga06r32_661759_c1 | 3300050510 | Bacteria | 1012 |
| 1036 | nmdc:mga06r32_9782_c1 | 3300050510 | Bacteria | 8657 |
| 1037 | nmdc:mga08y16_127224_c1 | 3300050511 | Bacteria | 2650 |
| 1038 | nmdc:mga08y16_196207_c1 | 3300050511 | Bacteria | 2092 |
| 1039 | nmdc:mga08y16_29105_c1 | 3300050511 | Bacteria | 5822 |
| 1040 | nmdc:mga08y16_2_c1 | 3300050511 | Bacteria | 983367 |
| 1041 | nmdc:mga08y16_31371_c1 | 3300050511 | Bacteria | 5166 |
| 1042 | nmdc:mga08y16_372185_c1 | 3300050511 | Bacteria | 1465 |
| 1043 | nmdc:mga08y16_43775_c1 | 3300050511 | Bacteria | 4692 |
| 1044 | nmdc:mga08y16_610186_c1 | 3300050511 | Bacteria | 1099 |
| 1045 | nmdc:mga08y16_612888_c1 | 3300050511 | Bacteria | 1096 |
| 1046 | nmdc:mga08y16_68367_c1 | 3300050511 | Bacteria | 3704 |
| 1047 | nmdc:mga08y16_76758_c1 | 3300050511 | Bacteria | 3483 |
| 1048 | nmdc:mga08y16_8354_c1 | 3300050511 | Bacteria | 10833 |
| 1049 | nmdc:mga08y16_87298_c1 | 3300050511 | Bacteria | 3250 |
| 1050 | nmdc:mga0n895_11464_c1 | 3300050512 | Bacteria | 7910 |
| 1051 | nmdc:mga0n895_11831_c1 | 3300050512 | Bacteria | 7804 |
| 1052 | nmdc:mga0n895_137187_c1 | 3300050512 | Bacteria | 2473 |
| 1053 | nmdc:mga0n895_21827_c1 | 3300050512 | Bacteria | 5994 |
| 1054 | nmdc:mga0n895_227_c1 | 3300050512 | Bacteria | 35542 |
| 1055 | nmdc:mga0n895_288504_c1 | 3300050512 | Bacteria | 1664 |
| 1056 | nmdc:mga0n895_35341_c1 | 3300050512 | Bacteria | 4817 |
| 1057 | nmdc:mga0n895_4474_c1 | 3300050512 | Bacteria | 11485 |
| 1058 | nmdc:mga0n895_8678_c1 | 3300050512 | Bacteria | 8826 |
| 1059 | nmdc:mga0rr50_12816_c1 | 3300050513 | Bacteria | 5433 |
| 1060 | nmdc:mga0rr50_161712_c1 | 3300050513 | Bacteria | 1818 |
| 1061 | nmdc:mga0rr50_175_c1 | 3300050513 | Bacteria | 34417 |
| 1062 | nmdc:mga0rr50_328378_c1 | 3300050513 | Bacteria | 1284 |
| 1063 | nmdc:mga0rr50_36190_c1 | 3300050513 | Bacteria | 3553 |
| 1064 | nmdc:mga0rr50_4207_c1 | 3300050513 | Bacteria | 8415 |
| 1065 | nmdc:mga0rr50_6399_c1 | 3300050513 | Bacteria | 7165 |
| 1066 | nmdc:mga0rr50_750348_c1 | 3300050513 | Bacteria | 833 |
| 1067 | nmdc:mga0rr50_9834_c1 | 3300050513 | Bacteria | 6041 |
| 1068 | nmdc:mga08x19_1177_c1 | 3300050514 | Bacteria | 16391 |
| 1069 | nmdc:mga08x19_78190_c1 | 3300050514 | Bacteria | 2168 |
| 1070 | nmdc:mga08x19_83427_c1 | 3300050514 | Bacteria | 2101 |
| 1071 | nmdc:mga08x19_97097_c1 | 3300050514 | Bacteria | 1951 |
| 1072 | nmdc:mga0a205_206193_c1 | 3300050515 | Bacteria | 1855 |
| 1073 | nmdc:mga0a205_26771_c1 | 3300050515 | Bacteria | 5503 |
| 1074 | nmdc:mga0a205_279122_c1 | 3300050515 | Bacteria | 1546 |
| 1075 | Ga0495601_0142718 | 3300053077 | Bacteria | 1562 |
| 1076 | Ga0495601_0580165 | 3300053077 | Bacteria | 720 |
| 1077 | Ga0495595_0060382 | 3300053084 | Bacteria | 1774 |
| 1078 | Ga0495595_0089139 | 3300053084 | Bacteria | 1478 |
| 1079 | Ga0495619_0023881 | 3300053085 | Bacteria | 3920 |
| 1080 | Ga0495619_0169987 | 3300053085 | Bacteria | 1507 |
| 1081 | Ga0500592_009690 | 3300053116 | Bacteria | 1532 |
| 1082 | Ga0500628_093471 | 3300053129 | Bacteria | 787 |
| 1083 | Ga0500568_0008697 | 3300053139 | Bacteria | 4871 |
| 1084 | Ga0500645_002436 | 3300053730 | Bacteria | 8287 |
| 1085 | Ga0501084_0013715 | 3300054114 | Bacteria | 6708 |
| 1086 | Ga0501084_0028474 | 3300054114 | Bacteria | 4670 |
| 1087 | Ga0501084_0076124 | 3300054114 | Bacteria | 2812 |
| 1088 | Ga0501084_0199112 | 3300054114 | Bacteria | 1690 |
| 1089 | Ga0501084_0452287 | 3300054114 | Bacteria | 1086 |
| 1090 | Ga0501084_0650630 | 3300054114 | Bacteria | 890 |
| 1091 | Ga0590071_000639 | 3300059421 | Bacteria | 9941 |
| 1092 | Ga0590071_000996 | 3300059421 | Bacteria | 7735 |
| 1093 | Ga0590071_038043 | 3300059421 | Bacteria | 1155 |
| 1094 | Ga0590074_000990 | 3300059423 | Bacteria | 4468 |
| 1095 | Ga0590074_004534 | 3300059423 | Bacteria | 2300 |
| 1096 | Ga0590075_000405 | 3300059424 | Bacteria | 11801 |
| 1097 | Ga0590075_012446 | 3300059424 | Bacteria | 2067 |
| 1098 | Ga0590077_000732 | 3300059426 | Bacteria | 8606 |
| 1099 | Ga0590077_006869 | 3300059426 | Bacteria | 2331 |
| 1100 | Ga0587088_030624 | 3300059508 | Bacteria | 959 |
| 1101 | Ga0501082_0001088 | 3300060353 | Bacteria | 24065 |
| 1102 | Ga0501082_0025450 | 3300060353 | Bacteria | 5099 |
| 1103 | Ga0501082_0299014 | 3300060353 | Bacteria | 1401 |
| 1104 | Ga0501082_0325312 | 3300060353 | Bacteria | 1339 |
| 1105 | Ga0501082_0455563 | 3300060353 | Bacteria | 1118 |
| 1106 | Ga0501082_0640026 | 3300060353 | Bacteria | 930 |
| 1107 | Ga0530510_0024932 | 3300061734 | Bacteria | 4274 |
| 1108 | Ga0530510_0727720 | 3300061734 | Bacteria | 756 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300028379 | Ga0268266_10684856 | Ga0268266_106848561 | 214 |
| 2 | 3300049822 | Ga0501035_0411067 | Ga0501035_0411067_320_973 | 214 |
| 3 | 3300035111 | Ga0373923_0270722 | Ga0373923_0270722_121_783 | 216 |
| 4 | 3300053077 | Ga0495601_0580165 | Ga0495601_0580165_29_691 | 216 |
| 5 | 3300009148 | Ga0105243_10723962 | Ga0105243_107239621 | 217 |
| 6 | 3300049589 | Ga0501073_0516279 | Ga0501073_0516279_146_808 | 217 |
| 7 | 3300053129 | Ga0500628_093471 | Ga0500628_093471_13_675 | 217 |
| 8 | 3300005617 | Ga0068859_100097924 | Ga0068859_1000979244 | 223 |
| 9 | 3300006931 | Ga0097620_100097925 | Ga0097620_1000979254 | 223 |
| 10 | 3300009094 | Ga0111539_10518014 | Ga0111539_105180142 | 223 |
| 11 | 3300047317 | Ga0495604_0452314 | Ga0495604_0452314_60_764 | 223 |
| 12 | 3300050511 | nmdc:mga08y16_76758_c1 | nmdc:mga08y16_76758_c1_2632_3336 | 223 |
| 13 | 3300026095 | Ga0207676_11178537 | Ga0207676_111785371 | 226 |
| 14 | 3300005295 | Ga0065707_10105294 | Ga0065707_101052943 | 227 |
| 15 | 3300005295 | Ga0065707_10251684 | Ga0065707_102516842 | 227 |
| 16 | 3300005331 | Ga0070670_100344019 | Ga0070670_1003440191 | 227 |
| 17 | 3300005340 | Ga0070689_100461992 | Ga0070689_1004619921 | 227 |
| 18 | 3300005353 | Ga0070669_100781276 | Ga0070669_1007812761 | 227 |
| 19 | 3300005354 | Ga0070675_100337921 | Ga0070675_1003379211 | 227 |
| 20 | 3300005356 | Ga0070674_100095868 | Ga0070674_1000958682 | 227 |
| 21 | 3300005356 | Ga0070674_100332866 | Ga0070674_1003328661 | 227 |
| 22 | 3300005364 | Ga0070673_100472307 | Ga0070673_1004723071 | 227 |
| 23 | 3300005440 | Ga0070705_100087692 | Ga0070705_1000876922 | 227 |
| 24 | 3300005444 | Ga0070694_100029135 | Ga0070694_1000291352 | 227 |
| 25 | 3300005467 | Ga0070706_100039283 | Ga0070706_1000392834 | 227 |
| 26 | 3300005543 | Ga0070672_100547294 | Ga0070672_1005472941 | 227 |
| 27 | 3300005577 | Ga0068857_100702700 | Ga0068857_1007027002 | 227 |
| 28 | 3300005617 | Ga0068859_100051119 | Ga0068859_1000511194 | 227 |
| 29 | 3300005618 | Ga0068864_100340238 | Ga0068864_1003402381 | 227 |
| 30 | 3300005719 | Ga0068861_100075215 | Ga0068861_1000752153 | 227 |
| 31 | 3300005843 | Ga0068860_100528742 | Ga0068860_1005287421 | 227 |
| 32 | 3300005844 | Ga0068862_100037942 | Ga0068862_1000379424 | 227 |
| 33 | 3300005844 | Ga0068862_100119836 | Ga0068862_1001198363 | 227 |
| 34 | 3300006844 | Ga0075428_100000017 | Ga0075428_1000000174 | 227 |
| 35 | 3300006931 | Ga0097620_100051121 | Ga0097620_1000511214 | 227 |
| 36 | 3300009094 | Ga0111539_10000002 | Ga0111539_10000002434 | 227 |
| 37 | 3300025910 | Ga0207684_10050513 | Ga0207684_100505134 | 227 |
| 38 | 3300025923 | Ga0207681_10171250 | Ga0207681_101712502 | 227 |
| 39 | 3300025925 | Ga0207650_10264885 | Ga0207650_102648852 | 227 |
| 40 | 3300025926 | Ga0207659_10531041 | Ga0207659_105310411 | 227 |
| 41 | 3300025931 | Ga0207644_10135879 | Ga0207644_101358792 | 227 |
| 42 | 3300025937 | Ga0207669_10128917 | Ga0207669_101289172 | 227 |
| 43 | 3300025937 | Ga0207669_10316644 | Ga0207669_103166442 | 227 |
| 44 | 3300025940 | Ga0207691_10261739 | Ga0207691_102617392 | 227 |
| 45 | 3300025940 | Ga0207691_10385659 | Ga0207691_103856591 | 227 |
| 46 | 3300025960 | Ga0207651_10360489 | Ga0207651_103604891 | 227 |
| 47 | 3300026116 | Ga0207674_10511690 | Ga0207674_105116901 | 227 |
| 48 | 3300026118 | Ga0207675_100042150 | Ga0207675_1000421504 | 227 |
| 49 | 3300026118 | Ga0207675_100136795 | Ga0207675_1001367953 | 227 |
| 50 | 3300027907 | Ga0207428_10000004 | Ga0207428_10000004222 | 227 |
| 51 | 3300028381 | Ga0268264_11019828 | Ga0268264_110198281 | 227 |
| 52 | 3300031824 | Ga0307413_10052063 | Ga0307413_100520632 | 227 |
| 53 | 3300032005 | Ga0307411_10071737 | Ga0307411_100717373 | 227 |
| 54 | 3300042009 | Ga0439451_029653 | Ga0439451_029653_60_755 | 227 |
| 55 | 3300042013 | Ga0439456_057636 | Ga0439456_057636_22_717 | 227 |
| 56 | 3300049569 | Ga0501032_0126259 | Ga0501032_0126259_58_753 | 227 |
| 57 | 3300049572 | Ga0501036_0032096 | Ga0501036_0032096_3082_3777 | 227 |
| 58 | 3300049574 | Ga0501038_0614018 | Ga0501038_0614018_28_723 | 227 |
| 59 | 3300049575 | Ga0501039_0035361 | Ga0501039_0035361_3104_3799 | 227 |
| 60 | 3300049576 | Ga0501040_0013689 | Ga0501040_0013689_28_723 | 227 |
| 61 | 3300049577 | Ga0501041_0030844 | Ga0501041_0030844_1945_2640 | 227 |
| 62 | 3300049580 | Ga0501046_0002275 | Ga0501046_0002275_651_1346 | 227 |
| 63 | 3300049587 | Ga0501071_0018416 | Ga0501071_0018416_2569_3264 | 227 |
| 64 | 3300049591 | Ga0501075_0001529 | Ga0501075_0001529_1879_2574 | 227 |
| 65 | 3300049592 | Ga0501076_0002067 | Ga0501076_0002067_1926_2621 | 227 |
| 66 | 3300049741 | Ga0501079_0001902 | Ga0501079_0001902_13894_14589 | 227 |
| 67 | 3300049742 | Ga0501080_0197934 | Ga0501080_0197934_118_813 | 227 |
| 68 | 3300049743 | Ga0501081_0061259 | Ga0501081_0061259_143_838 | 227 |
| 69 | 3300049824 | Ga0501045_0008126 | Ga0501045_0008126_5536_6231 | 227 |
| 70 | 3300050509 | nmdc:mga0qj67_151112_c1 | nmdc:mga0qj67_151112_c1_183_878 | 227 |
| 71 | 3300050511 | nmdc:mga08y16_2_c1 | nmdc:mga08y16_2_c1_481703_482398 | 227 |
| 72 | 3300054114 | Ga0501084_0013715 | Ga0501084_0013715_2766_3461 | 227 |
| 73 | 3300060353 | Ga0501082_0001088 | Ga0501082_0001088_15695_16390 | 227 |
| 74 | 3300061734 | Ga0530510_0024932 | Ga0530510_0024932_1265_1960 | 227 |
| 75 | 3300003575 | Ga0007409J51694_1063287 | Ga0007409J51694_10632873 | 228 |
| 76 | 3300005331 | Ga0070670_100106489 | Ga0070670_1001064892 | 228 |
| 77 | 3300005334 | Ga0068869_100350246 | Ga0068869_1003502462 | 228 |
| 78 | 3300005338 | Ga0068868_100078911 | Ga0068868_1000789117 | 228 |
| 79 | 3300005353 | Ga0070669_100573711 | Ga0070669_1005737111 | 228 |
| 80 | 3300005354 | Ga0070675_100069790 | Ga0070675_1000697902 | 228 |
| 81 | 3300005355 | Ga0070671_100142650 | Ga0070671_1001426502 | 228 |
| 82 | 3300005356 | Ga0070674_100420077 | Ga0070674_1004200771 | 228 |
| 83 | 3300005364 | Ga0070673_100031948 | Ga0070673_1000319485 | 228 |
| 84 | 3300005406 | Ga0070703_10009170 | Ga0070703_100091704 | 228 |
| 85 | 3300005434 | Ga0070709_10090197 | Ga0070709_100901972 | 228 |
| 86 | 3300005434 | Ga0070709_10209858 | Ga0070709_102098582 | 228 |
| 87 | 3300005440 | Ga0070705_100008577 | Ga0070705_1000085774 | 228 |
| 88 | 3300005440 | Ga0070705_100441458 | Ga0070705_1004414581 | 228 |
| 89 | 3300005445 | Ga0070708_100018355 | Ga0070708_1000183557 | 228 |
| 90 | 3300005445 | Ga0070708_100117345 | Ga0070708_1001173453 | 228 |
| 91 | 3300005456 | Ga0070678_100073380 | Ga0070678_1000733804 | 228 |
| 92 | 3300005457 | Ga0070662_100360579 | Ga0070662_1003605791 | 228 |
| 93 | 3300005458 | Ga0070681_10096625 | Ga0070681_100966253 | 228 |
| 94 | 3300005467 | Ga0070706_100446197 | Ga0070706_1004461971 | 228 |
| 95 | 3300005518 | Ga0070699_100099854 | Ga0070699_1000998541 | 228 |
| 96 | 3300005518 | Ga0070699_100476066 | Ga0070699_1004760661 | 228 |
| 97 | 3300005536 | Ga0070697_100006688 | Ga0070697_1000066885 | 228 |
| 98 | 3300005536 | Ga0070697_100384124 | Ga0070697_1003841242 | 228 |
| 99 | 3300005543 | Ga0070672_100069103 | Ga0070672_1000691035 | 228 |
| 100 | 3300005545 | Ga0070695_100006978 | Ga0070695_1000069787 | 228 |
| 101 | 3300005545 | Ga0070695_100389579 | Ga0070695_1003895791 | 228 |
| 102 | 3300005546 | Ga0070696_100030063 | Ga0070696_1000300634 | 228 |
| 103 | 3300005546 | Ga0070696_100064740 | Ga0070696_1000647404 | 228 |
| 104 | 3300005547 | Ga0070693_100000610 | Ga0070693_1000006107 | 228 |
| 105 | 3300005548 | Ga0070665_100026504 | Ga0070665_10002650412 | 228 |
| 106 | 3300005548 | Ga0070665_100442732 | Ga0070665_1004427321 | 228 |
| 107 | 3300005549 | Ga0070704_100002012 | Ga0070704_10000201217 | 228 |
| 108 | 3300005549 | Ga0070704_100036297 | Ga0070704_1000362975 | 228 |
| 109 | 3300005564 | Ga0070664_100369425 | Ga0070664_1003694252 | 228 |
| 110 | 3300005618 | Ga0068864_100041795 | Ga0068864_1000417955 | 228 |
| 111 | 3300005719 | Ga0068861_100276293 | Ga0068861_1002762932 | 228 |
| 112 | 3300005840 | Ga0068870_10018787 | Ga0068870_100187872 | 228 |
| 113 | 3300005843 | Ga0068860_100031462 | Ga0068860_1000314625 | 228 |
| 114 | 3300005843 | Ga0068860_100168973 | Ga0068860_1001689731 | 228 |
| 115 | 3300006048 | Ga0075363_100035548 | Ga0075363_1000355482 | 228 |
| 116 | 3300006051 | Ga0075364_10473049 | Ga0075364_104730491 | 228 |
| 117 | 3300006177 | Ga0075362_10100835 | Ga0075362_101008352 | 228 |
| 118 | 3300006178 | Ga0075367_10238896 | Ga0075367_102388962 | 228 |
| 119 | 3300006195 | Ga0075366_10010873 | Ga0075366_1001087311 | 228 |
| 120 | 3300006195 | Ga0075366_10282549 | Ga0075366_102825492 | 228 |
| 121 | 3300006195 | Ga0075366_10291189 | Ga0075366_102911892 | 228 |
| 122 | 3300006353 | Ga0075370_10329409 | Ga0075370_103294091 | 228 |
| 123 | 3300006881 | Ga0068865_100254832 | Ga0068865_1002548321 | 228 |
| 124 | 3300007265 | Ga0099794_10020540 | Ga0099794_100205403 | 228 |
| 125 | 3300007265 | Ga0099794_10056389 | Ga0099794_100563892 | 228 |
| 126 | 3300007788 | Ga0099795_10062127 | Ga0099795_100621272 | 228 |
| 127 | 3300009098 | Ga0105245_10475638 | Ga0105245_104756382 | 228 |
| 128 | 3300009177 | Ga0105248_10091410 | Ga0105248_100914107 | 228 |
| 129 | 3300009177 | Ga0105248_10115515 | Ga0105248_101155154 | 228 |
| 130 | 3300013297 | Ga0157378_10000704 | Ga0157378_1000070422 | 228 |
| 131 | 3300013306 | Ga0163162_10012245 | Ga0163162_100122455 | 228 |
| 132 | 3300014969 | Ga0157376_10432527 | Ga0157376_104325272 | 228 |
| 133 | 3300025885 | Ga0207653_10003613 | Ga0207653_100036134 | 228 |
| 134 | 3300025893 | Ga0207682_10231348 | Ga0207682_102313481 | 228 |
| 135 | 3300025900 | Ga0207710_10073604 | Ga0207710_100736042 | 228 |
| 136 | 3300025906 | Ga0207699_10069863 | Ga0207699_100698633 | 228 |
| 137 | 3300025908 | Ga0207643_10039470 | Ga0207643_100394704 | 228 |
| 138 | 3300025910 | Ga0207684_10012006 | Ga0207684_100120062 | 228 |
| 139 | 3300025912 | Ga0207707_10098331 | Ga0207707_100983313 | 228 |
| 140 | 3300025925 | Ga0207650_10211568 | Ga0207650_102115682 | 228 |
| 141 | 3300025926 | Ga0207659_10022090 | Ga0207659_1002209010 | 228 |
| 142 | 3300025927 | Ga0207687_10408057 | Ga0207687_104080572 | 228 |
| 143 | 3300025929 | Ga0207664_10296002 | Ga0207664_102960021 | 228 |
| 144 | 3300025933 | Ga0207706_10077839 | Ga0207706_100778395 | 228 |
| 145 | 3300025937 | Ga0207669_10503623 | Ga0207669_105036232 | 228 |
| 146 | 3300025940 | Ga0207691_10075386 | Ga0207691_100753864 | 228 |
| 147 | 3300025941 | Ga0207711_10060938 | Ga0207711_100609383 | 228 |
| 148 | 3300025941 | Ga0207711_10276586 | Ga0207711_102765861 | 228 |
| 149 | 3300025960 | Ga0207651_10558974 | Ga0207651_105589742 | 228 |
| 150 | 3300025986 | Ga0207658_10057390 | Ga0207658_100573904 | 228 |
| 151 | 3300026023 | Ga0207677_10130122 | Ga0207677_101301222 | 228 |
| 152 | 3300026067 | Ga0207678_10122540 | Ga0207678_101225402 | 228 |
| 153 | 3300026075 | Ga0207708_10091673 | Ga0207708_100916733 | 228 |
| 154 | 3300026075 | Ga0207708_10445131 | Ga0207708_104451312 | 228 |
| 155 | 3300026118 | Ga0207675_100158686 | Ga0207675_1001586862 | 228 |
| 156 | 3300026118 | Ga0207675_100325465 | Ga0207675_1003254652 | 228 |
| 157 | 3300026121 | Ga0207683_10186750 | Ga0207683_101867503 | 228 |
| 158 | 3300027671 | Ga0209588_1014818 | Ga0209588_10148181 | 228 |
| 159 | 3300027671 | Ga0209588_1019378 | Ga0209588_10193784 | 228 |
| 160 | 3300027866 | Ga0209813_10037870 | Ga0209813_100378702 | 228 |
| 161 | 3300027866 | Ga0209813_10050128 | Ga0209813_100501282 | 228 |
| 162 | 3300028016 | Ga0265354_1000867 | Ga0265354_10008674 | 228 |
| 163 | 3300028379 | Ga0268266_10139169 | Ga0268266_101391693 | 228 |
| 164 | 3300028379 | Ga0268266_10285861 | Ga0268266_102858612 | 228 |
| 165 | 3300028379 | Ga0268266_10437845 | Ga0268266_104378451 | 228 |
| 166 | 3300028381 | Ga0268264_10108239 | Ga0268264_101082392 | 228 |
| 167 | 3300030878 | Ga0265770_1015124 | Ga0265770_10151242 | 228 |
| 168 | 3300031090 | Ga0265760_10009102 | Ga0265760_100091024 | 228 |
| 169 | 3300031090 | Ga0265760_10073772 | Ga0265760_100737722 | 228 |
| 170 | 3300031548 | Ga0307408_100212416 | Ga0307408_1002124162 | 228 |
| 171 | 3300032005 | Ga0307411_10072865 | Ga0307411_100728652 | 228 |
| 172 | 3300035111 | Ga0373923_0118330 | Ga0373923_0118330_71_781 | 228 |
| 173 | 3300035118 | Ga0373954_0037597 | Ga0373954_0037597_39_749 | 228 |
| 174 | 3300035172 | Ga0373955_0041481 | Ga0373955_0041481_1669_2379 | 228 |
| 175 | 3300036401 | Ga0373937_0037988 | Ga0373937_0037988_203_913 | 228 |
| 176 | 3300042133 | Ga0450896_002037 | Ga0450896_002037_1184_1876 | 228 |
| 177 | 3300046472 | Ga0495580_0249190 | Ga0495580_0249190_28_738 | 228 |
| 178 | 3300047319 | Ga0495674_0118370 | Ga0495674_0118370_723_1433 | 228 |
| 179 | 3300048904 | Ga0496101_0260201 | Ga0496101_0260201_572_1279 | 228 |
| 180 | 3300048905 | Ga0496102_0082744 | Ga0496102_0082744_1830_2537 | 228 |
| 181 | 3300048905 | Ga0496102_0756689 | Ga0496102_0756689_10_702 | 228 |
| 182 | 3300048909 | Ga0496106_0025726 | Ga0496106_0025726_1364_2071 | 228 |
| 183 | 3300049588 | Ga0501072_0683916 | Ga0501072_0683916_29_724 | 228 |
| 184 | 3300050490 | nmdc:mga03n38_282840_c1 | nmdc:mga03n38_282840_c1_142_837 | 228 |
| 185 | 3300050491 | nmdc:mga00v17_98918_c1 | nmdc:mga00v17_98918_c1_509_1201 | 228 |
| 186 | 3300050493 | nmdc:mga0k408_110761_c1 | nmdc:mga0k408_110761_c1_470_1162 | 228 |
| 187 | 3300050493 | nmdc:mga0k408_126883_c1 | nmdc:mga0k408_126883_c1_473_1165 | 228 |
| 188 | 3300050493 | nmdc:mga0k408_14708_c1 | nmdc:mga0k408_14708_c1_1924_2619 | 228 |
| 189 | 3300050493 | nmdc:mga0k408_99516_c1 | nmdc:mga0k408_99516_c1_670_1362 | 228 |
| 190 | 3300050494 | nmdc:mga06z11_118965_c1 | nmdc:mga06z11_118965_c1_564_1256 | 228 |
| 191 | 3300050494 | nmdc:mga06z11_161560_c1 | nmdc:mga06z11_161560_c1_411_1106 | 228 |
| 192 | 3300050494 | nmdc:mga06z11_77643_c1 | nmdc:mga06z11_77643_c1_522_1214 | 228 |
| 193 | 3300050495 | nmdc:mga04h51_45238_c1 | nmdc:mga04h51_45238_c1_253_945 | 228 |
| 194 | 3300050496 | nmdc:mga07m45_82966_c1 | nmdc:mga07m45_82966_c1_427_1119 | 228 |
| 195 | 3300054114 | Ga0501084_0452287 | Ga0501084_0452287_308_1003 | 228 |
| 196 | 3300059421 | Ga0590071_038043 | Ga0590071_038043_17_715 | 228 |
| 197 | 3300006178 | Ga0075367_10027582 | Ga0075367_100275822 | 229 |
| 198 | 3300046460 | Ga0495638_0015590 | Ga0495638_0015590_3105_3800 | 229 |
| 199 | 3300049591 | Ga0501075_0145847 | Ga0501075_0145847_866_1558 | 229 |
| 200 | 3300053116 | Ga0500592_009690 | Ga0500592_009690_194_889 | 229 |
| 201 | 3300060353 | Ga0501082_0455563 | Ga0501082_0455563_64_756 | 229 |
| 202 | 3300025945 | Ga0207679_10081867 | Ga0207679_100818673 | 230 |
| 203 | 3300049540 | Ga0501324_009773 | Ga0501324_009773_32_736 | 230 |
| 204 | 3300049572 | Ga0501036_0201968 | Ga0501036_0201968_709_1410 | 230 |
| 205 | 3300049580 | Ga0501046_0424535 | Ga0501046_0424535_22_723 | 230 |
| 206 | 3300049582 | Ga0501048_0217979 | Ga0501048_0217979_89_790 | 230 |
| 207 | 3300049583 | Ga0501067_0155966 | Ga0501067_0155966_543_1244 | 230 |
| 208 | 3300049587 | Ga0501071_0068927 | Ga0501071_0068927_1072_1773 | 230 |
| 209 | 3300049588 | Ga0501072_0122132 | Ga0501072_0122132_338_1039 | 230 |
| 210 | 3300049592 | Ga0501076_0046065 | Ga0501076_0046065_1041_1742 | 230 |
| 211 | 3300049743 | Ga0501081_0190602 | Ga0501081_0190602_522_1223 | 230 |
| 212 | 3300053730 | Ga0500645_002436 | Ga0500645_002436_5457_6155 | 230 |
| 213 | 3300054114 | Ga0501084_0199112 | Ga0501084_0199112_734_1435 | 230 |
| 214 | 2162886011 | MRS1b_contig_6987276 | MRS1b_0785.00002030 | 231 |
| 215 | 2162886012 | MBSR1b_contig_750255 | MBSR1b_0584.00005650 | 231 |
| 216 | 3300002244 | JGI24742J22300_10008969 | JGI24742J22300_100089692 | 231 |
| 217 | 3300002459 | JGI24751J29686_10002254 | JGI24751J29686_100022544 | 231 |
| 218 | 3300002459 | JGI24751J29686_10012467 | JGI24751J29686_100124671 | 231 |
| 219 | 3300003163 | Ga0006759J45824_1071695 | Ga0006759J45824_10716953 | 231 |
| 220 | 3300003544 | Ga0007417J51691_1063962 | Ga0007417J51691_10639623 | 231 |
| 221 | 3300003577 | Ga0007416J51690_1063111 | Ga0007416J51690_10631114 | 231 |
| 222 | 3300004798 | Ga0058859_11631144 | Ga0058859_116311441 | 231 |
| 223 | 3300004800 | Ga0058861_12027855 | Ga0058861_120278552 | 231 |
| 224 | 3300004803 | Ga0058862_10054132 | Ga0058862_100541326 | 231 |
| 225 | 3300005290 | Ga0065712_10003155 | Ga0065712_100031557 | 231 |
| 226 | 3300005290 | Ga0065712_10003180 | Ga0065712_100031804 | 231 |
| 227 | 3300005290 | Ga0065712_10010412 | Ga0065712_100104123 | 231 |
| 228 | 3300005290 | Ga0065712_10016186 | Ga0065712_100161863 | 231 |
| 229 | 3300005290 | Ga0065712_10072555 | Ga0065712_100725554 | 231 |
| 230 | 3300005290 | Ga0065712_10076319 | Ga0065712_100763193 | 231 |
| 231 | 3300005293 | Ga0065715_10012525 | Ga0065715_100125253 | 231 |
| 232 | 3300005293 | Ga0065715_10018175 | Ga0065715_100181752 | 231 |
| 233 | 3300005293 | Ga0065715_10030346 | Ga0065715_100303461 | 231 |
| 234 | 3300005293 | Ga0065715_10134694 | Ga0065715_101346941 | 231 |
| 235 | 3300005293 | Ga0065715_10143024 | Ga0065715_101430243 | 231 |
| 236 | 3300005293 | Ga0065715_10147492 | Ga0065715_101474921 | 231 |
| 237 | 3300005293 | Ga0065715_10188267 | Ga0065715_101882672 | 231 |
| 238 | 3300005293 | Ga0065715_10268954 | Ga0065715_102689541 | 231 |
| 239 | 3300005293 | Ga0065715_10326421 | Ga0065715_103264212 | 231 |
| 240 | 3300005293 | Ga0065715_10427148 | Ga0065715_104271481 | 231 |
| 241 | 3300005295 | Ga0065707_10142628 | Ga0065707_101426283 | 231 |
| 242 | 3300005295 | Ga0065707_10234509 | Ga0065707_102345092 | 231 |
| 243 | 3300005327 | Ga0070658_10049558 | Ga0070658_100495581 | 231 |
| 244 | 3300005328 | Ga0070676_10006877 | Ga0070676_1000687711 | 231 |
| 245 | 3300005328 | Ga0070676_10020758 | Ga0070676_100207582 | 231 |
| 246 | 3300005329 | Ga0070683_100022502 | Ga0070683_1000225024 | 231 |
| 247 | 3300005329 | Ga0070683_100067471 | Ga0070683_1000674717 | 231 |
| 248 | 3300005329 | Ga0070683_100143037 | Ga0070683_1001430372 | 231 |
| 249 | 3300005329 | Ga0070683_100258581 | Ga0070683_1002585813 | 231 |
| 250 | 3300005329 | Ga0070683_100284898 | Ga0070683_1002848982 | 231 |
| 251 | 3300005330 | Ga0070690_100063688 | Ga0070690_1000636883 | 231 |
| 252 | 3300005331 | Ga0070670_100032636 | Ga0070670_1000326364 | 231 |
| 253 | 3300005331 | Ga0070670_100036649 | Ga0070670_1000366496 | 231 |
| 254 | 3300005331 | Ga0070670_100042782 | Ga0070670_1000427824 | 231 |
| 255 | 3300005331 | Ga0070670_100242385 | Ga0070670_1002423852 | 231 |
| 256 | 3300005331 | Ga0070670_100825900 | Ga0070670_1008259001 | 231 |
| 257 | 3300005334 | Ga0068869_100226264 | Ga0068869_1002262642 | 231 |
| 258 | 3300005334 | Ga0068869_100280484 | Ga0068869_1002804842 | 231 |
| 259 | 3300005335 | Ga0070666_10051301 | Ga0070666_100513016 | 231 |
| 260 | 3300005335 | Ga0070666_10298179 | Ga0070666_102981791 | 231 |
| 261 | 3300005336 | Ga0070680_100462572 | Ga0070680_1004625722 | 231 |
| 262 | 3300005337 | Ga0070682_100319668 | Ga0070682_1003196681 | 231 |
| 263 | 3300005338 | Ga0068868_100029640 | Ga0068868_10002964011 | 231 |
| 264 | 3300005338 | Ga0068868_100816285 | Ga0068868_1008162851 | 231 |
| 265 | 3300005339 | Ga0070660_100021355 | Ga0070660_1000213554 | 231 |
| 266 | 3300005339 | Ga0070660_100281513 | Ga0070660_1002815131 | 231 |
| 267 | 3300005340 | Ga0070689_100010275 | Ga0070689_1000102753 | 231 |
| 268 | 3300005340 | Ga0070689_100035329 | Ga0070689_1000353297 | 231 |
| 269 | 3300005340 | Ga0070689_100178217 | Ga0070689_1001782173 | 231 |
| 270 | 3300005341 | Ga0070691_10021653 | Ga0070691_100216535 | 231 |
| 271 | 3300005343 | Ga0070687_100010598 | Ga0070687_1000105985 | 231 |
| 272 | 3300005343 | Ga0070687_100058939 | Ga0070687_1000589392 | 231 |
| 273 | 3300005343 | Ga0070687_100269366 | Ga0070687_1002693662 | 231 |
| 274 | 3300005343 | Ga0070687_100429411 | Ga0070687_1004294112 | 231 |
| 275 | 3300005344 | Ga0070661_100104558 | Ga0070661_1001045583 | 231 |
| 276 | 3300005344 | Ga0070661_100169352 | Ga0070661_1001693522 | 231 |
| 277 | 3300005347 | Ga0070668_100068984 | Ga0070668_1000689844 | 231 |
| 278 | 3300005353 | Ga0070669_100012125 | Ga0070669_10001212510 | 231 |
| 279 | 3300005353 | Ga0070669_100107040 | Ga0070669_1001070402 | 231 |
| 280 | 3300005353 | Ga0070669_100114726 | Ga0070669_1001147263 | 231 |
| 281 | 3300005354 | Ga0070675_100003283 | Ga0070675_10000328316 | 231 |
| 282 | 3300005354 | Ga0070675_100058678 | Ga0070675_1000586783 | 231 |
| 283 | 3300005354 | Ga0070675_100058711 | Ga0070675_1000587112 | 231 |
| 284 | 3300005354 | Ga0070675_100141131 | Ga0070675_1001411311 | 231 |
| 285 | 3300005354 | Ga0070675_100280217 | Ga0070675_1002802172 | 231 |
| 286 | 3300005354 | Ga0070675_100616641 | Ga0070675_1006166411 | 231 |
| 287 | 3300005355 | Ga0070671_100019573 | Ga0070671_1000195736 | 231 |
| 288 | 3300005355 | Ga0070671_100022293 | Ga0070671_1000222934 | 231 |
| 289 | 3300005355 | Ga0070671_100069061 | Ga0070671_1000690612 | 231 |
| 290 | 3300005355 | Ga0070671_100082165 | Ga0070671_1000821654 | 231 |
| 291 | 3300005355 | Ga0070671_100159531 | Ga0070671_1001595313 | 231 |
| 292 | 3300005356 | Ga0070674_100011938 | Ga0070674_1000119383 | 231 |
| 293 | 3300005356 | Ga0070674_100176591 | Ga0070674_1001765913 | 231 |
| 294 | 3300005364 | Ga0070673_100019034 | Ga0070673_1000190342 | 231 |
| 295 | 3300005364 | Ga0070673_100135160 | Ga0070673_1001351602 | 231 |
| 296 | 3300005364 | Ga0070673_100137927 | Ga0070673_1001379273 | 231 |
| 297 | 3300005364 | Ga0070673_100223833 | Ga0070673_1002238331 | 231 |
| 298 | 3300005364 | Ga0070673_100258329 | Ga0070673_1002583291 | 231 |
| 299 | 3300005364 | Ga0070673_100282747 | Ga0070673_1002827472 | 231 |
| 300 | 3300005365 | Ga0070688_100034074 | Ga0070688_1000340744 | 231 |
| 301 | 3300005366 | Ga0070659_100070503 | Ga0070659_1000705033 | 231 |
| 302 | 3300005366 | Ga0070659_100427545 | Ga0070659_1004275452 | 231 |
| 303 | 3300005367 | Ga0070667_100268327 | Ga0070667_1002683271 | 231 |
| 304 | 3300005367 | Ga0070667_100323696 | Ga0070667_1003236962 | 231 |
| 305 | 3300005367 | Ga0070667_100374965 | Ga0070667_1003749652 | 231 |
| 306 | 3300005434 | Ga0070709_10046224 | Ga0070709_100462246 | 231 |
| 307 | 3300005434 | Ga0070709_10185255 | Ga0070709_101852552 | 231 |
| 308 | 3300005434 | Ga0070709_10381645 | Ga0070709_103816451 | 231 |
| 309 | 3300005435 | Ga0070714_100016727 | Ga0070714_10001672712 | 231 |
| 310 | 3300005438 | Ga0070701_10008026 | Ga0070701_100080264 | 231 |
| 311 | 3300005438 | Ga0070701_10204590 | Ga0070701_102045901 | 231 |
| 312 | 3300005440 | Ga0070705_100014714 | Ga0070705_1000147144 | 231 |
| 313 | 3300005440 | Ga0070705_100355430 | Ga0070705_1003554301 | 231 |
| 314 | 3300005441 | Ga0070700_100054235 | Ga0070700_1000542352 | 231 |
| 315 | 3300005441 | Ga0070700_100071481 | Ga0070700_1000714813 | 231 |
| 316 | 3300005441 | Ga0070700_100121566 | Ga0070700_1001215663 | 231 |
| 317 | 3300005444 | Ga0070694_100079554 | Ga0070694_1000795543 | 231 |
| 318 | 3300005444 | Ga0070694_100086832 | Ga0070694_1000868322 | 231 |
| 319 | 3300005444 | Ga0070694_100171326 | Ga0070694_1001713261 | 231 |
| 320 | 3300005445 | Ga0070708_100037389 | Ga0070708_1000373894 | 231 |
| 321 | 3300005455 | Ga0070663_100075212 | Ga0070663_1000752123 | 231 |
| 322 | 3300005455 | Ga0070663_100102519 | Ga0070663_1001025192 | 231 |
| 323 | 3300005456 | Ga0070678_100021386 | Ga0070678_1000213864 | 231 |
| 324 | 3300005456 | Ga0070678_100025537 | Ga0070678_1000255377 | 231 |
| 325 | 3300005456 | Ga0070678_100148080 | Ga0070678_1001480803 | 231 |
| 326 | 3300005456 | Ga0070678_100503690 | Ga0070678_1005036901 | 231 |
| 327 | 3300005457 | Ga0070662_100310444 | Ga0070662_1003104441 | 231 |
| 328 | 3300005457 | Ga0070662_100313497 | Ga0070662_1003134972 | 231 |
| 329 | 3300005458 | Ga0070681_10036645 | Ga0070681_100366454 | 231 |
| 330 | 3300005459 | Ga0068867_100024756 | Ga0068867_1000247564 | 231 |
| 331 | 3300005459 | Ga0068867_100046871 | Ga0068867_1000468715 | 231 |
| 332 | 3300005466 | Ga0070685_10068726 | Ga0070685_100687264 | 231 |
| 333 | 3300005471 | Ga0070698_100031163 | Ga0070698_1000311634 | 231 |
| 334 | 3300005471 | Ga0070698_100045728 | Ga0070698_1000457286 | 231 |
| 335 | 3300005471 | Ga0070698_100169372 | Ga0070698_1001693724 | 231 |
| 336 | 3300005471 | Ga0070698_100458387 | Ga0070698_1004583872 | 231 |
| 337 | 3300005518 | Ga0070699_100039862 | Ga0070699_1000398624 | 231 |
| 338 | 3300005530 | Ga0070679_100331744 | Ga0070679_1003317441 | 231 |
| 339 | 3300005535 | Ga0070684_100050464 | Ga0070684_1000504646 | 231 |
| 340 | 3300005535 | Ga0070684_100227261 | Ga0070684_1002272612 | 231 |
| 341 | 3300005535 | Ga0070684_100593368 | Ga0070684_1005933682 | 231 |
| 342 | 3300005539 | Ga0068853_100401456 | Ga0068853_1004014562 | 231 |
| 343 | 3300005539 | Ga0068853_100585276 | Ga0068853_1005852761 | 231 |
| 344 | 3300005543 | Ga0070672_100035240 | Ga0070672_1000352404 | 231 |
| 345 | 3300005543 | Ga0070672_100090608 | Ga0070672_1000906084 | 231 |
| 346 | 3300005543 | Ga0070672_100131380 | Ga0070672_1001313802 | 231 |
| 347 | 3300005543 | Ga0070672_100149735 | Ga0070672_1001497353 | 231 |
| 348 | 3300005543 | Ga0070672_100163998 | Ga0070672_1001639982 | 231 |
| 349 | 3300005543 | Ga0070672_100222995 | Ga0070672_1002229952 | 231 |
| 350 | 3300005543 | Ga0070672_100240827 | Ga0070672_1002408271 | 231 |
| 351 | 3300005544 | Ga0070686_100054834 | Ga0070686_1000548343 | 231 |
| 352 | 3300005544 | Ga0070686_100101114 | Ga0070686_1001011142 | 231 |
| 353 | 3300005545 | Ga0070695_100027513 | Ga0070695_1000275137 | 231 |
| 354 | 3300005545 | Ga0070695_100031080 | Ga0070695_1000310804 | 231 |
| 355 | 3300005546 | Ga0070696_100292081 | Ga0070696_1002920812 | 231 |
| 356 | 3300005547 | Ga0070693_100010528 | Ga0070693_1000105287 | 231 |
| 357 | 3300005547 | Ga0070693_100025995 | Ga0070693_1000259952 | 231 |
| 358 | 3300005547 | Ga0070693_100211067 | Ga0070693_1002110671 | 231 |
| 359 | 3300005548 | Ga0070665_100001142 | Ga0070665_1000011424 | 231 |
| 360 | 3300005548 | Ga0070665_100043746 | Ga0070665_1000437467 | 231 |
| 361 | 3300005548 | Ga0070665_100151522 | Ga0070665_1001515221 | 231 |
| 362 | 3300005548 | Ga0070665_100663561 | Ga0070665_1006635612 | 231 |
| 363 | 3300005548 | Ga0070665_100846182 | Ga0070665_1008461821 | 231 |
| 364 | 3300005549 | Ga0070704_100022139 | Ga0070704_1000221394 | 231 |
| 365 | 3300005549 | Ga0070704_100038836 | Ga0070704_1000388363 | 231 |
| 366 | 3300005549 | Ga0070704_100085002 | Ga0070704_1000850024 | 231 |
| 367 | 3300005549 | Ga0070704_100191163 | Ga0070704_1001911633 | 231 |
| 368 | 3300005549 | Ga0070704_100299790 | Ga0070704_1002997901 | 231 |
| 369 | 3300005549 | Ga0070704_100429123 | Ga0070704_1004291232 | 231 |
| 370 | 3300005564 | Ga0070664_100000479 | Ga0070664_10000047937 | 231 |
| 371 | 3300005564 | Ga0070664_100023901 | Ga0070664_1000239014 | 231 |
| 372 | 3300005564 | Ga0070664_100345767 | Ga0070664_1003457672 | 231 |
| 373 | 3300005564 | Ga0070664_100801303 | Ga0070664_1008013032 | 231 |
| 374 | 3300005577 | Ga0068857_100088906 | Ga0068857_1000889062 | 231 |
| 375 | 3300005577 | Ga0068857_100095854 | Ga0068857_1000958544 | 231 |
| 376 | 3300005578 | Ga0068854_100030421 | Ga0068854_1000304213 | 231 |
| 377 | 3300005614 | Ga0068856_100021502 | Ga0068856_1000215024 | 231 |
| 378 | 3300005615 | Ga0070702_100069828 | Ga0070702_1000698283 | 231 |
| 379 | 3300005615 | Ga0070702_100193094 | Ga0070702_1001930942 | 231 |
| 380 | 3300005616 | Ga0068852_100156437 | Ga0068852_1001564374 | 231 |
| 381 | 3300005616 | Ga0068852_100880250 | Ga0068852_1008802501 | 231 |
| 382 | 3300005617 | Ga0068859_100052431 | Ga0068859_1000524314 | 231 |
| 383 | 3300005617 | Ga0068859_100058170 | Ga0068859_1000581705 | 231 |
| 384 | 3300005617 | Ga0068859_100060743 | Ga0068859_1000607434 | 231 |
| 385 | 3300005617 | Ga0068859_100116721 | Ga0068859_1001167212 | 231 |
| 386 | 3300005617 | Ga0068859_100143147 | Ga0068859_1001431473 | 231 |
| 387 | 3300005618 | Ga0068864_100020005 | Ga0068864_1000200054 | 231 |
| 388 | 3300005618 | Ga0068864_100021918 | Ga0068864_1000219184 | 231 |
| 389 | 3300005618 | Ga0068864_100103104 | Ga0068864_1001031043 | 231 |
| 390 | 3300005718 | Ga0068866_10029809 | Ga0068866_100298093 | 231 |
| 391 | 3300005718 | Ga0068866_10141972 | Ga0068866_101419722 | 231 |
| 392 | 3300005719 | Ga0068861_100037825 | Ga0068861_1000378255 | 231 |
| 393 | 3300005719 | Ga0068861_100280773 | Ga0068861_1002807732 | 231 |
| 394 | 3300005834 | Ga0068851_10180931 | Ga0068851_101809311 | 231 |
| 395 | 3300005841 | Ga0068863_100002641 | Ga0068863_1000026414 | 231 |
| 396 | 3300005841 | Ga0068863_100101783 | Ga0068863_1001017832 | 231 |
| 397 | 3300005841 | Ga0068863_100314856 | Ga0068863_1003148563 | 231 |
| 398 | 3300005841 | Ga0068863_100448766 | Ga0068863_1004487662 | 231 |
| 399 | 3300005842 | Ga0068858_100003549 | Ga0068858_1000035493 | 231 |
| 400 | 3300005842 | Ga0068858_100108646 | Ga0068858_1001086464 | 231 |
| 401 | 3300005842 | Ga0068858_100179900 | Ga0068858_1001799003 | 231 |
| 402 | 3300005843 | Ga0068860_100110727 | Ga0068860_1001107273 | 231 |
| 403 | 3300005843 | Ga0068860_100146900 | Ga0068860_1001469004 | 231 |
| 404 | 3300005843 | Ga0068860_100308768 | Ga0068860_1003087682 | 231 |
| 405 | 3300005844 | Ga0068862_100038643 | Ga0068862_1000386437 | 231 |
| 406 | 3300005844 | Ga0068862_100463520 | Ga0068862_1004635202 | 231 |
| 407 | 3300005937 | Ga0081455_10052243 | Ga0081455_100522433 | 231 |
| 408 | 3300005937 | Ga0081455_10062519 | Ga0081455_100625193 | 231 |
| 409 | 3300005983 | Ga0081540_1071342 | Ga0081540_10713423 | 231 |
| 410 | 3300005985 | Ga0081539_10004143 | Ga0081539_100041434 | 231 |
| 411 | 3300006042 | Ga0075368_10010245 | Ga0075368_100102454 | 231 |
| 412 | 3300006058 | Ga0075432_10066499 | Ga0075432_100664992 | 231 |
| 413 | 3300006178 | Ga0075367_10074056 | Ga0075367_100740563 | 231 |
| 414 | 3300006178 | Ga0075367_10128678 | Ga0075367_101286782 | 231 |
| 415 | 3300006237 | Ga0097621_100012152 | Ga0097621_10001215211 | 231 |
| 416 | 3300006237 | Ga0097621_100019408 | Ga0097621_1000194084 | 231 |
| 417 | 3300006237 | Ga0097621_100050116 | Ga0097621_1000501166 | 231 |
| 418 | 3300006237 | Ga0097621_100108636 | Ga0097621_1001086362 | 231 |
| 419 | 3300006237 | Ga0097621_100163688 | Ga0097621_1001636882 | 231 |
| 420 | 3300006237 | Ga0097621_100168154 | Ga0097621_1001681543 | 231 |
| 421 | 3300006358 | Ga0068871_100016384 | Ga0068871_1000163844 | 231 |
| 422 | 3300006358 | Ga0068871_100089011 | Ga0068871_1000890114 | 231 |
| 423 | 3300006358 | Ga0068871_100358315 | Ga0068871_1003583152 | 231 |
| 424 | 3300006358 | Ga0068871_100871149 | Ga0068871_1008711491 | 231 |
| 425 | 3300006844 | Ga0075428_100059187 | Ga0075428_1000591877 | 231 |
| 426 | 3300006844 | Ga0075428_100092394 | Ga0075428_1000923942 | 231 |
| 427 | 3300006844 | Ga0075428_100101880 | Ga0075428_1001018806 | 231 |
| 428 | 3300006844 | Ga0075428_100173346 | Ga0075428_1001733464 | 231 |
| 429 | 3300006844 | Ga0075428_100542217 | Ga0075428_1005422172 | 231 |
| 430 | 3300006844 | Ga0075428_100751183 | Ga0075428_1007511832 | 231 |
| 431 | 3300006844 | Ga0075428_101101983 | Ga0075428_1011019832 | 231 |
| 432 | 3300006846 | Ga0075430_100032704 | Ga0075430_1000327044 | 231 |
| 433 | 3300006846 | Ga0075430_100060590 | Ga0075430_1000605904 | 231 |
| 434 | 3300006846 | Ga0075430_100328105 | Ga0075430_1003281052 | 231 |
| 435 | 3300006847 | Ga0075431_100051337 | Ga0075431_1000513372 | 231 |
| 436 | 3300006847 | Ga0075431_100054499 | Ga0075431_1000544992 | 231 |
| 437 | 3300006847 | Ga0075431_100071897 | Ga0075431_1000718972 | 231 |
| 438 | 3300006847 | Ga0075431_100078029 | Ga0075431_1000780292 | 231 |
| 439 | 3300006847 | Ga0075431_100081544 | Ga0075431_1000815447 | 231 |
| 440 | 3300006847 | Ga0075431_100139789 | Ga0075431_1001397892 | 231 |
| 441 | 3300006847 | Ga0075431_100165453 | Ga0075431_1001654533 | 231 |
| 442 | 3300006847 | Ga0075431_100239897 | Ga0075431_1002398971 | 231 |
| 443 | 3300006847 | Ga0075431_100448333 | Ga0075431_1004483332 | 231 |
| 444 | 3300006847 | Ga0075431_100806842 | Ga0075431_1008068422 | 231 |
| 445 | 3300006852 | Ga0075433_10146434 | Ga0075433_101464342 | 231 |
| 446 | 3300006852 | Ga0075433_10299581 | Ga0075433_102995812 | 231 |
| 447 | 3300006871 | Ga0075434_100008089 | Ga0075434_1000080894 | 231 |
| 448 | 3300006871 | Ga0075434_100023274 | Ga0075434_10002327411 | 231 |
| 449 | 3300006871 | Ga0075434_100030826 | Ga0075434_1000308264 | 231 |
| 450 | 3300006871 | Ga0075434_100049389 | Ga0075434_1000493894 | 231 |
| 451 | 3300006871 | Ga0075434_100052251 | Ga0075434_1000522517 | 231 |
| 452 | 3300006871 | Ga0075434_100120927 | Ga0075434_1001209271 | 231 |
| 453 | 3300006871 | Ga0075434_100163608 | Ga0075434_1001636083 | 231 |
| 454 | 3300006871 | Ga0075434_100323067 | Ga0075434_1003230673 | 231 |
| 455 | 3300006871 | Ga0075434_100458533 | Ga0075434_1004585332 | 231 |
| 456 | 3300006880 | Ga0075429_100022950 | Ga0075429_1000229508 | 231 |
| 457 | 3300006880 | Ga0075429_100061614 | Ga0075429_1000616143 | 231 |
| 458 | 3300006880 | Ga0075429_100161465 | Ga0075429_1001614652 | 231 |
| 459 | 3300006880 | Ga0075429_100249221 | Ga0075429_1002492213 | 231 |
| 460 | 3300006881 | Ga0068865_100167247 | Ga0068865_1001672471 | 231 |
| 461 | 3300006881 | Ga0068865_100342560 | Ga0068865_1003425602 | 231 |
| 462 | 3300006881 | Ga0068865_100568230 | Ga0068865_1005682301 | 231 |
| 463 | 3300006914 | Ga0075436_100013829 | Ga0075436_1000138293 | 231 |
| 464 | 3300006914 | Ga0075436_100045093 | Ga0075436_1000450933 | 231 |
| 465 | 3300006914 | Ga0075436_100061898 | Ga0075436_1000618981 | 231 |
| 466 | 3300006914 | Ga0075436_100499804 | Ga0075436_1004998041 | 231 |
| 467 | 3300006931 | Ga0097620_100052429 | Ga0097620_1000524293 | 231 |
| 468 | 3300006931 | Ga0097620_100058168 | Ga0097620_1000581685 | 231 |
| 469 | 3300006931 | Ga0097620_100060741 | Ga0097620_1000607412 | 231 |
| 470 | 3300006931 | Ga0097620_100116734 | Ga0097620_1001167342 | 231 |
| 471 | 3300006931 | Ga0097620_100143146 | Ga0097620_1001431463 | 231 |
| 472 | 3300007076 | Ga0075435_100006214 | Ga0075435_1000062141 | 231 |
| 473 | 3300007076 | Ga0075435_100009940 | Ga0075435_1000099408 | 231 |
| 474 | 3300007076 | Ga0075435_100010966 | Ga0075435_1000109664 | 231 |
| 475 | 3300007076 | Ga0075435_100013746 | Ga0075435_10001374611 | 231 |
| 476 | 3300007076 | Ga0075435_100018121 | Ga0075435_1000181217 | 231 |
| 477 | 3300007076 | Ga0075435_100077607 | Ga0075435_1000776072 | 231 |
| 478 | 3300007076 | Ga0075435_100111882 | Ga0075435_1001118824 | 231 |
| 479 | 3300007076 | Ga0075435_100153841 | Ga0075435_1001538413 | 231 |
| 480 | 3300007076 | Ga0075435_100210480 | Ga0075435_1002104802 | 231 |
| 481 | 3300007076 | Ga0075435_100477185 | Ga0075435_1004771852 | 231 |
| 482 | 3300009093 | Ga0105240_10039744 | Ga0105240_100397444 | 231 |
| 483 | 3300009093 | Ga0105240_10517443 | Ga0105240_105174432 | 231 |
| 484 | 3300009093 | Ga0105240_10830910 | Ga0105240_108309102 | 231 |
| 485 | 3300009094 | Ga0111539_10050951 | Ga0111539_100509517 | 231 |
| 486 | 3300009094 | Ga0111539_10070960 | Ga0111539_100709604 | 231 |
| 487 | 3300009094 | Ga0111539_10071376 | Ga0111539_100713765 | 231 |
| 488 | 3300009094 | Ga0111539_10083713 | Ga0111539_100837134 | 231 |
| 489 | 3300009094 | Ga0111539_10162198 | Ga0111539_101621982 | 231 |
| 490 | 3300009094 | Ga0111539_10175332 | Ga0111539_101753325 | 231 |
| 491 | 3300009094 | Ga0111539_10454973 | Ga0111539_104549732 | 231 |
| 492 | 3300009094 | Ga0111539_10569014 | Ga0111539_105690142 | 231 |
| 493 | 3300009094 | Ga0111539_10590377 | Ga0111539_105903771 | 231 |
| 494 | 3300009101 | Ga0105247_10015895 | Ga0105247_1001589510 | 231 |
| 495 | 3300009101 | Ga0105247_10338603 | Ga0105247_103386031 | 231 |
| 496 | 3300009147 | Ga0114129_10001925 | Ga0114129_100019254 | 231 |
| 497 | 3300009147 | Ga0114129_10037064 | Ga0114129_1003706412 | 231 |
| 498 | 3300009147 | Ga0114129_10057496 | Ga0114129_100574964 | 231 |
| 499 | 3300009147 | Ga0114129_10082040 | Ga0114129_100820406 | 231 |
| 500 | 3300009147 | Ga0114129_10083262 | Ga0114129_100832623 | 231 |
| 501 | 3300009147 | Ga0114129_10088785 | Ga0114129_100887854 | 231 |
| 502 | 3300009147 | Ga0114129_10089356 | Ga0114129_100893562 | 231 |
| 503 | 3300009147 | Ga0114129_10090758 | Ga0114129_100907583 | 231 |
| 504 | 3300009147 | Ga0114129_10124117 | Ga0114129_101241172 | 231 |
| 505 | 3300009147 | Ga0114129_10175605 | Ga0114129_101756054 | 231 |
| 506 | 3300009147 | Ga0114129_10218741 | Ga0114129_102187412 | 231 |
| 507 | 3300009147 | Ga0114129_10319563 | Ga0114129_103195632 | 231 |
| 508 | 3300009148 | Ga0105243_10043926 | Ga0105243_100439265 | 231 |
| 509 | 3300009148 | Ga0105243_10063738 | Ga0105243_100637383 | 231 |
| 510 | 3300009174 | Ga0105241_10070577 | Ga0105241_100705772 | 231 |
| 511 | 3300009174 | Ga0105241_10239476 | Ga0105241_102394762 | 231 |
| 512 | 3300009176 | Ga0105242_10033180 | Ga0105242_100331807 | 231 |
| 513 | 3300009176 | Ga0105242_10204657 | Ga0105242_102046573 | 231 |
| 514 | 3300009176 | Ga0105242_10509381 | Ga0105242_105093811 | 231 |
| 515 | 3300009177 | Ga0105248_10058749 | Ga0105248_100587493 | 231 |
| 516 | 3300009177 | Ga0105248_10137242 | Ga0105248_101372422 | 231 |
| 517 | 3300009177 | Ga0105248_10174972 | Ga0105248_101749723 | 231 |
| 518 | 3300009177 | Ga0105248_10303600 | Ga0105248_103036003 | 231 |
| 519 | 3300009177 | Ga0105248_10365917 | Ga0105248_103659172 | 231 |
| 520 | 3300009177 | Ga0105248_11319378 | Ga0105248_113193781 | 231 |
| 521 | 3300009545 | Ga0105237_10818557 | Ga0105237_108185572 | 231 |
| 522 | 3300009551 | Ga0105238_10213858 | Ga0105238_102138583 | 231 |
| 523 | 3300009551 | Ga0105238_10518896 | Ga0105238_105188961 | 231 |
| 524 | 3300009553 | Ga0105249_10047141 | Ga0105249_100471412 | 231 |
| 525 | 3300009553 | Ga0105249_10432333 | Ga0105249_104323332 | 231 |
| 526 | 3300013105 | Ga0157369_10199512 | Ga0157369_101995122 | 231 |
| 527 | 3300013296 | Ga0157374_10070935 | Ga0157374_100709354 | 231 |
| 528 | 3300013296 | Ga0157374_10196172 | Ga0157374_101961722 | 231 |
| 529 | 3300013296 | Ga0157374_10278710 | Ga0157374_102787102 | 231 |
| 530 | 3300013297 | Ga0157378_10111251 | Ga0157378_101112514 | 231 |
| 531 | 3300013297 | Ga0157378_10122509 | Ga0157378_101225092 | 231 |
| 532 | 3300013306 | Ga0163162_10055553 | Ga0163162_100555534 | 231 |
| 533 | 3300013306 | Ga0163162_10082782 | Ga0163162_100827827 | 231 |
| 534 | 3300013308 | Ga0157375_10224479 | Ga0157375_102244793 | 231 |
| 535 | 3300014325 | Ga0163163_10019918 | Ga0163163_100199184 | 231 |
| 536 | 3300014325 | Ga0163163_10034316 | Ga0163163_100343163 | 231 |
| 537 | 3300014325 | Ga0163163_10238824 | Ga0163163_102388242 | 231 |
| 538 | 3300014325 | Ga0163163_10513724 | Ga0163163_105137242 | 231 |
| 539 | 3300014326 | Ga0157380_10090303 | Ga0157380_100903033 | 231 |
| 540 | 3300014326 | Ga0157380_10213298 | Ga0157380_102132982 | 231 |
| 541 | 3300014326 | Ga0157380_10493336 | Ga0157380_104933362 | 231 |
| 542 | 3300014326 | Ga0157380_10960479 | Ga0157380_109604791 | 231 |
| 543 | 3300014968 | Ga0157379_10087694 | Ga0157379_100876944 | 231 |
| 544 | 3300014968 | Ga0157379_10127107 | Ga0157379_101271074 | 231 |
| 545 | 3300014968 | Ga0157379_10645930 | Ga0157379_106459301 | 231 |
| 546 | 3300014969 | Ga0157376_10244614 | Ga0157376_102446142 | 231 |
| 547 | 3300014969 | Ga0157376_10324727 | Ga0157376_103247273 | 231 |
| 548 | 3300014969 | Ga0157376_10618666 | Ga0157376_106186662 | 231 |
| 549 | 3300025315 | Ga0207697_10006737 | Ga0207697_100067374 | 231 |
| 550 | 3300025315 | Ga0207697_10049267 | Ga0207697_100492672 | 231 |
| 551 | 3300025315 | Ga0207697_10063571 | Ga0207697_100635712 | 231 |
| 552 | 3300025893 | Ga0207682_10057577 | Ga0207682_100575772 | 231 |
| 553 | 3300025899 | Ga0207642_10114509 | Ga0207642_101145091 | 231 |
| 554 | 3300025900 | Ga0207710_10263789 | Ga0207710_102637891 | 231 |
| 555 | 3300025903 | Ga0207680_10086181 | Ga0207680_100861812 | 231 |
| 556 | 3300025903 | Ga0207680_10167783 | Ga0207680_101677831 | 231 |
| 557 | 3300025903 | Ga0207680_10222653 | Ga0207680_102226531 | 231 |
| 558 | 3300025904 | Ga0207647_10020837 | Ga0207647_100208374 | 231 |
| 559 | 3300025906 | Ga0207699_10038979 | Ga0207699_100389796 | 231 |
| 560 | 3300025906 | Ga0207699_10160286 | Ga0207699_101602862 | 231 |
| 561 | 3300025906 | Ga0207699_10229896 | Ga0207699_102298962 | 231 |
| 562 | 3300025907 | Ga0207645_10022529 | Ga0207645_100225293 | 231 |
| 563 | 3300025907 | Ga0207645_10024118 | Ga0207645_100241184 | 231 |
| 564 | 3300025907 | Ga0207645_10488157 | Ga0207645_104881572 | 231 |
| 565 | 3300025908 | Ga0207643_10212788 | Ga0207643_102127882 | 231 |
| 566 | 3300025910 | Ga0207684_10300332 | Ga0207684_103003321 | 231 |
| 567 | 3300025911 | Ga0207654_10066422 | Ga0207654_100664222 | 231 |
| 568 | 3300025911 | Ga0207654_10289253 | Ga0207654_102892532 | 231 |
| 569 | 3300025912 | Ga0207707_10031478 | Ga0207707_100314787 | 231 |
| 570 | 3300025912 | Ga0207707_10075131 | Ga0207707_100751312 | 231 |
| 571 | 3300025913 | Ga0207695_10136434 | Ga0207695_101364341 | 231 |
| 572 | 3300025913 | Ga0207695_10732804 | Ga0207695_107328041 | 231 |
| 573 | 3300025916 | Ga0207663_10133573 | Ga0207663_101335732 | 231 |
| 574 | 3300025916 | Ga0207663_10302828 | Ga0207663_103028282 | 231 |
| 575 | 3300025917 | Ga0207660_10399279 | Ga0207660_103992792 | 231 |
| 576 | 3300025918 | Ga0207662_10045759 | Ga0207662_100457595 | 231 |
| 577 | 3300025918 | Ga0207662_10115019 | Ga0207662_101150193 | 231 |
| 578 | 3300025918 | Ga0207662_10121296 | Ga0207662_101212963 | 231 |
| 579 | 3300025919 | Ga0207657_10083516 | Ga0207657_100835162 | 231 |
| 580 | 3300025920 | Ga0207649_10238303 | Ga0207649_102383032 | 231 |
| 581 | 3300025920 | Ga0207649_10288881 | Ga0207649_102888812 | 231 |
| 582 | 3300025922 | Ga0207646_10096455 | Ga0207646_100964553 | 231 |
| 583 | 3300025922 | Ga0207646_10432458 | Ga0207646_104324582 | 231 |
| 584 | 3300025923 | Ga0207681_10099023 | Ga0207681_100990231 | 231 |
| 585 | 3300025923 | Ga0207681_10225089 | Ga0207681_102250892 | 231 |
| 586 | 3300025923 | Ga0207681_10271701 | Ga0207681_102717012 | 231 |
| 587 | 3300025923 | Ga0207681_10321576 | Ga0207681_103215762 | 231 |
| 588 | 3300025923 | Ga0207681_10341396 | Ga0207681_103413962 | 231 |
| 589 | 3300025924 | Ga0207694_10602381 | Ga0207694_106023811 | 231 |
| 590 | 3300025925 | Ga0207650_10024531 | Ga0207650_100245313 | 231 |
| 591 | 3300025925 | Ga0207650_10054709 | Ga0207650_100547094 | 231 |
| 592 | 3300025925 | Ga0207650_10081604 | Ga0207650_100816044 | 231 |
| 593 | 3300025925 | Ga0207650_10355854 | Ga0207650_103558542 | 231 |
| 594 | 3300025926 | Ga0207659_10002281 | Ga0207659_1000228116 | 231 |
| 595 | 3300025926 | Ga0207659_10075534 | Ga0207659_100755343 | 231 |
| 596 | 3300025926 | Ga0207659_10288692 | Ga0207659_102886922 | 231 |
| 597 | 3300025926 | Ga0207659_10399579 | Ga0207659_103995792 | 231 |
| 598 | 3300025926 | Ga0207659_10433300 | Ga0207659_104333002 | 231 |
| 599 | 3300025927 | Ga0207687_10171415 | Ga0207687_101714151 | 231 |
| 600 | 3300025928 | Ga0207700_10924622 | Ga0207700_109246221 | 231 |
| 601 | 3300025929 | Ga0207664_10024634 | Ga0207664_100246344 | 231 |
| 602 | 3300025931 | Ga0207644_10006250 | Ga0207644_100062504 | 231 |
| 603 | 3300025931 | Ga0207644_10013745 | Ga0207644_100137454 | 231 |
| 604 | 3300025931 | Ga0207644_10066753 | Ga0207644_100667532 | 231 |
| 605 | 3300025931 | Ga0207644_10157657 | Ga0207644_101576573 | 231 |
| 606 | 3300025931 | Ga0207644_10247228 | Ga0207644_102472282 | 231 |
| 607 | 3300025931 | Ga0207644_10261013 | Ga0207644_102610132 | 231 |
| 608 | 3300025931 | Ga0207644_10496618 | Ga0207644_104966182 | 231 |
| 609 | 3300025933 | Ga0207706_10061580 | Ga0207706_100615803 | 231 |
| 610 | 3300025934 | Ga0207686_10026234 | Ga0207686_100262344 | 231 |
| 611 | 3300025934 | Ga0207686_10042760 | Ga0207686_100427604 | 231 |
| 612 | 3300025934 | Ga0207686_10382956 | Ga0207686_103829562 | 231 |
| 613 | 3300025935 | Ga0207709_10057765 | Ga0207709_100577654 | 231 |
| 614 | 3300025935 | Ga0207709_10130334 | Ga0207709_101303342 | 231 |
| 615 | 3300025936 | Ga0207670_10032793 | Ga0207670_100327933 | 231 |
| 616 | 3300025936 | Ga0207670_10070285 | Ga0207670_100702854 | 231 |
| 617 | 3300025936 | Ga0207670_10077619 | Ga0207670_100776191 | 231 |
| 618 | 3300025936 | Ga0207670_10208154 | Ga0207670_102081542 | 231 |
| 619 | 3300025937 | Ga0207669_10097789 | Ga0207669_100977892 | 231 |
| 620 | 3300025937 | Ga0207669_10196919 | Ga0207669_101969191 | 231 |
| 621 | 3300025937 | Ga0207669_10294840 | Ga0207669_102948402 | 231 |
| 622 | 3300025937 | Ga0207669_10750250 | Ga0207669_107502502 | 231 |
| 623 | 3300025938 | Ga0207704_10090084 | Ga0207704_100900841 | 231 |
| 624 | 3300025939 | Ga0207665_10220209 | Ga0207665_102202092 | 231 |
| 625 | 3300025940 | Ga0207691_10057475 | Ga0207691_100574754 | 231 |
| 626 | 3300025940 | Ga0207691_10059070 | Ga0207691_100590704 | 231 |
| 627 | 3300025940 | Ga0207691_10089812 | Ga0207691_100898123 | 231 |
| 628 | 3300025940 | Ga0207691_10126513 | Ga0207691_101265133 | 231 |
| 629 | 3300025940 | Ga0207691_10154885 | Ga0207691_101548852 | 231 |
| 630 | 3300025940 | Ga0207691_10167555 | Ga0207691_101675552 | 231 |
| 631 | 3300025940 | Ga0207691_10205619 | Ga0207691_102056193 | 231 |
| 632 | 3300025940 | Ga0207691_10215919 | Ga0207691_102159192 | 231 |
| 633 | 3300025940 | Ga0207691_10427391 | Ga0207691_104273911 | 231 |
| 634 | 3300025940 | Ga0207691_10540080 | Ga0207691_105400802 | 231 |
| 635 | 3300025941 | Ga0207711_10046720 | Ga0207711_100467201 | 231 |
| 636 | 3300025941 | Ga0207711_10127929 | Ga0207711_101279294 | 231 |
| 637 | 3300025941 | Ga0207711_10140160 | Ga0207711_101401603 | 231 |
| 638 | 3300025941 | Ga0207711_10159678 | Ga0207711_101596781 | 231 |
| 639 | 3300025941 | Ga0207711_10744733 | Ga0207711_107447331 | 231 |
| 640 | 3300025942 | Ga0207689_10142740 | Ga0207689_101427402 | 231 |
| 641 | 3300025942 | Ga0207689_10146058 | Ga0207689_101460583 | 231 |
| 642 | 3300025942 | Ga0207689_10327625 | Ga0207689_103276252 | 231 |
| 643 | 3300025944 | Ga0207661_10052153 | Ga0207661_100521534 | 231 |
| 644 | 3300025944 | Ga0207661_10136329 | Ga0207661_101363294 | 231 |
| 645 | 3300025944 | Ga0207661_10145992 | Ga0207661_101459922 | 231 |
| 646 | 3300025945 | Ga0207679_10007830 | Ga0207679_100078304 | 231 |
| 647 | 3300025945 | Ga0207679_10031159 | Ga0207679_100311594 | 231 |
| 648 | 3300025945 | Ga0207679_10063554 | Ga0207679_100635544 | 231 |
| 649 | 3300025945 | Ga0207679_10203418 | Ga0207679_102034181 | 231 |
| 650 | 3300025945 | Ga0207679_10470877 | Ga0207679_104708772 | 231 |
| 651 | 3300025960 | Ga0207651_10012876 | Ga0207651_100128762 | 231 |
| 652 | 3300025960 | Ga0207651_10032332 | Ga0207651_100323327 | 231 |
| 653 | 3300025960 | Ga0207651_10133750 | Ga0207651_101337503 | 231 |
| 654 | 3300025960 | Ga0207651_10342075 | Ga0207651_103420752 | 231 |
| 655 | 3300025961 | Ga0207712_10030658 | Ga0207712_100306581 | 231 |
| 656 | 3300025961 | Ga0207712_10091557 | Ga0207712_100915572 | 231 |
| 657 | 3300025981 | Ga0207640_10018870 | Ga0207640_100188704 | 231 |
| 658 | 3300025981 | Ga0207640_10021255 | Ga0207640_100212557 | 231 |
| 659 | 3300025981 | Ga0207640_10371834 | Ga0207640_103718341 | 231 |
| 660 | 3300025981 | Ga0207640_10632071 | Ga0207640_106320711 | 231 |
| 661 | 3300025986 | Ga0207658_10064322 | Ga0207658_100643222 | 231 |
| 662 | 3300025986 | Ga0207658_10125681 | Ga0207658_101256814 | 231 |
| 663 | 3300025986 | Ga0207658_10308453 | Ga0207658_103084532 | 231 |
| 664 | 3300026023 | Ga0207677_10063437 | Ga0207677_100634372 | 231 |
| 665 | 3300026023 | Ga0207677_10101490 | Ga0207677_101014901 | 231 |
| 666 | 3300026023 | Ga0207677_10668529 | Ga0207677_106685291 | 231 |
| 667 | 3300026035 | Ga0207703_10037322 | Ga0207703_100373222 | 231 |
| 668 | 3300026035 | Ga0207703_10053472 | Ga0207703_100534726 | 231 |
| 669 | 3300026035 | Ga0207703_10087961 | Ga0207703_100879611 | 231 |
| 670 | 3300026035 | Ga0207703_10115187 | Ga0207703_101151873 | 231 |
| 671 | 3300026035 | Ga0207703_10510384 | Ga0207703_105103842 | 231 |
| 672 | 3300026041 | Ga0207639_10384205 | Ga0207639_103842052 | 231 |
| 673 | 3300026067 | Ga0207678_10118278 | Ga0207678_101182783 | 231 |
| 674 | 3300026067 | Ga0207678_10223804 | Ga0207678_102238041 | 231 |
| 675 | 3300026075 | Ga0207708_10035399 | Ga0207708_100353997 | 231 |
| 676 | 3300026075 | Ga0207708_10094953 | Ga0207708_100949532 | 231 |
| 677 | 3300026075 | Ga0207708_10105780 | Ga0207708_101057803 | 231 |
| 678 | 3300026075 | Ga0207708_10325494 | Ga0207708_103254942 | 231 |
| 679 | 3300026078 | Ga0207702_10598141 | Ga0207702_105981411 | 231 |
| 680 | 3300026088 | Ga0207641_10006730 | Ga0207641_100067304 | 231 |
| 681 | 3300026088 | Ga0207641_10040192 | Ga0207641_100401927 | 231 |
| 682 | 3300026088 | Ga0207641_10268257 | Ga0207641_102682572 | 231 |
| 683 | 3300026089 | Ga0207648_10040419 | Ga0207648_100404194 | 231 |
| 684 | 3300026089 | Ga0207648_10108973 | Ga0207648_101089732 | 231 |
| 685 | 3300026089 | Ga0207648_10115354 | Ga0207648_101153543 | 231 |
| 686 | 3300026089 | Ga0207648_10178924 | Ga0207648_101789241 | 231 |
| 687 | 3300026089 | Ga0207648_10523384 | Ga0207648_105233842 | 231 |
| 688 | 3300026095 | Ga0207676_10090307 | Ga0207676_100903071 | 231 |
| 689 | 3300026095 | Ga0207676_10114833 | Ga0207676_101148333 | 231 |
| 690 | 3300026116 | Ga0207674_10017732 | Ga0207674_100177323 | 231 |
| 691 | 3300026116 | Ga0207674_10101649 | Ga0207674_101016494 | 231 |
| 692 | 3300026118 | Ga0207675_100031657 | Ga0207675_1000316577 | 231 |
| 693 | 3300026118 | Ga0207675_100037707 | Ga0207675_1000377074 | 231 |
| 694 | 3300026121 | Ga0207683_10015965 | Ga0207683_100159654 | 231 |
| 695 | 3300026121 | Ga0207683_10062914 | Ga0207683_100629146 | 231 |
| 696 | 3300026121 | Ga0207683_10100072 | Ga0207683_101000722 | 231 |
| 697 | 3300026121 | Ga0207683_10241586 | Ga0207683_102415863 | 231 |
| 698 | 3300026142 | Ga0207698_10135357 | Ga0207698_101353572 | 231 |
| 699 | 3300026142 | Ga0207698_10784869 | Ga0207698_107848692 | 231 |
| 700 | 3300027907 | Ga0207428_10018173 | Ga0207428_100181737 | 231 |
| 701 | 3300027907 | Ga0207428_10021152 | Ga0207428_100211527 | 231 |
| 702 | 3300027907 | Ga0207428_10037083 | Ga0207428_100370834 | 231 |
| 703 | 3300027907 | Ga0207428_10047174 | Ga0207428_100471744 | 231 |
| 704 | 3300027907 | Ga0207428_10062710 | Ga0207428_100627104 | 231 |
| 705 | 3300027907 | Ga0207428_10071803 | Ga0207428_100718033 | 231 |
| 706 | 3300027907 | Ga0207428_10073958 | Ga0207428_100739584 | 231 |
| 707 | 3300027907 | Ga0207428_10152288 | Ga0207428_101522881 | 231 |
| 708 | 3300027907 | Ga0207428_10329439 | Ga0207428_103294392 | 231 |
| 709 | 3300028379 | Ga0268266_10006985 | Ga0268266_100069855 | 231 |
| 710 | 3300028380 | Ga0268265_10078111 | Ga0268265_100781114 | 231 |
| 711 | 3300028380 | Ga0268265_10548436 | Ga0268265_105484362 | 231 |
| 712 | 3300028380 | Ga0268265_10652652 | Ga0268265_106526521 | 231 |
| 713 | 3300028381 | Ga0268264_10244329 | Ga0268264_102443293 | 231 |
| 714 | 3300028381 | Ga0268264_10383910 | Ga0268264_103839102 | 231 |
| 715 | 3300028381 | Ga0268264_10425538 | Ga0268264_104255382 | 231 |
| 716 | 3300028381 | Ga0268264_10539066 | Ga0268264_105390662 | 231 |
| 717 | 3300028381 | Ga0268264_10636739 | Ga0268264_106367392 | 231 |
| 718 | 3300031456 | Ga0307513_10592853 | Ga0307513_105928531 | 231 |
| 719 | 3300031548 | Ga0307408_100015092 | Ga0307408_1000150924 | 231 |
| 720 | 3300031548 | Ga0307408_100056513 | Ga0307408_1000565132 | 231 |
| 721 | 3300031548 | Ga0307408_100069819 | Ga0307408_1000698192 | 231 |
| 722 | 3300031548 | Ga0307408_100177761 | Ga0307408_1001777612 | 231 |
| 723 | 3300031548 | Ga0307408_100220124 | Ga0307408_1002201242 | 231 |
| 724 | 3300031548 | Ga0307408_100258313 | Ga0307408_1002583132 | 231 |
| 725 | 3300031731 | Ga0307405_10132438 | Ga0307405_101324382 | 231 |
| 726 | 3300031731 | Ga0307405_10160354 | Ga0307405_101603543 | 231 |
| 727 | 3300031731 | Ga0307405_10176253 | Ga0307405_101762532 | 231 |
| 728 | 3300031824 | Ga0307413_10035015 | Ga0307413_100350154 | 231 |
| 729 | 3300031824 | Ga0307413_10765416 | Ga0307413_107654161 | 231 |
| 730 | 3300031852 | Ga0307410_10014184 | Ga0307410_100141843 | 231 |
| 731 | 3300031852 | Ga0307410_10044243 | Ga0307410_100442435 | 231 |
| 732 | 3300031852 | Ga0307410_10267751 | Ga0307410_102677511 | 231 |
| 733 | 3300031852 | Ga0307410_10322649 | Ga0307410_103226491 | 231 |
| 734 | 3300031852 | Ga0307410_10715375 | Ga0307410_107153752 | 231 |
| 735 | 3300031901 | Ga0307406_10309340 | Ga0307406_103093402 | 231 |
| 736 | 3300031901 | Ga0307406_10325596 | Ga0307406_103255961 | 231 |
| 737 | 3300031901 | Ga0307406_10717586 | Ga0307406_107175861 | 231 |
| 738 | 3300031903 | Ga0307407_10006748 | Ga0307407_100067484 | 231 |
| 739 | 3300031903 | Ga0307407_10107454 | Ga0307407_101074542 | 231 |
| 740 | 3300031911 | Ga0307412_10106226 | Ga0307412_101062262 | 231 |
| 741 | 3300031911 | Ga0307412_10108579 | Ga0307412_101085793 | 231 |
| 742 | 3300031911 | Ga0307412_10124288 | Ga0307412_101242882 | 231 |
| 743 | 3300031911 | Ga0307412_10140018 | Ga0307412_101400182 | 231 |
| 744 | 3300031911 | Ga0307412_10199510 | Ga0307412_101995102 | 231 |
| 745 | 3300031995 | Ga0307409_100008285 | Ga0307409_1000082854 | 231 |
| 746 | 3300031995 | Ga0307409_100032545 | Ga0307409_1000325455 | 231 |
| 747 | 3300031995 | Ga0307409_100109203 | Ga0307409_1001092034 | 231 |
| 748 | 3300031995 | Ga0307409_100148469 | Ga0307409_1001484691 | 231 |
| 749 | 3300031995 | Ga0307409_100297217 | Ga0307409_1002972172 | 231 |
| 750 | 3300031995 | Ga0307409_100302374 | Ga0307409_1003023743 | 231 |
| 751 | 3300032002 | Ga0307416_100009329 | Ga0307416_1000093297 | 231 |
| 752 | 3300032002 | Ga0307416_100016235 | Ga0307416_1000162354 | 231 |
| 753 | 3300032002 | Ga0307416_100023389 | Ga0307416_1000233894 | 231 |
| 754 | 3300032002 | Ga0307416_100071517 | Ga0307416_1000715172 | 231 |
| 755 | 3300032002 | Ga0307416_100081275 | Ga0307416_1000812752 | 231 |
| 756 | 3300032002 | Ga0307416_100196156 | Ga0307416_1001961562 | 231 |
| 757 | 3300032002 | Ga0307416_100343099 | Ga0307416_1003430991 | 231 |
| 758 | 3300032002 | Ga0307416_100409672 | Ga0307416_1004096722 | 231 |
| 759 | 3300032002 | Ga0307416_100453952 | Ga0307416_1004539522 | 231 |
| 760 | 3300032002 | Ga0307416_100642174 | Ga0307416_1006421742 | 231 |
| 761 | 3300032002 | Ga0307416_100684915 | Ga0307416_1006849152 | 231 |
| 762 | 3300032002 | Ga0307416_100771646 | Ga0307416_1007716461 | 231 |
| 763 | 3300032004 | Ga0307414_10031493 | Ga0307414_100314933 | 231 |
| 764 | 3300032004 | Ga0307414_10224910 | Ga0307414_102249101 | 231 |
| 765 | 3300032004 | Ga0307414_10382949 | Ga0307414_103829491 | 231 |
| 766 | 3300032004 | Ga0307414_10859977 | Ga0307414_108599772 | 231 |
| 767 | 3300032004 | Ga0307414_10863805 | Ga0307414_108638051 | 231 |
| 768 | 3300032005 | Ga0307411_10027976 | Ga0307411_100279764 | 231 |
| 769 | 3300032005 | Ga0307411_10036028 | Ga0307411_100360283 | 231 |
| 770 | 3300032005 | Ga0307411_10037127 | Ga0307411_100371272 | 231 |
| 771 | 3300032005 | Ga0307411_10060259 | Ga0307411_100602593 | 231 |
| 772 | 3300032005 | Ga0307411_10085700 | Ga0307411_100857003 | 231 |
| 773 | 3300032005 | Ga0307411_10092303 | Ga0307411_100923032 | 231 |
| 774 | 3300032005 | Ga0307411_10189555 | Ga0307411_101895552 | 231 |
| 775 | 3300032005 | Ga0307411_10424864 | Ga0307411_104248642 | 231 |
| 776 | 3300032126 | Ga0307415_100017833 | Ga0307415_1000178333 | 231 |
| 777 | 3300032126 | Ga0307415_100070727 | Ga0307415_1000707273 | 231 |
| 778 | 3300034957 | Ga0373938_0000588 | Ga0373938_0000588_3191_3898 | 231 |
| 779 | 3300035084 | Ga0373928_0007331 | Ga0373928_0007331_396_1103 | 231 |
| 780 | 3300035085 | Ga0373929_0000498 | Ga0373929_0000498_2740_3447 | 231 |
| 781 | 3300035085 | Ga0373929_0041471 | Ga0373929_0041471_64_768 | 231 |
| 782 | 3300035086 | Ga0373934_0193373 | Ga0373934_0193373_43_750 | 231 |
| 783 | 3300035088 | Ga0373940_0001234 | Ga0373940_0001234_2136_2843 | 231 |
| 784 | 3300035090 | Ga0373949_0001772 | Ga0373949_0001772_1907_2614 | 231 |
| 785 | 3300035091 | Ga0373951_0000520 | Ga0373951_0000520_7942_8649 | 231 |
| 786 | 3300035091 | Ga0373951_0074382 | Ga0373951_0074382_113_820 | 231 |
| 787 | 3300035112 | Ga0373932_0000492 | Ga0373932_0000492_7684_8391 | 231 |
| 788 | 3300035114 | Ga0373939_0015291 | Ga0373939_0015291_535_1239 | 231 |
| 789 | 3300035115 | Ga0373941_0000603 | Ga0373941_0000603_41_748 | 231 |
| 790 | 3300035115 | Ga0373941_0030086 | Ga0373941_0030086_439_1143 | 231 |
| 791 | 3300035116 | Ga0373945_0019159 | Ga0373945_0019159_272_979 | 231 |
| 792 | 3300035119 | Ga0373956_0109075 | Ga0373956_0109075_75_782 | 231 |
| 793 | 3300035120 | Ga0373957_0083157 | Ga0373957_0083157_546_1253 | 231 |
| 794 | 3300035121 | Ga0373960_0000207 | Ga0373960_0000207_596_1303 | 231 |
| 795 | 3300035170 | Ga0373943_0007836 | Ga0373943_0007836_2705_3412 | 231 |
| 796 | 3300035171 | Ga0373946_0028290 | Ga0373946_0028290_396_1103 | 231 |
| 797 | 3300035207 | Ga0373942_0001108 | Ga0373942_0001108_298_1005 | 231 |
| 798 | 3300035241 | Ga0373961_0006147 | Ga0373961_0006147_1953_2660 | 231 |
| 799 | 3300035242 | Ga0373962_0003292 | Ga0373962_0003292_1365_2072 | 231 |
| 800 | 3300035410 | Ga0373924_0083647 | Ga0373924_0083647_487_1194 | 231 |
| 801 | 3300035410 | Ga0373924_0107574 | Ga0373924_0107574_202_909 | 231 |
| 802 | 3300035691 | Ga0373931_0010417 | Ga0373931_0010417_3637_4344 | 231 |
| 803 | 3300035691 | Ga0373931_0054554 | Ga0373931_0054554_576_1280 | 231 |
| 804 | 3300035691 | Ga0373931_0067984 | Ga0373931_0067984_214_921 | 231 |
| 805 | 3300035724 | Ga0373933_0325216 | Ga0373933_0325216_89_796 | 231 |
| 806 | 3300035724 | Ga0373933_0479462 | Ga0373933_0479462_38_745 | 231 |
| 807 | 3300035725 | Ga0373947_0056371 | Ga0373947_0056371_845_1552 | 231 |
| 808 | 3300036401 | Ga0373937_0121007 | Ga0373937_0121007_67_774 | 231 |
| 809 | 3300036401 | Ga0373937_0230640 | Ga0373937_0230640_139_843 | 231 |
| 810 | 3300036401 | Ga0373937_0298647 | Ga0373937_0298647_283_990 | 231 |
| 811 | 3300036401 | Ga0373937_0795541 | Ga0373937_0795541_175_882 | 231 |
| 812 | 3300037068 | Ga0373925_0049612 | Ga0373925_0049612_975_1682 | 231 |
| 813 | 3300037068 | Ga0373925_0146349 | Ga0373925_0146349_533_1240 | 231 |
| 814 | 3300037068 | Ga0373925_0296252 | Ga0373925_0296252_555_1262 | 231 |
| 815 | 3300039437 | Ga0436365_1133449 | Ga0436365_1133449_1056_1760 | 231 |
| 816 | 3300041404 | Ga0439436_0027609 | Ga0439436_0027609_122_829 | 231 |
| 817 | 3300041997 | Ga0439431_0033613 | Ga0439431_0033613_178_882 | 231 |
| 818 | 3300041999 | Ga0439433_0056506 | Ga0439433_0056506_135_839 | 231 |
| 819 | 3300042007 | Ga0439449_0073224 | Ga0439449_0073224_471_1175 | 231 |
| 820 | 3300042008 | Ga0439450_011567 | Ga0439450_011567_27_731 | 231 |
| 821 | 3300042125 | Ga0450923_003629 | Ga0450923_003629_1241_1945 | 231 |
| 822 | 3300042156 | Ga0439446_0032896 | Ga0439446_0032896_260_964 | 231 |
| 823 | 3300042156 | Ga0439446_0041694 | Ga0439446_0041694_162_866 | 231 |
| 824 | 3300042439 | Ga0439464_0031586 | Ga0439464_0031586_436_1140 | 231 |
| 825 | 3300042439 | Ga0439464_0102316 | Ga0439464_0102316_62_766 | 231 |
| 826 | 3300042532 | Ga0450893_0011972 | Ga0450893_0011972_362_1066 | 231 |
| 827 | 3300042876 | Ga0451577_0328861 | Ga0451577_0328861_519_1220 | 231 |
| 828 | 3300042876 | Ga0451577_0674870 | Ga0451577_0674870_88_795 | 231 |
| 829 | 3300044673 | Ga0453683_0381884 | Ga0453683_0381884_62_769 | 231 |
| 830 | 3300044712 | Ga0453684_0024329 | Ga0453684_0024329_6257_6958 | 231 |
| 831 | 3300045051 | Ga0451576_0009891 | Ga0451576_0009891_4446_5153 | 231 |
| 832 | 3300045051 | Ga0451576_0275906 | Ga0451576_0275906_772_1476 | 231 |
| 833 | 3300045051 | Ga0451576_0586042 | Ga0451576_0586042_32_736 | 231 |
| 834 | 3300045051 | Ga0451576_0808552 | Ga0451576_0808552_110_805 | 231 |
| 835 | 3300046454 | Ga0495592_0028300 | Ga0495592_0028300_2587_3294 | 231 |
| 836 | 3300046455 | Ga0495603_0016917 | Ga0495603_0016917_2933_3637 | 231 |
| 837 | 3300046460 | Ga0495638_0170701 | Ga0495638_0170701_332_1036 | 231 |
| 838 | 3300046472 | Ga0495580_0015407 | Ga0495580_0015407_239_946 | 231 |
| 839 | 3300046472 | Ga0495580_0191064 | Ga0495580_0191064_79_783 | 231 |
| 840 | 3300046473 | Ga0495582_0147266 | Ga0495582_0147266_531_1238 | 231 |
| 841 | 3300046511 | Ga0495608_0017777 | Ga0495608_0017777_2783_3490 | 231 |
| 842 | 3300046511 | Ga0495608_0113728 | Ga0495608_0113728_833_1540 | 231 |
| 843 | 3300046514 | Ga0495618_0221069 | Ga0495618_0221069_345_1052 | 231 |
| 844 | 3300046516 | Ga0495628_0055499 | Ga0495628_0055499_496_1203 | 231 |
| 845 | 3300046517 | Ga0495630_0021767 | Ga0495630_0021767_3481_4188 | 231 |
| 846 | 3300046522 | Ga0495643_0073682 | Ga0495643_0073682_418_1122 | 231 |
| 847 | 3300046528 | Ga0495642_0096846 | Ga0495642_0096846_87_794 | 231 |
| 848 | 3300046529 | Ga0495652_0142327 | Ga0495652_0142327_240_947 | 231 |
| 849 | 3300046535 | Ga0495586_0189637 | Ga0495586_0189637_384_1091 | 231 |
| 850 | 3300046536 | Ga0495587_0082171 | Ga0495587_0082171_877_1584 | 231 |
| 851 | 3300046536 | Ga0495587_0182521 | Ga0495587_0182521_389_1096 | 231 |
| 852 | 3300046539 | Ga0495621_0096887 | Ga0495621_0096887_352_1056 | 231 |
| 853 | 3300046543 | Ga0495645_0009873 | Ga0495645_0009873_4395_5102 | 231 |
| 854 | 3300046558 | Ga0495633_0012872 | Ga0495633_0012872_1501_2205 | 231 |
| 855 | 3300046615 | Ga0495656_0180639 | Ga0495656_0180639_276_980 | 231 |
| 856 | 3300046615 | Ga0495656_0244875 | Ga0495656_0244875_78_782 | 231 |
| 857 | 3300046642 | Ga0495634_0053535 | Ga0495634_0053535_547_1254 | 231 |
| 858 | 3300046663 | Ga0495635_0403272 | Ga0495635_0403272_63_770 | 231 |
| 859 | 3300046664 | Ga0495659_0007506 | Ga0495659_0007506_680_1384 | 231 |
| 860 | 3300046674 | Ga0495588_0080299 | Ga0495588_0080299_345_1061 | 231 |
| 861 | 3300046675 | Ga0495657_0280200 | Ga0495657_0280200_98_805 | 231 |
| 862 | 3300046678 | Ga0495599_0043040 | Ga0495599_0043040_1748_2455 | 231 |
| 863 | 3300046683 | Ga0495658_0147865 | Ga0495658_0147865_180_884 | 231 |
| 864 | 3300046684 | Ga0495669_0030390 | Ga0495669_0030390_1569_2276 | 231 |
| 865 | 3300046684 | Ga0495669_0111431 | Ga0495669_0111431_252_959 | 231 |
| 866 | 3300046689 | Ga0495613_0014914 | Ga0495613_0014914_3395_4102 | 231 |
| 867 | 3300046689 | Ga0495613_0083081 | Ga0495613_0083081_366_1070 | 231 |
| 868 | 3300046691 | Ga0495670_0115442 | Ga0495670_0115442_592_1299 | 231 |
| 869 | 3300046794 | Ga0495589_0248876 | Ga0495589_0248876_43_747 | 231 |
| 870 | 3300047317 | Ga0495604_0182373 | Ga0495604_0182373_719_1426 | 231 |
| 871 | 3300047318 | Ga0495636_0214872 | Ga0495636_0214872_88_795 | 231 |
| 872 | 3300047319 | Ga0495674_0288352 | Ga0495674_0288352_106_813 | 231 |
| 873 | 3300047319 | Ga0495674_0622938 | Ga0495674_0622938_79_786 | 231 |
| 874 | 3300047320 | Ga0495672_0033778 | Ga0495672_0033778_1016_1720 | 231 |
| 875 | 3300047444 | Ga0495675_0123218 | Ga0495675_0123218_86_793 | 231 |
| 876 | 3300047471 | Ga0495684_0008118 | Ga0495684_0008118_6858_7565 | 231 |
| 877 | 3300048088 | Ga0495602_0061934 | Ga0495602_0061934_1171_1878 | 231 |
| 878 | 3300048088 | Ga0495602_0293386 | Ga0495602_0293386_81_788 | 231 |
| 879 | 3300048088 | Ga0495602_0415876 | Ga0495602_0415876_229_936 | 231 |
| 880 | 3300048903 | Ga0496100_0182592 | Ga0496100_0182592_754_1458 | 231 |
| 881 | 3300048903 | Ga0496100_0464573 | Ga0496100_0464573_195_902 | 231 |
| 882 | 3300048904 | Ga0496101_0212867 | Ga0496101_0212867_762_1469 | 231 |
| 883 | 3300048904 | Ga0496101_0251514 | Ga0496101_0251514_483_1187 | 231 |
| 884 | 3300048905 | Ga0496102_0069466 | Ga0496102_0069466_1508_2212 | 231 |
| 885 | 3300048905 | Ga0496102_0243158 | Ga0496102_0243158_188_895 | 231 |
| 886 | 3300048905 | Ga0496102_0646366 | Ga0496102_0646366_38_742 | 231 |
| 887 | 3300048906 | Ga0496103_0363353 | Ga0496103_0363353_15_716 | 231 |
| 888 | 3300048907 | Ga0496104_0004897 | Ga0496104_0004897_4706_5410 | 231 |
| 889 | 3300048907 | Ga0496104_0095500 | Ga0496104_0095500_1084_1791 | 231 |
| 890 | 3300048907 | Ga0496104_0372470 | Ga0496104_0372470_336_1043 | 231 |
| 891 | 3300048909 | Ga0496106_0077272 | Ga0496106_0077272_823_1530 | 231 |
| 892 | 3300048910 | Ga0496107_0296569 | Ga0496107_0296569_207_914 | 231 |
| 893 | 3300048911 | Ga0496108_0000658 | Ga0496108_0000658_3491_4195 | 231 |
| 894 | 3300048911 | Ga0496108_0099597 | Ga0496108_0099597_193_897 | 231 |
| 895 | 3300048912 | Ga0496109_0011768 | Ga0496109_0011768_4966_5670 | 231 |
| 896 | 3300048912 | Ga0496109_0121316 | Ga0496109_0121316_994_1698 | 231 |
| 897 | 3300048912 | Ga0496109_0132789 | Ga0496109_0132789_855_1562 | 231 |
| 898 | 3300048912 | Ga0496109_0139996 | Ga0496109_0139996_959_1663 | 231 |
| 899 | 3300048912 | Ga0496109_0234069 | Ga0496109_0234069_600_1304 | 231 |
| 900 | 3300048912 | Ga0496109_0409612 | Ga0496109_0409612_482_1186 | 231 |
| 901 | 3300048912 | Ga0496109_0629953 | Ga0496109_0629953_109_813 | 231 |
| 902 | 3300048913 | Ga0496110_0033880 | Ga0496110_0033880_686_1390 | 231 |
| 903 | 3300048913 | Ga0496110_0046805 | Ga0496110_0046805_698_1402 | 231 |
| 904 | 3300048913 | Ga0496110_0274681 | Ga0496110_0274681_756_1463 | 231 |
| 905 | 3300048913 | Ga0496110_0511469 | Ga0496110_0511469_12_719 | 231 |
| 906 | 3300048915 | Ga0496112_0009883 | Ga0496112_0009883_3028_3732 | 231 |
| 907 | 3300048915 | Ga0496112_0073890 | Ga0496112_0073890_2052_2759 | 231 |
| 908 | 3300048915 | Ga0496112_0074263 | Ga0496112_0074263_1885_2589 | 231 |
| 909 | 3300048915 | Ga0496112_0202732 | Ga0496112_0202732_1170_1877 | 231 |
| 910 | 3300048915 | Ga0496112_0320491 | Ga0496112_0320491_53_757 | 231 |
| 911 | 3300048915 | Ga0496112_0385448 | Ga0496112_0385448_359_1063 | 231 |
| 912 | 3300048916 | Ga0496113_0213031 | Ga0496113_0213031_640_1344 | 231 |
| 913 | 3300048917 | Ga0496114_0160689 | Ga0496114_0160689_45_752 | 231 |
| 914 | 3300048917 | Ga0496114_0690835 | Ga0496114_0690835_69_776 | 231 |
| 915 | 3300048918 | Ga0496115_0060668 | Ga0496115_0060668_200_907 | 231 |
| 916 | 3300049520 | Ga0501297_009693 | Ga0501297_009693_23_727 | 231 |
| 917 | 3300049568 | Ga0501031_0147439 | Ga0501031_0147439_476_1180 | 231 |
| 918 | 3300049569 | Ga0501032_0074211 | Ga0501032_0074211_1093_1797 | 231 |
| 919 | 3300049569 | Ga0501032_0113711 | Ga0501032_0113711_335_1039 | 231 |
| 920 | 3300049570 | Ga0501033_0018683 | Ga0501033_0018683_2061_2765 | 231 |
| 921 | 3300049570 | Ga0501033_0074743 | Ga0501033_0074743_466_1170 | 231 |
| 922 | 3300049571 | Ga0501034_0037393 | Ga0501034_0037393_3074_3778 | 231 |
| 923 | 3300049571 | Ga0501034_0071835 | Ga0501034_0071835_549_1253 | 231 |
| 924 | 3300049571 | Ga0501034_0072478 | Ga0501034_0072478_2710_3417 | 231 |
| 925 | 3300049571 | Ga0501034_0140910 | Ga0501034_0140910_740_1447 | 231 |
| 926 | 3300049571 | Ga0501034_0250752 | Ga0501034_0250752_483_1187 | 231 |
| 927 | 3300049571 | Ga0501034_0259060 | Ga0501034_0259060_787_1491 | 231 |
| 928 | 3300049572 | Ga0501036_0089317 | Ga0501036_0089317_317_1021 | 231 |
| 929 | 3300049572 | Ga0501036_0142435 | Ga0501036_0142435_841_1545 | 231 |
| 930 | 3300049572 | Ga0501036_0353765 | Ga0501036_0353765_125_829 | 231 |
| 931 | 3300049573 | Ga0501037_0074291 | Ga0501037_0074291_1750_2454 | 231 |
| 932 | 3300049573 | Ga0501037_0117625 | Ga0501037_0117625_177_881 | 231 |
| 933 | 3300049574 | Ga0501038_0190899 | Ga0501038_0190899_738_1442 | 231 |
| 934 | 3300049574 | Ga0501038_0224718 | Ga0501038_0224718_448_1152 | 231 |
| 935 | 3300049574 | Ga0501038_0387895 | Ga0501038_0387895_166_870 | 231 |
| 936 | 3300049575 | Ga0501039_0128245 | Ga0501039_0128245_1139_1843 | 231 |
| 937 | 3300049575 | Ga0501039_0449037 | Ga0501039_0449037_180_884 | 231 |
| 938 | 3300049576 | Ga0501040_0133727 | Ga0501040_0133727_527_1231 | 231 |
| 939 | 3300049577 | Ga0501041_0055825 | Ga0501041_0055825_937_1641 | 231 |
| 940 | 3300049578 | Ga0501042_0054369 | Ga0501042_0054369_926_1630 | 231 |
| 941 | 3300049578 | Ga0501042_0173385 | Ga0501042_0173385_128_832 | 231 |
| 942 | 3300049578 | Ga0501042_0275046 | Ga0501042_0275046_286_990 | 231 |
| 943 | 3300049579 | Ga0501043_0027314 | Ga0501043_0027314_705_1409 | 231 |
| 944 | 3300049579 | Ga0501043_0208316 | Ga0501043_0208316_462_1166 | 231 |
| 945 | 3300049579 | Ga0501043_0367696 | Ga0501043_0367696_284_988 | 231 |
| 946 | 3300049580 | Ga0501046_0018619 | Ga0501046_0018619_1115_1819 | 231 |
| 947 | 3300049580 | Ga0501046_0058667 | Ga0501046_0058667_724_1428 | 231 |
| 948 | 3300049580 | Ga0501046_0078328 | Ga0501046_0078328_582_1286 | 231 |
| 949 | 3300049580 | Ga0501046_0202015 | Ga0501046_0202015_358_1062 | 231 |
| 950 | 3300049581 | Ga0501047_0025147 | Ga0501047_0025147_1143_1847 | 231 |
| 951 | 3300049581 | Ga0501047_0052430 | Ga0501047_0052430_1467_2174 | 231 |
| 952 | 3300049581 | Ga0501047_0064532 | Ga0501047_0064532_1570_2274 | 231 |
| 953 | 3300049581 | Ga0501047_0086071 | Ga0501047_0086071_1691_2566 | 231 |
| 954 | 3300049582 | Ga0501048_0026794 | Ga0501048_0026794_526_1230 | 231 |
| 955 | 3300049582 | Ga0501048_0033526 | Ga0501048_0033526_1323_2027 | 231 |
| 956 | 3300049582 | Ga0501048_0140230 | Ga0501048_0140230_528_1232 | 231 |
| 957 | 3300049583 | Ga0501067_0006917 | Ga0501067_0006917_3386_4090 | 231 |
| 958 | 3300049583 | Ga0501067_0068438 | Ga0501067_0068438_685_1389 | 231 |
| 959 | 3300049583 | Ga0501067_0115584 | Ga0501067_0115584_193_897 | 231 |
| 960 | 3300049583 | Ga0501067_0167051 | Ga0501067_0167051_109_813 | 231 |
| 961 | 3300049584 | Ga0501068_0069240 | Ga0501068_0069240_260_964 | 231 |
| 962 | 3300049584 | Ga0501068_0072213 | Ga0501068_0072213_1127_1831 | 231 |
| 963 | 3300049584 | Ga0501068_0180750 | Ga0501068_0180750_478_1182 | 231 |
| 964 | 3300049585 | Ga0501069_0005228 | Ga0501069_0005228_3339_4043 | 231 |
| 965 | 3300049585 | Ga0501069_0045955 | Ga0501069_0045955_1260_1964 | 231 |
| 966 | 3300049585 | Ga0501069_0301657 | Ga0501069_0301657_135_839 | 231 |
| 967 | 3300049586 | Ga0501070_0013474 | Ga0501070_0013474_4917_5621 | 231 |
| 968 | 3300049586 | Ga0501070_0100061 | Ga0501070_0100061_450_1154 | 231 |
| 969 | 3300049586 | Ga0501070_0556823 | Ga0501070_0556823_200_904 | 231 |
| 970 | 3300049587 | Ga0501071_0027667 | Ga0501071_0027667_2106_2810 | 231 |
| 971 | 3300049587 | Ga0501071_0210170 | Ga0501071_0210170_602_1306 | 231 |
| 972 | 3300049587 | Ga0501071_0558170 | Ga0501071_0558170_20_727 | 231 |
| 973 | 3300049588 | Ga0501072_0242205 | Ga0501072_0242205_196_900 | 231 |
| 974 | 3300049589 | Ga0501073_0027272 | Ga0501073_0027272_2983_3687 | 231 |
| 975 | 3300049589 | Ga0501073_0301994 | Ga0501073_0301994_20_727 | 231 |
| 976 | 3300049590 | Ga0501074_0022318 | Ga0501074_0022318_2975_3679 | 231 |
| 977 | 3300049590 | Ga0501074_0046591 | Ga0501074_0046591_1146_1850 | 231 |
| 978 | 3300049590 | Ga0501074_0074785 | Ga0501074_0074785_1448_2152 | 231 |
| 979 | 3300049591 | Ga0501075_0086770 | Ga0501075_0086770_194_898 | 231 |
| 980 | 3300049591 | Ga0501075_0316002 | Ga0501075_0316002_44_748 | 231 |
| 981 | 3300049591 | Ga0501075_0375192 | Ga0501075_0375192_86_790 | 231 |
| 982 | 3300049592 | Ga0501076_0034815 | Ga0501076_0034815_1863_2567 | 231 |
| 983 | 3300049592 | Ga0501076_0058187 | Ga0501076_0058187_1438_2142 | 231 |
| 984 | 3300049592 | Ga0501076_0075602 | Ga0501076_0075602_1709_2413 | 231 |
| 985 | 3300049593 | Ga0501077_0135947 | Ga0501077_0135947_519_1223 | 231 |
| 986 | 3300049593 | Ga0501077_0213136 | Ga0501077_0213136_59_766 | 231 |
| 987 | 3300049593 | Ga0501077_0218782 | Ga0501077_0218782_210_914 | 231 |
| 988 | 3300049741 | Ga0501079_0017412 | Ga0501079_0017412_3503_4207 | 231 |
| 989 | 3300049741 | Ga0501079_0049715 | Ga0501079_0049715_1529_2233 | 231 |
| 990 | 3300049741 | Ga0501079_0252649 | Ga0501079_0252649_30_734 | 231 |
| 991 | 3300049742 | Ga0501080_0214485 | Ga0501080_0214485_712_1416 | 231 |
| 992 | 3300049742 | Ga0501080_0237012 | Ga0501080_0237012_757_1461 | 231 |
| 993 | 3300049742 | Ga0501080_0260097 | Ga0501080_0260097_478_1182 | 231 |
| 994 | 3300049742 | Ga0501080_0657211 | Ga0501080_0657211_120_824 | 231 |
| 995 | 3300049743 | Ga0501081_0109942 | Ga0501081_0109942_508_1212 | 231 |
| 996 | 3300049743 | Ga0501081_0112059 | Ga0501081_0112059_534_1241 | 231 |
| 997 | 3300049744 | Ga0501083_0022768 | Ga0501083_0022768_1226_1930 | 231 |
| 998 | 3300049744 | Ga0501083_0041524 | Ga0501083_0041524_1146_1850 | 231 |
| 999 | 3300049744 | Ga0501083_0164071 | Ga0501083_0164071_488_1192 | 231 |
| 1000 | 3300049744 | Ga0501083_0254237 | Ga0501083_0254237_293_997 | 231 |
| 1001 | 3300049822 | Ga0501035_0042303 | Ga0501035_0042303_3006_3710 | 231 |
| 1002 | 3300049822 | Ga0501035_0223589 | Ga0501035_0223589_615_1319 | 231 |
| 1003 | 3300049822 | Ga0501035_0243448 | Ga0501035_0243448_477_1181 | 231 |
| 1004 | 3300049823 | Ga0501044_0021080 | Ga0501044_0021080_626_1330 | 231 |
| 1005 | 3300049823 | Ga0501044_0029768 | Ga0501044_0029768_3840_4544 | 231 |
| 1006 | 3300049823 | Ga0501044_0142201 | Ga0501044_0142201_467_1171 | 231 |
| 1007 | 3300049823 | Ga0501044_0205449 | Ga0501044_0205449_452_1156 | 231 |
| 1008 | 3300049823 | Ga0501044_0354059 | Ga0501044_0354059_537_1244 | 231 |
| 1009 | 3300049823 | Ga0501044_0461503 | Ga0501044_0461503_20_724 | 231 |
| 1010 | 3300049824 | Ga0501045_0042915 | Ga0501045_0042915_808_1512 | 231 |
| 1011 | 3300049824 | Ga0501045_0086150 | Ga0501045_0086150_1368_2072 | 231 |
| 1012 | 3300049824 | Ga0501045_0372966 | Ga0501045_0372966_291_995 | 231 |
| 1013 | 3300049824 | Ga0501045_0410113 | Ga0501045_0410113_167_871 | 231 |
| 1014 | 3300050491 | nmdc:mga00v17_64576_c1 | nmdc:mga00v17_64576_c1_952_1656 | 231 |
| 1015 | 3300050494 | nmdc:mga06z11_31694_c1 | nmdc:mga06z11_31694_c1_1594_2298 | 231 |
| 1016 | 3300050494 | nmdc:mga06z11_94303_c1 | nmdc:mga06z11_94303_c1_432_1136 | 231 |
| 1017 | 3300050495 | nmdc:mga04h51_20005_c1 | nmdc:mga04h51_20005_c1_857_1561 | 231 |
| 1018 | 3300050507 | nmdc:mga05p37_120124_c1 | nmdc:mga05p37_120124_c1_1393_2100 | 231 |
| 1019 | 3300050507 | nmdc:mga05p37_146498_c1 | nmdc:mga05p37_146498_c1_689_1396 | 231 |
| 1020 | 3300050507 | nmdc:mga05p37_167051_c1 | nmdc:mga05p37_167051_c1_1767_2474 | 231 |
| 1021 | 3300050507 | nmdc:mga05p37_19272_c1 | nmdc:mga05p37_19272_c1_3998_4702 | 231 |
| 1022 | 3300050507 | nmdc:mga05p37_1991_c1 | nmdc:mga05p37_1991_c1_4930_5634 | 231 |
| 1023 | 3300050507 | nmdc:mga05p37_24767_c1 | nmdc:mga05p37_24767_c1_3096_3803 | 231 |
| 1024 | 3300050507 | nmdc:mga05p37_295663_c1 | nmdc:mga05p37_295663_c1_861_1568 | 231 |
| 1025 | 3300050507 | nmdc:mga05p37_43028_c1 | nmdc:mga05p37_43028_c1_2235_2939 | 231 |
| 1026 | 3300050507 | nmdc:mga05p37_433650_c1 | nmdc:mga05p37_433650_c1_672_1376 | 231 |
| 1027 | 3300050507 | nmdc:mga05p37_44395_c1 | nmdc:mga05p37_44395_c1_1640_2335 | 231 |
| 1028 | 3300050507 | nmdc:mga05p37_52287_c1 | nmdc:mga05p37_52287_c1_2779_3486 | 231 |
| 1029 | 3300050507 | nmdc:mga05p37_59927_c1 | nmdc:mga05p37_59927_c1_2692_3399 | 231 |
| 1030 | 3300050507 | nmdc:mga05p37_64450_c1 | nmdc:mga05p37_64450_c1_1026_1733 | 231 |
| 1031 | 3300050507 | nmdc:mga05p37_69189_c1 | nmdc:mga05p37_69189_c1_1896_2600 | 231 |
| 1032 | 3300050507 | nmdc:mga05p37_833607_c1 | nmdc:mga05p37_833607_c1_157_861 | 231 |
| 1033 | 3300050508 | nmdc:mga09592_125191_c1 | nmdc:mga09592_125191_c1_251_958 | 231 |
| 1034 | 3300050508 | nmdc:mga09592_130065_c1 | nmdc:mga09592_130065_c1_1367_2074 | 231 |
| 1035 | 3300050508 | nmdc:mga09592_34324_c1 | nmdc:mga09592_34324_c1_73_768 | 231 |
| 1036 | 3300050508 | nmdc:mga09592_43035_c1 | nmdc:mga09592_43035_c1_444_1148 | 231 |
| 1037 | 3300050509 | nmdc:mga0qj67_29761_c1 | nmdc:mga0qj67_29761_c1_1857_2561 | 231 |
| 1038 | 3300050509 | nmdc:mga0qj67_33544_c1 | nmdc:mga0qj67_33544_c1_1823_2518 | 231 |
| 1039 | 3300050509 | nmdc:mga0qj67_437915_c1 | nmdc:mga0qj67_437915_c1_271_975 | 231 |
| 1040 | 3300050510 | nmdc:mga06r32_131021_c1 | nmdc:mga06r32_131021_c1_1353_2057 | 231 |
| 1041 | 3300050510 | nmdc:mga06r32_249618_c1 | nmdc:mga06r32_249618_c1_165_869 | 231 |
| 1042 | 3300050510 | nmdc:mga06r32_29409_c1 | nmdc:mga06r32_29409_c1_2095_2799 | 231 |
| 1043 | 3300050510 | nmdc:mga06r32_356837_c1 | nmdc:mga06r32_356837_c1_116_823 | 231 |
| 1044 | 3300050510 | nmdc:mga06r32_373571_c1 | nmdc:mga06r32_373571_c1_35_739 | 231 |
| 1045 | 3300050510 | nmdc:mga06r32_44234_c1 | nmdc:mga06r32_44234_c1_2722_3426 | 231 |
| 1046 | 3300050510 | nmdc:mga06r32_48449_c1 | nmdc:mga06r32_48449_c1_817_1521 | 231 |
| 1047 | 3300050510 | nmdc:mga06r32_59131_c1 | nmdc:mga06r32_59131_c1_1013_1720 | 231 |
| 1048 | 3300050510 | nmdc:mga06r32_661759_c1 | nmdc:mga06r32_661759_c1_205_900 | 231 |
| 1049 | 3300050510 | nmdc:mga06r32_9782_c1 | nmdc:mga06r32_9782_c1_6344_7039 | 231 |
| 1050 | 3300050511 | nmdc:mga08y16_127224_c1 | nmdc:mga08y16_127224_c1_475_1179 | 231 |
| 1051 | 3300050511 | nmdc:mga08y16_196207_c1 | nmdc:mga08y16_196207_c1_275_970 | 231 |
| 1052 | 3300050511 | nmdc:mga08y16_29105_c1 | nmdc:mga08y16_29105_c1_2519_3223 | 231 |
| 1053 | 3300050511 | nmdc:mga08y16_31371_c1 | nmdc:mga08y16_31371_c1_2725_3429 | 231 |
| 1054 | 3300050511 | nmdc:mga08y16_372185_c1 | nmdc:mga08y16_372185_c1_440_1147 | 231 |
| 1055 | 3300050511 | nmdc:mga08y16_43775_c1 | nmdc:mga08y16_43775_c1_2251_2961 | 231 |
| 1056 | 3300050511 | nmdc:mga08y16_610186_c1 | nmdc:mga08y16_610186_c1_164_871 | 231 |
| 1057 | 3300050511 | nmdc:mga08y16_612888_c1 | nmdc:mga08y16_612888_c1_79_783 | 231 |
| 1058 | 3300050511 | nmdc:mga08y16_68367_c1 | nmdc:mga08y16_68367_c1_1052_1756 | 231 |
| 1059 | 3300050511 | nmdc:mga08y16_8354_c1 | nmdc:mga08y16_8354_c1_1867_2574 | 231 |
| 1060 | 3300050511 | nmdc:mga08y16_87298_c1 | nmdc:mga08y16_87298_c1_752_1456 | 231 |
| 1061 | 3300050512 | nmdc:mga0n895_11464_c1 | nmdc:mga0n895_11464_c1_2599_3303 | 231 |
| 1062 | 3300050512 | nmdc:mga0n895_11831_c1 | nmdc:mga0n895_11831_c1_3411_4118 | 231 |
| 1063 | 3300050512 | nmdc:mga0n895_137187_c1 | nmdc:mga0n895_137187_c1_1231_1935 | 231 |
| 1064 | 3300050512 | nmdc:mga0n895_21827_c1 | nmdc:mga0n895_21827_c1_1816_2523 | 231 |
| 1065 | 3300050512 | nmdc:mga0n895_227_c1 | nmdc:mga0n895_227_c1_2272_2979 | 231 |
| 1066 | 3300050512 | nmdc:mga0n895_288504_c1 | nmdc:mga0n895_288504_c1_462_1166 | 231 |
| 1067 | 3300050512 | nmdc:mga0n895_35341_c1 | nmdc:mga0n895_35341_c1_2459_3163 | 231 |
| 1068 | 3300050512 | nmdc:mga0n895_4474_c1 | nmdc:mga0n895_4474_c1_8884_9579 | 231 |
| 1069 | 3300050512 | nmdc:mga0n895_8678_c1 | nmdc:mga0n895_8678_c1_3769_4476 | 231 |
| 1070 | 3300050513 | nmdc:mga0rr50_12816_c1 | nmdc:mga0rr50_12816_c1_3433_4137 | 231 |
| 1071 | 3300050513 | nmdc:mga0rr50_161712_c1 | nmdc:mga0rr50_161712_c1_75_782 | 231 |
| 1072 | 3300050513 | nmdc:mga0rr50_175_c1 | nmdc:mga0rr50_175_c1_30856_31563 | 231 |
| 1073 | 3300050513 | nmdc:mga0rr50_328378_c1 | nmdc:mga0rr50_328378_c1_284_991 | 231 |
| 1074 | 3300050513 | nmdc:mga0rr50_36190_c1 | nmdc:mga0rr50_36190_c1_267_974 | 231 |
| 1075 | 3300050513 | nmdc:mga0rr50_4207_c1 | nmdc:mga0rr50_4207_c1_3891_4595 | 231 |
| 1076 | 3300050513 | nmdc:mga0rr50_6399_c1 | nmdc:mga0rr50_6399_c1_2807_3514 | 231 |
| 1077 | 3300050513 | nmdc:mga0rr50_750348_c1 | nmdc:mga0rr50_750348_c1_97_801 | 231 |
| 1078 | 3300050513 | nmdc:mga0rr50_9834_c1 | nmdc:mga0rr50_9834_c1_1466_2173 | 231 |
| 1079 | 3300050514 | nmdc:mga08x19_1177_c1 | nmdc:mga08x19_1177_c1_1473_2180 | 231 |
| 1080 | 3300050514 | nmdc:mga08x19_78190_c1 | nmdc:mga08x19_78190_c1_711_1418 | 231 |
| 1081 | 3300050514 | nmdc:mga08x19_83427_c1 | nmdc:mga08x19_83427_c1_774_1481 | 231 |
| 1082 | 3300050514 | nmdc:mga08x19_97097_c1 | nmdc:mga08x19_97097_c1_539_1246 | 231 |
| 1083 | 3300050515 | nmdc:mga0a205_206193_c1 | nmdc:mga0a205_206193_c1_704_1408 | 231 |
| 1084 | 3300050515 | nmdc:mga0a205_26771_c1 | nmdc:mga0a205_26771_c1_1899_2606 | 231 |
| 1085 | 3300050515 | nmdc:mga0a205_279122_c1 | nmdc:mga0a205_279122_c1_623_1327 | 231 |
| 1086 | 3300053077 | Ga0495601_0142718 | Ga0495601_0142718_543_1250 | 231 |
| 1087 | 3300053084 | Ga0495595_0060382 | Ga0495595_0060382_278_985 | 231 |
| 1088 | 3300053084 | Ga0495595_0089139 | Ga0495595_0089139_558_1265 | 231 |
| 1089 | 3300053085 | Ga0495619_0023881 | Ga0495619_0023881_483_1190 | 231 |
| 1090 | 3300053085 | Ga0495619_0169987 | Ga0495619_0169987_215_922 | 231 |
| 1091 | 3300053139 | Ga0500568_0008697 | Ga0500568_0008697_2072_2776 | 231 |
| 1092 | 3300054114 | Ga0501084_0028474 | Ga0501084_0028474_804_1508 | 231 |
| 1093 | 3300054114 | Ga0501084_0076124 | Ga0501084_0076124_432_1136 | 231 |
| 1094 | 3300054114 | Ga0501084_0650630 | Ga0501084_0650630_58_762 | 231 |
| 1095 | 3300059421 | Ga0590071_000639 | Ga0590071_000639_7017_7721 | 231 |
| 1096 | 3300059421 | Ga0590071_000996 | Ga0590071_000996_777_1481 | 231 |
| 1097 | 3300059423 | Ga0590074_000990 | Ga0590074_000990_2074_2778 | 231 |
| 1098 | 3300059423 | Ga0590074_004534 | Ga0590074_004534_157_861 | 231 |
| 1099 | 3300059424 | Ga0590075_000405 | Ga0590075_000405_7252_7956 | 231 |
| 1100 | 3300059424 | Ga0590075_012446 | Ga0590075_012446_119_823 | 231 |
| 1101 | 3300059426 | Ga0590077_000732 | Ga0590077_000732_5685_6389 | 231 |
| 1102 | 3300059426 | Ga0590077_006869 | Ga0590077_006869_913_1617 | 231 |
| 1103 | 3300059508 | Ga0587088_030624 | Ga0587088_030624_22_729 | 231 |
| 1104 | 3300060353 | Ga0501082_0025450 | Ga0501082_0025450_2716_3420 | 231 |
| 1105 | 3300060353 | Ga0501082_0299014 | Ga0501082_0299014_123_827 | 231 |
| 1106 | 3300060353 | Ga0501082_0325312 | Ga0501082_0325312_97_801 | 231 |
| 1107 | 3300060353 | Ga0501082_0640026 | Ga0501082_0640026_153_857 | 231 |
| 1108 | 3300061734 | Ga0530510_0727720 | Ga0530510_0727720_25_729 | 231 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2vpl-assembly1.cif.gz_A | the structure of the complex between the first domain of l1 protein from thermus thermophilus and mrna from methanococcus jannaschii | 0.9393 | 5 | 224 |
| 4wpo-assembly1.cif.gz_AC | crystal structure of the thermus thermophilus 70s ribosome in complex with elongation factor g in the pre-translocational state | 0.936 | 5 | 224 |
| 5j8b-assembly1.cif.gz_C | crystal structure of elongation factor 4 (ef-4/lepa) in complex with gdpcp bound to the thermus thermophilus 70s ribosome | 0.921 | 5 | 224 |
| 4wpo-assembly1.cif.gz_AC | crystal structure of the thermus thermophilus 70s ribosome in complex with elongation factor g in the pre-translocational state | 0.9163 | 5 | 224 |
| 2ov7-assembly3.cif.gz_C | the first domain of the ribosomal protein l1 from thermus thermophilus | 0.9153 | 12 | 224 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2wrrC01 | Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain | 0.9395 | 18 | 224 | 3.30.190.20 |
| 2wrrC01 | Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain | 0.8875 | 18 | 224 | 3.30.190.20 |
| af_Q60E59_194_280_3.40.50.790 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Ribosomal protein L1/L10, domain II | 0.8731 | 73 | 158 | 3.40.50.790 |
| af_I1L5L1_126_340_3.30.190.20 | Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain | 0.873 | 17 | 231 | 3.30.190.20 |
| af_I1L5L1_126_340_3.30.190.20 | Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain | 0.8693 | 17 | 231 | 3.30.190.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A660VFQ9-F1-model_v4 | Large ribosomal subunit protein uL1 | 0.9177 | 1 | 224 |
GO:0000049
GO:0003735 GO:0006412 GO:0006417 GO:0015934 GO:0019843 |
| AF-A0A2H0LTR9-F1-model_v4 | Ribosomal protein | 0.9122 | 57 | 224 |
GO:0003735
GO:0006412 GO:0006417 GO:0015934 GO:0019843 |
| AF-A0A1F4W0B7-F1-model_v4 | Ribosomal protein | 0.9047 | 5 | 224 |
GO:0003735
GO:0006412 GO:0006417 GO:0015934 GO:0019843 |
| AF-A0A356KI38-F1-model_v4 | Large ribosomal subunit protein uL1 | 0.9036 | 2 | 227 |
GO:0000049
GO:0003735 GO:0006412 GO:0006417 GO:0015934 GO:0019843 |
| AF-A0A2H0LTR9-F1-model_v4 | Ribosomal protein | 0.9021 | 57 | 224 |
GO:0003735
GO:0006412 GO:0006417 GO:0015934 GO:0019843 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar