F490210

General Info

Members Datasets Scaffolds Average Seq Length
1110 389 1104 229

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100256254|Ga0070714_1002562541
Length 276
Sequence MSTPPGKLHDHGKFSALGRVSGLAGPGPGPRFGTAVMTRVLVIDDEEPILRALRINLAAHKYEVSTAVDGASGLAAIARDRPDVVILDLGLPDMDGTEVISGVRGWTSMPIIVLSAWGQESQKVAALDAGADDYVTKPFGMGELLARLRVAVRRASPAPDEPVVVSGDFTVDLAAKRVHRQRDGADVRLTPTEWQLLEVLVRHREKLVTQRQLLAEVWGPEYQTEGNYLRVYMAHLRRKLEPDPSRPRYLVTEPGIGYRFTATGSGDASPPEGRSS

Samples

Sample ID Description Type Environment
1 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
2 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
3 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
4 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
5 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
122 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
188 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
189 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
190 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
191 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
192 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
193 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
194 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
195 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
196 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
197 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
198 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
199 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
200 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
201 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
202 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
203 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
204 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
205 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
206 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
207 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
208 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
209 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
210 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
211 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
212 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
213 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
214 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
215 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
216 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
217 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
218 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
219 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
220 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
221 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
222 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
223 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
224 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
225 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
226 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
227 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
228 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
229 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
230 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
231 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
232 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
233 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
234 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
235 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
236 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
237 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
238 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
239 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
240 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
241 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
242 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
243 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
244 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
245 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
246 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
247 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
248 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
249 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
250 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
251 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
252 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
253 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
254 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
255 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
256 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
257 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
258 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
259 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
260 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
261 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
262 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
263 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
264 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
265 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
266 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
267 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
268 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
269 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
270 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
271 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
272 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
273 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
274 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
275 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
276 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
277 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
278 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
279 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
280 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
281 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
282 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
283 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
284 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
285 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
286 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
287 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
288 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
289 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
290 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
291 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
292 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
293 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
294 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
295 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
296 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
297 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
298 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
299 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
300 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
301 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
302 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
303 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
304 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
305 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
306 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
307 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
308 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
309 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
310 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
311 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
312 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
313 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
314 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
315 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
316 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
317 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
318 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
319 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
320 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
321 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
322 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
323 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
324 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
325 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
326 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
327 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
328 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
329 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
330 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
331 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
332 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
333 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
334 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
335 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
336 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
337 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
338 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
339 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
340 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
341 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
342 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
343 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
344 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
345 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
358 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
359 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
360 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
361 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
362 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
363 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
364 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
365 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
366 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
367 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
368 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
371 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
372 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
373 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
374 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
375 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
376 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
377 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
378 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
379 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
380 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
381 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
382 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
383 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
384 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
385 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
386 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
387 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
388 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
389 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.02
Metatranscriptomes 1.44
Isolates 0.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.54
Nodule 0
Rhizoplane 6.04
Rhizosphere 90.63
Stem 0
Stem Tuber 0
Unclassified 2.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10093592 3300002067 Bacteria 862
2 JGI24744J21845_10005151 3300002077 Bacteria 2705
3 JGI25406J46586_10006130 3300003203 Bacteria 5552
4 Ga0070658_10006845 3300005327 Bacteria 9215
5 Ga0070658_10023598 3300005327 Bacteria 4935
6 Ga0070658_10064156 3300005327 Bacteria 2996
7 Ga0070658_10257089 3300005327 Bacteria 1482
8 Ga0070658_10283857 3300005327 Bacteria 1409
9 Ga0070676_10104111 3300005328 Bacteria 1758
10 Ga0070676_10452015 3300005328 Bacteria 903
11 Ga0070683_100004571 3300005329 Bacteria 11420
12 Ga0070683_100059709 3300005329 Bacteria 3543
13 Ga0070683_100064566 3300005329 Bacteria 3408
14 Ga0070683_100101131 3300005329 Bacteria 2714
15 Ga0070683_100113133 3300005329 Bacteria 2561
16 Ga0070683_100127961 3300005329 Bacteria 2402
17 Ga0070683_100144915 3300005329 Bacteria 2250
18 Ga0070683_100153307 3300005329 Bacteria 2185
19 Ga0070683_100167567 3300005329 Bacteria 2085
20 Ga0070683_100232294 3300005329 Bacteria 1753
21 Ga0070683_100321577 3300005329 Bacteria 1472
22 Ga0070670_100081101 3300005331 Bacteria 2788
23 Ga0070670_100628995 3300005331 Bacteria 962
24 Ga0068869_100018522 3300005334 Bacteria 4742
25 Ga0068869_100030074 3300005334 Bacteria 3809
26 Ga0070680_100290980 3300005336 Bacteria 1384
27 Ga0070682_100008855 3300005337 Bacteria 5683
28 Ga0070682_100151536 3300005337 Bacteria 1591
29 Ga0070682_100576076 3300005337 Bacteria 885
30 Ga0068868_100004265 3300005338 Bacteria 10005
31 Ga0068868_100024352 3300005338 Bacteria 4593
32 Ga0070660_100019041 3300005339 Bacteria 5025
33 Ga0070660_100027145 3300005339 Bacteria 4271
34 Ga0070660_100129995 3300005339 Bacteria 2014
35 Ga0070660_100397204 3300005339 Bacteria 1140
36 Ga0070689_100408094 3300005340 Bacteria 1149
37 Ga0070689_100564929 3300005340 Bacteria 982
38 Ga0070691_10024889 3300005341 Bacteria 2785
39 Ga0070691_10101628 3300005341 Bacteria 1428
40 Ga0070661_100030787 3300005344 Bacteria 3878
41 Ga0070661_100085981 3300005344 Bacteria 2324
42 Ga0070661_100457680 3300005344 Bacteria 1016
43 Ga0070661_100499430 3300005344 Bacteria 974
44 Ga0070692_10146692 3300005345 Bacteria 1340
45 Ga0070692_10195973 3300005345 Bacteria 1180
46 Ga0070668_100017010 3300005347 Bacteria 5440
47 Ga0070668_100225900 3300005347 Bacteria 1546
48 Ga0070669_100350604 3300005353 Bacteria 1198
49 Ga0070669_100436787 3300005353 Bacteria 1077
50 Ga0070675_100002740 3300005354 Bacteria 13250
51 Ga0070675_100080840 3300005354 Bacteria 2709
52 Ga0070675_100085263 3300005354 Bacteria 2639
53 Ga0070675_100167581 3300005354 Bacteria 1893
54 Ga0070675_100450683 3300005354 Bacteria 1154
55 Ga0070674_100068747 3300005356 Bacteria 2497
56 Ga0070674_100260495 3300005356 Bacteria 1366
57 Ga0070674_100922664 3300005356 Bacteria 762
58 Ga0070673_100117165 3300005364 Bacteria 2216
59 Ga0070688_100287082 3300005365 Bacteria 1184
60 Ga0070659_100037838 3300005366 Bacteria 3762
61 Ga0070659_100112961 3300005366 Bacteria 2194
62 Ga0070659_100155108 3300005366 Bacteria 1869
63 Ga0070709_10003021 3300005434 Bacteria 9039
64 Ga0070709_10028678 3300005434 Bacteria 3322
65 Ga0070709_10039282 3300005434 Bacteria 2903
66 Ga0070709_10040725 3300005434 Bacteria 2858
67 Ga0070709_10067334 3300005434 Bacteria 2299
68 Ga0070709_10112358 3300005434 Bacteria 1833
69 Ga0070714_100000452 3300005435 Bacteria 29888
70 Ga0070714_100001028 3300005435 Bacteria 19875
71 Ga0070714_100005940 3300005435 Bacteria 9370
72 Ga0070714_100005955 3300005435 Bacteria 9363
73 Ga0070714_100082551 3300005435 Bacteria 2800
74 Ga0070714_100083836 3300005435 Bacteria 2780
75 Ga0070714_100256254 3300005435 Bacteria 1619
76 Ga0070714_100276806 3300005435 Bacteria 1558
77 Ga0070713_100007261 3300005436 Bacteria 7760
78 Ga0070713_100010227 3300005436 Bacteria 6771
79 Ga0070713_100024420 3300005436 Bacteria 4707
80 Ga0070713_100037406 3300005436 Bacteria 3924
81 Ga0070713_100065592 3300005436 Bacteria 3051
82 Ga0070713_100147037 3300005436 Bacteria 2093
83 Ga0070713_100280114 3300005436 Bacteria 1529
84 Ga0070713_100292505 3300005436 Bacteria 1497
85 Ga0070713_100330256 3300005436 Bacteria 1410
86 Ga0070710_10008259 3300005437 Bacteria 5067
87 Ga0070710_10018475 3300005437 Bacteria 3587
88 Ga0070710_10082483 3300005437 Bacteria 1880
89 Ga0070710_10088860 3300005437 Bacteria 1819
90 Ga0070710_10184202 3300005437 Bacteria 1309
91 Ga0070701_10006868 3300005438 Bacteria 4816
92 Ga0070701_10025713 3300005438 Bacteria 2862
93 Ga0070711_100021021 3300005439 Bacteria 4215
94 Ga0070711_100032826 3300005439 Bacteria 3454
95 Ga0070711_100043948 3300005439 Bacteria 3029
96 Ga0070705_100076262 3300005440 Bacteria 2044
97 Ga0070705_100123531 3300005440 Bacteria 1675
98 Ga0070700_100009488 3300005441 Bacteria 5345
99 Ga0070700_100033665 3300005441 Bacteria 3088
100 Ga0070700_100278561 3300005441 Bacteria 1212
101 Ga0070708_100534018 3300005445 Bacteria 1106
102 Ga0070663_100026326 3300005455 Bacteria 3939
103 Ga0070663_100055561 3300005455 Bacteria 2834
104 Ga0070663_100085492 3300005455 Bacteria 2328
105 Ga0070663_100233430 3300005455 Bacteria 1449
106 Ga0070663_100331677 3300005455 Bacteria 1226
107 Ga0070678_100015224 3300005456 Bacteria 4882
108 Ga0070678_100096045 3300005456 Bacteria 2285
109 Ga0070678_100224580 3300005456 Bacteria 1562
110 Ga0070662_100063633 3300005457 Bacteria 2699
111 Ga0070681_10009600 3300005458 Bacteria 9514
112 Ga0070681_10313312 3300005458 Bacteria 1479
113 Ga0070681_10419697 3300005458 Bacteria 1250
114 Ga0068867_100007002 3300005459 Bacteria 7968
115 Ga0070685_10043361 3300005466 Bacteria 2571
116 Ga0070685_10060364 3300005466 Bacteria 2217
117 Ga0070685_10064127 3300005466 Bacteria 2160
118 Ga0070685_10391648 3300005466 Bacteria 960
119 Ga0070706_100001048 3300005467 Bacteria 30008
120 Ga0070706_100003836 3300005467 Bacteria 14695
121 Ga0070706_100005036 3300005467 Bacteria 12629
122 Ga0070706_100006933 3300005467 Bacteria 10691
123 Ga0070706_100007675 3300005467 Bacteria 10090
124 Ga0070706_100079469 3300005467 Bacteria 3035
125 Ga0070706_100088284 3300005467 Bacteria 2875
126 Ga0070706_100208006 3300005467 Bacteria 1827
127 Ga0070706_100631577 3300005467 Bacteria 994
128 Ga0070706_100906047 3300005467 Bacteria 815
129 Ga0070707_100000792 3300005468 Bacteria 31220
130 Ga0070707_100023200 3300005468 Bacteria 5869
131 Ga0070707_100029054 3300005468 Bacteria 5262
132 Ga0070707_100035864 3300005468 Bacteria 4732
133 Ga0070707_100045292 3300005468 Bacteria 4211
134 Ga0070707_100120283 3300005468 Bacteria 2549
135 Ga0070707_100121840 3300005468 Bacteria 2532
136 Ga0070707_100233253 3300005468 Bacteria 1791
137 Ga0070707_100372866 3300005468 Bacteria 1387
138 Ga0070698_100006771 3300005471 Bacteria 12423
139 Ga0070698_100008876 3300005471 Bacteria 10807
140 Ga0070698_100011521 3300005471 Bacteria 9383
141 Ga0070698_100037550 3300005471 Bacteria 4994
142 Ga0070698_100038643 3300005471 Bacteria 4917
143 Ga0070698_100076311 3300005471 Bacteria 3354
144 Ga0070698_100077164 3300005471 Bacteria 3332
145 Ga0070698_100118694 3300005471 Bacteria 2606
146 Ga0070698_100222699 3300005471 Bacteria 1820
147 Ga0070698_100322806 3300005471 Bacteria 1475
148 Ga0070699_100001575 3300005518 Bacteria 20852
149 Ga0070699_100002101 3300005518 Bacteria 18041
150 Ga0070699_100068500 3300005518 Bacteria 3082
151 Ga0070699_100321845 3300005518 Bacteria 1390
152 Ga0070699_100529912 3300005518 Bacteria 1071
153 Ga0070699_100703631 3300005518 Bacteria 923
154 Ga0070679_100003755 3300005530 Bacteria 13929
155 Ga0070679_100008909 3300005530 Bacteria 9470
156 Ga0070679_100031308 3300005530 Bacteria 5254
157 Ga0070679_100111734 3300005530 Bacteria 2719
158 Ga0070679_100745761 3300005530 Bacteria 922
159 Ga0070679_100873675 3300005530 Bacteria 842
160 Ga0070684_100019147 3300005535 Bacteria 5660
161 Ga0070684_100019292 3300005535 Bacteria 5638
162 Ga0070684_100158834 3300005535 Bacteria 2050
163 Ga0070684_100200043 3300005535 Bacteria 1819
164 Ga0070684_100230379 3300005535 Bacteria 1691
165 Ga0070684_100743007 3300005535 Bacteria 916
166 Ga0070684_100880707 3300005535 Bacteria 838
167 Ga0070697_100010976 3300005536 Bacteria 7077
168 Ga0070697_100061101 3300005536 Bacteria 3073
169 Ga0068853_100163892 3300005539 Bacteria 2007
170 Ga0068853_100257281 3300005539 Bacteria 1604
171 Ga0070672_100001312 3300005543 Bacteria 15342
172 Ga0070686_100020181 3300005544 Bacteria 3941
173 Ga0070686_100112921 3300005544 Bacteria 1854
174 Ga0070686_100154360 3300005544 Bacteria 1611
175 Ga0070695_100099157 3300005545 Bacteria 1959
176 Ga0070696_100103024 3300005546 Bacteria 2047
177 Ga0070693_100050430 3300005547 Bacteria 2379
178 Ga0070693_100060807 3300005547 Bacteria 2194
179 Ga0070693_100152791 3300005547 Bacteria 1464
180 Ga0070693_100223269 3300005547 Bacteria 1235
181 Ga0070665_100054642 3300005548 Bacteria 4005
182 Ga0070665_100589065 3300005548 Bacteria 1125
183 Ga0068855_100058270 3300005563 Bacteria 4524
184 Ga0068855_100097460 3300005563 Bacteria 3387
185 Ga0070664_100009193 3300005564 Bacteria 8023
186 Ga0070664_100299231 3300005564 Bacteria 1454
187 Ga0070664_100355724 3300005564 Bacteria 1333
188 Ga0070664_100460177 3300005564 Bacteria 1169
189 Ga0070664_100548494 3300005564 Bacteria 1069
190 Ga0068857_100004338 3300005577 Bacteria 11970
191 Ga0068857_100045347 3300005577 Bacteria 3900
192 Ga0068857_100073149 3300005577 Bacteria 3053
193 Ga0068857_100400311 3300005577 Bacteria 1277
194 Ga0068857_100497630 3300005577 Bacteria 1144
195 Ga0068854_100011357 3300005578 Bacteria 5794
196 Ga0068854_100013890 3300005578 Bacteria 5296
197 Ga0068854_100028924 3300005578 Bacteria 3833
198 Ga0068856_100108541 3300005614 Bacteria 2772
199 Ga0068856_100530346 3300005614 Bacteria 1198
200 Ga0070702_100007486 3300005615 Bacteria 5232
201 Ga0070702_100017373 3300005615 Bacteria 3710
202 Ga0070702_100025155 3300005615 Bacteria 3186
203 Ga0070702_100237246 3300005615 Bacteria 1229
204 Ga0070702_100379323 3300005615 Bacteria 1005
205 Ga0068852_100192661 3300005616 Bacteria 1924
206 Ga0068859_100041006 3300005617 Bacteria 4650
207 Ga0068864_100012042 3300005618 Bacteria 7143
208 Ga0068864_100068223 3300005618 Bacteria 3089
209 Ga0068864_100244236 3300005618 Bacteria 1664
210 Ga0068864_100403177 3300005618 Bacteria 1300
211 Ga0068864_100645846 3300005618 Bacteria 1030
212 Ga0068864_101067031 3300005618 Bacteria 803
213 Ga0068866_10071920 3300005718 Bacteria 1831
214 Ga0068866_10092394 3300005718 Bacteria 1651
215 Ga0068861_100014698 3300005719 Bacteria 5497
216 Ga0068861_100069261 3300005719 Bacteria 2729
217 Ga0068851_10114771 3300005834 Bacteria 1442
218 Ga0068870_10007764 3300005840 Bacteria 4797
219 Ga0068870_10068076 3300005840 Bacteria 1933
220 Ga0068863_100092777 3300005841 Bacteria 2865
221 Ga0068863_100853033 3300005841 Bacteria 910
222 Ga0068858_100070389 3300005842 Bacteria 3243
223 Ga0068858_100224105 3300005842 Bacteria 1781
224 Ga0068858_100573081 3300005842 Bacteria 1094
225 Ga0068860_100021498 3300005843 Bacteria 6247
226 Ga0068860_100115439 3300005843 Bacteria 2568
227 Ga0068860_100152796 3300005843 Bacteria 2223
228 Ga0068860_100231940 3300005843 Bacteria 1794
229 Ga0068860_100269611 3300005843 Bacteria 1661
230 Ga0068860_100740566 3300005843 Bacteria 994
231 Ga0068862_100014232 3300005844 Bacteria 6597
232 Ga0068862_100227134 3300005844 Bacteria 1692
233 Ga0068862_100252439 3300005844 Bacteria 1608
234 Ga0081540_1000345 3300005983 Bacteria 46912
235 Ga0081540_1001308 3300005983 Bacteria 21736
236 Ga0081540_1006178 3300005983 Bacteria 8781
237 Ga0081539_10003383 3300005985 Bacteria 19743
238 Ga0081539_10005543 3300005985 Bacteria 12795
239 Ga0081539_10010664 3300005985 Bacteria 7415
240 Ga0081539_10027029 3300005985 Bacteria 3643
241 Ga0081539_10027830 3300005985 Bacteria 3571
242 Ga0081539_10176204 3300005985 Bacteria 1007
243 Ga0070717_10007804 3300006028 Bacteria 7962
244 Ga0070717_10018129 3300006028 Bacteria 5492
245 Ga0070717_10046161 3300006028 Bacteria 3563
246 Ga0070717_10052576 3300006028 Bacteria 3356
247 Ga0070717_10058504 3300006028 Bacteria 3188
248 Ga0070717_10119623 3300006028 Bacteria 2255
249 Ga0070717_10175368 3300006028 Bacteria 1866
250 Ga0070717_10368294 3300006028 Bacteria 1287
251 Ga0070717_10514079 3300006028 Bacteria 1083
252 Ga0070717_10624459 3300006028 Bacteria 978
253 Ga0070715_10001476 3300006163 Bacteria 6841
254 Ga0070715_10050842 3300006163 Bacteria 1781
255 Ga0070715_10179863 3300006163 Bacteria 1060
256 Ga0070716_100001463 3300006173 Bacteria 10525
257 Ga0070716_100019289 3300006173 Bacteria 3562
258 Ga0070716_100076159 3300006173 Bacteria 1987
259 Ga0070712_100071500 3300006175 Bacteria 2482
260 Ga0070712_100260485 3300006175 Bacteria 1389
261 Ga0070712_100266517 3300006175 Bacteria 1374
262 Ga0097621_100215728 3300006237 Bacteria 1670
263 Ga0097621_100311445 3300006237 Bacteria 1393
264 Ga0097621_100627844 3300006237 Bacteria 984
265 Ga0075428_100553200 3300006844 Bacteria 1230
266 Ga0075428_100717706 3300006844 Bacteria 1065
267 Ga0075431_100073239 3300006847 Bacteria 3534
268 Ga0075431_100075900 3300006847 Bacteria 3468
269 Ga0075431_100106830 3300006847 Bacteria 2888
270 Ga0075434_100389538 3300006871 Bacteria 1414
271 Ga0068865_100011812 3300006881 Bacteria 5476
272 Ga0068865_100096507 3300006881 Bacteria 2156
273 Ga0068865_100374407 3300006881 Bacteria 1160
274 Ga0075436_100004827 3300006914 Bacteria 9266
275 Ga0075436_100020931 3300006914 Bacteria 4486
276 Ga0097620_100041008 3300006931 Bacteria 4650
277 Ga0105240_10273382 3300009093 Bacteria 1944
278 Ga0105240_10350751 3300009093 Bacteria 1674
279 Ga0105240_10609138 3300009093 Bacteria 1201
280 Ga0111539_10001402 3300009094 Bacteria 32087
281 Ga0111539_10024563 3300009094 Bacteria 7392
282 Ga0111539_10865089 3300009094 Bacteria 1052
283 Ga0105245_10017866 3300009098 Bacteria 6193
284 Ga0105245_10028596 3300009098 Bacteria 4919
285 Ga0105245_10101497 3300009098 Bacteria 2663
286 Ga0105245_10163393 3300009098 Bacteria 2114
287 Ga0105245_10500369 3300009098 Bacteria 1231
288 Ga0105247_10540866 3300009101 Bacteria 855
289 Ga0114129_10024315 3300009147 Bacteria 8583
290 Ga0114129_10216522 3300009147 Bacteria 2586
291 Ga0114129_10333104 3300009147 Bacteria 2015
292 Ga0105243_10002861 3300009148 Bacteria 14307
293 Ga0105243_10150131 3300009148 Bacteria 1998
294 Ga0105243_10275198 3300009148 Bacteria 1514
295 Ga0105243_10277580 3300009148 Bacteria 1508
296 Ga0105243_10316852 3300009148 Bacteria 1420
297 Ga0105243_10341615 3300009148 Bacteria 1371
298 Ga0105243_10362608 3300009148 Bacteria 1334
299 Ga0105241_10103218 3300009174 Bacteria 2270
300 Ga0105242_10010464 3300009176 Bacteria 7119
301 Ga0105242_10073410 3300009176 Bacteria 2844
302 Ga0105242_10208554 3300009176 Bacteria 1740
303 Ga0105242_11072563 3300009176 Bacteria 818
304 Ga0105248_10109534 3300009177 Bacteria 3114
305 Ga0105248_10604018 3300009177 Bacteria 1238
306 Ga0105238_10049831 3300009551 Bacteria 4216
307 Ga0105238_10119356 3300009551 Bacteria 2617
308 Ga0105238_10159425 3300009551 Bacteria 2231
309 Ga0105238_10229245 3300009551 Bacteria 1834
310 Ga0105238_10291352 3300009551 Bacteria 1614
311 Ga0105249_10016248 3300009553 Bacteria 6601
312 Ga0105249_10130704 3300009553 Bacteria 2397
313 Ga0105249_10169960 3300009553 Bacteria 2113
314 Ga0105249_10697895 3300009553 Bacteria 1075
315 Ga0105239_10109864 3300010375 Bacteria 3056
316 Ga0105239_10130301 3300010375 Bacteria 2797
317 Ga0105239_10201441 3300010375 Bacteria 2230
318 Ga0105239_10238761 3300010375 Bacteria 2040
319 Ga0105246_10032876 3300011119 Bacteria 3443
320 Ga0105246_10093187 3300011119 Bacteria 2175
321 Ga0105246_10095239 3300011119 Bacteria 2155
322 Ga0105246_10919680 3300011119 Bacteria 786
323 Ga0157342_1008389 3300012507 Bacteria 1022
324 Ga0157371_10431412 3300013102 Bacteria 967
325 Ga0157370_10170964 3300013104 Bacteria 2020
326 Ga0157370_10304658 3300013104 Bacteria 1470
327 Ga0157369_10006230 3300013105 Bacteria 13844
328 Ga0157369_10009643 3300013105 Bacteria 11042
329 Ga0157369_10043686 3300013105 Bacteria 4884
330 Ga0157369_10223548 3300013105 Bacteria 1970
331 Ga0157374_10223871 3300013296 Bacteria 1847
332 Ga0157374_10649385 3300013296 Bacteria 1067
333 Ga0157378_10176077 3300013297 Bacteria 2009
334 Ga0157378_10498396 3300013297 Bacteria 1216
335 Ga0163162_10033664 3300013306 Bacteria 5093
336 Ga0163162_10236810 3300013306 Bacteria 1956
337 Ga0163162_10833720 3300013306 Bacteria 1038
338 Ga0157372_10070802 3300013307 Bacteria 3925
339 Ga0157372_10090164 3300013307 Bacteria 3484
340 Ga0157372_10634069 3300013307 Bacteria 1245
341 Ga0157372_10750118 3300013307 Bacteria 1135
342 Ga0157372_10770623 3300013307 Bacteria 1118
343 Ga0157375_10077212 3300013308 Bacteria 3359
344 Ga0157375_10144159 3300013308 Bacteria 2511
345 Ga0157375_10218869 3300013308 Bacteria 2062
346 Ga0163163_10003412 3300014325 Bacteria 13498
347 Ga0163163_10101314 3300014325 Bacteria 2902
348 Ga0163163_10124358 3300014325 Bacteria 2616
349 Ga0163163_10327439 3300014325 Bacteria 1586
350 Ga0163163_10357935 3300014325 Bacteria 1516
351 Ga0157380_10014664 3300014326 Bacteria 5739
352 Ga0157380_10482740 3300014326 Bacteria 1199
353 Ga0157380_10532211 3300014326 Bacteria 1149
354 Ga0157380_10720355 3300014326 Bacteria 1005
355 Ga0157377_10001840 3300014745 Bacteria 9255
356 Ga0157377_10070554 3300014745 Bacteria 2018
357 Ga0157379_10005808 3300014968 Bacteria 10614
358 Ga0157379_10187756 3300014968 Bacteria 1868
359 Ga0157379_10279803 3300014968 Bacteria 1518
360 Ga0157379_10941423 3300014968 Bacteria 821
361 Ga0157376_10025898 3300014969 Bacteria 4626
362 Ga0157376_10116353 3300014969 Bacteria 2362
363 Ga0157376_10154488 3300014969 Bacteria 2073
364 Ga0163161_10052133 3300017792 Bacteria 2965
365 Ga0197907_11154562 3300020069 Bacteria 798
366 Ga0206356_10064106 3300020070 Bacteria 1258
367 Ga0206356_10374739 3300020070 Bacteria 1315
368 Ga0206351_10623328 3300020077 Bacteria 1113
369 Ga0206350_10545162 3300020080 Bacteria 1169
370 Ga0206350_11332998 3300020080 Bacteria 2318
371 Ga0206353_10430810 3300020082 Bacteria 2728
372 Ga0206353_10680297 3300020082 Bacteria 2431
373 Ga0206353_10837455 3300020082 Bacteria 4788
374 Ga0206353_11138628 3300020082 Bacteria 1790
375 Ga0213875_10045485 3300021388 Bacteria 2060
376 Ga0213875_10053546 3300021388 Bacteria 1890
377 Ga0224712_10003657 3300022467 Bacteria 4032
378 Ga0224712_10009872 3300022467 Bacteria 2896
379 Ga0224712_10012296 3300022467 Bacteria 2687
380 Ga0224712_10022462 3300022467 Bacteria 2175
381 Ga0224712_10172980 3300022467 Bacteria 969
382 Ga0224712_10210403 3300022467 Bacteria 887
383 Ga0207697_10076100 3300025315 Bacteria 1410
384 Ga0207656_10105874 3300025321 Bacteria 1294
385 Ga0207692_10001219 3300025898 Bacteria 9545
386 Ga0207692_10048644 3300025898 Bacteria 2136
387 Ga0207692_10231762 3300025898 Bacteria 1099
388 Ga0207692_10379978 3300025898 Bacteria 877
389 Ga0207642_10046425 3300025899 Bacteria 1935
390 Ga0207688_10003336 3300025901 Bacteria 8774
391 Ga0207688_10011417 3300025901 Bacteria 4836
392 Ga0207688_10121591 3300025901 Bacteria 1524
393 Ga0207688_10128231 3300025901 Bacteria 1485
394 Ga0207647_10045140 3300025904 Bacteria 2750
395 Ga0207647_10053383 3300025904 Bacteria 2491
396 Ga0207647_10210887 3300025904 Bacteria 1122
397 Ga0207685_10017954 3300025905 Bacteria 2300
398 Ga0207685_10056915 3300025905 Bacteria 1532
399 Ga0207699_10010674 3300025906 Bacteria 4619
400 Ga0207699_10018548 3300025906 Bacteria 3689
401 Ga0207699_10069684 3300025906 Bacteria 2145
402 Ga0207699_10084580 3300025906 Bacteria 1976
403 Ga0207699_10094201 3300025906 Bacteria 1886
404 Ga0207699_10300896 3300025906 Bacteria 1120
405 Ga0207645_10031739 3300025907 Bacteria 3397
406 Ga0207645_10094505 3300025907 Bacteria 1924
407 Ga0207643_10014808 3300025908 Bacteria 4241
408 Ga0207643_10023975 3300025908 Bacteria 3367
409 Ga0207705_10014311 3300025909 Bacteria 5709
410 Ga0207705_10020113 3300025909 Bacteria 4775
411 Ga0207705_10262640 3300025909 Bacteria 1318
412 Ga0207684_10002703 3300025910 Bacteria 17712
413 Ga0207684_10004377 3300025910 Bacteria 13330
414 Ga0207684_10011882 3300025910 Bacteria 7590
415 Ga0207684_10020585 3300025910 Bacteria 5637
416 Ga0207684_10027199 3300025910 Bacteria 4876
417 Ga0207684_10098696 3300025910 Bacteria 2494
418 Ga0207684_10103864 3300025910 Bacteria 2430
419 Ga0207684_10164710 3300025910 Bacteria 1910
420 Ga0207684_10224693 3300025910 Bacteria 1620
421 Ga0207684_10281699 3300025910 Bacteria 1433
422 Ga0207654_10051541 3300025911 Bacteria 2369
423 Ga0207707_10001352 3300025912 Bacteria 22855
424 Ga0207707_10303303 3300025912 Bacteria 1381
425 Ga0207693_10011242 3300025915 Bacteria 7246
426 Ga0207693_10055473 3300025915 Bacteria 3109
427 Ga0207693_10122229 3300025915 Bacteria 2045
428 Ga0207693_10177362 3300025915 Bacteria 1677
429 Ga0207663_10016400 3300025916 Bacteria 4107
430 Ga0207663_10176131 3300025916 Bacteria 1523
431 Ga0207663_10517600 3300025916 Bacteria 929
432 Ga0207660_10492199 3300025917 Bacteria 994
433 Ga0207662_10039032 3300025918 Bacteria 2783
434 Ga0207657_10013739 3300025919 Bacteria 7926
435 Ga0207657_10028157 3300025919 Bacteria 5131
436 Ga0207657_10735171 3300025919 Bacteria 765
437 Ga0207649_10066986 3300025920 Bacteria 2278
438 Ga0207649_10165670 3300025920 Bacteria 1535
439 Ga0207652_10008724 3300025921 Bacteria 8160
440 Ga0207652_10016769 3300025921 Bacteria 5985
441 Ga0207652_10147526 3300025921 Bacteria 2106
442 Ga0207652_10341302 3300025921 Bacteria 1352
443 Ga0207652_10351540 3300025921 Bacteria 1330
444 Ga0207652_10437911 3300025921 Bacteria 1178
445 Ga0207646_10001043 3300025922 Bacteria 35345
446 Ga0207646_10003277 3300025922 Bacteria 18442
447 Ga0207646_10006902 3300025922 Bacteria 11663
448 Ga0207646_10036661 3300025922 Bacteria 4426
449 Ga0207646_10066969 3300025922 Bacteria 3206
450 Ga0207646_10108168 3300025922 Bacteria 2494
451 Ga0207646_10112799 3300025922 Bacteria 2440
452 Ga0207646_10125319 3300025922 Bacteria 2309
453 Ga0207646_10175844 3300025922 Bacteria 1933
454 Ga0207646_10214371 3300025922 Bacteria 1739
455 Ga0207646_10378277 3300025922 Bacteria 1279
456 Ga0207694_10266117 3300025924 Bacteria 1405
457 Ga0207650_10781202 3300025925 Bacteria 809
458 Ga0207659_10004462 3300025926 Bacteria 8473
459 Ga0207659_10301483 3300025926 Bacteria 1316
460 Ga0207687_10012294 3300025927 Bacteria 5597
461 Ga0207687_10044430 3300025927 Bacteria 3066
462 Ga0207687_10117011 3300025927 Bacteria 1988
463 Ga0207687_10242425 3300025927 Bacteria 1429
464 Ga0207700_10012464 3300025928 Bacteria 5484
465 Ga0207700_10017983 3300025928 Bacteria 4735
466 Ga0207700_10032895 3300025928 Bacteria 3704
467 Ga0207700_10034300 3300025928 Bacteria 3642
468 Ga0207700_10050547 3300025928 Bacteria 3098
469 Ga0207700_10085111 3300025928 Bacteria 2481
470 Ga0207700_10118893 3300025928 Bacteria 2139
471 Ga0207700_10223870 3300025928 Bacteria 1596
472 Ga0207700_10279193 3300025928 Bacteria 1436
473 Ga0207700_10319977 3300025928 Bacteria 1344
474 Ga0207700_10413001 3300025928 Bacteria 1184
475 Ga0207664_10001219 3300025929 Bacteria 17030
476 Ga0207664_10001859 3300025929 Bacteria 13926
477 Ga0207664_10002401 3300025929 Bacteria 12385
478 Ga0207664_10010461 3300025929 Bacteria 6554
479 Ga0207664_10017597 3300025929 Bacteria 5244
480 Ga0207664_10045207 3300025929 Bacteria 3452
481 Ga0207664_10050425 3300025929 Bacteria 3282
482 Ga0207664_10078311 3300025929 Bacteria 2681
483 Ga0207664_10130081 3300025929 Bacteria 2118
484 Ga0207664_10154753 3300025929 Bacteria 1951
485 Ga0207664_10199746 3300025929 Bacteria 1725
486 Ga0207644_10704144 3300025931 Bacteria 842
487 Ga0207690_10262610 3300025932 Bacteria 1338
488 Ga0207706_10101311 3300025933 Bacteria 2534
489 Ga0207706_10188207 3300025933 Bacteria 1812
490 Ga0207686_10199327 3300025934 Bacteria 1433
491 Ga0207686_10233304 3300025934 Bacteria 1335
492 Ga0207709_10021557 3300025935 Bacteria 3649
493 Ga0207709_10040829 3300025935 Bacteria 2780
494 Ga0207709_10049174 3300025935 Bacteria 2572
495 Ga0207709_10056214 3300025935 Bacteria 2435
496 Ga0207670_10076188 3300025936 Bacteria 2333
497 Ga0207669_10050661 3300025937 Bacteria 2484
498 Ga0207669_10199851 3300025937 Bacteria 1450
499 Ga0207669_10354556 3300025937 Bacteria 1135
500 Ga0207704_10060273 3300025938 Bacteria 2347
501 Ga0207704_10676032 3300025938 Bacteria 852
502 Ga0207665_10000937 3300025939 Bacteria 19776
503 Ga0207665_10025697 3300025939 Bacteria 3886
504 Ga0207665_10044338 3300025939 Bacteria 2976
505 Ga0207691_10002759 3300025940 Bacteria 17117
506 Ga0207691_10043103 3300025940 Bacteria 4159
507 Ga0207691_10648383 3300025940 Bacteria 892
508 Ga0207711_10157543 3300025941 Bacteria 2053
509 Ga0207689_10028926 3300025942 Bacteria 4632
510 Ga0207689_10078275 3300025942 Bacteria 2717
511 Ga0207689_10284620 3300025942 Bacteria 1369
512 Ga0207689_10316061 3300025942 Bacteria 1296
513 Ga0207661_10020538 3300025944 Bacteria 4938
514 Ga0207661_10082632 3300025944 Bacteria 2656
515 Ga0207661_10246257 3300025944 Bacteria 1587
516 Ga0207661_10279300 3300025944 Bacteria 1492
517 Ga0207661_10298439 3300025944 Bacteria 1444
518 Ga0207679_10059848 3300025945 Bacteria 2827
519 Ga0207679_10083461 3300025945 Bacteria 2449
520 Ga0207679_10315845 3300025945 Bacteria 1351
521 Ga0207679_10412030 3300025945 Bacteria 1191
522 Ga0207667_10783030 3300025949 Bacteria 951
523 Ga0207651_10447590 3300025960 Bacteria 1108
524 Ga0207712_10041209 3300025961 Bacteria 3173
525 Ga0207712_10455059 3300025961 Bacteria 1086
526 Ga0207668_10818972 3300025972 Bacteria 825
527 Ga0207640_10034135 3300025981 Bacteria 3172
528 Ga0207640_10485021 3300025981 Bacteria 1026
529 Ga0207640_10592054 3300025981 Bacteria 938
530 Ga0207677_10065603 3300026023 Bacteria 2534
531 Ga0207677_10153779 3300026023 Bacteria 1778
532 Ga0207677_10161080 3300026023 Bacteria 1743
533 Ga0207677_10258882 3300026023 Bacteria 1417
534 Ga0207677_10557749 3300026023 Bacteria 999
535 Ga0207677_10645376 3300026023 Bacteria 934
536 Ga0207703_10082642 3300026035 Bacteria 2681
537 Ga0207703_10182944 3300026035 Bacteria 1850
538 Ga0207703_10344111 3300026035 Bacteria 1371
539 Ga0207639_10294704 3300026041 Bacteria 1432
540 Ga0207678_10013263 3300026067 Bacteria 7232
541 Ga0207678_10112010 3300026067 Bacteria 2328
542 Ga0207678_10116286 3300026067 Bacteria 2282
543 Ga0207678_10361747 3300026067 Bacteria 1252
544 Ga0207678_10414828 3300026067 Bacteria 1167
545 Ga0207708_10000171 3300026075 Bacteria 51434
546 Ga0207708_10013641 3300026075 Bacteria 6070
547 Ga0207708_10047624 3300026075 Bacteria 3263
548 Ga0207708_10141025 3300026075 Bacteria 1891
549 Ga0207702_10098834 3300026078 Bacteria 2572
550 Ga0207702_10406511 3300026078 Bacteria 1314
551 Ga0207702_10534781 3300026078 Bacteria 1145
552 Ga0207641_10067667 3300026088 Bacteria 3061
553 Ga0207648_10000926 3300026089 Bacteria 33052
554 Ga0207648_10021225 3300026089 Bacteria 5838
555 Ga0207648_10273380 3300026089 Bacteria 1510
556 Ga0207676_10023529 3300026095 Bacteria 4547
557 Ga0207676_10060211 3300026095 Bacteria 3002
558 Ga0207676_10534115 3300026095 Bacteria 1118
559 Ga0207674_10002791 3300026116 Bacteria 21738
560 Ga0207674_10003072 3300026116 Bacteria 20651
561 Ga0207674_10021296 3300026116 Bacteria 6986
562 Ga0207674_10043441 3300026116 Bacteria 4634
563 Ga0207674_10050070 3300026116 Bacteria 4269
564 Ga0207674_10062060 3300026116 Bacteria 3775
565 Ga0207674_10330823 3300026116 Bacteria 1473
566 Ga0207675_100021690 3300026118 Bacteria 5978
567 Ga0207675_100045873 3300026118 Bacteria 4082
568 Ga0207683_10040527 3300026121 Bacteria 4065
569 Ga0207683_10044001 3300026121 Bacteria 3902
570 Ga0207683_10542743 3300026121 Bacteria 1075
571 Ga0207698_10013511 3300026142 Bacteria 5390
572 Ga0207698_10087552 3300026142 Bacteria 2537
573 Ga0207428_10018301 3300027907 Bacteria 5986
574 Ga0207428_10170260 3300027907 Bacteria 1650
575 Ga0207428_10312454 3300027907 Bacteria 1162
576 Ga0268266_10037281 3300028379 Bacteria 4143
577 Ga0268266_10148443 3300028379 Bacteria 2111
578 Ga0268265_10021593 3300028380 Bacteria 4513
579 Ga0268265_10158734 3300028380 Bacteria 1918
580 Ga0268265_10303887 3300028380 Bacteria 1438
581 Ga0268265_10764455 3300028380 Bacteria 939
582 Ga0268265_10838033 3300028380 Bacteria 899
583 Ga0268264_10015344 3300028381 Bacteria 6283
584 Ga0268264_10016885 3300028381 Bacteria 5975
585 Ga0268264_10102534 3300028381 Bacteria 2490
586 Ga0268264_10147125 3300028381 Bacteria 2108
587 Ga0268264_10223668 3300028381 Bacteria 1734
588 Ga0268264_10732260 3300028381 Bacteria 984
589 Ga0265337_1007835 3300028556 Bacteria 3957
590 Ga0265326_10007791 3300028558 Bacteria 3263
591 Ga0265319_1000101 3300028563 Bacteria 66582
592 Ga0265319_1004032 3300028563 Bacteria 7433
593 Ga0265334_10003352 3300028573 Bacteria 7312
594 Ga0265318_10000112 3300028577 Bacteria 75202
595 Ga0265318_10001261 3300028577 Bacteria 15307
596 Ga0265318_10061405 3300028577 Bacteria 1400
597 Ga0265323_10009626 3300028653 Bacteria 3938
598 Ga0265322_10006720 3300028654 Bacteria 3379
599 Ga0265336_10001704 3300028666 Bacteria 9695
600 Ga0265336_10014619 3300028666 Bacteria 2595
601 Ga0307515_10000042 3300028794 Bacteria 309141
602 Ga0307515_10014744 3300028794 Bacteria 14459
603 Ga0307515_10030070 3300028794 Bacteria 9144
604 Ga0265338_10000743 3300028800 Bacteria 55581
605 Ga0265338_10001346 3300028800 Bacteria 40029
606 Ga0265338_10005011 3300028800 Bacteria 17505
607 Ga0265338_10006911 3300028800 Bacteria 14280
608 Ga0265338_10057494 3300028800 Bacteria 3440
609 Ga0265338_10066202 3300028800 Bacteria 3128
610 Ga0265324_10010807 3300029957 Bacteria 3501
611 Ga0307512_10007084 3300030522 Bacteria 11176
612 Ga0307512_10027813 3300030522 Bacteria 4968
613 Ga0265330_10000056 3300031235 Bacteria 100283
614 Ga0265332_10000050 3300031238 Bacteria 112449
615 Ga0265332_10002184 3300031238 Bacteria 10071
616 Ga0265328_10001238 3300031239 Bacteria 11839
617 Ga0265320_10000115 3300031240 Bacteria 69750
618 Ga0265320_10005115 3300031240 Bacteria 8473
619 Ga0265320_10109686 3300031240 Bacteria 1265
620 Ga0265325_10000326 3300031241 Bacteria 33654
621 Ga0265325_10001667 3300031241 Bacteria 15409
622 Ga0265325_10035966 3300031241 Bacteria 2626
623 Ga0265329_10000048 3300031242 Bacteria 51268
624 Ga0265340_10001141 3300031247 Bacteria 15183
625 Ga0265340_10001852 3300031247 Bacteria 12068
626 Ga0265339_10006545 3300031249 Bacteria 7634
627 Ga0265339_10007679 3300031249 Bacteria 6938
628 Ga0265339_10041381 3300031249 Bacteria 2558
629 Ga0265331_10000335 3300031250 Bacteria 50304
630 Ga0265316_10001199 3300031344 Bacteria 28027
631 Ga0265316_10008688 3300031344 Bacteria 9401
632 Ga0265316_10020583 3300031344 Bacteria 5613
633 Ga0307513_10024342 3300031456 Bacteria 7044
634 Ga0307513_10047902 3300031456 Bacteria 4645
635 Ga0307513_10080092 3300031456 Bacteria 3370
636 Ga0307513_10265934 3300031456 Bacteria 1501
637 Ga0307408_100181523 3300031548 Bacteria 1688
638 Ga0265313_10000009 3300031595 Bacteria 169607
639 Ga0265313_10000187 3300031595 Bacteria 66087
640 Ga0265313_10000383 3300031595 Bacteria 47643
641 Ga0265313_10033580 3300031595 Bacteria 2605
642 Ga0307508_10086037 3300031616 Bacteria 2727
643 Ga0307508_10149401 3300031616 Bacteria 1941
644 Ga0316579_10050303 3300031691 Bacteria 1949
645 Ga0265314_10000430 3300031711 Bacteria 56257
646 Ga0265314_10017800 3300031711 Bacteria 5567
647 Ga0265342_10000333 3300031712 Bacteria 52702
648 Ga0265342_10012657 3300031712 Bacteria 5707
649 Ga0307516_10003947 3300031730 Bacteria 18653
650 Ga0307516_10034399 3300031730 Bacteria 5092
651 Ga0307516_10153774 3300031730 Bacteria 2058
652 Ga0307405_10333712 3300031731 Bacteria 1163
653 Ga0316577_10042918 3300031733 Bacteria 2530
654 Ga0307413_10023726 3300031824 Bacteria 3329
655 Ga0307413_10312890 3300031824 Bacteria 1196
656 Ga0307410_10015091 3300031852 Bacteria 4571
657 Ga0307410_10032568 3300031852 Bacteria 3356
658 Ga0307406_10028625 3300031901 Bacteria 3368
659 Ga0307407_10044263 3300031903 Bacteria 2507
660 Ga0307407_10102867 3300031903 Bacteria 1777
661 Ga0307407_10140691 3300031903 Bacteria 1556
662 Ga0307412_10134797 3300031911 Bacteria 1800
663 Ga0307409_100090877 3300031995 Bacteria 2500
664 Ga0307409_100384215 3300031995 Bacteria 1336
665 Ga0307409_100984808 3300031995 Bacteria 861
666 Ga0307416_100021692 3300032002 Bacteria 4617
667 Ga0307416_100492760 3300032002 Bacteria 1288
668 Ga0307414_10086307 3300032004 Bacteria 2315
669 Ga0307414_10271610 3300032004 Bacteria 1420
670 Ga0307414_10501103 3300032004 Bacteria 1074
671 Ga0307411_10642793 3300032005 Bacteria 917
672 Ga0307415_100002584 3300032126 Bacteria 9047
673 Ga0307415_100035580 3300032126 Bacteria 3253
674 Ga0307415_100489620 3300032126 Bacteria 1073
675 Ga0307507_10147119 3300033179 Bacteria 1786
676 Ga0316214_1002630 3300033545 Bacteria 2215
677 Ga0373938_0044313 3300034957 Bacteria 998
678 Ga0373926_0002315 3300035083 Bacteria 6025
679 Ga0373926_0006977 3300035083 Bacteria 3756
680 Ga0373934_0000101 3300035086 Bacteria 29995
681 Ga0373934_0012313 3300035086 Bacteria 3229
682 Ga0373934_0040878 3300035086 Bacteria 1829
683 Ga0373934_0042417 3300035086 Bacteria 1797
684 Ga0373949_0031357 3300035090 Bacteria 1267
685 Ga0373951_0000271 3300035091 Bacteria 16583
686 Ga0373923_0000967 3300035111 Bacteria 7719
687 Ga0373923_0010902 3300035111 Bacteria 3320
688 Ga0373923_0015587 3300035111 Bacteria 2871
689 Ga0373923_0039155 3300035111 Bacteria 1946
690 Ga0373923_0061499 3300035111 Bacteria 1596
691 Ga0373923_0075589 3300035111 Bacteria 1453
692 Ga0373936_0003980 3300035113 Bacteria 5568
693 Ga0373936_0308040 3300035113 Bacteria 716
694 Ga0373945_0028991 3300035116 Bacteria 1942
695 Ga0373945_0034494 3300035116 Bacteria 1803
696 Ga0373953_0000521 3300035117 Bacteria 10670
697 Ga0373953_0009295 3300035117 Bacteria 3375
698 Ga0373953_0026137 3300035117 Bacteria 2235
699 Ga0373954_0008596 3300035118 Bacteria 4490
700 Ga0373954_0015680 3300035118 Bacteria 3389
701 Ga0373954_0027967 3300035118 Bacteria 2591
702 Ga0373956_0000095 3300035119 Bacteria 29811
703 Ga0373956_0018190 3300035119 Bacteria 2972
704 Ga0373956_0113215 3300035119 Bacteria 1264
705 Ga0373957_0000033 3300035120 Bacteria 35539
706 Ga0373943_0066062 3300035170 Bacteria 1820
707 Ga0373943_0085374 3300035170 Bacteria 1625
708 Ga0373946_0002118 3300035171 Bacteria 6960
709 Ga0373946_0010570 3300035171 Bacteria 3420
710 Ga0373946_0145535 3300035171 Bacteria 1102
711 Ga0373955_0000002 3300035172 Bacteria 125763
712 Ga0373955_0007055 3300035172 Bacteria 5145
713 Ga0373955_0012915 3300035172 Bacteria 4026
714 Ga0373924_0002327 3300035410 Bacteria 6376
715 Ga0373924_0009167 3300035410 Bacteria 3621
716 Ga0373931_0346063 3300035691 Bacteria 929
717 Ga0373935_0000234 3300035692 Bacteria 27285
718 Ga0373935_0045225 3300035692 Bacteria 2777
719 Ga0373935_0192321 3300035692 Bacteria 1406
720 Ga0373935_0206279 3300035692 Bacteria 1360
721 Ga0373927_0254902 3300035695 Bacteria 1153
722 Ga0373933_0000029 3300035724 Bacteria 86829
723 Ga0373933_0012974 3300035724 Bacteria 4609
724 Ga0373933_0024647 3300035724 Bacteria 3444
725 Ga0373933_0033935 3300035724 Bacteria 2971
726 Ga0373933_0137993 3300035724 Bacteria 1538
727 Ga0373933_0198132 3300035724 Bacteria 1284
728 Ga0373947_0000005 3300035725 Bacteria 225129
729 Ga0373947_0134795 3300035725 Bacteria 1579
730 Ga0373937_0000362 3300036401 Bacteria 42228
731 Ga0373937_0004443 3300036401 Bacteria 11918
732 Ga0373937_0095938 3300036401 Bacteria 2750
733 Ga0373937_0243235 3300036401 Bacteria 1695
734 Ga0373937_0330572 3300036401 Bacteria 1442
735 Ga0373937_0448943 3300036401 Bacteria 1224
736 Ga0373937_0472913 3300036401 Bacteria 1190
737 Ga0316584_0019297 3300036712 Bacteria 4928
738 Ga0373925_0000021 3300037068 Bacteria 162277
739 Ga0373925_0199253 3300037068 Bacteria 1591
740 Ga0373925_0221133 3300037068 Bacteria 1511
741 Ga0373925_0475917 3300037068 Bacteria 1024
742 Ga0395900_0003692 3300037418 Bacteria 16457
743 Ga0395900_0407298 3300037418 Bacteria 1323
744 Ga0395898_0042087 3300037466 Bacteria 4509
745 Ga0395898_0150625 3300037466 Bacteria 2226
746 Ga0395898_0974500 3300037466 Bacteria 784
747 Ga0316581_0039286 3300037588 Bacteria 1440
748 Ga0436364_0115602 3300037853 Bacteria 2288
749 Ga0436364_0361850 3300037853 Bacteria 4047
750 Ga0436364_1130152 3300037853 Bacteria 3129
751 Ga0436364_1225860 3300037853 Bacteria 2715
752 Ga0395901_0059328 3300038443 Bacteria 3981
753 Ga0436361_0546799 3300039447 Bacteria 1419
754 Ga0436363_0208428 3300039450 Bacteria 2554
755 Ga0451787_197248 3300041441 Bacteria 1637
756 Ga0451789_0052206 3300041443 Bacteria 4804
757 Ga0451791_1114879 3300041451 Bacteria 5775
758 Ga0451791_1689531 3300041451 Bacteria 1860
759 Ga0451793_0720655 3300041452 Bacteria 12238
760 Ga0451797_0100726 3300041453 Bacteria 4175
761 Ga0451800_0314848 3300041459 Bacteria 1739
762 Ga0451807_0584294 3300041486 Bacteria 1090
763 Ga0451839_0061394 3300041496 Bacteria 3005
764 Ga0451841_0287715 3300041498 Bacteria 1713
765 Ga0451843_0204342 3300041509 Bacteria 4137
766 Ga0466965_0355675 3300044683 Bacteria 803
767 Ga0466966_0085720 3300044684 Bacteria 1958
768 Ga0466961_0105411 3300044693 Bacteria 1775
769 Ga0466963_0076384 3300044694 Bacteria 2262
770 Ga0466964_0222376 3300044706 Bacteria 917
771 Ga0466957_0239841 3300044842 Bacteria 1202
772 Ga0466960_0012595 3300044901 Bacteria 3575
773 Ga0466960_0097893 3300044901 Bacteria 1506
774 Ga0466959_0003301 3300045049 Bacteria 10527
775 Ga0466959_0020862 3300045049 Bacteria 4828
776 Ga0466959_0133545 3300045049 Bacteria 1758
777 Ga0466959_0362030 3300045049 Bacteria 988
778 Ga0466958_0090390 3300045836 Bacteria 1895
779 Ga0466958_0121743 3300045836 Bacteria 1634
780 Ga0466958_0259650 3300045836 Bacteria 1112
781 Ga0466958_0276648 3300045836 Bacteria 1075
782 Ga0466967_0000444 3300045976 Bacteria 19804
783 Ga0466967_0004649 3300045976 Bacteria 9313
784 Ga0466967_0015004 3300045976 Bacteria 6059
785 Ga0466967_0026433 3300045976 Bacteria 4808
786 Ga0466967_0044615 3300045976 Bacteria 3847
787 Ga0466967_0050982 3300045976 Bacteria 3625
788 Ga0466967_0076441 3300045976 Bacteria 3012
789 Ga0466967_0127873 3300045976 Bacteria 2355
790 Ga0466967_0154742 3300045976 Bacteria 2146
791 Ga0466967_0573243 3300045976 Bacteria 1112
792 Ga0466967_0943566 3300045976 Bacteria 858
793 Ga0495592_0000043 3300046454 Bacteria 122354
794 Ga0495592_0008890 3300046454 Bacteria 7542
795 Ga0495592_0040782 3300046454 Bacteria 3482
796 Ga0495592_0100369 3300046454 Bacteria 2064
797 Ga0495592_0135693 3300046454 Bacteria 1716
798 Ga0495592_0232868 3300046454 Bacteria 1225
799 Ga0495603_0042928 3300046455 Bacteria 2701
800 Ga0495629_0005691 3300046459 Bacteria 9307
801 Ga0495629_0091124 3300046459 Bacteria 2127
802 Ga0495629_0217170 3300046459 Bacteria 1319
803 Ga0495641_0001864 3300046461 Bacteria 17302
804 Ga0495651_0000135 3300046462 Bacteria 54990
805 Ga0495651_0003167 3300046462 Bacteria 12664
806 Ga0495651_0006755 3300046462 Bacteria 8766
807 Ga0495651_0021269 3300046462 Bacteria 5041
808 Ga0495651_0028970 3300046462 Bacteria 4318
809 Ga0495651_0055294 3300046462 Bacteria 3050
810 Ga0495653_0000571 3300046463 Bacteria 28231
811 Ga0495653_0012759 3300046463 Bacteria 6861
812 Ga0495653_0063902 3300046463 Bacteria 2775
813 Ga0495653_0132596 3300046463 Bacteria 1761
814 Ga0495653_0179118 3300046463 Bacteria 1456
815 Ga0495653_0299490 3300046463 Bacteria 1049
816 Ga0495580_0015800 3300046472 Bacteria 5685
817 Ga0495582_0212637 3300046473 Bacteria 1105
818 Ga0495582_0296301 3300046473 Bacteria 929
819 Ga0495639_0001668 3300046475 Bacteria 9874
820 Ga0495662_0009182 3300046476 Bacteria 4853
821 Ga0495662_0011201 3300046476 Bacteria 4383
822 Ga0495662_0036057 3300046476 Bacteria 2387
823 Ga0495662_0074460 3300046476 Bacteria 1647
824 Ga0495664_0014805 3300046477 Bacteria 4428
825 Ga0495664_0017439 3300046477 Bacteria 4104
826 Ga0495664_0125390 3300046477 Bacteria 1553
827 Ga0495664_0177147 3300046477 Bacteria 1293
828 Ga0495664_0275579 3300046477 Bacteria 1016
829 Ga0495594_0158565 3300046499 Bacteria 1286
830 Ga0495594_0226331 3300046499 Bacteria 1066
831 Ga0495608_0000016 3300046511 Bacteria 196738
832 Ga0495608_0007773 3300046511 Bacteria 7551
833 Ga0495608_0013563 3300046511 Bacteria 5652
834 Ga0495608_0050860 3300046511 Bacteria 2748
835 Ga0495608_0119179 3300046511 Bacteria 1693
836 Ga0495618_0022655 3300046514 Bacteria 3880
837 Ga0495618_0183018 3300046514 Bacteria 1331
838 Ga0495618_0199061 3300046514 Bacteria 1268
839 Ga0495618_0346335 3300046514 Bacteria 916
840 Ga0495628_0000034 3300046516 Bacteria 115264
841 Ga0495628_0008967 3300046516 Bacteria 8554
842 Ga0495628_0013773 3300046516 Bacteria 6795
843 Ga0495628_0227919 3300046516 Bacteria 1397
844 Ga0495628_0388891 3300046516 Bacteria 1020
845 Ga0495630_0001481 3300046517 Bacteria 16232
846 Ga0495630_0009954 3300046517 Bacteria 6846
847 Ga0495630_0077567 3300046517 Bacteria 2505
848 Ga0495630_0283839 3300046517 Bacteria 1265
849 Ga0495663_0054344 3300046525 Bacteria 1247
850 Ga0495666_0005436 3300046526 Bacteria 6418
851 Ga0495666_0094215 3300046526 Bacteria 1412
852 Ga0495652_0000174 3300046529 Bacteria 73044
853 Ga0495652_0014268 3300046529 Bacteria 7133
854 Ga0495652_0018126 3300046529 Bacteria 6283
855 Ga0495652_0022357 3300046529 Bacteria 5610
856 Ga0495652_0054315 3300046529 Bacteria 3411
857 Ga0495652_0054402 3300046529 Bacteria 3408
858 Ga0495652_0066154 3300046529 Bacteria 3034
859 Ga0495652_0239700 3300046529 Bacteria 1350
860 Ga0495665_0017965 3300046531 Bacteria 3801
861 Ga0495640_0006733 3300046533 Bacteria 9067
862 Ga0495640_0011539 3300046533 Bacteria 6795
863 Ga0495640_0039902 3300046533 Bacteria 3291
864 Ga0495640_0254242 3300046533 Bacteria 1099
865 Ga0495587_0000044 3300046536 Bacteria 108443
866 Ga0495587_0002197 3300046536 Bacteria 13041
867 Ga0495587_0004185 3300046536 Bacteria 9552
868 Ga0495587_0007131 3300046536 Bacteria 7253
869 Ga0495587_0023581 3300046536 Bacteria 3781
870 Ga0495587_0123462 3300046536 Bacteria 1482
871 Ga0495645_0145071 3300046543 Bacteria 1654
872 Ga0495645_0168207 3300046543 Bacteria 1510
873 Ga0495645_0315594 3300046543 Bacteria 1016
874 Ga0495622_0140668 3300046557 Bacteria 1096
875 Ga0495667_0000052 3300046559 Bacteria 108432
876 Ga0495667_0058789 3300046559 Bacteria 2524
877 Ga0495667_0065610 3300046559 Bacteria 2374
878 Ga0495667_0083468 3300046559 Bacteria 2075
879 Ga0495667_0229903 3300046559 Bacteria 1182
880 Ga0495667_0270642 3300046559 Bacteria 1079
881 Ga0495656_0169464 3300046615 Bacteria 1066
882 Ga0495634_0005292 3300046642 Bacteria 9963
883 Ga0495634_0009343 3300046642 Bacteria 7234
884 Ga0495634_0057919 3300046642 Bacteria 2584
885 Ga0495634_0144929 3300046642 Bacteria 1505
886 Ga0495634_0245119 3300046642 Bacteria 1098
887 Ga0495635_0039234 3300046663 Bacteria 3276
888 Ga0495635_0065132 3300046663 Bacteria 2500
889 Ga0495635_0072653 3300046663 Bacteria 2356
890 Ga0495635_0148515 3300046663 Bacteria 1596
891 Ga0495635_0235376 3300046663 Bacteria 1236
892 Ga0495635_0336209 3300046663 Bacteria 1009
893 Ga0495588_0091891 3300046674 Bacteria 1590
894 Ga0495588_0195713 3300046674 Bacteria 1068
895 Ga0495657_0000015 3300046675 Bacteria 187657
896 Ga0495657_0009392 3300046675 Bacteria 7416
897 Ga0495657_0013373 3300046675 Bacteria 6059
898 Ga0495657_0024401 3300046675 Bacteria 4307
899 Ga0495657_0027681 3300046675 Bacteria 3997
900 Ga0495657_0082289 3300046675 Bacteria 2080
901 Ga0495657_0091969 3300046675 Bacteria 1944
902 Ga0495657_0233343 3300046675 Bacteria 1112
903 Ga0495599_0000035 3300046678 Bacteria 103981
904 Ga0495599_0003091 3300046678 Bacteria 9690
905 Ga0495599_0007370 3300046678 Bacteria 6669
906 Ga0495599_0051967 3300046678 Bacteria 2567
907 Ga0495599_0198281 3300046678 Bacteria 1233
908 Ga0495623_0000767 3300046679 Bacteria 21507
909 Ga0495623_0002607 3300046679 Bacteria 11904
910 Ga0495623_0037673 3300046679 Bacteria 3093
911 Ga0495623_0140134 3300046679 Bacteria 1440
912 Ga0495623_0222683 3300046679 Bacteria 1074
913 Ga0495623_0233732 3300046679 Bacteria 1041
914 Ga0495623_0306196 3300046679 Bacteria 876
915 Ga0495646_0002176 3300046680 Bacteria 11936
916 Ga0495646_0014045 3300046680 Bacteria 5091
917 Ga0495646_0040257 3300046680 Bacteria 2879
918 Ga0495646_0382705 3300046680 Bacteria 733
919 Ga0495658_0000676 3300046683 Bacteria 18454
920 Ga0495613_0078282 3300046689 Bacteria 2405
921 Ga0495624_0122064 3300046690 Bacteria 1599
922 Ga0495624_0126680 3300046690 Bacteria 1567
923 Ga0495600_0007475 3300046809 Bacteria 6688
924 Ga0495600_0025656 3300046809 Bacteria 3798
925 Ga0495600_0056237 3300046809 Bacteria 2570
926 Ga0495600_0088286 3300046809 Bacteria 2023
927 Ga0495600_0223031 3300046809 Bacteria 1205
928 Ga0495600_0270490 3300046809 Bacteria 1078
929 Ga0495581_0001515 3300047315 Bacteria 12943
930 Ga0495581_0017534 3300047315 Bacteria 4159
931 Ga0495581_0023897 3300047315 Bacteria 3542
932 Ga0495581_0091086 3300047315 Bacteria 1769
933 Ga0495604_0000048 3300047317 Bacteria 108810
934 Ga0495604_0009246 3300047317 Bacteria 7801
935 Ga0495604_0030548 3300047317 Bacteria 4278
936 Ga0495604_0041434 3300047317 Bacteria 3611
937 Ga0495604_0046676 3300047317 Bacteria 3378
938 Ga0495604_0131706 3300047317 Bacteria 1796
939 Ga0495604_0154282 3300047317 Bacteria 1628
940 Ga0495674_0027236 3300047319 Bacteria 5224
941 Ga0495674_0139615 3300047319 Bacteria 2037
942 Ga0495676_0004969 3300047321 Bacteria 12194
943 Ga0495676_0006692 3300047321 Bacteria 10614
944 Ga0495680_0000069 3300047322 Bacteria 88766
945 Ga0495680_0010239 3300047322 Bacteria 8372
946 Ga0495680_0012666 3300047322 Bacteria 7406
947 Ga0495680_0019087 3300047322 Bacteria 5802
948 Ga0495680_0020724 3300047322 Bacteria 5521
949 Ga0495680_0074021 3300047322 Bacteria 2587
950 Ga0495680_0187849 3300047322 Bacteria 1487
951 Ga0495675_0000685 3300047444 Bacteria 21288
952 Ga0495675_0040750 3300047444 Bacteria 2960
953 Ga0495675_0048135 3300047444 Bacteria 2712
954 Ga0495675_0067482 3300047444 Bacteria 2260
955 Ga0495684_0002558 3300047471 Bacteria 14475
956 Ga0495684_0009605 3300047471 Bacteria 7458
957 Ga0495684_0014538 3300047471 Bacteria 6059
958 Ga0495684_0067033 3300047471 Bacteria 2729
959 Ga0495684_0079004 3300047471 Bacteria 2497
960 Ga0495684_0125480 3300047471 Bacteria 1931
961 Ga0495684_0205211 3300047471 Bacteria 1452
962 Ga0495593_0045862 3300047673 Bacteria 2331
963 Ga0495593_0246927 3300047673 Bacteria 894
964 Ga0495602_0000970 3300048088 Bacteria 27780
965 Ga0495602_0028336 3300048088 Bacteria 5362
966 Ga0495602_0036043 3300048088 Bacteria 4607
967 Ga0495602_0041593 3300048088 Bacteria 4196
968 Ga0495602_0091366 3300048088 Bacteria 2525
969 Ga0495602_0099272 3300048088 Bacteria 2393
970 Ga0495614_0140023 3300048089 Bacteria 1074
971 Ga0496100_0192306 3300048903 Bacteria 1482
972 Ga0496102_0074809 3300048905 Bacteria 3114
973 Ga0496102_0136609 3300048905 Bacteria 2298
974 Ga0496102_0334117 3300048905 Bacteria 1427
975 Ga0496102_0482142 3300048905 Bacteria 1161
976 Ga0496102_0662145 3300048905 Bacteria 967
977 Ga0496103_0053830 3300048906 Bacteria 2494
978 Ga0496104_0000441 3300048907 Bacteria 36043
979 Ga0496104_0005513 3300048907 Bacteria 11084
980 Ga0496104_0007235 3300048907 Bacteria 9794
981 Ga0496104_0012681 3300048907 Bacteria 7590
982 Ga0496105_0031146 3300048908 Bacteria 4372
983 Ga0496105_0085888 3300048908 Bacteria 2600
984 Ga0496106_0334431 3300048909 Bacteria 1216
985 Ga0496106_0370120 3300048909 Bacteria 1151
986 Ga0496106_0666185 3300048909 Bacteria 831
987 Ga0496108_0000748 3300048911 Bacteria 25330
988 Ga0496108_0018581 3300048911 Bacteria 5694
989 Ga0496108_0022231 3300048911 Bacteria 5215
990 Ga0496108_0022533 3300048911 Bacteria 5179
991 Ga0496108_0034966 3300048911 Bacteria 4175
992 Ga0496108_0148646 3300048911 Bacteria 2021
993 Ga0496108_0180850 3300048911 Bacteria 1826
994 Ga0496108_0213929 3300048911 Bacteria 1673
995 Ga0496108_0546456 3300048911 Bacteria 1011
996 Ga0496109_0001743 3300048912 Bacteria 18151
997 Ga0496109_0110366 3300048912 Bacteria 2557
998 Ga0496109_0152282 3300048912 Bacteria 2165
999 Ga0496109_0170111 3300048912 Bacteria 2044
1000 Ga0496109_0207973 3300048912 Bacteria 1840
1001 Ga0496109_0246635 3300048912 Bacteria 1681
1002 Ga0496109_0248074 3300048912 Bacteria 1676
1003 Ga0496109_0458350 3300048912 Bacteria 1204
1004 Ga0496110_0003033 3300048913 Bacteria 12739
1005 Ga0496110_0032286 3300048913 Bacteria 4521
1006 Ga0496110_0059346 3300048913 Bacteria 3372
1007 Ga0496110_0061091 3300048913 Bacteria 3325
1008 Ga0496110_0063852 3300048913 Bacteria 3254
1009 Ga0496110_0158974 3300048913 Bacteria 2048
1010 Ga0496111_0001177 3300048914 Bacteria 14549
1011 Ga0496111_0161411 3300048914 Bacteria 1664
1012 Ga0496111_0368051 3300048914 Bacteria 1063
1013 Ga0496112_0000159 3300048915 Bacteria 42547
1014 Ga0496112_0337142 3300048915 Bacteria 1451
1015 Ga0496112_0412413 3300048915 Bacteria 1290
1016 Ga0496112_0443375 3300048915 Bacteria 1236
1017 Ga0496112_0496972 3300048915 Bacteria 1155
1018 Ga0496112_0751517 3300048915 Bacteria 901
1019 Ga0496113_0051315 3300048916 Bacteria 3078
1020 Ga0496113_0054954 3300048916 Bacteria 2983
1021 Ga0496113_0381641 3300048916 Bacteria 1131
1022 Ga0496113_0710750 3300048916 Bacteria 801
1023 Ga0496114_0088480 3300048917 Bacteria 2627
1024 Ga0496114_0242525 3300048917 Bacteria 1585
1025 Ga0496114_0286236 3300048917 Bacteria 1454
1026 Ga0496114_0681767 3300048917 Bacteria 902
1027 Ga0496115_0106658 3300048918 Bacteria 2300
1028 Ga0496115_0136170 3300048918 Bacteria 2025
1029 Ga0496115_0353438 3300048918 Bacteria 1198
1030 Ga0496119_0083288 3300048922 Bacteria 1837
1031 Ga0496126_0007772 3300048929 Bacteria 11685
1032 Ga0496126_0337260 3300048929 Bacteria 1236
1033 Ga0501031_0066544 3300049568 Bacteria 2348
1034 Ga0501032_0142716 3300049569 Bacteria 1577
1035 Ga0501033_0123128 3300049570 Bacteria 1881
1036 Ga0501033_0299190 3300049570 Bacteria 1133
1037 Ga0501036_0012617 3300049572 Bacteria 7009
1038 Ga0501036_0031750 3300049572 Bacteria 4463
1039 Ga0501036_0419841 3300049572 Bacteria 1115
1040 Ga0501038_0055593 3300049574 Bacteria 3400
1041 Ga0501039_0023712 3300049575 Bacteria 4710
1042 Ga0501039_0183281 3300049575 Bacteria 1646
1043 Ga0501039_0579009 3300049575 Bacteria 880
1044 Ga0501040_0005034 3300049576 Bacteria 8539
1045 Ga0501042_0016519 3300049578 Bacteria 5068
1046 Ga0501042_0053553 3300049578 Bacteria 2879
1047 Ga0501043_0238103 3300049579 Bacteria 1404
1048 Ga0501046_0064009 3300049580 Bacteria 2871
1049 Ga0501047_0024344 3300049581 Bacteria 5812
1050 Ga0501048_0006698 3300049582 Bacteria 8751
1051 Ga0501067_0002370 3300049583 Bacteria 10435
1052 Ga0501067_0217319 3300049583 Bacteria 1064
1053 Ga0501068_0246065 3300049584 Bacteria 1139
1054 Ga0501068_0396983 3300049584 Bacteria 889
1055 Ga0501070_0038435 3300049586 Bacteria 3993
1056 Ga0501071_0004689 3300049587 Bacteria 8689
1057 Ga0501072_0006738 3300049588 Bacteria 8728
1058 Ga0501074_0141438 3300049590 Bacteria 1721
1059 Ga0501076_0038370 3300049592 Bacteria 3761
1060 Ga0501076_0221856 3300049592 Bacteria 1545
1061 Ga0501077_0125451 3300049593 Bacteria 1627
1062 Ga0501079_0024703 3300049741 Bacteria 4611
1063 Ga0501079_0162120 3300049741 Bacteria 1744
1064 Ga0501080_0028140 3300049742 Bacteria 5226
1065 Ga0501080_0044011 3300049742 Bacteria 4157
1066 Ga0501080_0268637 3300049742 Bacteria 1553
1067 Ga0501081_0156214 3300049743 Bacteria 1641
1068 Ga0501081_0443958 3300049743 Bacteria 963
1069 Ga0501035_0036768 3300049822 Bacteria 4436
1070 Ga0501044_0034810 3300049823 Bacteria 5279
1071 Ga0501045_0053012 3300049824 Bacteria 2963
1072 nmdc:mga06r32_562659_c1 3300050510 Bacteria 1113
1073 nmdc:mga06r32_99194_c1 3300050510 Bacteria 2856
1074 nmdc:mga08y16_1241598_c1 3300050511 Bacteria 714
1075 nmdc:mga08y16_14122_c1 3300050511 Bacteria 8408
1076 nmdc:mga08y16_24926_c1 3300050511 Bacteria 6309
1077 nmdc:mga08y16_51474_c1 3300050511 Bacteria 4309
1078 nmdc:mga0rr50_145490_c1 3300050513 Bacteria 1911
1079 nmdc:mga0rr50_316648_c1 3300050513 Bacteria 1307
1080 nmdc:mga0a205_30845_c1 3300050515 Bacteria 5135
1081 Ga0495601_0085937 3300053077 Bacteria 2021
1082 Ga0495601_0144616 3300053077 Bacteria 1552
1083 Ga0495612_0014977 3300053078 Bacteria 3110
1084 Ga0495612_0130935 3300053078 Bacteria 1083
1085 Ga0495595_0000162 3300053084 Bacteria 26749
1086 Ga0495595_0004135 3300053084 Bacteria 5826
1087 Ga0495595_0019979 3300053084 Bacteria 2911
1088 Ga0495595_0032891 3300053084 Bacteria 2337
1089 Ga0495595_0154657 3300053084 Bacteria 1129
1090 Ga0495619_0003428 3300053085 Bacteria 10234
1091 Ga0495619_0256704 3300053085 Bacteria 1211
1092 Ga0495619_0316284 3300053085 Bacteria 1081
1093 Ga0495619_0338068 3300053085 Bacteria 1042
1094 Ga0500651_0084308 3300053093 Bacteria 1965
1095 Ga0500650_0115430 3300053098 Bacteria 1253
1096 Ga0500569_024140 3300053109 Bacteria 1642
1097 Ga0500594_0077090 3300053118 Bacteria 990
1098 Ga0500652_004451 3300053131 Bacteria 4341
1099 Ga0500611_097349 3300053727 Bacteria 757
1100 Ga0501084_0052825 3300054114 Bacteria 3399
1101 Ga0501082_0042883 3300060353 Bacteria 3899
1102 Ga0501082_0448009 3300060353 Bacteria 1128
1103 Ga0466962_0035909 3300061719 Bacteria 2372
1104 Ga0530510_0018293 3300061734 Bacteria 4968

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036401 Ga0373937_0243235 Ga0373937_0243235_37_624 184
2 3300047471 Ga0495684_0205211 Ga0495684_0205211_10_597 184
3 3300005356 Ga0070674_100922664 Ga0070674_1009226641 201
4 3300005467 Ga0070706_100005036 Ga0070706_1000050363 203
5 3300005467 Ga0070706_100631577 Ga0070706_1006315772 203
6 3300005468 Ga0070707_100045292 Ga0070707_1000452922 203
7 3300005471 Ga0070698_100038643 Ga0070698_1000386432 203
8 3300005518 Ga0070699_100002101 Ga0070699_1000021018 203
9 3300005518 Ga0070699_100068500 Ga0070699_1000685002 203
10 3300005536 Ga0070697_100061101 Ga0070697_1000611012 203
11 3300006028 Ga0070717_10007804 Ga0070717_100078042 203
12 3300006028 Ga0070717_10052576 Ga0070717_100525762 203
13 3300025910 Ga0207684_10004377 Ga0207684_100043772 203
14 3300025910 Ga0207684_10027199 Ga0207684_100271992 203
15 3300025922 Ga0207646_10003277 Ga0207646_100032776 203
16 3300025922 Ga0207646_10006902 Ga0207646_100069024 203
17 3300006847 Ga0075431_100075900 Ga0075431_1000759002 205
18 3300050510 nmdc:mga06r32_562659_c1 nmdc:mga06r32_562659_c1_211_891 205
19 3300031691 Ga0316579_10050303 Ga0316579_100503031 209
20 3300031733 Ga0316577_10042918 Ga0316577_100429182 209
21 3300036712 Ga0316584_0019297 Ga0316584_0019297_2881_3600 209
22 3300037588 Ga0316581_0039286 Ga0316581_0039286_395_1114 209
23 3300020070 Ga0206356_10064106 Ga0206356_100641061 210
24 3300048929 Ga0496126_0337260 Ga0496126_0337260_451_1125 211
25 3300049592 Ga0501076_0221856 Ga0501076_0221856_412_1104 213
26 3300005518 Ga0070699_100529912 Ga0070699_1005299122 214
27 3300061719 Ga0466962_0035909 Ga0466962_0035909_232_945 215
28 3300005467 Ga0070706_100006933 Ga0070706_1000069339 219
29 3300005468 Ga0070707_100000792 Ga0070707_10000079217 219
30 3300006028 Ga0070717_10119623 Ga0070717_101196232 219
31 3300025910 Ga0207684_10098696 Ga0207684_100986962 219
32 3300025922 Ga0207646_10001043 Ga0207646_100010434 219
33 3300025922 Ga0207646_10175844 Ga0207646_101758442 219
34 3300025922 Ga0207646_10378277 Ga0207646_103782771 219
35 3300037853 Ga0436364_0115602 Ga0436364_0115602_1539_2207 219
36 iso_pu_bacteria 2946003308 2946005680 219
37 3300005564 Ga0070664_100355724 Ga0070664_1003557242 220
38 3300005618 Ga0068864_100012042 Ga0068864_1000120423 220
39 3300005841 Ga0068863_100092777 Ga0068863_1000927773 220
40 3300006163 Ga0070715_10179863 Ga0070715_101798632 220
41 3300009177 Ga0105248_10109534 Ga0105248_101095342 220
42 3300014968 Ga0157379_10187756 Ga0157379_101877562 220
43 3300025941 Ga0207711_10157543 Ga0207711_101575432 220
44 3300025945 Ga0207679_10083461 Ga0207679_100834612 220
45 3300026116 Ga0207674_10330823 Ga0207674_103308232 220
46 3300028381 Ga0268264_10147125 Ga0268264_101471252 220
47 3300037068 Ga0373925_0475917 Ga0373925_0475917_197_862 220
48 3300037418 Ga0395900_0407298 Ga0395900_0407298_267_932 220
49 3300037466 Ga0395898_0150625 Ga0395898_0150625_937_1602 220
50 3300038443 Ga0395901_0059328 Ga0395901_0059328_1080_1745 220
51 3300044684 Ga0466966_0085720 Ga0466966_0085720_808_1470 220
52 3300045049 Ga0466959_0020862 Ga0466959_0020862_2045_2707 220
53 3300046517 Ga0495630_0283839 Ga0495630_0283839_498_1163 220
54 3300047673 Ga0495593_0045862 Ga0495593_0045862_687_1352 220
55 3300048907 Ga0496104_0007235 Ga0496104_0007235_7760_8425 220
56 3300048908 Ga0496105_0031146 Ga0496105_0031146_2271_2936 220
57 3300048911 Ga0496108_0018581 Ga0496108_0018581_2640_3305 220
58 3300048912 Ga0496109_0110366 Ga0496109_0110366_1309_1974 220
59 3300048913 Ga0496110_0059346 Ga0496110_0059346_2335_3000 220
60 3300048915 Ga0496112_0443375 Ga0496112_0443375_251_916 220
61 iso_pu_bacteria 2622736605 2623499272 220
62 iso_pu_bacteria 2904479285 2904482173 220
63 3300005467 Ga0070706_100007675 Ga0070706_1000076753 221
64 3300005468 Ga0070707_100121840 Ga0070707_1001218402 221
65 3300005471 Ga0070698_100222699 Ga0070698_1002226991 221
66 3300006028 Ga0070717_10514079 Ga0070717_105140792 221
67 3300025910 Ga0207684_10011882 Ga0207684_100118823 221
68 3300025922 Ga0207646_10112799 Ga0207646_101127992 221
69 3300049578 Ga0501042_0053553 Ga0501042_0053553_2131_2835 221
70 3300005327 Ga0070658_10006845 Ga0070658_100068458 222
71 3300005329 Ga0070683_100144915 Ga0070683_1001449152 222
72 3300005337 Ga0070682_100576076 Ga0070682_1005760762 222
73 3300005341 Ga0070691_10024889 Ga0070691_100248892 222
74 3300005344 Ga0070661_100085981 Ga0070661_1000859812 222
75 3300005345 Ga0070692_10146692 Ga0070692_101466922 222
76 3300005366 Ga0070659_100112961 Ga0070659_1001129614 222
77 3300005467 Ga0070706_100001048 Ga0070706_10000104822 222
78 3300005468 Ga0070707_100120283 Ga0070707_1001202832 222
79 3300005471 Ga0070698_100006771 Ga0070698_1000067719 222
80 3300005518 Ga0070699_100703631 Ga0070699_1007036311 222
81 3300005530 Ga0070679_100008909 Ga0070679_1000089095 222
82 3300005530 Ga0070679_100031308 Ga0070679_1000313084 222
83 3300005535 Ga0070684_100880707 Ga0070684_1008807071 222
84 3300005577 Ga0068857_100004338 Ga0068857_1000043382 222
85 3300009093 Ga0105240_10609138 Ga0105240_106091382 222
86 3300013104 Ga0157370_10170964 Ga0157370_101709644 222
87 3300013105 Ga0157369_10009643 Ga0157369_1000964314 222
88 3300020070 Ga0206356_10374739 Ga0206356_103747392 222
89 3300020082 Ga0206353_10680297 Ga0206353_106802972 222
90 3300022467 Ga0224712_10210403 Ga0224712_102104031 222
91 3300025906 Ga0207699_10300896 Ga0207699_103008962 222
92 3300025909 Ga0207705_10020113 Ga0207705_100201134 222
93 3300025910 Ga0207684_10002703 Ga0207684_100027034 222
94 3300025920 Ga0207649_10165670 Ga0207649_101656702 222
95 3300025921 Ga0207652_10016769 Ga0207652_100167694 222
96 3300025921 Ga0207652_10341302 Ga0207652_103413021 222
97 3300025922 Ga0207646_10108168 Ga0207646_101081682 222
98 3300025928 Ga0207700_10413001 Ga0207700_104130012 222
99 3300026078 Ga0207702_10406511 Ga0207702_104065112 222
100 3300026116 Ga0207674_10003072 Ga0207674_100030725 222
101 3300026116 Ga0207674_10021296 Ga0207674_100212964 222
102 3300031995 Ga0307409_100984808 Ga0307409_1009848082 222
103 3300048915 Ga0496112_0496972 Ga0496112_0496972_390_1067 222
104 3300048917 Ga0496114_0088480 Ga0496114_0088480_1510_2199 222
105 iso_pu_bacteria 2558860112 2558910879 222
106 3300005328 Ga0070676_10104111 Ga0070676_101041112 223
107 3300005329 Ga0070683_100004571 Ga0070683_1000045714 223
108 3300005329 Ga0070683_100127961 Ga0070683_1001279612 223
109 3300005334 Ga0068869_100018522 Ga0068869_1000185223 223
110 3300005338 Ga0068868_100004265 Ga0068868_1000042657 223
111 3300005339 Ga0070660_100027145 Ga0070660_1000271452 223
112 3300005353 Ga0070669_100350604 Ga0070669_1003506042 223
113 3300005354 Ga0070675_100002740 Ga0070675_1000027409 223
114 3300005441 Ga0070700_100033665 Ga0070700_1000336653 223
115 3300005455 Ga0070663_100085492 Ga0070663_1000854921 223
116 3300005456 Ga0070678_100015224 Ga0070678_1000152245 223
117 3300005471 Ga0070698_100322806 Ga0070698_1003228062 223
118 3300005530 Ga0070679_100745761 Ga0070679_1007457611 223
119 3300005564 Ga0070664_100009193 Ga0070664_1000091932 223
120 3300005615 Ga0070702_100017373 Ga0070702_1000173732 223
121 3300005618 Ga0068864_101067031 Ga0068864_1010670311 223
122 3300005843 Ga0068860_100269611 Ga0068860_1002696112 223
123 3300005844 Ga0068862_100227134 Ga0068862_1002271342 223
124 3300005985 Ga0081539_10003383 Ga0081539_1000338313 223
125 3300005985 Ga0081539_10010664 Ga0081539_100106641 223
126 3300005985 Ga0081539_10027830 Ga0081539_100278301 223
127 3300005985 Ga0081539_10176204 Ga0081539_101762041 223
128 3300006847 Ga0075431_100073239 Ga0075431_1000732393 223
129 3300009094 Ga0111539_10001402 Ga0111539_1000140216 223
130 3300009098 Ga0105245_10500369 Ga0105245_105003692 223
131 3300009148 Ga0105243_10150131 Ga0105243_101501312 223
132 3300009176 Ga0105242_11072563 Ga0105242_110725631 223
133 3300009551 Ga0105238_10119356 Ga0105238_101193562 223
134 3300009553 Ga0105249_10697895 Ga0105249_106978951 223
135 3300010375 Ga0105239_10201441 Ga0105239_102014412 223
136 3300014745 Ga0157377_10001840 Ga0157377_100018402 223
137 3300021388 Ga0213875_10045485 Ga0213875_100454852 223
138 3300025907 Ga0207645_10094505 Ga0207645_100945052 223
139 3300025917 Ga0207660_10492199 Ga0207660_104921991 223
140 3300025919 Ga0207657_10735171 Ga0207657_107351711 223
141 3300025924 Ga0207694_10266117 Ga0207694_102661172 223
142 3300025925 Ga0207650_10781202 Ga0207650_107812021 223
143 3300025926 Ga0207659_10004462 Ga0207659_100044622 223
144 3300025927 Ga0207687_10117011 Ga0207687_101170111 223
145 3300025931 Ga0207644_10704144 Ga0207644_107041441 223
146 3300025933 Ga0207706_10188207 Ga0207706_101882072 223
147 3300025935 Ga0207709_10040829 Ga0207709_100408292 223
148 3300025940 Ga0207691_10648383 Ga0207691_106483832 223
149 3300025942 Ga0207689_10028926 Ga0207689_100289263 223
150 3300025944 Ga0207661_10298439 Ga0207661_102984392 223
151 3300025945 Ga0207679_10059848 Ga0207679_100598482 223
152 3300025961 Ga0207712_10455059 Ga0207712_104550591 223
153 3300026023 Ga0207677_10153779 Ga0207677_101537792 223
154 3300026067 Ga0207678_10112010 Ga0207678_101120103 223
155 3300026075 Ga0207708_10047624 Ga0207708_100476242 223
156 3300027907 Ga0207428_10018301 Ga0207428_100183012 223
157 3300028381 Ga0268264_10223668 Ga0268264_102236682 223
158 3300028794 Ga0307515_10014744 Ga0307515_100147447 223
159 3300028794 Ga0307515_10030070 Ga0307515_100300707 223
160 3300030522 Ga0307512_10007084 Ga0307512_1000708411 223
161 3300030522 Ga0307512_10027813 Ga0307512_100278132 223
162 3300031456 Ga0307513_10047902 Ga0307513_100479023 223
163 3300031456 Ga0307513_10265934 Ga0307513_102659342 223
164 3300031616 Ga0307508_10086037 Ga0307508_100860372 223
165 3300031730 Ga0307516_10034399 Ga0307516_100343994 223
166 3300031824 Ga0307413_10312890 Ga0307413_103128901 223
167 3300033179 Ga0307507_10147119 Ga0307507_101471191 223
168 3300035091 Ga0373951_0000271 Ga0373951_0000271_3278_3958 223
169 3300037466 Ga0395898_0974500 Ga0395898_0974500_45_719 223
170 3300037853 Ga0436364_0361850 Ga0436364_0361850_2616_3290 223
171 3300044706 Ga0466964_0222376 Ga0466964_0222376_74_745 223
172 3300045976 Ga0466967_0015004 Ga0466967_0015004_3503_4174 223
173 3300045976 Ga0466967_0044615 Ga0466967_0044615_2097_2771 223
174 3300046642 Ga0495634_0245119 Ga0495634_0245119_313_1014 223
175 3300049741 Ga0501079_0162120 Ga0501079_0162120_966_1643 223
176 3300049742 Ga0501080_0044011 Ga0501080_0044011_324_1001 223
177 3300049743 Ga0501081_0443958 Ga0501081_0443958_160_840 223
178 3300050510 nmdc:mga06r32_99194_c1 nmdc:mga06r32_99194_c1_1869_2558 223
179 3300050511 nmdc:mga08y16_14122_c1 nmdc:mga08y16_14122_c1_4505_5179 223
180 3300053093 Ga0500651_0084308 Ga0500651_0084308_1248_1922 223
181 3300053098 Ga0500650_0115430 Ga0500650_0115430_223_897 223
182 3300053109 Ga0500569_024140 Ga0500569_024140_122_796 223
183 3300053118 Ga0500594_0077090 Ga0500594_0077090_68_742 223
184 3300053131 Ga0500652_004451 Ga0500652_004451_2780_3454 223
185 3300053727 Ga0500611_097349 Ga0500611_097349_16_690 223
186 3300003203 JGI25406J46586_10006130 JGI25406J46586_100061303 224
187 3300005327 Ga0070658_10064156 Ga0070658_100641562 224
188 3300005327 Ga0070658_10257089 Ga0070658_102570891 224
189 3300005329 Ga0070683_100113133 Ga0070683_1001131332 224
190 3300005329 Ga0070683_100153307 Ga0070683_1001533072 224
191 3300005329 Ga0070683_100167567 Ga0070683_1001675672 224
192 3300005329 Ga0070683_100232294 Ga0070683_1002322942 224
193 3300005339 Ga0070660_100129995 Ga0070660_1001299952 224
194 3300005340 Ga0070689_100408094 Ga0070689_1004080941 224
195 3300005341 Ga0070691_10101628 Ga0070691_101016282 224
196 3300005344 Ga0070661_100457680 Ga0070661_1004576801 224
197 3300005344 Ga0070661_100499430 Ga0070661_1004994301 224
198 3300005354 Ga0070675_100080840 Ga0070675_1000808403 224
199 3300005354 Ga0070675_100450683 Ga0070675_1004506832 224
200 3300005356 Ga0070674_100260495 Ga0070674_1002604952 224
201 3300005364 Ga0070673_100117165 Ga0070673_1001171651 224
202 3300005366 Ga0070659_100037838 Ga0070659_1000378381 224
203 3300005434 Ga0070709_10003021 Ga0070709_100030219 224
204 3300005434 Ga0070709_10028678 Ga0070709_100286783 224
205 3300005434 Ga0070709_10039282 Ga0070709_100392822 224
206 3300005434 Ga0070709_10040725 Ga0070709_100407252 224
207 3300005434 Ga0070709_10067334 Ga0070709_100673342 224
208 3300005434 Ga0070709_10112358 Ga0070709_101123582 224
209 3300005435 Ga0070714_100001028 Ga0070714_1000010286 224
210 3300005435 Ga0070714_100005940 Ga0070714_1000059403 224
211 3300005435 Ga0070714_100005955 Ga0070714_1000059558 224
212 3300005435 Ga0070714_100082551 Ga0070714_1000825512 224
213 3300005435 Ga0070714_100083836 Ga0070714_1000838362 224
214 3300005435 Ga0070714_100276806 Ga0070714_1002768062 224
215 3300005436 Ga0070713_100007261 Ga0070713_1000072616 224
216 3300005436 Ga0070713_100010227 Ga0070713_1000102273 224
217 3300005436 Ga0070713_100024420 Ga0070713_1000244202 224
218 3300005436 Ga0070713_100065592 Ga0070713_1000655922 224
219 3300005436 Ga0070713_100147037 Ga0070713_1001470373 224
220 3300005436 Ga0070713_100280114 Ga0070713_1002801142 224
221 3300005436 Ga0070713_100292505 Ga0070713_1002925051 224
222 3300005436 Ga0070713_100330256 Ga0070713_1003302562 224
223 3300005437 Ga0070710_10008259 Ga0070710_100082592 224
224 3300005437 Ga0070710_10018475 Ga0070710_100184753 224
225 3300005437 Ga0070710_10082483 Ga0070710_100824831 224
226 3300005437 Ga0070710_10088860 Ga0070710_100888602 224
227 3300005437 Ga0070710_10184202 Ga0070710_101842022 224
228 3300005438 Ga0070701_10025713 Ga0070701_100257132 224
229 3300005439 Ga0070711_100021021 Ga0070711_1000210212 224
230 3300005439 Ga0070711_100032826 Ga0070711_1000328263 224
231 3300005439 Ga0070711_100043948 Ga0070711_1000439482 224
232 3300005440 Ga0070705_100076262 Ga0070705_1000762622 224
233 3300005440 Ga0070705_100123531 Ga0070705_1001235312 224
234 3300005445 Ga0070708_100534018 Ga0070708_1005340181 224
235 3300005455 Ga0070663_100026326 Ga0070663_1000263265 224
236 3300005456 Ga0070678_100096045 Ga0070678_1000960452 224
237 3300005458 Ga0070681_10009600 Ga0070681_100096002 224
238 3300005458 Ga0070681_10313312 Ga0070681_103133123 224
239 3300005458 Ga0070681_10419697 Ga0070681_104196972 224
240 3300005466 Ga0070685_10043361 Ga0070685_100433612 224
241 3300005467 Ga0070706_100003836 Ga0070706_1000038365 224
242 3300005467 Ga0070706_100079469 Ga0070706_1000794693 224
243 3300005467 Ga0070706_100088284 Ga0070706_1000882842 224
244 3300005467 Ga0070706_100208006 Ga0070706_1002080063 224
245 3300005467 Ga0070706_100906047 Ga0070706_1009060471 224
246 3300005468 Ga0070707_100023200 Ga0070707_1000232002 224
247 3300005468 Ga0070707_100029054 Ga0070707_1000290543 224
248 3300005468 Ga0070707_100035864 Ga0070707_1000358642 224
249 3300005468 Ga0070707_100233253 Ga0070707_1002332532 224
250 3300005468 Ga0070707_100372866 Ga0070707_1003728662 224
251 3300005471 Ga0070698_100008876 Ga0070698_10000887611 224
252 3300005471 Ga0070698_100011521 Ga0070698_1000115212 224
253 3300005471 Ga0070698_100037550 Ga0070698_1000375503 224
254 3300005471 Ga0070698_100076311 Ga0070698_1000763112 224
255 3300005471 Ga0070698_100077164 Ga0070698_1000771642 224
256 3300005471 Ga0070698_100118694 Ga0070698_1001186942 224
257 3300005518 Ga0070699_100001575 Ga0070699_10000157515 224
258 3300005518 Ga0070699_100321845 Ga0070699_1003218452 224
259 3300005530 Ga0070679_100003755 Ga0070679_1000037554 224
260 3300005530 Ga0070679_100873675 Ga0070679_1008736751 224
261 3300005535 Ga0070684_100019147 Ga0070684_1000191474 224
262 3300005535 Ga0070684_100230379 Ga0070684_1002303791 224
263 3300005536 Ga0070697_100010976 Ga0070697_1000109763 224
264 3300005539 Ga0068853_100163892 Ga0068853_1001638921 224
265 3300005544 Ga0070686_100020181 Ga0070686_1000201812 224
266 3300005545 Ga0070695_100099157 Ga0070695_1000991572 224
267 3300005546 Ga0070696_100103024 Ga0070696_1001030242 224
268 3300005547 Ga0070693_100050430 Ga0070693_1000504302 224
269 3300005547 Ga0070693_100152791 Ga0070693_1001527911 224
270 3300005548 Ga0070665_100054642 Ga0070665_1000546425 224
271 3300005548 Ga0070665_100589065 Ga0070665_1005890652 224
272 3300005563 Ga0068855_100058270 Ga0068855_1000582703 224
273 3300005563 Ga0068855_100097460 Ga0068855_1000974602 224
274 3300005564 Ga0070664_100299231 Ga0070664_1002992311 224
275 3300005577 Ga0068857_100045347 Ga0068857_1000453473 224
276 3300005577 Ga0068857_100073149 Ga0068857_1000731492 224
277 3300005577 Ga0068857_100497630 Ga0068857_1004976302 224
278 3300005578 Ga0068854_100028924 Ga0068854_1000289241 224
279 3300005614 Ga0068856_100108541 Ga0068856_1001085412 224
280 3300005617 Ga0068859_100041006 Ga0068859_1000410063 224
281 3300005618 Ga0068864_100645846 Ga0068864_1006458462 224
282 3300005718 Ga0068866_10071920 Ga0068866_100719202 224
283 3300005842 Ga0068858_100070389 Ga0068858_1000703892 224
284 3300005843 Ga0068860_100152796 Ga0068860_1001527962 224
285 3300005843 Ga0068860_100231940 Ga0068860_1002319402 224
286 3300005843 Ga0068860_100740566 Ga0068860_1007405661 224
287 3300005844 Ga0068862_100252439 Ga0068862_1002524391 224
288 3300005983 Ga0081540_1000345 Ga0081540_10003456 224
289 3300005983 Ga0081540_1001308 Ga0081540_100130813 224
290 3300005985 Ga0081539_10005543 Ga0081539_100055434 224
291 3300005985 Ga0081539_10027029 Ga0081539_100270292 224
292 3300006028 Ga0070717_10018129 Ga0070717_100181296 224
293 3300006028 Ga0070717_10046161 Ga0070717_100461612 224
294 3300006028 Ga0070717_10058504 Ga0070717_100585042 224
295 3300006028 Ga0070717_10368294 Ga0070717_103682942 224
296 3300006028 Ga0070717_10624459 Ga0070717_106244592 224
297 3300006163 Ga0070715_10001476 Ga0070715_100014762 224
298 3300006163 Ga0070715_10050842 Ga0070715_100508422 224
299 3300006173 Ga0070716_100001463 Ga0070716_10000146311 224
300 3300006173 Ga0070716_100019289 Ga0070716_1000192892 224
301 3300006173 Ga0070716_100076159 Ga0070716_1000761592 224
302 3300006175 Ga0070712_100071500 Ga0070712_1000715002 224
303 3300006175 Ga0070712_100260485 Ga0070712_1002604852 224
304 3300006175 Ga0070712_100266517 Ga0070712_1002665172 224
305 3300006237 Ga0097621_100215728 Ga0097621_1002157282 224
306 3300006237 Ga0097621_100311445 Ga0097621_1003114452 224
307 3300006847 Ga0075431_100106830 Ga0075431_1001068302 224
308 3300006871 Ga0075434_100389538 Ga0075434_1003895382 224
309 3300006914 Ga0075436_100004827 Ga0075436_1000048274 224
310 3300006914 Ga0075436_100020931 Ga0075436_1000209312 224
311 3300006931 Ga0097620_100041008 Ga0097620_1000410082 224
312 3300009093 Ga0105240_10273382 Ga0105240_102733822 224
313 3300009093 Ga0105240_10350751 Ga0105240_103507511 224
314 3300009098 Ga0105245_10028596 Ga0105245_100285965 224
315 3300009098 Ga0105245_10163393 Ga0105245_101633932 224
316 3300009147 Ga0114129_10024315 Ga0114129_100243154 224
317 3300009148 Ga0105243_10277580 Ga0105243_102775802 224
318 3300009148 Ga0105243_10341615 Ga0105243_103416152 224
319 3300009176 Ga0105242_10073410 Ga0105242_100734101 224
320 3300009177 Ga0105248_10604018 Ga0105248_106040182 224
321 3300009551 Ga0105238_10159425 Ga0105238_101594252 224
322 3300009551 Ga0105238_10291352 Ga0105238_102913522 224
323 3300009553 Ga0105249_10169960 Ga0105249_101699602 224
324 3300011119 Ga0105246_10032876 Ga0105246_100328762 224
325 3300011119 Ga0105246_10919680 Ga0105246_109196801 224
326 3300012507 Ga0157342_1008389 Ga0157342_10083891 224
327 3300013105 Ga0157369_10006230 Ga0157369_1000623011 224
328 3300013105 Ga0157369_10223548 Ga0157369_102235482 224
329 3300013296 Ga0157374_10649385 Ga0157374_106493852 224
330 3300013297 Ga0157378_10176077 Ga0157378_101760772 224
331 3300013306 Ga0163162_10833720 Ga0163162_108337201 224
332 3300013307 Ga0157372_10090164 Ga0157372_100901643 224
333 3300013307 Ga0157372_10770623 Ga0157372_107706232 224
334 3300013308 Ga0157375_10077212 Ga0157375_100772123 224
335 3300013308 Ga0157375_10144159 Ga0157375_101441592 224
336 3300013308 Ga0157375_10218869 Ga0157375_102188691 224
337 3300014325 Ga0163163_10003412 Ga0163163_100034128 224
338 3300014325 Ga0163163_10124358 Ga0163163_101243583 224
339 3300014326 Ga0157380_10720355 Ga0157380_107203552 224
340 3300014745 Ga0157377_10070554 Ga0157377_100705542 224
341 3300014968 Ga0157379_10005808 Ga0157379_100058082 224
342 3300014968 Ga0157379_10279803 Ga0157379_102798032 224
343 3300014969 Ga0157376_10025898 Ga0157376_100258984 224
344 3300014969 Ga0157376_10116353 Ga0157376_101163532 224
345 3300014969 Ga0157376_10154488 Ga0157376_101544882 224
346 3300020069 Ga0197907_11154562 Ga0197907_111545621 224
347 3300020077 Ga0206351_10623328 Ga0206351_106233282 224
348 3300020080 Ga0206350_10545162 Ga0206350_105451622 224
349 3300020080 Ga0206350_11332998 Ga0206350_113329982 224
350 3300020082 Ga0206353_10430810 Ga0206353_104308103 224
351 3300020082 Ga0206353_10837455 Ga0206353_108374552 224
352 3300021388 Ga0213875_10053546 Ga0213875_100535461 224
353 3300022467 Ga0224712_10003657 Ga0224712_100036572 224
354 3300022467 Ga0224712_10009872 Ga0224712_100098722 224
355 3300022467 Ga0224712_10012296 Ga0224712_100122963 224
356 3300022467 Ga0224712_10022462 Ga0224712_100224621 224
357 3300022467 Ga0224712_10172980 Ga0224712_101729802 224
358 3300025898 Ga0207692_10001219 Ga0207692_100012196 224
359 3300025898 Ga0207692_10048644 Ga0207692_100486442 224
360 3300025898 Ga0207692_10231762 Ga0207692_102317622 224
361 3300025898 Ga0207692_10379978 Ga0207692_103799782 224
362 3300025901 Ga0207688_10011417 Ga0207688_100114174 224
363 3300025904 Ga0207647_10053383 Ga0207647_100533832 224
364 3300025904 Ga0207647_10210887 Ga0207647_102108872 224
365 3300025905 Ga0207685_10017954 Ga0207685_100179542 224
366 3300025905 Ga0207685_10056915 Ga0207685_100569152 224
367 3300025906 Ga0207699_10010674 Ga0207699_100106743 224
368 3300025906 Ga0207699_10018548 Ga0207699_100185484 224
369 3300025906 Ga0207699_10069684 Ga0207699_100696842 224
370 3300025906 Ga0207699_10084580 Ga0207699_100845802 224
371 3300025906 Ga0207699_10094201 Ga0207699_100942012 224
372 3300025909 Ga0207705_10014311 Ga0207705_100143113 224
373 3300025910 Ga0207684_10020585 Ga0207684_100205851 224
374 3300025910 Ga0207684_10103864 Ga0207684_101038642 224
375 3300025910 Ga0207684_10164710 Ga0207684_101647102 224
376 3300025910 Ga0207684_10224693 Ga0207684_102246932 224
377 3300025910 Ga0207684_10281699 Ga0207684_102816991 224
378 3300025912 Ga0207707_10001352 Ga0207707_1000135212 224
379 3300025912 Ga0207707_10303303 Ga0207707_103033033 224
380 3300025915 Ga0207693_10011242 Ga0207693_100112422 224
381 3300025915 Ga0207693_10055473 Ga0207693_100554732 224
382 3300025915 Ga0207693_10122229 Ga0207693_101222292 224
383 3300025915 Ga0207693_10177362 Ga0207693_101773622 224
384 3300025916 Ga0207663_10016400 Ga0207663_100164003 224
385 3300025916 Ga0207663_10176131 Ga0207663_101761311 224
386 3300025916 Ga0207663_10517600 Ga0207663_105176002 224
387 3300025918 Ga0207662_10039032 Ga0207662_100390322 224
388 3300025919 Ga0207657_10013739 Ga0207657_100137392 224
389 3300025921 Ga0207652_10008724 Ga0207652_100087245 224
390 3300025921 Ga0207652_10147526 Ga0207652_101475262 224
391 3300025921 Ga0207652_10351540 Ga0207652_103515401 224
392 3300025922 Ga0207646_10036661 Ga0207646_100366614 224
393 3300025922 Ga0207646_10066969 Ga0207646_100669692 224
394 3300025922 Ga0207646_10125319 Ga0207646_101253192 224
395 3300025922 Ga0207646_10214371 Ga0207646_102143712 224
396 3300025928 Ga0207700_10012464 Ga0207700_100124642 224
397 3300025928 Ga0207700_10017983 Ga0207700_100179832 224
398 3300025928 Ga0207700_10032895 Ga0207700_100328952 224
399 3300025928 Ga0207700_10034300 Ga0207700_100343003 224
400 3300025928 Ga0207700_10050547 Ga0207700_100505472 224
401 3300025928 Ga0207700_10118893 Ga0207700_101188932 224
402 3300025928 Ga0207700_10223870 Ga0207700_102238703 224
403 3300025928 Ga0207700_10279193 Ga0207700_102791932 224
404 3300025928 Ga0207700_10319977 Ga0207700_103199772 224
405 3300025929 Ga0207664_10001219 Ga0207664_1000121915 224
406 3300025929 Ga0207664_10001859 Ga0207664_100018594 224
407 3300025929 Ga0207664_10010461 Ga0207664_100104612 224
408 3300025929 Ga0207664_10045207 Ga0207664_100452072 224
409 3300025929 Ga0207664_10050425 Ga0207664_100504253 224
410 3300025929 Ga0207664_10078311 Ga0207664_100783111 224
411 3300025929 Ga0207664_10130081 Ga0207664_101300812 224
412 3300025929 Ga0207664_10154753 Ga0207664_101547532 224
413 3300025929 Ga0207664_10199746 Ga0207664_101997462 224
414 3300025932 Ga0207690_10262610 Ga0207690_102626102 224
415 3300025934 Ga0207686_10233304 Ga0207686_102333042 224
416 3300025937 Ga0207669_10199851 Ga0207669_101998512 224
417 3300025937 Ga0207669_10354556 Ga0207669_103545561 224
418 3300025939 Ga0207665_10000937 Ga0207665_1000093712 224
419 3300025939 Ga0207665_10025697 Ga0207665_100256972 224
420 3300025939 Ga0207665_10044338 Ga0207665_100443382 224
421 3300025940 Ga0207691_10043103 Ga0207691_100431032 224
422 3300025942 Ga0207689_10316061 Ga0207689_103160611 224
423 3300025944 Ga0207661_10279300 Ga0207661_102793002 224
424 3300025945 Ga0207679_10315845 Ga0207679_103158451 224
425 3300026023 Ga0207677_10161080 Ga0207677_101610801 224
426 3300026023 Ga0207677_10645376 Ga0207677_106453761 224
427 3300026035 Ga0207703_10182944 Ga0207703_101829442 224
428 3300026067 Ga0207678_10013263 Ga0207678_100132633 224
429 3300026067 Ga0207678_10414828 Ga0207678_104148281 224
430 3300026078 Ga0207702_10098834 Ga0207702_100988342 224
431 3300026089 Ga0207648_10273380 Ga0207648_102733802 224
432 3300026095 Ga0207676_10023529 Ga0207676_100235292 224
433 3300026095 Ga0207676_10534115 Ga0207676_105341152 224
434 3300026116 Ga0207674_10002791 Ga0207674_1000279115 224
435 3300026116 Ga0207674_10043441 Ga0207674_100434413 224
436 3300026116 Ga0207674_10062060 Ga0207674_100620603 224
437 3300026118 Ga0207675_100045873 Ga0207675_1000458732 224
438 3300026121 Ga0207683_10044001 Ga0207683_100440013 224
439 3300026121 Ga0207683_10542743 Ga0207683_105427432 224
440 3300028379 Ga0268266_10037281 Ga0268266_100372812 224
441 3300028379 Ga0268266_10148443 Ga0268266_101484432 224
442 3300028380 Ga0268265_10303887 Ga0268265_103038872 224
443 3300028380 Ga0268265_10764455 Ga0268265_107644552 224
444 3300028381 Ga0268264_10016885 Ga0268264_100168855 224
445 3300028381 Ga0268264_10102534 Ga0268264_101025342 224
446 3300028381 Ga0268264_10732260 Ga0268264_107322602 224
447 3300028556 Ga0265337_1007835 Ga0265337_10078354 224
448 3300028558 Ga0265326_10007791 Ga0265326_100077914 224
449 3300028563 Ga0265319_1000101 Ga0265319_100010125 224
450 3300028563 Ga0265319_1004032 Ga0265319_10040323 224
451 3300028573 Ga0265334_10003352 Ga0265334_100033523 224
452 3300028577 Ga0265318_10000112 Ga0265318_1000011245 224
453 3300028577 Ga0265318_10001261 Ga0265318_100012612 224
454 3300028577 Ga0265318_10061405 Ga0265318_100614052 224
455 3300028653 Ga0265323_10009626 Ga0265323_100096263 224
456 3300028654 Ga0265322_10006720 Ga0265322_100067203 224
457 3300028666 Ga0265336_10001704 Ga0265336_100017045 224
458 3300028666 Ga0265336_10014619 Ga0265336_100146192 224
459 3300028794 Ga0307515_10000042 Ga0307515_10000042265 224
460 3300028800 Ga0265338_10000743 Ga0265338_100007436 224
461 3300028800 Ga0265338_10001346 Ga0265338_100013464 224
462 3300028800 Ga0265338_10005011 Ga0265338_100050116 224
463 3300028800 Ga0265338_10006911 Ga0265338_100069114 224
464 3300028800 Ga0265338_10057494 Ga0265338_100574942 224
465 3300028800 Ga0265338_10066202 Ga0265338_100662022 224
466 3300029957 Ga0265324_10010807 Ga0265324_100108072 224
467 3300031235 Ga0265330_10000056 Ga0265330_1000005626 224
468 3300031238 Ga0265332_10000050 Ga0265332_1000005030 224
469 3300031238 Ga0265332_10002184 Ga0265332_100021846 224
470 3300031239 Ga0265328_10001238 Ga0265328_100012387 224
471 3300031240 Ga0265320_10000115 Ga0265320_100001153 224
472 3300031240 Ga0265320_10005115 Ga0265320_100051154 224
473 3300031240 Ga0265320_10109686 Ga0265320_101096862 224
474 3300031241 Ga0265325_10000326 Ga0265325_100003268 224
475 3300031241 Ga0265325_10001667 Ga0265325_1000166710 224
476 3300031241 Ga0265325_10035966 Ga0265325_100359663 224
477 3300031242 Ga0265329_10000048 Ga0265329_1000004822 224
478 3300031247 Ga0265340_10001141 Ga0265340_100011414 224
479 3300031247 Ga0265340_10001852 Ga0265340_100018528 224
480 3300031249 Ga0265339_10006545 Ga0265339_100065453 224
481 3300031249 Ga0265339_10007679 Ga0265339_100076792 224
482 3300031249 Ga0265339_10041381 Ga0265339_100413812 224
483 3300031250 Ga0265331_10000335 Ga0265331_1000033514 224
484 3300031344 Ga0265316_10001199 Ga0265316_1000119919 224
485 3300031344 Ga0265316_10008688 Ga0265316_100086882 224
486 3300031344 Ga0265316_10020583 Ga0265316_100205833 224
487 3300031548 Ga0307408_100181523 Ga0307408_1001815232 224
488 3300031595 Ga0265313_10000009 Ga0265313_10000009128 224
489 3300031595 Ga0265313_10000187 Ga0265313_100001875 224
490 3300031595 Ga0265313_10000383 Ga0265313_1000038317 224
491 3300031595 Ga0265313_10033580 Ga0265313_100335802 224
492 3300031616 Ga0307508_10149401 Ga0307508_101494012 224
493 3300031711 Ga0265314_10000430 Ga0265314_1000043034 224
494 3300031711 Ga0265314_10017800 Ga0265314_100178005 224
495 3300031712 Ga0265342_10000333 Ga0265342_1000033334 224
496 3300031712 Ga0265342_10012657 Ga0265342_100126576 224
497 3300031730 Ga0307516_10003947 Ga0307516_100039475 224
498 3300031731 Ga0307405_10333712 Ga0307405_103337121 224
499 3300031824 Ga0307413_10023726 Ga0307413_100237263 224
500 3300031852 Ga0307410_10015091 Ga0307410_100150912 224
501 3300031852 Ga0307410_10032568 Ga0307410_100325683 224
502 3300031901 Ga0307406_10028625 Ga0307406_100286253 224
503 3300031903 Ga0307407_10044263 Ga0307407_100442632 224
504 3300031903 Ga0307407_10102867 Ga0307407_101028672 224
505 3300031903 Ga0307407_10140691 Ga0307407_101406912 224
506 3300031911 Ga0307412_10134797 Ga0307412_101347972 224
507 3300031995 Ga0307409_100090877 Ga0307409_1000908773 224
508 3300031995 Ga0307409_100384215 Ga0307409_1003842151 224
509 3300032002 Ga0307416_100021692 Ga0307416_1000216922 224
510 3300032002 Ga0307416_100492760 Ga0307416_1004927602 224
511 3300032004 Ga0307414_10086307 Ga0307414_100863072 224
512 3300032004 Ga0307414_10271610 Ga0307414_102716102 224
513 3300032004 Ga0307414_10501103 Ga0307414_105011032 224
514 3300032005 Ga0307411_10642793 Ga0307411_106427931 224
515 3300032126 Ga0307415_100002584 Ga0307415_1000025847 224
516 3300032126 Ga0307415_100035580 Ga0307415_1000355802 224
517 3300032126 Ga0307415_100489620 Ga0307415_1004896202 224
518 3300033545 Ga0316214_1002630 Ga0316214_10026302 224
519 3300034957 Ga0373938_0044313 Ga0373938_0044313_31_708 224
520 3300035083 Ga0373926_0002315 Ga0373926_0002315_1770_2459 224
521 3300035083 Ga0373926_0006977 Ga0373926_0006977_1612_2289 224
522 3300035086 Ga0373934_0000101 Ga0373934_0000101_27196_27906 224
523 3300035086 Ga0373934_0012313 Ga0373934_0012313_1058_1765 224
524 3300035086 Ga0373934_0040878 Ga0373934_0040878_428_1105 224
525 3300035086 Ga0373934_0042417 Ga0373934_0042417_565_1272 224
526 3300035090 Ga0373949_0031357 Ga0373949_0031357_224_901 224
527 3300035111 Ga0373923_0000967 Ga0373923_0000967_4169_4879 224
528 3300035111 Ga0373923_0010902 Ga0373923_0010902_1316_1999 224
529 3300035111 Ga0373923_0015587 Ga0373923_0015587_1339_2016 224
530 3300035111 Ga0373923_0039155 Ga0373923_0039155_552_1259 224
531 3300035111 Ga0373923_0061499 Ga0373923_0061499_711_1391 224
532 3300035111 Ga0373923_0075589 Ga0373923_0075589_602_1387 224
533 3300035113 Ga0373936_0003980 Ga0373936_0003980_556_1233 224
534 3300035113 Ga0373936_0308040 Ga0373936_0308040_26_703 224
535 3300035116 Ga0373945_0028991 Ga0373945_0028991_611_1354 224
536 3300035116 Ga0373945_0034494 Ga0373945_0034494_733_1410 224
537 3300035117 Ga0373953_0000521 Ga0373953_0000521_4638_5348 224
538 3300035117 Ga0373953_0009295 Ga0373953_0009295_1021_1704 224
539 3300035117 Ga0373953_0026137 Ga0373953_0026137_1183_1890 224
540 3300035118 Ga0373954_0008596 Ga0373954_0008596_1842_2525 224
541 3300035118 Ga0373954_0015680 Ga0373954_0015680_1767_2552 224
542 3300035118 Ga0373954_0027967 Ga0373954_0027967_1078_1785 224
543 3300035119 Ga0373956_0000095 Ga0373956_0000095_27054_27764 224
544 3300035119 Ga0373956_0018190 Ga0373956_0018190_48_731 224
545 3300035119 Ga0373956_0113215 Ga0373956_0113215_268_1053 224
546 3300035120 Ga0373957_0000033 Ga0373957_0000033_1262_1972 224
547 3300035170 Ga0373943_0066062 Ga0373943_0066062_860_1645 224
548 3300035170 Ga0373943_0085374 Ga0373943_0085374_584_1261 224
549 3300035171 Ga0373946_0002118 Ga0373946_0002118_3327_4004 224
550 3300035171 Ga0373946_0010570 Ga0373946_0010570_2138_2827 224
551 3300035171 Ga0373946_0145535 Ga0373946_0145535_132_812 224
552 3300035172 Ga0373955_0000002 Ga0373955_0000002_81130_81840 224
553 3300035172 Ga0373955_0007055 Ga0373955_0007055_4420_5097 224
554 3300035172 Ga0373955_0012915 Ga0373955_0012915_1014_1697 224
555 3300035410 Ga0373924_0002327 Ga0373924_0002327_452_1129 224
556 3300035410 Ga0373924_0009167 Ga0373924_0009167_2130_2840 224
557 3300035691 Ga0373931_0346063 Ga0373931_0346063_183_860 224
558 3300035692 Ga0373935_0000234 Ga0373935_0000234_9247_9936 224
559 3300035692 Ga0373935_0045225 Ga0373935_0045225_783_1466 224
560 3300035692 Ga0373935_0192321 Ga0373935_0192321_318_1031 224
561 3300035695 Ga0373927_0254902 Ga0373927_0254902_165_908 224
562 3300035724 Ga0373933_0000029 Ga0373933_0000029_60438_61148 224
563 3300035724 Ga0373933_0012974 Ga0373933_0012974_2620_3303 224
564 3300035724 Ga0373933_0024647 Ga0373933_0024647_26_703 224
565 3300035724 Ga0373933_0033935 Ga0373933_0033935_1503_2210 224
566 3300035724 Ga0373933_0137993 Ga0373933_0137993_584_1288 224
567 3300035724 Ga0373933_0198132 Ga0373933_0198132_55_732 224
568 3300035725 Ga0373947_0000005 Ga0373947_0000005_160832_161521 224
569 3300036401 Ga0373937_0000362 Ga0373937_0000362_28589_29299 224
570 3300036401 Ga0373937_0004443 Ga0373937_0004443_7919_8626 224
571 3300036401 Ga0373937_0095938 Ga0373937_0095938_962_1645 224
572 3300036401 Ga0373937_0330572 Ga0373937_0330572_728_1405 224
573 3300036401 Ga0373937_0448943 Ga0373937_0448943_408_1088 224
574 3300036401 Ga0373937_0472913 Ga0373937_0472913_142_819 224
575 3300037068 Ga0373925_0000021 Ga0373925_0000021_55758_56432 224
576 3300037068 Ga0373925_0199253 Ga0373925_0199253_331_1008 224
577 3300037068 Ga0373925_0221133 Ga0373925_0221133_359_1102 224
578 3300037418 Ga0395900_0003692 Ga0395900_0003692_13318_13992 224
579 3300037466 Ga0395898_0042087 Ga0395898_0042087_3364_4038 224
580 3300037853 Ga0436364_1130152 Ga0436364_1130152_562_1239 224
581 3300037853 Ga0436364_1225860 Ga0436364_1225860_1137_1814 224
582 3300039447 Ga0436361_0546799 Ga0436361_0546799_205_885 224
583 3300039450 Ga0436363_0208428 Ga0436363_0208428_1079_1834 224
584 3300041441 Ga0451787_197248 Ga0451787_197248_484_1164 224
585 3300041443 Ga0451789_0052206 Ga0451789_0052206_303_983 224
586 3300041451 Ga0451791_1114879 Ga0451791_1114879_1121_1801 224
587 3300041451 Ga0451791_1689531 Ga0451791_1689531_1165_1842 224
588 3300041452 Ga0451793_0720655 Ga0451793_0720655_7544_8224 224
589 3300041453 Ga0451797_0100726 Ga0451797_0100726_326_1006 224
590 3300041459 Ga0451800_0314848 Ga0451800_0314848_76_756 224
591 3300041486 Ga0451807_0584294 Ga0451807_0584294_268_948 224
592 3300041496 Ga0451839_0061394 Ga0451839_0061394_2285_2965 224
593 3300041498 Ga0451841_0287715 Ga0451841_0287715_277_957 224
594 3300041509 Ga0451843_0204342 Ga0451843_0204342_55_735 224
595 3300044683 Ga0466965_0355675 Ga0466965_0355675_97_792 224
596 3300044693 Ga0466961_0105411 Ga0466961_0105411_272_964 224
597 3300044694 Ga0466963_0076384 Ga0466963_0076384_148_825 224
598 3300044842 Ga0466957_0239841 Ga0466957_0239841_364_1038 224
599 3300044901 Ga0466960_0012595 Ga0466960_0012595_446_1120 224
600 3300044901 Ga0466960_0097893 Ga0466960_0097893_211_885 224
601 3300045049 Ga0466959_0003301 Ga0466959_0003301_8416_9090 224
602 3300045049 Ga0466959_0133545 Ga0466959_0133545_562_1236 224
603 3300045836 Ga0466958_0090390 Ga0466958_0090390_319_1008 224
604 3300045836 Ga0466958_0121743 Ga0466958_0121743_306_983 224
605 3300045836 Ga0466958_0259650 Ga0466958_0259650_12_686 224
606 3300045836 Ga0466958_0276648 Ga0466958_0276648_165_839 224
607 3300045976 Ga0466967_0000444 Ga0466967_0000444_10292_10966 224
608 3300045976 Ga0466967_0004649 Ga0466967_0004649_5705_6379 224
609 3300045976 Ga0466967_0026433 Ga0466967_0026433_1437_2114 224
610 3300045976 Ga0466967_0050982 Ga0466967_0050982_1957_2631 224
611 3300045976 Ga0466967_0127873 Ga0466967_0127873_1585_2262 224
612 3300045976 Ga0466967_0154742 Ga0466967_0154742_50_724 224
613 3300045976 Ga0466967_0573243 Ga0466967_0573243_221_922 224
614 3300046454 Ga0495592_0000043 Ga0495592_0000043_82530_83240 224
615 3300046454 Ga0495592_0008890 Ga0495592_0008890_586_1260 224
616 3300046454 Ga0495592_0040782 Ga0495592_0040782_1157_1837 224
617 3300046454 Ga0495592_0100369 Ga0495592_0100369_862_1569 224
618 3300046454 Ga0495592_0135693 Ga0495592_0135693_456_1133 224
619 3300046454 Ga0495592_0232868 Ga0495592_0232868_443_1126 224
620 3300046455 Ga0495603_0042928 Ga0495603_0042928_918_1592 224
621 3300046459 Ga0495629_0005691 Ga0495629_0005691_985_1659 224
622 3300046459 Ga0495629_0091124 Ga0495629_0091124_812_1597 224
623 3300046459 Ga0495629_0217170 Ga0495629_0217170_584_1261 224
624 3300046461 Ga0495641_0001864 Ga0495641_0001864_8923_9600 224
625 3300046462 Ga0495651_0000135 Ga0495651_0000135_28695_29405 224
626 3300046462 Ga0495651_0003167 Ga0495651_0003167_1987_2694 224
627 3300046462 Ga0495651_0006755 Ga0495651_0006755_1890_2567 224
628 3300046462 Ga0495651_0021269 Ga0495651_0021269_3354_4139 224
629 3300046462 Ga0495651_0028970 Ga0495651_0028970_1296_1979 224
630 3300046462 Ga0495651_0055294 Ga0495651_0055294_2146_2826 224
631 3300046463 Ga0495653_0000571 Ga0495653_0000571_1077_1787 224
632 3300046463 Ga0495653_0012759 Ga0495653_0012759_2345_3025 224
633 3300046463 Ga0495653_0063902 Ga0495653_0063902_1707_2414 224
634 3300046463 Ga0495653_0132596 Ga0495653_0132596_501_1178 224
635 3300046463 Ga0495653_0179118 Ga0495653_0179118_177_854 224
636 3300046463 Ga0495653_0299490 Ga0495653_0299490_142_843 224
637 3300046472 Ga0495580_0015800 Ga0495580_0015800_2002_2679 224
638 3300046473 Ga0495582_0212637 Ga0495582_0212637_294_1067 224
639 3300046473 Ga0495582_0296301 Ga0495582_0296301_166_843 224
640 3300046475 Ga0495639_0001668 Ga0495639_0001668_95_772 224
641 3300046476 Ga0495662_0009182 Ga0495662_0009182_1667_2350 224
642 3300046476 Ga0495662_0011201 Ga0495662_0011201_1327_2004 224
643 3300046476 Ga0495662_0036057 Ga0495662_0036057_315_1100 224
644 3300046476 Ga0495662_0074460 Ga0495662_0074460_182_862 224
645 3300046477 Ga0495664_0014805 Ga0495664_0014805_2683_3363 224
646 3300046477 Ga0495664_0017439 Ga0495664_0017439_742_1425 224
647 3300046477 Ga0495664_0125390 Ga0495664_0125390_517_1194 224
648 3300046477 Ga0495664_0177147 Ga0495664_0177147_336_1016 224
649 3300046477 Ga0495664_0275579 Ga0495664_0275579_108_785 224
650 3300046499 Ga0495594_0158565 Ga0495594_0158565_274_1047 224
651 3300046499 Ga0495594_0226331 Ga0495594_0226331_33_707 224
652 3300046511 Ga0495608_0000016 Ga0495608_0000016_82185_82895 224
653 3300046511 Ga0495608_0007773 Ga0495608_0007773_2176_2856 224
654 3300046511 Ga0495608_0013563 Ga0495608_0013563_4310_4987 224
655 3300046511 Ga0495608_0050860 Ga0495608_0050860_521_1204 224
656 3300046511 Ga0495608_0119179 Ga0495608_0119179_656_1333 224
657 3300046514 Ga0495618_0022655 Ga0495618_0022655_383_1066 224
658 3300046514 Ga0495618_0183018 Ga0495618_0183018_143_823 224
659 3300046514 Ga0495618_0199061 Ga0495618_0199061_278_955 224
660 3300046514 Ga0495618_0346335 Ga0495618_0346335_48_722 224
661 3300046516 Ga0495628_0000034 Ga0495628_0000034_31921_32631 224
662 3300046516 Ga0495628_0008967 Ga0495628_0008967_1595_2269 224
663 3300046516 Ga0495628_0013773 Ga0495628_0013773_3219_3920 224
664 3300046516 Ga0495628_0227919 Ga0495628_0227919_584_1264 224
665 3300046516 Ga0495628_0388891 Ga0495628_0388891_237_914 224
666 3300046517 Ga0495630_0001481 Ga0495630_0001481_14684_15361 224
667 3300046517 Ga0495630_0009954 Ga0495630_0009954_1632_2315 224
668 3300046517 Ga0495630_0077567 Ga0495630_0077567_143_823 224
669 3300046525 Ga0495663_0054344 Ga0495663_0054344_454_1128 224
670 3300046526 Ga0495666_0005436 Ga0495666_0005436_616_1293 224
671 3300046526 Ga0495666_0094215 Ga0495666_0094215_576_1319 224
672 3300046529 Ga0495652_0000174 Ga0495652_0000174_46764_47474 224
673 3300046529 Ga0495652_0014268 Ga0495652_0014268_627_1304 224
674 3300046529 Ga0495652_0018126 Ga0495652_0018126_3492_4175 224
675 3300046529 Ga0495652_0022357 Ga0495652_0022357_2233_2913 224
676 3300046529 Ga0495652_0054315 Ga0495652_0054315_1442_2116 224
677 3300046529 Ga0495652_0054402 Ga0495652_0054402_1234_1941 224
678 3300046529 Ga0495652_0066154 Ga0495652_0066154_1540_2217 224
679 3300046529 Ga0495652_0239700 Ga0495652_0239700_309_986 224
680 3300046531 Ga0495665_0017965 Ga0495665_0017965_2435_3112 224
681 3300046533 Ga0495640_0006733 Ga0495640_0006733_6470_7147 224
682 3300046533 Ga0495640_0011539 Ga0495640_0011539_3168_3842 224
683 3300046533 Ga0495640_0039902 Ga0495640_0039902_2213_2896 224
684 3300046533 Ga0495640_0254242 Ga0495640_0254242_47_832 224
685 3300046536 Ga0495587_0000044 Ga0495587_0000044_25552_26262 224
686 3300046536 Ga0495587_0002197 Ga0495587_0002197_6817_7494 224
687 3300046536 Ga0495587_0004185 Ga0495587_0004185_8059_8844 224
688 3300046536 Ga0495587_0007131 Ga0495587_0007131_4579_5259 224
689 3300046536 Ga0495587_0023581 Ga0495587_0023581_2065_2748 224
690 3300046536 Ga0495587_0123462 Ga0495587_0123462_177_854 224
691 3300046543 Ga0495645_0145071 Ga0495645_0145071_459_1139 224
692 3300046543 Ga0495645_0168207 Ga0495645_0168207_795_1475 224
693 3300046543 Ga0495645_0315594 Ga0495645_0315594_272_949 224
694 3300046557 Ga0495622_0140668 Ga0495622_0140668_255_932 224
695 3300046559 Ga0495667_0000052 Ga0495667_0000052_82174_82884 224
696 3300046559 Ga0495667_0058789 Ga0495667_0058789_1754_2461 224
697 3300046559 Ga0495667_0065610 Ga0495667_0065610_1434_2117 224
698 3300046559 Ga0495667_0083468 Ga0495667_0083468_779_1453 224
699 3300046559 Ga0495667_0229903 Ga0495667_0229903_11_688 224
700 3300046559 Ga0495667_0270642 Ga0495667_0270642_227_904 224
701 3300046615 Ga0495656_0169464 Ga0495656_0169464_21_695 224
702 3300046642 Ga0495634_0005292 Ga0495634_0005292_85_762 224
703 3300046642 Ga0495634_0009343 Ga0495634_0009343_1295_1969 224
704 3300046642 Ga0495634_0057919 Ga0495634_0057919_48_731 224
705 3300046642 Ga0495634_0144929 Ga0495634_0144929_732_1409 224
706 3300046663 Ga0495635_0039234 Ga0495635_0039234_2301_2981 224
707 3300046663 Ga0495635_0065132 Ga0495635_0065132_351_1136 224
708 3300046663 Ga0495635_0072653 Ga0495635_0072653_332_1015 224
709 3300046663 Ga0495635_0148515 Ga0495635_0148515_395_1102 224
710 3300046663 Ga0495635_0235376 Ga0495635_0235376_289_966 224
711 3300046663 Ga0495635_0336209 Ga0495635_0336209_318_998 224
712 3300046674 Ga0495588_0091891 Ga0495588_0091891_781_1458 224
713 3300046674 Ga0495588_0195713 Ga0495588_0195713_180_860 224
714 3300046675 Ga0495657_0000015 Ga0495657_0000015_82180_82890 224
715 3300046675 Ga0495657_0009392 Ga0495657_0009392_5406_6083 224
716 3300046675 Ga0495657_0013373 Ga0495657_0013373_4599_5279 224
717 3300046675 Ga0495657_0024401 Ga0495657_0024401_1920_2594 224
718 3300046675 Ga0495657_0027681 Ga0495657_0027681_2226_2933 224
719 3300046675 Ga0495657_0082289 Ga0495657_0082289_393_1178 224
720 3300046675 Ga0495657_0091969 Ga0495657_0091969_935_1618 224
721 3300046675 Ga0495657_0233343 Ga0495657_0233343_148_825 224
722 3300046678 Ga0495599_0000035 Ga0495599_0000035_20742_21452 224
723 3300046678 Ga0495599_0003091 Ga0495599_0003091_7314_8099 224
724 3300046678 Ga0495599_0007370 Ga0495599_0007370_4527_5210 224
725 3300046678 Ga0495599_0051967 Ga0495599_0051967_1435_2112 224
726 3300046678 Ga0495599_0198281 Ga0495599_0198281_230_910 224
727 3300046679 Ga0495623_0000767 Ga0495623_0000767_19820_20530 224
728 3300046679 Ga0495623_0002607 Ga0495623_0002607_4386_5171 224
729 3300046679 Ga0495623_0037673 Ga0495623_0037673_972_1655 224
730 3300046679 Ga0495623_0140134 Ga0495623_0140134_276_950 224
731 3300046679 Ga0495623_0222683 Ga0495623_0222683_232_912 224
732 3300046679 Ga0495623_0233732 Ga0495623_0233732_16_723 224
733 3300046679 Ga0495623_0306196 Ga0495623_0306196_164_841 224
734 3300046680 Ga0495646_0002176 Ga0495646_0002176_1635_2345 224
735 3300046680 Ga0495646_0014045 Ga0495646_0014045_1144_1929 224
736 3300046680 Ga0495646_0040257 Ga0495646_0040257_456_1133 224
737 3300046680 Ga0495646_0382705 Ga0495646_0382705_26_703 224
738 3300046683 Ga0495658_0000676 Ga0495658_0000676_16238_16915 224
739 3300046689 Ga0495613_0078282 Ga0495613_0078282_1370_2047 224
740 3300046690 Ga0495624_0122064 Ga0495624_0122064_114_791 224
741 3300046690 Ga0495624_0126680 Ga0495624_0126680_503_1183 224
742 3300046809 Ga0495600_0007475 Ga0495600_0007475_1588_2268 224
743 3300046809 Ga0495600_0025656 Ga0495600_0025656_1240_1914 224
744 3300046809 Ga0495600_0056237 Ga0495600_0056237_163_873 224
745 3300046809 Ga0495600_0088286 Ga0495600_0088286_916_1596 224
746 3300046809 Ga0495600_0223031 Ga0495600_0223031_406_1191 224
747 3300046809 Ga0495600_0270490 Ga0495600_0270490_97_804 224
748 3300047315 Ga0495581_0001515 Ga0495581_0001515_11766_12443 224
749 3300047315 Ga0495581_0017534 Ga0495581_0017534_527_1201 224
750 3300047315 Ga0495581_0023897 Ga0495581_0023897_1002_1787 224
751 3300047317 Ga0495604_0000048 Ga0495604_0000048_82530_83240 224
752 3300047317 Ga0495604_0009246 Ga0495604_0009246_352_1137 224
753 3300047317 Ga0495604_0030548 Ga0495604_0030548_519_1202 224
754 3300047317 Ga0495604_0041434 Ga0495604_0041434_138_812 224
755 3300047317 Ga0495604_0046676 Ga0495604_0046676_498_1178 224
756 3300047317 Ga0495604_0131706 Ga0495604_0131706_370_1047 224
757 3300047317 Ga0495604_0154282 Ga0495604_0154282_64_771 224
758 3300047319 Ga0495674_0027236 Ga0495674_0027236_601_1281 224
759 3300047319 Ga0495674_0139615 Ga0495674_0139615_1131_1811 224
760 3300047321 Ga0495676_0004969 Ga0495676_0004969_2710_3384 224
761 3300047321 Ga0495676_0006692 Ga0495676_0006692_814_1491 224
762 3300047322 Ga0495680_0000069 Ga0495680_0000069_5464_6174 224
763 3300047322 Ga0495680_0010239 Ga0495680_0010239_6824_7501 224
764 3300047322 Ga0495680_0012666 Ga0495680_0012666_6040_6825 224
765 3300047322 Ga0495680_0019087 Ga0495680_0019087_528_1208 224
766 3300047322 Ga0495680_0020724 Ga0495680_0020724_1967_2674 224
767 3300047322 Ga0495680_0074021 Ga0495680_0074021_1486_2163 224
768 3300047322 Ga0495680_0187849 Ga0495680_0187849_601_1284 224
769 3300047444 Ga0495675_0000685 Ga0495675_0000685_16935_17645 224
770 3300047444 Ga0495675_0040750 Ga0495675_0040750_1198_1905 224
771 3300047444 Ga0495675_0048135 Ga0495675_0048135_953_1738 224
772 3300047444 Ga0495675_0067482 Ga0495675_0067482_740_1414 224
773 3300047471 Ga0495684_0002558 Ga0495684_0002558_5899_6684 224
774 3300047471 Ga0495684_0009605 Ga0495684_0009605_6166_6843 224
775 3300047471 Ga0495684_0014538 Ga0495684_0014538_3431_4132 224
776 3300047471 Ga0495684_0067033 Ga0495684_0067033_243_926 224
777 3300047471 Ga0495684_0079004 Ga0495684_0079004_1221_1901 224
778 3300047471 Ga0495684_0125480 Ga0495684_0125480_616_1326 224
779 3300047673 Ga0495593_0246927 Ga0495593_0246927_29_709 224
780 3300048088 Ga0495602_0000970 Ga0495602_0000970_25571_26281 224
781 3300048088 Ga0495602_0028336 Ga0495602_0028336_1435_2112 224
782 3300048088 Ga0495602_0036043 Ga0495602_0036043_2933_3616 224
783 3300048088 Ga0495602_0041593 Ga0495602_0041593_1025_1702 224
784 3300048088 Ga0495602_0091366 Ga0495602_0091366_938_1645 224
785 3300048088 Ga0495602_0099272 Ga0495602_0099272_334_1041 224
786 3300048089 Ga0495614_0140023 Ga0495614_0140023_68_745 224
787 3300048903 Ga0496100_0192306 Ga0496100_0192306_582_1256 224
788 3300048905 Ga0496102_0074809 Ga0496102_0074809_537_1250 224
789 3300048905 Ga0496102_0334117 Ga0496102_0334117_181_864 224
790 3300048905 Ga0496102_0482142 Ga0496102_0482142_244_921 224
791 3300048906 Ga0496103_0053830 Ga0496103_0053830_1283_1960 224
792 3300048907 Ga0496104_0000441 Ga0496104_0000441_22785_23465 224
793 3300048907 Ga0496104_0005513 Ga0496104_0005513_8535_9209 224
794 3300048907 Ga0496104_0012681 Ga0496104_0012681_4586_5380 224
795 3300048908 Ga0496105_0085888 Ga0496105_0085888_58_738 224
796 3300048909 Ga0496106_0334431 Ga0496106_0334431_113_787 224
797 3300048909 Ga0496106_0370120 Ga0496106_0370120_420_1097 224
798 3300048909 Ga0496106_0666185 Ga0496106_0666185_121_798 224
799 3300048911 Ga0496108_0000748 Ga0496108_0000748_12516_13196 224
800 3300048911 Ga0496108_0022231 Ga0496108_0022231_4238_5032 224
801 3300048911 Ga0496108_0022533 Ga0496108_0022533_3406_4080 224
802 3300048911 Ga0496108_0180850 Ga0496108_0180850_629_1306 224
803 3300048911 Ga0496108_0213929 Ga0496108_0213929_81_758 224
804 3300048911 Ga0496108_0546456 Ga0496108_0546456_92_772 224
805 3300048912 Ga0496109_0001743 Ga0496109_0001743_4354_5034 224
806 3300048912 Ga0496109_0152282 Ga0496109_0152282_488_1282 224
807 3300048912 Ga0496109_0170111 Ga0496109_0170111_695_1375 224
808 3300048912 Ga0496109_0207973 Ga0496109_0207973_379_1053 224
809 3300048912 Ga0496109_0246635 Ga0496109_0246635_393_1070 224
810 3300048912 Ga0496109_0458350 Ga0496109_0458350_93_776 224
811 3300048913 Ga0496110_0003033 Ga0496110_0003033_2860_3540 224
812 3300048913 Ga0496110_0032286 Ga0496110_0032286_1714_2397 224
813 3300048913 Ga0496110_0063852 Ga0496110_0063852_134_847 224
814 3300048914 Ga0496111_0001177 Ga0496111_0001177_10914_11594 224
815 3300048914 Ga0496111_0368051 Ga0496111_0368051_373_1050 224
816 3300048915 Ga0496112_0000159 Ga0496112_0000159_1872_2546 224
817 3300048915 Ga0496112_0337142 Ga0496112_0337142_331_1125 224
818 3300048915 Ga0496112_0412413 Ga0496112_0412413_214_897 224
819 3300048916 Ga0496113_0051315 Ga0496113_0051315_2130_2810 224
820 3300048916 Ga0496113_0054954 Ga0496113_0054954_498_1292 224
821 3300048916 Ga0496113_0710750 Ga0496113_0710750_66_743 224
822 3300048917 Ga0496114_0242525 Ga0496114_0242525_823_1506 224
823 3300048917 Ga0496114_0681767 Ga0496114_0681767_195_875 224
824 3300048918 Ga0496115_0106658 Ga0496115_0106658_202_885 224
825 3300048918 Ga0496115_0136170 Ga0496115_0136170_512_1186 224
826 3300048918 Ga0496115_0353438 Ga0496115_0353438_85_798 224
827 3300048922 Ga0496119_0083288 Ga0496119_0083288_499_1176 224
828 3300048929 Ga0496126_0007772 Ga0496126_0007772_6297_6971 224
829 3300049568 Ga0501031_0066544 Ga0501031_0066544_831_1505 224
830 3300049569 Ga0501032_0142716 Ga0501032_0142716_660_1343 224
831 3300049570 Ga0501033_0123128 Ga0501033_0123128_1000_1686 224
832 3300049570 Ga0501033_0299190 Ga0501033_0299190_429_1103 224
833 3300049572 Ga0501036_0012617 Ga0501036_0012617_6321_6995 224
834 3300049572 Ga0501036_0031750 Ga0501036_0031750_943_1629 224
835 3300049572 Ga0501036_0419841 Ga0501036_0419841_219_902 224
836 3300049574 Ga0501038_0055593 Ga0501038_0055593_1733_2407 224
837 3300049575 Ga0501039_0023712 Ga0501039_0023712_3713_4399 224
838 3300049575 Ga0501039_0183281 Ga0501039_0183281_216_899 224
839 3300049575 Ga0501039_0579009 Ga0501039_0579009_68_742 224
840 3300049576 Ga0501040_0005034 Ga0501040_0005034_7266_7952 224
841 3300049578 Ga0501042_0016519 Ga0501042_0016519_3696_4382 224
842 3300049579 Ga0501043_0238103 Ga0501043_0238103_424_1098 224
843 3300049580 Ga0501046_0064009 Ga0501046_0064009_1503_2189 224
844 3300049581 Ga0501047_0024344 Ga0501047_0024344_118_792 224
845 3300049582 Ga0501048_0006698 Ga0501048_0006698_7919_8605 224
846 3300049583 Ga0501067_0002370 Ga0501067_0002370_8618_9292 224
847 3300049583 Ga0501067_0217319 Ga0501067_0217319_186_860 224
848 3300049584 Ga0501068_0246065 Ga0501068_0246065_313_999 224
849 3300049584 Ga0501068_0396983 Ga0501068_0396983_194_868 224
850 3300049586 Ga0501070_0038435 Ga0501070_0038435_2724_3416 224
851 3300049587 Ga0501071_0004689 Ga0501071_0004689_567_1253 224
852 3300049588 Ga0501072_0006738 Ga0501072_0006738_872_1558 224
853 3300049590 Ga0501074_0141438 Ga0501074_0141438_565_1251 224
854 3300049592 Ga0501076_0038370 Ga0501076_0038370_2016_2702 224
855 3300049593 Ga0501077_0125451 Ga0501077_0125451_40_726 224
856 3300049741 Ga0501079_0024703 Ga0501079_0024703_2880_3566 224
857 3300049742 Ga0501080_0028140 Ga0501080_0028140_3230_3904 224
858 3300049742 Ga0501080_0268637 Ga0501080_0268637_650_1333 224
859 3300049743 Ga0501081_0156214 Ga0501081_0156214_391_1077 224
860 3300049822 Ga0501035_0036768 Ga0501035_0036768_1181_1855 224
861 3300049823 Ga0501044_0034810 Ga0501044_0034810_2571_3245 224
862 3300049824 Ga0501045_0053012 Ga0501045_0053012_447_1133 224
863 3300050511 nmdc:mga08y16_24926_c1 nmdc:mga08y16_24926_c1_3609_4286 224
864 3300050513 nmdc:mga0rr50_145490_c1 nmdc:mga0rr50_145490_c1_326_1003 224
865 3300050513 nmdc:mga0rr50_316648_c1 nmdc:mga0rr50_316648_c1_13_804 224
866 3300050515 nmdc:mga0a205_30845_c1 nmdc:mga0a205_30845_c1_3035_3712 224
867 3300053077 Ga0495601_0085937 Ga0495601_0085937_527_1204 224
868 3300053077 Ga0495601_0144616 Ga0495601_0144616_841_1518 224
869 3300053078 Ga0495612_0014977 Ga0495612_0014977_28_711 224
870 3300053078 Ga0495612_0130935 Ga0495612_0130935_75_752 224
871 3300053084 Ga0495595_0000162 Ga0495595_0000162_9841_10551 224
872 3300053084 Ga0495595_0004135 Ga0495595_0004135_542_1327 224
873 3300053084 Ga0495595_0019979 Ga0495595_0019979_1603_2280 224
874 3300053084 Ga0495595_0032891 Ga0495595_0032891_1343_2026 224
875 3300053084 Ga0495595_0154657 Ga0495595_0154657_93_770 224
876 3300053085 Ga0495619_0003428 Ga0495619_0003428_100_777 224
877 3300053085 Ga0495619_0256704 Ga0495619_0256704_289_1074 224
878 3300053085 Ga0495619_0316284 Ga0495619_0316284_107_820 224
879 3300053085 Ga0495619_0338068 Ga0495619_0338068_206_889 224
880 3300054114 Ga0501084_0052825 Ga0501084_0052825_1232_1918 224
881 3300060353 Ga0501082_0042883 Ga0501082_0042883_986_1672 224
882 3300060353 Ga0501082_0448009 Ga0501082_0448009_152_832 224
883 3300061734 Ga0530510_0018293 Ga0530510_0018293_3543_4229 224
884 3300002077 JGI24744J21845_10005151 JGI24744J21845_100051512 225
885 3300005327 Ga0070658_10023598 Ga0070658_100235984 225
886 3300005329 Ga0070683_100059709 Ga0070683_1000597092 225
887 3300005329 Ga0070683_100064566 Ga0070683_1000645662 225
888 3300005331 Ga0070670_100081101 Ga0070670_1000811012 225
889 3300005336 Ga0070680_100290980 Ga0070680_1002909802 225
890 3300005337 Ga0070682_100008855 Ga0070682_1000088552 225
891 3300005339 Ga0070660_100019041 Ga0070660_1000190412 225
892 3300005347 Ga0070668_100225900 Ga0070668_1002259002 225
893 3300005354 Ga0070675_100085263 Ga0070675_1000852632 225
894 3300005438 Ga0070701_10006868 Ga0070701_100068683 225
895 3300005441 Ga0070700_100009488 Ga0070700_1000094884 225
896 3300005455 Ga0070663_100331677 Ga0070663_1003316772 225
897 3300005459 Ga0068867_100007002 Ga0068867_1000070024 225
898 3300005466 Ga0070685_10391648 Ga0070685_103916482 225
899 3300005530 Ga0070679_100111734 Ga0070679_1001117342 225
900 3300005535 Ga0070684_100019292 Ga0070684_1000192924 225
901 3300005535 Ga0070684_100158834 Ga0070684_1001588342 225
902 3300005543 Ga0070672_100001312 Ga0070672_10000131212 225
903 3300005544 Ga0070686_100154360 Ga0070686_1001543602 225
904 3300005547 Ga0070693_100060807 Ga0070693_1000608072 225
905 3300005564 Ga0070664_100460177 Ga0070664_1004601772 225
906 3300005578 Ga0068854_100013890 Ga0068854_1000138905 225
907 3300005614 Ga0068856_100530346 Ga0068856_1005303462 225
908 3300005615 Ga0070702_100007486 Ga0070702_1000074863 225
909 3300005615 Ga0070702_100025155 Ga0070702_1000251551 225
910 3300005618 Ga0068864_100403177 Ga0068864_1004031772 225
911 3300005719 Ga0068861_100014698 Ga0068861_1000146984 225
912 3300005840 Ga0068870_10007764 Ga0068870_100077644 225
913 3300005983 Ga0081540_1006178 Ga0081540_10061782 225
914 3300006844 Ga0075428_100717706 Ga0075428_1007177061 225
915 3300006881 Ga0068865_100011812 Ga0068865_1000118122 225
916 3300006881 Ga0068865_100096507 Ga0068865_1000965072 225
917 3300009094 Ga0111539_10024563 Ga0111539_100245632 225
918 3300009098 Ga0105245_10017866 Ga0105245_100178665 225
919 3300009147 Ga0114129_10333104 Ga0114129_103331042 225
920 3300009148 Ga0105243_10002861 Ga0105243_1000286116 225
921 3300009148 Ga0105243_10275198 Ga0105243_102751982 225
922 3300009551 Ga0105238_10049831 Ga0105238_100498314 225
923 3300009553 Ga0105249_10016248 Ga0105249_100162487 225
924 3300009553 Ga0105249_10130704 Ga0105249_101307042 225
925 3300010375 Ga0105239_10130301 Ga0105239_101303012 225
926 3300013104 Ga0157370_10304658 Ga0157370_103046582 225
927 3300013105 Ga0157369_10043686 Ga0157369_100436862 225
928 3300013306 Ga0163162_10033664 Ga0163162_100336642 225
929 3300013307 Ga0157372_10070802 Ga0157372_100708022 225
930 3300013307 Ga0157372_10750118 Ga0157372_107501181 225
931 3300014325 Ga0163163_10357935 Ga0163163_103579352 225
932 3300014326 Ga0157380_10014664 Ga0157380_100146644 225
933 3300014326 Ga0157380_10482740 Ga0157380_104827402 225
934 3300014968 Ga0157379_10941423 Ga0157379_109414232 225
935 3300020082 Ga0206353_11138628 Ga0206353_111386282 225
936 3300025315 Ga0207697_10076100 Ga0207697_100761002 225
937 3300025899 Ga0207642_10046425 Ga0207642_100464252 225
938 3300025901 Ga0207688_10003336 Ga0207688_100033369 225
939 3300025908 Ga0207643_10014808 Ga0207643_100148085 225
940 3300025909 Ga0207705_10262640 Ga0207705_102626402 225
941 3300025919 Ga0207657_10028157 Ga0207657_100281574 225
942 3300025921 Ga0207652_10437911 Ga0207652_104379112 225
943 3300025926 Ga0207659_10301483 Ga0207659_103014832 225
944 3300025927 Ga0207687_10012294 Ga0207687_100122944 225
945 3300025935 Ga0207709_10021557 Ga0207709_100215572 225
946 3300025935 Ga0207709_10056214 Ga0207709_100562142 225
947 3300025938 Ga0207704_10060273 Ga0207704_100602732 225
948 3300025940 Ga0207691_10002759 Ga0207691_1000275914 225
949 3300025944 Ga0207661_10020538 Ga0207661_100205383 225
950 3300025961 Ga0207712_10041209 Ga0207712_100412092 225
951 3300025972 Ga0207668_10818972 Ga0207668_108189721 225
952 3300025981 Ga0207640_10592054 Ga0207640_105920542 225
953 3300026023 Ga0207677_10065603 Ga0207677_100656032 225
954 3300026041 Ga0207639_10294704 Ga0207639_102947042 225
955 3300026067 Ga0207678_10361747 Ga0207678_103617472 225
956 3300026075 Ga0207708_10000171 Ga0207708_1000017112 225
957 3300026078 Ga0207702_10534781 Ga0207702_105347811 225
958 3300026089 Ga0207648_10000926 Ga0207648_100009265 225
959 3300026118 Ga0207675_100021690 Ga0207675_1000216904 225
960 3300026121 Ga0207683_10040527 Ga0207683_100405272 225
961 3300026142 Ga0207698_10013511 Ga0207698_100135115 225
962 3300027907 Ga0207428_10170260 Ga0207428_101702603 225
963 3300028380 Ga0268265_10158734 Ga0268265_101587342 225
964 3300035692 Ga0373935_0206279 Ga0373935_0206279_63_776 225
965 3300035725 Ga0373947_0134795 Ga0373947_0134795_183_896 225
966 3300045976 Ga0466967_0076441 Ga0466967_0076441_198_911 225
967 3300047315 Ga0495581_0091086 Ga0495581_0091086_723_1463 225
968 3300048905 Ga0496102_0136609 Ga0496102_0136609_655_1332 225
969 3300048911 Ga0496108_0034966 Ga0496108_0034966_445_1122 225
970 3300048913 Ga0496110_0061091 Ga0496110_0061091_1215_1892 225
971 3300050511 nmdc:mga08y16_51474_c1 nmdc:mga08y16_51474_c1_3400_4077 225
972 3300005435 Ga0070714_100000452 Ga0070714_10000045210 226
973 3300005435 Ga0070714_100256254 Ga0070714_1002562541 226
974 3300009147 Ga0114129_10216522 Ga0114129_102165225 226
975 3300009176 Ga0105242_10010464 Ga0105242_100104642 226
976 3300014325 Ga0163163_10101314 Ga0163163_101013142 226
977 3300025929 Ga0207664_10002401 Ga0207664_100024016 226
978 3300031456 Ga0307513_10080092 Ga0307513_100800922 226
979 3300031730 Ga0307516_10153774 Ga0307516_101537742 226
980 3300045049 Ga0466959_0362030 Ga0466959_0362030_122_802 226
981 3300045976 Ga0466967_0943566 Ga0466967_0943566_120_800 226
982 iso_pu_bacteria 2870782633 2870784859 226
983 3300005340 Ga0070689_100564929 Ga0070689_1005649292 227
984 3300013102 Ga0157371_10431412 Ga0157371_104314121 227
985 iso_pu_bacteria 8054472261 8054476347 227
986 3300005327 Ga0070658_10283857 Ga0070658_102838571 228
987 3300005328 Ga0070676_10452015 Ga0070676_104520151 228
988 3300005329 Ga0070683_100101131 Ga0070683_1001011312 228
989 3300005329 Ga0070683_100321577 Ga0070683_1003215771 228
990 3300005331 Ga0070670_100628995 Ga0070670_1006289951 228
991 3300005334 Ga0068869_100030074 Ga0068869_1000300742 228
992 3300005337 Ga0070682_100151536 Ga0070682_1001515361 228
993 3300005338 Ga0068868_100024352 Ga0068868_1000243523 228
994 3300005339 Ga0070660_100397204 Ga0070660_1003972041 228
995 3300005344 Ga0070661_100030787 Ga0070661_1000307874 228
996 3300005345 Ga0070692_10195973 Ga0070692_101959732 228
997 3300005347 Ga0070668_100017010 Ga0070668_1000170103 228
998 3300005353 Ga0070669_100436787 Ga0070669_1004367872 228
999 3300005354 Ga0070675_100167581 Ga0070675_1001675812 228
1000 3300005356 Ga0070674_100068747 Ga0070674_1000687472 228
1001 3300005365 Ga0070688_100287082 Ga0070688_1002870822 228
1002 3300005366 Ga0070659_100155108 Ga0070659_1001551082 228
1003 3300005436 Ga0070713_100037406 Ga0070713_1000374062 228
1004 3300005441 Ga0070700_100278561 Ga0070700_1002785611 228
1005 3300005455 Ga0070663_100055561 Ga0070663_1000555614 228
1006 3300005455 Ga0070663_100233430 Ga0070663_1002334302 228
1007 3300005456 Ga0070678_100224580 Ga0070678_1002245802 228
1008 3300005457 Ga0070662_100063633 Ga0070662_1000636332 228
1009 3300005466 Ga0070685_10060364 Ga0070685_100603642 228
1010 3300005466 Ga0070685_10064127 Ga0070685_100641272 228
1011 3300005535 Ga0070684_100200043 Ga0070684_1002000432 228
1012 3300005535 Ga0070684_100743007 Ga0070684_1007430071 228
1013 3300005539 Ga0068853_100257281 Ga0068853_1002572812 228
1014 3300005544 Ga0070686_100112921 Ga0070686_1001129211 228
1015 3300005547 Ga0070693_100223269 Ga0070693_1002232692 228
1016 3300005564 Ga0070664_100548494 Ga0070664_1005484941 228
1017 3300005577 Ga0068857_100400311 Ga0068857_1004003112 228
1018 3300005578 Ga0068854_100011357 Ga0068854_1000113574 228
1019 3300005615 Ga0070702_100237246 Ga0070702_1002372462 228
1020 3300005615 Ga0070702_100379323 Ga0070702_1003793231 228
1021 3300005616 Ga0068852_100192661 Ga0068852_1001926612 228
1022 3300005618 Ga0068864_100068223 Ga0068864_1000682233 228
1023 3300005618 Ga0068864_100244236 Ga0068864_1002442362 228
1024 3300005718 Ga0068866_10092394 Ga0068866_100923942 228
1025 3300005719 Ga0068861_100069261 Ga0068861_1000692614 228
1026 3300005834 Ga0068851_10114771 Ga0068851_101147712 228
1027 3300005840 Ga0068870_10068076 Ga0068870_100680761 228
1028 3300005841 Ga0068863_100853033 Ga0068863_1008530331 228
1029 3300005842 Ga0068858_100224105 Ga0068858_1002241052 228
1030 3300005842 Ga0068858_100573081 Ga0068858_1005730812 228
1031 3300005843 Ga0068860_100021498 Ga0068860_1000214984 228
1032 3300005843 Ga0068860_100115439 Ga0068860_1001154393 228
1033 3300005844 Ga0068862_100014232 Ga0068862_1000142324 228
1034 3300006028 Ga0070717_10175368 Ga0070717_101753683 228
1035 3300006237 Ga0097621_100627844 Ga0097621_1006278441 228
1036 3300006844 Ga0075428_100553200 Ga0075428_1005532002 228
1037 3300006881 Ga0068865_100374407 Ga0068865_1003744071 228
1038 3300009098 Ga0105245_10101497 Ga0105245_101014972 228
1039 3300009101 Ga0105247_10540866 Ga0105247_105408661 228
1040 3300009148 Ga0105243_10362608 Ga0105243_103626082 228
1041 3300009176 Ga0105242_10208554 Ga0105242_102085541 228
1042 3300009551 Ga0105238_10229245 Ga0105238_102292452 228
1043 3300010375 Ga0105239_10109864 Ga0105239_101098642 228
1044 3300011119 Ga0105246_10095239 Ga0105246_100952393 228
1045 3300013297 Ga0157378_10498396 Ga0157378_104983962 228
1046 3300013306 Ga0163162_10236810 Ga0163162_102368101 228
1047 3300013307 Ga0157372_10634069 Ga0157372_106340692 228
1048 3300014326 Ga0157380_10532211 Ga0157380_105322112 228
1049 3300017792 Ga0163161_10052133 Ga0163161_100521333 228
1050 3300025321 Ga0207656_10105874 Ga0207656_101058742 228
1051 3300025901 Ga0207688_10121591 Ga0207688_101215912 228
1052 3300025901 Ga0207688_10128231 Ga0207688_101282312 228
1053 3300025904 Ga0207647_10045140 Ga0207647_100451402 228
1054 3300025907 Ga0207645_10031739 Ga0207645_100317392 228
1055 3300025908 Ga0207643_10023975 Ga0207643_100239751 228
1056 3300025911 Ga0207654_10051541 Ga0207654_100515412 228
1057 3300025920 Ga0207649_10066986 Ga0207649_100669862 228
1058 3300025927 Ga0207687_10044430 Ga0207687_100444303 228
1059 3300025927 Ga0207687_10242425 Ga0207687_102424252 228
1060 3300025928 Ga0207700_10085111 Ga0207700_100851112 228
1061 3300025929 Ga0207664_10017597 Ga0207664_100175973 228
1062 3300025933 Ga0207706_10101311 Ga0207706_101013112 228
1063 3300025934 Ga0207686_10199327 Ga0207686_101993273 228
1064 3300025935 Ga0207709_10049174 Ga0207709_100491742 228
1065 3300025936 Ga0207670_10076188 Ga0207670_100761882 228
1066 3300025937 Ga0207669_10050661 Ga0207669_100506611 228
1067 3300025938 Ga0207704_10676032 Ga0207704_106760321 228
1068 3300025942 Ga0207689_10078275 Ga0207689_100782752 228
1069 3300025942 Ga0207689_10284620 Ga0207689_102846202 228
1070 3300025944 Ga0207661_10082632 Ga0207661_100826322 228
1071 3300025944 Ga0207661_10246257 Ga0207661_102462572 228
1072 3300025945 Ga0207679_10412030 Ga0207679_104120302 228
1073 3300025949 Ga0207667_10783030 Ga0207667_107830302 228
1074 3300025960 Ga0207651_10447590 Ga0207651_104475902 228
1075 3300025981 Ga0207640_10034135 Ga0207640_100341352 228
1076 3300025981 Ga0207640_10485021 Ga0207640_104850211 228
1077 3300026023 Ga0207677_10258882 Ga0207677_102588822 228
1078 3300026023 Ga0207677_10557749 Ga0207677_105577492 228
1079 3300026035 Ga0207703_10082642 Ga0207703_100826422 228
1080 3300026035 Ga0207703_10344111 Ga0207703_103441111 228
1081 3300026067 Ga0207678_10116286 Ga0207678_101162862 228
1082 3300026075 Ga0207708_10013641 Ga0207708_100136414 228
1083 3300026075 Ga0207708_10141025 Ga0207708_101410252 228
1084 3300026088 Ga0207641_10067667 Ga0207641_100676672 228
1085 3300026089 Ga0207648_10021225 Ga0207648_100212252 228
1086 3300026095 Ga0207676_10060211 Ga0207676_100602112 228
1087 3300026116 Ga0207674_10050070 Ga0207674_100500702 228
1088 3300026142 Ga0207698_10087552 Ga0207698_100875523 228
1089 3300027907 Ga0207428_10312454 Ga0207428_103124541 228
1090 3300028380 Ga0268265_10021593 Ga0268265_100215933 228
1091 3300028380 Ga0268265_10838033 Ga0268265_108380332 228
1092 3300028381 Ga0268264_10015344 Ga0268264_100153445 228
1093 3300048905 Ga0496102_0662145 Ga0496102_0662145_252_938 228
1094 3300048911 Ga0496108_0148646 Ga0496108_0148646_672_1358 228
1095 3300048912 Ga0496109_0248074 Ga0496109_0248074_979_1665 228
1096 3300048913 Ga0496110_0158974 Ga0496110_0158974_374_1060 228
1097 3300048914 Ga0496111_0161411 Ga0496111_0161411_507_1193 228
1098 3300048915 Ga0496112_0751517 Ga0496112_0751517_148_834 228
1099 3300002067 JGI24735J21928_10093592 JGI24735J21928_100935921 229
1100 3300009094 Ga0111539_10865089 Ga0111539_108650891 229
1101 3300009148 Ga0105243_10316852 Ga0105243_103168522 229
1102 3300009174 Ga0105241_10103218 Ga0105241_101032183 229
1103 3300010375 Ga0105239_10238761 Ga0105239_102387612 229
1104 3300011119 Ga0105246_10093187 Ga0105246_100931872 229
1105 3300013296 Ga0157374_10223871 Ga0157374_102238712 229
1106 3300014325 Ga0163163_10327439 Ga0163163_103274392 229
1107 3300031456 Ga0307513_10024342 Ga0307513_100243421 229
1108 3300048916 Ga0496113_0381641 Ga0496113_0381641_325_1017 229
1109 3300048917 Ga0496114_0286236 Ga0496114_0286236_366_1058 229
1110 3300050511 nmdc:mga08y16_1241598_c1 nmdc:mga08y16_1241598_c1_12_704 229

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

40

149

0.98

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

184

260

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9689 5 120
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9687 5 120
1nxx-assembly1.cif.gz_A-2 micarec ph 5.5 0.9667 5 120
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9619 4 121
2zwm-assembly1.cif.gz_B crystal structure of yycf receiver domain from bacillus subtilis 0.9613 4 120
ID Description Score Start End Superfamily
af_P9WGN1_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9964 5 82 3.40.50.2300
af_P21866_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9898 4 82 3.40.50.2300
af_O69730_8_88_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9777 4 82 3.40.50.2300
af_P9WGM1_5_87_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9765 1 82 3.40.50.2300
af_P9WGN1_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9716 5 82 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A7X9Q292-F1-model_v4 DNA-binding response regulator 0.9805 128 228 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A7C1YRM9-F1-model_v4 Winged helix family transcriptional regulator 0.967 144 228 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A0B0H5R4-F1-model_v4 Response regulator 0.9663 3 116 GO:0000160
AF-A0A7V2QLS0-F1-model_v4 Response regulator 0.9649 2 119 GO:0000160
AF-A0A496VL76-F1-model_v4 Response regulatory domain-containing protein 0.9635 3 119 GO:0000160
GO:0016772

Feature Viewer

pLDDT pTM Quality
90.37 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map