F490210
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1110 | 389 | 1104 | 229 |
Family's Representative Sequence
| Representative Sequence | 3300005435|Ga0070714_100256254|Ga0070714_1002562541 |
| Length | 276 |
| Sequence | MSTPPGKLHDHGKFSALGRVSGLAGPGPGPRFGTAVMTRVLVIDDEEPILRALRINLAAHKYEVSTAVDGASGLAAIARDRPDVVILDLGLPDMDGTEVISGVRGWTSMPIIVLSAWGQESQKVAALDAGADDYVTKPFGMGELLARLRVAVRRASPAPDEPVVVSGDFTVDLAAKRVHRQRDGADVRLTPTEWQLLEVLVRHREKLVTQRQLLAEVWGPEYQTEGNYLRVYMAHLRRKLEPDPSRPRYLVTEPGIGYRFTATGSGDASPPEGRSS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 2 | 2622736605 | Geodermatophilus ruber DSM 45317 | Isolate | Rhizosphere |
| 3 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 4 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 5 | 2946003308 | Arthrobacter agilis W3I6 | Isolate | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 8 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 76 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 77 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 102 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 122 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 184 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 188 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 189 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 190 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 191 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 192 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 193 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 194 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 195 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 196 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 197 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 198 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 199 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 200 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 201 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 202 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 203 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 204 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 205 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 206 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 207 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 208 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 209 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 210 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 211 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 212 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 213 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 214 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 215 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 216 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 217 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 218 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 219 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 220 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 221 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 222 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 223 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 224 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 225 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 226 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 227 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 228 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 229 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 230 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 231 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 232 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 233 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 234 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 235 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 236 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 237 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 238 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 239 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 240 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 241 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 242 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 243 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 244 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 245 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 246 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 247 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 248 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 249 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 250 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 251 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 252 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 253 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 254 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 255 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 256 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 257 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 258 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 259 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 260 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 261 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 262 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 263 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 264 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 265 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 266 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 267 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 268 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 269 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 270 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 271 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 272 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 273 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 274 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 275 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 276 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 277 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 278 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 279 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 280 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 281 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 282 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 330 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 331 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 332 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 333 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 334 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 335 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 337 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 338 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 339 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 340 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 341 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 342 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 343 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 344 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 345 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 380 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 381 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 382 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 383 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 384 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 385 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 388 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 389 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.02 |
| Metatranscriptomes | 1.44 |
| Isolates | 0.54 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.54 |
| Nodule | 0 |
| Rhizoplane | 6.04 |
| Rhizosphere | 90.63 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.79 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24735J21928_10093592 | 3300002067 | Bacteria | 862 |
| 2 | JGI24744J21845_10005151 | 3300002077 | Bacteria | 2705 |
| 3 | JGI25406J46586_10006130 | 3300003203 | Bacteria | 5552 |
| 4 | Ga0070658_10006845 | 3300005327 | Bacteria | 9215 |
| 5 | Ga0070658_10023598 | 3300005327 | Bacteria | 4935 |
| 6 | Ga0070658_10064156 | 3300005327 | Bacteria | 2996 |
| 7 | Ga0070658_10257089 | 3300005327 | Bacteria | 1482 |
| 8 | Ga0070658_10283857 | 3300005327 | Bacteria | 1409 |
| 9 | Ga0070676_10104111 | 3300005328 | Bacteria | 1758 |
| 10 | Ga0070676_10452015 | 3300005328 | Bacteria | 903 |
| 11 | Ga0070683_100004571 | 3300005329 | Bacteria | 11420 |
| 12 | Ga0070683_100059709 | 3300005329 | Bacteria | 3543 |
| 13 | Ga0070683_100064566 | 3300005329 | Bacteria | 3408 |
| 14 | Ga0070683_100101131 | 3300005329 | Bacteria | 2714 |
| 15 | Ga0070683_100113133 | 3300005329 | Bacteria | 2561 |
| 16 | Ga0070683_100127961 | 3300005329 | Bacteria | 2402 |
| 17 | Ga0070683_100144915 | 3300005329 | Bacteria | 2250 |
| 18 | Ga0070683_100153307 | 3300005329 | Bacteria | 2185 |
| 19 | Ga0070683_100167567 | 3300005329 | Bacteria | 2085 |
| 20 | Ga0070683_100232294 | 3300005329 | Bacteria | 1753 |
| 21 | Ga0070683_100321577 | 3300005329 | Bacteria | 1472 |
| 22 | Ga0070670_100081101 | 3300005331 | Bacteria | 2788 |
| 23 | Ga0070670_100628995 | 3300005331 | Bacteria | 962 |
| 24 | Ga0068869_100018522 | 3300005334 | Bacteria | 4742 |
| 25 | Ga0068869_100030074 | 3300005334 | Bacteria | 3809 |
| 26 | Ga0070680_100290980 | 3300005336 | Bacteria | 1384 |
| 27 | Ga0070682_100008855 | 3300005337 | Bacteria | 5683 |
| 28 | Ga0070682_100151536 | 3300005337 | Bacteria | 1591 |
| 29 | Ga0070682_100576076 | 3300005337 | Bacteria | 885 |
| 30 | Ga0068868_100004265 | 3300005338 | Bacteria | 10005 |
| 31 | Ga0068868_100024352 | 3300005338 | Bacteria | 4593 |
| 32 | Ga0070660_100019041 | 3300005339 | Bacteria | 5025 |
| 33 | Ga0070660_100027145 | 3300005339 | Bacteria | 4271 |
| 34 | Ga0070660_100129995 | 3300005339 | Bacteria | 2014 |
| 35 | Ga0070660_100397204 | 3300005339 | Bacteria | 1140 |
| 36 | Ga0070689_100408094 | 3300005340 | Bacteria | 1149 |
| 37 | Ga0070689_100564929 | 3300005340 | Bacteria | 982 |
| 38 | Ga0070691_10024889 | 3300005341 | Bacteria | 2785 |
| 39 | Ga0070691_10101628 | 3300005341 | Bacteria | 1428 |
| 40 | Ga0070661_100030787 | 3300005344 | Bacteria | 3878 |
| 41 | Ga0070661_100085981 | 3300005344 | Bacteria | 2324 |
| 42 | Ga0070661_100457680 | 3300005344 | Bacteria | 1016 |
| 43 | Ga0070661_100499430 | 3300005344 | Bacteria | 974 |
| 44 | Ga0070692_10146692 | 3300005345 | Bacteria | 1340 |
| 45 | Ga0070692_10195973 | 3300005345 | Bacteria | 1180 |
| 46 | Ga0070668_100017010 | 3300005347 | Bacteria | 5440 |
| 47 | Ga0070668_100225900 | 3300005347 | Bacteria | 1546 |
| 48 | Ga0070669_100350604 | 3300005353 | Bacteria | 1198 |
| 49 | Ga0070669_100436787 | 3300005353 | Bacteria | 1077 |
| 50 | Ga0070675_100002740 | 3300005354 | Bacteria | 13250 |
| 51 | Ga0070675_100080840 | 3300005354 | Bacteria | 2709 |
| 52 | Ga0070675_100085263 | 3300005354 | Bacteria | 2639 |
| 53 | Ga0070675_100167581 | 3300005354 | Bacteria | 1893 |
| 54 | Ga0070675_100450683 | 3300005354 | Bacteria | 1154 |
| 55 | Ga0070674_100068747 | 3300005356 | Bacteria | 2497 |
| 56 | Ga0070674_100260495 | 3300005356 | Bacteria | 1366 |
| 57 | Ga0070674_100922664 | 3300005356 | Bacteria | 762 |
| 58 | Ga0070673_100117165 | 3300005364 | Bacteria | 2216 |
| 59 | Ga0070688_100287082 | 3300005365 | Bacteria | 1184 |
| 60 | Ga0070659_100037838 | 3300005366 | Bacteria | 3762 |
| 61 | Ga0070659_100112961 | 3300005366 | Bacteria | 2194 |
| 62 | Ga0070659_100155108 | 3300005366 | Bacteria | 1869 |
| 63 | Ga0070709_10003021 | 3300005434 | Bacteria | 9039 |
| 64 | Ga0070709_10028678 | 3300005434 | Bacteria | 3322 |
| 65 | Ga0070709_10039282 | 3300005434 | Bacteria | 2903 |
| 66 | Ga0070709_10040725 | 3300005434 | Bacteria | 2858 |
| 67 | Ga0070709_10067334 | 3300005434 | Bacteria | 2299 |
| 68 | Ga0070709_10112358 | 3300005434 | Bacteria | 1833 |
| 69 | Ga0070714_100000452 | 3300005435 | Bacteria | 29888 |
| 70 | Ga0070714_100001028 | 3300005435 | Bacteria | 19875 |
| 71 | Ga0070714_100005940 | 3300005435 | Bacteria | 9370 |
| 72 | Ga0070714_100005955 | 3300005435 | Bacteria | 9363 |
| 73 | Ga0070714_100082551 | 3300005435 | Bacteria | 2800 |
| 74 | Ga0070714_100083836 | 3300005435 | Bacteria | 2780 |
| 75 | Ga0070714_100256254 | 3300005435 | Bacteria | 1619 |
| 76 | Ga0070714_100276806 | 3300005435 | Bacteria | 1558 |
| 77 | Ga0070713_100007261 | 3300005436 | Bacteria | 7760 |
| 78 | Ga0070713_100010227 | 3300005436 | Bacteria | 6771 |
| 79 | Ga0070713_100024420 | 3300005436 | Bacteria | 4707 |
| 80 | Ga0070713_100037406 | 3300005436 | Bacteria | 3924 |
| 81 | Ga0070713_100065592 | 3300005436 | Bacteria | 3051 |
| 82 | Ga0070713_100147037 | 3300005436 | Bacteria | 2093 |
| 83 | Ga0070713_100280114 | 3300005436 | Bacteria | 1529 |
| 84 | Ga0070713_100292505 | 3300005436 | Bacteria | 1497 |
| 85 | Ga0070713_100330256 | 3300005436 | Bacteria | 1410 |
| 86 | Ga0070710_10008259 | 3300005437 | Bacteria | 5067 |
| 87 | Ga0070710_10018475 | 3300005437 | Bacteria | 3587 |
| 88 | Ga0070710_10082483 | 3300005437 | Bacteria | 1880 |
| 89 | Ga0070710_10088860 | 3300005437 | Bacteria | 1819 |
| 90 | Ga0070710_10184202 | 3300005437 | Bacteria | 1309 |
| 91 | Ga0070701_10006868 | 3300005438 | Bacteria | 4816 |
| 92 | Ga0070701_10025713 | 3300005438 | Bacteria | 2862 |
| 93 | Ga0070711_100021021 | 3300005439 | Bacteria | 4215 |
| 94 | Ga0070711_100032826 | 3300005439 | Bacteria | 3454 |
| 95 | Ga0070711_100043948 | 3300005439 | Bacteria | 3029 |
| 96 | Ga0070705_100076262 | 3300005440 | Bacteria | 2044 |
| 97 | Ga0070705_100123531 | 3300005440 | Bacteria | 1675 |
| 98 | Ga0070700_100009488 | 3300005441 | Bacteria | 5345 |
| 99 | Ga0070700_100033665 | 3300005441 | Bacteria | 3088 |
| 100 | Ga0070700_100278561 | 3300005441 | Bacteria | 1212 |
| 101 | Ga0070708_100534018 | 3300005445 | Bacteria | 1106 |
| 102 | Ga0070663_100026326 | 3300005455 | Bacteria | 3939 |
| 103 | Ga0070663_100055561 | 3300005455 | Bacteria | 2834 |
| 104 | Ga0070663_100085492 | 3300005455 | Bacteria | 2328 |
| 105 | Ga0070663_100233430 | 3300005455 | Bacteria | 1449 |
| 106 | Ga0070663_100331677 | 3300005455 | Bacteria | 1226 |
| 107 | Ga0070678_100015224 | 3300005456 | Bacteria | 4882 |
| 108 | Ga0070678_100096045 | 3300005456 | Bacteria | 2285 |
| 109 | Ga0070678_100224580 | 3300005456 | Bacteria | 1562 |
| 110 | Ga0070662_100063633 | 3300005457 | Bacteria | 2699 |
| 111 | Ga0070681_10009600 | 3300005458 | Bacteria | 9514 |
| 112 | Ga0070681_10313312 | 3300005458 | Bacteria | 1479 |
| 113 | Ga0070681_10419697 | 3300005458 | Bacteria | 1250 |
| 114 | Ga0068867_100007002 | 3300005459 | Bacteria | 7968 |
| 115 | Ga0070685_10043361 | 3300005466 | Bacteria | 2571 |
| 116 | Ga0070685_10060364 | 3300005466 | Bacteria | 2217 |
| 117 | Ga0070685_10064127 | 3300005466 | Bacteria | 2160 |
| 118 | Ga0070685_10391648 | 3300005466 | Bacteria | 960 |
| 119 | Ga0070706_100001048 | 3300005467 | Bacteria | 30008 |
| 120 | Ga0070706_100003836 | 3300005467 | Bacteria | 14695 |
| 121 | Ga0070706_100005036 | 3300005467 | Bacteria | 12629 |
| 122 | Ga0070706_100006933 | 3300005467 | Bacteria | 10691 |
| 123 | Ga0070706_100007675 | 3300005467 | Bacteria | 10090 |
| 124 | Ga0070706_100079469 | 3300005467 | Bacteria | 3035 |
| 125 | Ga0070706_100088284 | 3300005467 | Bacteria | 2875 |
| 126 | Ga0070706_100208006 | 3300005467 | Bacteria | 1827 |
| 127 | Ga0070706_100631577 | 3300005467 | Bacteria | 994 |
| 128 | Ga0070706_100906047 | 3300005467 | Bacteria | 815 |
| 129 | Ga0070707_100000792 | 3300005468 | Bacteria | 31220 |
| 130 | Ga0070707_100023200 | 3300005468 | Bacteria | 5869 |
| 131 | Ga0070707_100029054 | 3300005468 | Bacteria | 5262 |
| 132 | Ga0070707_100035864 | 3300005468 | Bacteria | 4732 |
| 133 | Ga0070707_100045292 | 3300005468 | Bacteria | 4211 |
| 134 | Ga0070707_100120283 | 3300005468 | Bacteria | 2549 |
| 135 | Ga0070707_100121840 | 3300005468 | Bacteria | 2532 |
| 136 | Ga0070707_100233253 | 3300005468 | Bacteria | 1791 |
| 137 | Ga0070707_100372866 | 3300005468 | Bacteria | 1387 |
| 138 | Ga0070698_100006771 | 3300005471 | Bacteria | 12423 |
| 139 | Ga0070698_100008876 | 3300005471 | Bacteria | 10807 |
| 140 | Ga0070698_100011521 | 3300005471 | Bacteria | 9383 |
| 141 | Ga0070698_100037550 | 3300005471 | Bacteria | 4994 |
| 142 | Ga0070698_100038643 | 3300005471 | Bacteria | 4917 |
| 143 | Ga0070698_100076311 | 3300005471 | Bacteria | 3354 |
| 144 | Ga0070698_100077164 | 3300005471 | Bacteria | 3332 |
| 145 | Ga0070698_100118694 | 3300005471 | Bacteria | 2606 |
| 146 | Ga0070698_100222699 | 3300005471 | Bacteria | 1820 |
| 147 | Ga0070698_100322806 | 3300005471 | Bacteria | 1475 |
| 148 | Ga0070699_100001575 | 3300005518 | Bacteria | 20852 |
| 149 | Ga0070699_100002101 | 3300005518 | Bacteria | 18041 |
| 150 | Ga0070699_100068500 | 3300005518 | Bacteria | 3082 |
| 151 | Ga0070699_100321845 | 3300005518 | Bacteria | 1390 |
| 152 | Ga0070699_100529912 | 3300005518 | Bacteria | 1071 |
| 153 | Ga0070699_100703631 | 3300005518 | Bacteria | 923 |
| 154 | Ga0070679_100003755 | 3300005530 | Bacteria | 13929 |
| 155 | Ga0070679_100008909 | 3300005530 | Bacteria | 9470 |
| 156 | Ga0070679_100031308 | 3300005530 | Bacteria | 5254 |
| 157 | Ga0070679_100111734 | 3300005530 | Bacteria | 2719 |
| 158 | Ga0070679_100745761 | 3300005530 | Bacteria | 922 |
| 159 | Ga0070679_100873675 | 3300005530 | Bacteria | 842 |
| 160 | Ga0070684_100019147 | 3300005535 | Bacteria | 5660 |
| 161 | Ga0070684_100019292 | 3300005535 | Bacteria | 5638 |
| 162 | Ga0070684_100158834 | 3300005535 | Bacteria | 2050 |
| 163 | Ga0070684_100200043 | 3300005535 | Bacteria | 1819 |
| 164 | Ga0070684_100230379 | 3300005535 | Bacteria | 1691 |
| 165 | Ga0070684_100743007 | 3300005535 | Bacteria | 916 |
| 166 | Ga0070684_100880707 | 3300005535 | Bacteria | 838 |
| 167 | Ga0070697_100010976 | 3300005536 | Bacteria | 7077 |
| 168 | Ga0070697_100061101 | 3300005536 | Bacteria | 3073 |
| 169 | Ga0068853_100163892 | 3300005539 | Bacteria | 2007 |
| 170 | Ga0068853_100257281 | 3300005539 | Bacteria | 1604 |
| 171 | Ga0070672_100001312 | 3300005543 | Bacteria | 15342 |
| 172 | Ga0070686_100020181 | 3300005544 | Bacteria | 3941 |
| 173 | Ga0070686_100112921 | 3300005544 | Bacteria | 1854 |
| 174 | Ga0070686_100154360 | 3300005544 | Bacteria | 1611 |
| 175 | Ga0070695_100099157 | 3300005545 | Bacteria | 1959 |
| 176 | Ga0070696_100103024 | 3300005546 | Bacteria | 2047 |
| 177 | Ga0070693_100050430 | 3300005547 | Bacteria | 2379 |
| 178 | Ga0070693_100060807 | 3300005547 | Bacteria | 2194 |
| 179 | Ga0070693_100152791 | 3300005547 | Bacteria | 1464 |
| 180 | Ga0070693_100223269 | 3300005547 | Bacteria | 1235 |
| 181 | Ga0070665_100054642 | 3300005548 | Bacteria | 4005 |
| 182 | Ga0070665_100589065 | 3300005548 | Bacteria | 1125 |
| 183 | Ga0068855_100058270 | 3300005563 | Bacteria | 4524 |
| 184 | Ga0068855_100097460 | 3300005563 | Bacteria | 3387 |
| 185 | Ga0070664_100009193 | 3300005564 | Bacteria | 8023 |
| 186 | Ga0070664_100299231 | 3300005564 | Bacteria | 1454 |
| 187 | Ga0070664_100355724 | 3300005564 | Bacteria | 1333 |
| 188 | Ga0070664_100460177 | 3300005564 | Bacteria | 1169 |
| 189 | Ga0070664_100548494 | 3300005564 | Bacteria | 1069 |
| 190 | Ga0068857_100004338 | 3300005577 | Bacteria | 11970 |
| 191 | Ga0068857_100045347 | 3300005577 | Bacteria | 3900 |
| 192 | Ga0068857_100073149 | 3300005577 | Bacteria | 3053 |
| 193 | Ga0068857_100400311 | 3300005577 | Bacteria | 1277 |
| 194 | Ga0068857_100497630 | 3300005577 | Bacteria | 1144 |
| 195 | Ga0068854_100011357 | 3300005578 | Bacteria | 5794 |
| 196 | Ga0068854_100013890 | 3300005578 | Bacteria | 5296 |
| 197 | Ga0068854_100028924 | 3300005578 | Bacteria | 3833 |
| 198 | Ga0068856_100108541 | 3300005614 | Bacteria | 2772 |
| 199 | Ga0068856_100530346 | 3300005614 | Bacteria | 1198 |
| 200 | Ga0070702_100007486 | 3300005615 | Bacteria | 5232 |
| 201 | Ga0070702_100017373 | 3300005615 | Bacteria | 3710 |
| 202 | Ga0070702_100025155 | 3300005615 | Bacteria | 3186 |
| 203 | Ga0070702_100237246 | 3300005615 | Bacteria | 1229 |
| 204 | Ga0070702_100379323 | 3300005615 | Bacteria | 1005 |
| 205 | Ga0068852_100192661 | 3300005616 | Bacteria | 1924 |
| 206 | Ga0068859_100041006 | 3300005617 | Bacteria | 4650 |
| 207 | Ga0068864_100012042 | 3300005618 | Bacteria | 7143 |
| 208 | Ga0068864_100068223 | 3300005618 | Bacteria | 3089 |
| 209 | Ga0068864_100244236 | 3300005618 | Bacteria | 1664 |
| 210 | Ga0068864_100403177 | 3300005618 | Bacteria | 1300 |
| 211 | Ga0068864_100645846 | 3300005618 | Bacteria | 1030 |
| 212 | Ga0068864_101067031 | 3300005618 | Bacteria | 803 |
| 213 | Ga0068866_10071920 | 3300005718 | Bacteria | 1831 |
| 214 | Ga0068866_10092394 | 3300005718 | Bacteria | 1651 |
| 215 | Ga0068861_100014698 | 3300005719 | Bacteria | 5497 |
| 216 | Ga0068861_100069261 | 3300005719 | Bacteria | 2729 |
| 217 | Ga0068851_10114771 | 3300005834 | Bacteria | 1442 |
| 218 | Ga0068870_10007764 | 3300005840 | Bacteria | 4797 |
| 219 | Ga0068870_10068076 | 3300005840 | Bacteria | 1933 |
| 220 | Ga0068863_100092777 | 3300005841 | Bacteria | 2865 |
| 221 | Ga0068863_100853033 | 3300005841 | Bacteria | 910 |
| 222 | Ga0068858_100070389 | 3300005842 | Bacteria | 3243 |
| 223 | Ga0068858_100224105 | 3300005842 | Bacteria | 1781 |
| 224 | Ga0068858_100573081 | 3300005842 | Bacteria | 1094 |
| 225 | Ga0068860_100021498 | 3300005843 | Bacteria | 6247 |
| 226 | Ga0068860_100115439 | 3300005843 | Bacteria | 2568 |
| 227 | Ga0068860_100152796 | 3300005843 | Bacteria | 2223 |
| 228 | Ga0068860_100231940 | 3300005843 | Bacteria | 1794 |
| 229 | Ga0068860_100269611 | 3300005843 | Bacteria | 1661 |
| 230 | Ga0068860_100740566 | 3300005843 | Bacteria | 994 |
| 231 | Ga0068862_100014232 | 3300005844 | Bacteria | 6597 |
| 232 | Ga0068862_100227134 | 3300005844 | Bacteria | 1692 |
| 233 | Ga0068862_100252439 | 3300005844 | Bacteria | 1608 |
| 234 | Ga0081540_1000345 | 3300005983 | Bacteria | 46912 |
| 235 | Ga0081540_1001308 | 3300005983 | Bacteria | 21736 |
| 236 | Ga0081540_1006178 | 3300005983 | Bacteria | 8781 |
| 237 | Ga0081539_10003383 | 3300005985 | Bacteria | 19743 |
| 238 | Ga0081539_10005543 | 3300005985 | Bacteria | 12795 |
| 239 | Ga0081539_10010664 | 3300005985 | Bacteria | 7415 |
| 240 | Ga0081539_10027029 | 3300005985 | Bacteria | 3643 |
| 241 | Ga0081539_10027830 | 3300005985 | Bacteria | 3571 |
| 242 | Ga0081539_10176204 | 3300005985 | Bacteria | 1007 |
| 243 | Ga0070717_10007804 | 3300006028 | Bacteria | 7962 |
| 244 | Ga0070717_10018129 | 3300006028 | Bacteria | 5492 |
| 245 | Ga0070717_10046161 | 3300006028 | Bacteria | 3563 |
| 246 | Ga0070717_10052576 | 3300006028 | Bacteria | 3356 |
| 247 | Ga0070717_10058504 | 3300006028 | Bacteria | 3188 |
| 248 | Ga0070717_10119623 | 3300006028 | Bacteria | 2255 |
| 249 | Ga0070717_10175368 | 3300006028 | Bacteria | 1866 |
| 250 | Ga0070717_10368294 | 3300006028 | Bacteria | 1287 |
| 251 | Ga0070717_10514079 | 3300006028 | Bacteria | 1083 |
| 252 | Ga0070717_10624459 | 3300006028 | Bacteria | 978 |
| 253 | Ga0070715_10001476 | 3300006163 | Bacteria | 6841 |
| 254 | Ga0070715_10050842 | 3300006163 | Bacteria | 1781 |
| 255 | Ga0070715_10179863 | 3300006163 | Bacteria | 1060 |
| 256 | Ga0070716_100001463 | 3300006173 | Bacteria | 10525 |
| 257 | Ga0070716_100019289 | 3300006173 | Bacteria | 3562 |
| 258 | Ga0070716_100076159 | 3300006173 | Bacteria | 1987 |
| 259 | Ga0070712_100071500 | 3300006175 | Bacteria | 2482 |
| 260 | Ga0070712_100260485 | 3300006175 | Bacteria | 1389 |
| 261 | Ga0070712_100266517 | 3300006175 | Bacteria | 1374 |
| 262 | Ga0097621_100215728 | 3300006237 | Bacteria | 1670 |
| 263 | Ga0097621_100311445 | 3300006237 | Bacteria | 1393 |
| 264 | Ga0097621_100627844 | 3300006237 | Bacteria | 984 |
| 265 | Ga0075428_100553200 | 3300006844 | Bacteria | 1230 |
| 266 | Ga0075428_100717706 | 3300006844 | Bacteria | 1065 |
| 267 | Ga0075431_100073239 | 3300006847 | Bacteria | 3534 |
| 268 | Ga0075431_100075900 | 3300006847 | Bacteria | 3468 |
| 269 | Ga0075431_100106830 | 3300006847 | Bacteria | 2888 |
| 270 | Ga0075434_100389538 | 3300006871 | Bacteria | 1414 |
| 271 | Ga0068865_100011812 | 3300006881 | Bacteria | 5476 |
| 272 | Ga0068865_100096507 | 3300006881 | Bacteria | 2156 |
| 273 | Ga0068865_100374407 | 3300006881 | Bacteria | 1160 |
| 274 | Ga0075436_100004827 | 3300006914 | Bacteria | 9266 |
| 275 | Ga0075436_100020931 | 3300006914 | Bacteria | 4486 |
| 276 | Ga0097620_100041008 | 3300006931 | Bacteria | 4650 |
| 277 | Ga0105240_10273382 | 3300009093 | Bacteria | 1944 |
| 278 | Ga0105240_10350751 | 3300009093 | Bacteria | 1674 |
| 279 | Ga0105240_10609138 | 3300009093 | Bacteria | 1201 |
| 280 | Ga0111539_10001402 | 3300009094 | Bacteria | 32087 |
| 281 | Ga0111539_10024563 | 3300009094 | Bacteria | 7392 |
| 282 | Ga0111539_10865089 | 3300009094 | Bacteria | 1052 |
| 283 | Ga0105245_10017866 | 3300009098 | Bacteria | 6193 |
| 284 | Ga0105245_10028596 | 3300009098 | Bacteria | 4919 |
| 285 | Ga0105245_10101497 | 3300009098 | Bacteria | 2663 |
| 286 | Ga0105245_10163393 | 3300009098 | Bacteria | 2114 |
| 287 | Ga0105245_10500369 | 3300009098 | Bacteria | 1231 |
| 288 | Ga0105247_10540866 | 3300009101 | Bacteria | 855 |
| 289 | Ga0114129_10024315 | 3300009147 | Bacteria | 8583 |
| 290 | Ga0114129_10216522 | 3300009147 | Bacteria | 2586 |
| 291 | Ga0114129_10333104 | 3300009147 | Bacteria | 2015 |
| 292 | Ga0105243_10002861 | 3300009148 | Bacteria | 14307 |
| 293 | Ga0105243_10150131 | 3300009148 | Bacteria | 1998 |
| 294 | Ga0105243_10275198 | 3300009148 | Bacteria | 1514 |
| 295 | Ga0105243_10277580 | 3300009148 | Bacteria | 1508 |
| 296 | Ga0105243_10316852 | 3300009148 | Bacteria | 1420 |
| 297 | Ga0105243_10341615 | 3300009148 | Bacteria | 1371 |
| 298 | Ga0105243_10362608 | 3300009148 | Bacteria | 1334 |
| 299 | Ga0105241_10103218 | 3300009174 | Bacteria | 2270 |
| 300 | Ga0105242_10010464 | 3300009176 | Bacteria | 7119 |
| 301 | Ga0105242_10073410 | 3300009176 | Bacteria | 2844 |
| 302 | Ga0105242_10208554 | 3300009176 | Bacteria | 1740 |
| 303 | Ga0105242_11072563 | 3300009176 | Bacteria | 818 |
| 304 | Ga0105248_10109534 | 3300009177 | Bacteria | 3114 |
| 305 | Ga0105248_10604018 | 3300009177 | Bacteria | 1238 |
| 306 | Ga0105238_10049831 | 3300009551 | Bacteria | 4216 |
| 307 | Ga0105238_10119356 | 3300009551 | Bacteria | 2617 |
| 308 | Ga0105238_10159425 | 3300009551 | Bacteria | 2231 |
| 309 | Ga0105238_10229245 | 3300009551 | Bacteria | 1834 |
| 310 | Ga0105238_10291352 | 3300009551 | Bacteria | 1614 |
| 311 | Ga0105249_10016248 | 3300009553 | Bacteria | 6601 |
| 312 | Ga0105249_10130704 | 3300009553 | Bacteria | 2397 |
| 313 | Ga0105249_10169960 | 3300009553 | Bacteria | 2113 |
| 314 | Ga0105249_10697895 | 3300009553 | Bacteria | 1075 |
| 315 | Ga0105239_10109864 | 3300010375 | Bacteria | 3056 |
| 316 | Ga0105239_10130301 | 3300010375 | Bacteria | 2797 |
| 317 | Ga0105239_10201441 | 3300010375 | Bacteria | 2230 |
| 318 | Ga0105239_10238761 | 3300010375 | Bacteria | 2040 |
| 319 | Ga0105246_10032876 | 3300011119 | Bacteria | 3443 |
| 320 | Ga0105246_10093187 | 3300011119 | Bacteria | 2175 |
| 321 | Ga0105246_10095239 | 3300011119 | Bacteria | 2155 |
| 322 | Ga0105246_10919680 | 3300011119 | Bacteria | 786 |
| 323 | Ga0157342_1008389 | 3300012507 | Bacteria | 1022 |
| 324 | Ga0157371_10431412 | 3300013102 | Bacteria | 967 |
| 325 | Ga0157370_10170964 | 3300013104 | Bacteria | 2020 |
| 326 | Ga0157370_10304658 | 3300013104 | Bacteria | 1470 |
| 327 | Ga0157369_10006230 | 3300013105 | Bacteria | 13844 |
| 328 | Ga0157369_10009643 | 3300013105 | Bacteria | 11042 |
| 329 | Ga0157369_10043686 | 3300013105 | Bacteria | 4884 |
| 330 | Ga0157369_10223548 | 3300013105 | Bacteria | 1970 |
| 331 | Ga0157374_10223871 | 3300013296 | Bacteria | 1847 |
| 332 | Ga0157374_10649385 | 3300013296 | Bacteria | 1067 |
| 333 | Ga0157378_10176077 | 3300013297 | Bacteria | 2009 |
| 334 | Ga0157378_10498396 | 3300013297 | Bacteria | 1216 |
| 335 | Ga0163162_10033664 | 3300013306 | Bacteria | 5093 |
| 336 | Ga0163162_10236810 | 3300013306 | Bacteria | 1956 |
| 337 | Ga0163162_10833720 | 3300013306 | Bacteria | 1038 |
| 338 | Ga0157372_10070802 | 3300013307 | Bacteria | 3925 |
| 339 | Ga0157372_10090164 | 3300013307 | Bacteria | 3484 |
| 340 | Ga0157372_10634069 | 3300013307 | Bacteria | 1245 |
| 341 | Ga0157372_10750118 | 3300013307 | Bacteria | 1135 |
| 342 | Ga0157372_10770623 | 3300013307 | Bacteria | 1118 |
| 343 | Ga0157375_10077212 | 3300013308 | Bacteria | 3359 |
| 344 | Ga0157375_10144159 | 3300013308 | Bacteria | 2511 |
| 345 | Ga0157375_10218869 | 3300013308 | Bacteria | 2062 |
| 346 | Ga0163163_10003412 | 3300014325 | Bacteria | 13498 |
| 347 | Ga0163163_10101314 | 3300014325 | Bacteria | 2902 |
| 348 | Ga0163163_10124358 | 3300014325 | Bacteria | 2616 |
| 349 | Ga0163163_10327439 | 3300014325 | Bacteria | 1586 |
| 350 | Ga0163163_10357935 | 3300014325 | Bacteria | 1516 |
| 351 | Ga0157380_10014664 | 3300014326 | Bacteria | 5739 |
| 352 | Ga0157380_10482740 | 3300014326 | Bacteria | 1199 |
| 353 | Ga0157380_10532211 | 3300014326 | Bacteria | 1149 |
| 354 | Ga0157380_10720355 | 3300014326 | Bacteria | 1005 |
| 355 | Ga0157377_10001840 | 3300014745 | Bacteria | 9255 |
| 356 | Ga0157377_10070554 | 3300014745 | Bacteria | 2018 |
| 357 | Ga0157379_10005808 | 3300014968 | Bacteria | 10614 |
| 358 | Ga0157379_10187756 | 3300014968 | Bacteria | 1868 |
| 359 | Ga0157379_10279803 | 3300014968 | Bacteria | 1518 |
| 360 | Ga0157379_10941423 | 3300014968 | Bacteria | 821 |
| 361 | Ga0157376_10025898 | 3300014969 | Bacteria | 4626 |
| 362 | Ga0157376_10116353 | 3300014969 | Bacteria | 2362 |
| 363 | Ga0157376_10154488 | 3300014969 | Bacteria | 2073 |
| 364 | Ga0163161_10052133 | 3300017792 | Bacteria | 2965 |
| 365 | Ga0197907_11154562 | 3300020069 | Bacteria | 798 |
| 366 | Ga0206356_10064106 | 3300020070 | Bacteria | 1258 |
| 367 | Ga0206356_10374739 | 3300020070 | Bacteria | 1315 |
| 368 | Ga0206351_10623328 | 3300020077 | Bacteria | 1113 |
| 369 | Ga0206350_10545162 | 3300020080 | Bacteria | 1169 |
| 370 | Ga0206350_11332998 | 3300020080 | Bacteria | 2318 |
| 371 | Ga0206353_10430810 | 3300020082 | Bacteria | 2728 |
| 372 | Ga0206353_10680297 | 3300020082 | Bacteria | 2431 |
| 373 | Ga0206353_10837455 | 3300020082 | Bacteria | 4788 |
| 374 | Ga0206353_11138628 | 3300020082 | Bacteria | 1790 |
| 375 | Ga0213875_10045485 | 3300021388 | Bacteria | 2060 |
| 376 | Ga0213875_10053546 | 3300021388 | Bacteria | 1890 |
| 377 | Ga0224712_10003657 | 3300022467 | Bacteria | 4032 |
| 378 | Ga0224712_10009872 | 3300022467 | Bacteria | 2896 |
| 379 | Ga0224712_10012296 | 3300022467 | Bacteria | 2687 |
| 380 | Ga0224712_10022462 | 3300022467 | Bacteria | 2175 |
| 381 | Ga0224712_10172980 | 3300022467 | Bacteria | 969 |
| 382 | Ga0224712_10210403 | 3300022467 | Bacteria | 887 |
| 383 | Ga0207697_10076100 | 3300025315 | Bacteria | 1410 |
| 384 | Ga0207656_10105874 | 3300025321 | Bacteria | 1294 |
| 385 | Ga0207692_10001219 | 3300025898 | Bacteria | 9545 |
| 386 | Ga0207692_10048644 | 3300025898 | Bacteria | 2136 |
| 387 | Ga0207692_10231762 | 3300025898 | Bacteria | 1099 |
| 388 | Ga0207692_10379978 | 3300025898 | Bacteria | 877 |
| 389 | Ga0207642_10046425 | 3300025899 | Bacteria | 1935 |
| 390 | Ga0207688_10003336 | 3300025901 | Bacteria | 8774 |
| 391 | Ga0207688_10011417 | 3300025901 | Bacteria | 4836 |
| 392 | Ga0207688_10121591 | 3300025901 | Bacteria | 1524 |
| 393 | Ga0207688_10128231 | 3300025901 | Bacteria | 1485 |
| 394 | Ga0207647_10045140 | 3300025904 | Bacteria | 2750 |
| 395 | Ga0207647_10053383 | 3300025904 | Bacteria | 2491 |
| 396 | Ga0207647_10210887 | 3300025904 | Bacteria | 1122 |
| 397 | Ga0207685_10017954 | 3300025905 | Bacteria | 2300 |
| 398 | Ga0207685_10056915 | 3300025905 | Bacteria | 1532 |
| 399 | Ga0207699_10010674 | 3300025906 | Bacteria | 4619 |
| 400 | Ga0207699_10018548 | 3300025906 | Bacteria | 3689 |
| 401 | Ga0207699_10069684 | 3300025906 | Bacteria | 2145 |
| 402 | Ga0207699_10084580 | 3300025906 | Bacteria | 1976 |
| 403 | Ga0207699_10094201 | 3300025906 | Bacteria | 1886 |
| 404 | Ga0207699_10300896 | 3300025906 | Bacteria | 1120 |
| 405 | Ga0207645_10031739 | 3300025907 | Bacteria | 3397 |
| 406 | Ga0207645_10094505 | 3300025907 | Bacteria | 1924 |
| 407 | Ga0207643_10014808 | 3300025908 | Bacteria | 4241 |
| 408 | Ga0207643_10023975 | 3300025908 | Bacteria | 3367 |
| 409 | Ga0207705_10014311 | 3300025909 | Bacteria | 5709 |
| 410 | Ga0207705_10020113 | 3300025909 | Bacteria | 4775 |
| 411 | Ga0207705_10262640 | 3300025909 | Bacteria | 1318 |
| 412 | Ga0207684_10002703 | 3300025910 | Bacteria | 17712 |
| 413 | Ga0207684_10004377 | 3300025910 | Bacteria | 13330 |
| 414 | Ga0207684_10011882 | 3300025910 | Bacteria | 7590 |
| 415 | Ga0207684_10020585 | 3300025910 | Bacteria | 5637 |
| 416 | Ga0207684_10027199 | 3300025910 | Bacteria | 4876 |
| 417 | Ga0207684_10098696 | 3300025910 | Bacteria | 2494 |
| 418 | Ga0207684_10103864 | 3300025910 | Bacteria | 2430 |
| 419 | Ga0207684_10164710 | 3300025910 | Bacteria | 1910 |
| 420 | Ga0207684_10224693 | 3300025910 | Bacteria | 1620 |
| 421 | Ga0207684_10281699 | 3300025910 | Bacteria | 1433 |
| 422 | Ga0207654_10051541 | 3300025911 | Bacteria | 2369 |
| 423 | Ga0207707_10001352 | 3300025912 | Bacteria | 22855 |
| 424 | Ga0207707_10303303 | 3300025912 | Bacteria | 1381 |
| 425 | Ga0207693_10011242 | 3300025915 | Bacteria | 7246 |
| 426 | Ga0207693_10055473 | 3300025915 | Bacteria | 3109 |
| 427 | Ga0207693_10122229 | 3300025915 | Bacteria | 2045 |
| 428 | Ga0207693_10177362 | 3300025915 | Bacteria | 1677 |
| 429 | Ga0207663_10016400 | 3300025916 | Bacteria | 4107 |
| 430 | Ga0207663_10176131 | 3300025916 | Bacteria | 1523 |
| 431 | Ga0207663_10517600 | 3300025916 | Bacteria | 929 |
| 432 | Ga0207660_10492199 | 3300025917 | Bacteria | 994 |
| 433 | Ga0207662_10039032 | 3300025918 | Bacteria | 2783 |
| 434 | Ga0207657_10013739 | 3300025919 | Bacteria | 7926 |
| 435 | Ga0207657_10028157 | 3300025919 | Bacteria | 5131 |
| 436 | Ga0207657_10735171 | 3300025919 | Bacteria | 765 |
| 437 | Ga0207649_10066986 | 3300025920 | Bacteria | 2278 |
| 438 | Ga0207649_10165670 | 3300025920 | Bacteria | 1535 |
| 439 | Ga0207652_10008724 | 3300025921 | Bacteria | 8160 |
| 440 | Ga0207652_10016769 | 3300025921 | Bacteria | 5985 |
| 441 | Ga0207652_10147526 | 3300025921 | Bacteria | 2106 |
| 442 | Ga0207652_10341302 | 3300025921 | Bacteria | 1352 |
| 443 | Ga0207652_10351540 | 3300025921 | Bacteria | 1330 |
| 444 | Ga0207652_10437911 | 3300025921 | Bacteria | 1178 |
| 445 | Ga0207646_10001043 | 3300025922 | Bacteria | 35345 |
| 446 | Ga0207646_10003277 | 3300025922 | Bacteria | 18442 |
| 447 | Ga0207646_10006902 | 3300025922 | Bacteria | 11663 |
| 448 | Ga0207646_10036661 | 3300025922 | Bacteria | 4426 |
| 449 | Ga0207646_10066969 | 3300025922 | Bacteria | 3206 |
| 450 | Ga0207646_10108168 | 3300025922 | Bacteria | 2494 |
| 451 | Ga0207646_10112799 | 3300025922 | Bacteria | 2440 |
| 452 | Ga0207646_10125319 | 3300025922 | Bacteria | 2309 |
| 453 | Ga0207646_10175844 | 3300025922 | Bacteria | 1933 |
| 454 | Ga0207646_10214371 | 3300025922 | Bacteria | 1739 |
| 455 | Ga0207646_10378277 | 3300025922 | Bacteria | 1279 |
| 456 | Ga0207694_10266117 | 3300025924 | Bacteria | 1405 |
| 457 | Ga0207650_10781202 | 3300025925 | Bacteria | 809 |
| 458 | Ga0207659_10004462 | 3300025926 | Bacteria | 8473 |
| 459 | Ga0207659_10301483 | 3300025926 | Bacteria | 1316 |
| 460 | Ga0207687_10012294 | 3300025927 | Bacteria | 5597 |
| 461 | Ga0207687_10044430 | 3300025927 | Bacteria | 3066 |
| 462 | Ga0207687_10117011 | 3300025927 | Bacteria | 1988 |
| 463 | Ga0207687_10242425 | 3300025927 | Bacteria | 1429 |
| 464 | Ga0207700_10012464 | 3300025928 | Bacteria | 5484 |
| 465 | Ga0207700_10017983 | 3300025928 | Bacteria | 4735 |
| 466 | Ga0207700_10032895 | 3300025928 | Bacteria | 3704 |
| 467 | Ga0207700_10034300 | 3300025928 | Bacteria | 3642 |
| 468 | Ga0207700_10050547 | 3300025928 | Bacteria | 3098 |
| 469 | Ga0207700_10085111 | 3300025928 | Bacteria | 2481 |
| 470 | Ga0207700_10118893 | 3300025928 | Bacteria | 2139 |
| 471 | Ga0207700_10223870 | 3300025928 | Bacteria | 1596 |
| 472 | Ga0207700_10279193 | 3300025928 | Bacteria | 1436 |
| 473 | Ga0207700_10319977 | 3300025928 | Bacteria | 1344 |
| 474 | Ga0207700_10413001 | 3300025928 | Bacteria | 1184 |
| 475 | Ga0207664_10001219 | 3300025929 | Bacteria | 17030 |
| 476 | Ga0207664_10001859 | 3300025929 | Bacteria | 13926 |
| 477 | Ga0207664_10002401 | 3300025929 | Bacteria | 12385 |
| 478 | Ga0207664_10010461 | 3300025929 | Bacteria | 6554 |
| 479 | Ga0207664_10017597 | 3300025929 | Bacteria | 5244 |
| 480 | Ga0207664_10045207 | 3300025929 | Bacteria | 3452 |
| 481 | Ga0207664_10050425 | 3300025929 | Bacteria | 3282 |
| 482 | Ga0207664_10078311 | 3300025929 | Bacteria | 2681 |
| 483 | Ga0207664_10130081 | 3300025929 | Bacteria | 2118 |
| 484 | Ga0207664_10154753 | 3300025929 | Bacteria | 1951 |
| 485 | Ga0207664_10199746 | 3300025929 | Bacteria | 1725 |
| 486 | Ga0207644_10704144 | 3300025931 | Bacteria | 842 |
| 487 | Ga0207690_10262610 | 3300025932 | Bacteria | 1338 |
| 488 | Ga0207706_10101311 | 3300025933 | Bacteria | 2534 |
| 489 | Ga0207706_10188207 | 3300025933 | Bacteria | 1812 |
| 490 | Ga0207686_10199327 | 3300025934 | Bacteria | 1433 |
| 491 | Ga0207686_10233304 | 3300025934 | Bacteria | 1335 |
| 492 | Ga0207709_10021557 | 3300025935 | Bacteria | 3649 |
| 493 | Ga0207709_10040829 | 3300025935 | Bacteria | 2780 |
| 494 | Ga0207709_10049174 | 3300025935 | Bacteria | 2572 |
| 495 | Ga0207709_10056214 | 3300025935 | Bacteria | 2435 |
| 496 | Ga0207670_10076188 | 3300025936 | Bacteria | 2333 |
| 497 | Ga0207669_10050661 | 3300025937 | Bacteria | 2484 |
| 498 | Ga0207669_10199851 | 3300025937 | Bacteria | 1450 |
| 499 | Ga0207669_10354556 | 3300025937 | Bacteria | 1135 |
| 500 | Ga0207704_10060273 | 3300025938 | Bacteria | 2347 |
| 501 | Ga0207704_10676032 | 3300025938 | Bacteria | 852 |
| 502 | Ga0207665_10000937 | 3300025939 | Bacteria | 19776 |
| 503 | Ga0207665_10025697 | 3300025939 | Bacteria | 3886 |
| 504 | Ga0207665_10044338 | 3300025939 | Bacteria | 2976 |
| 505 | Ga0207691_10002759 | 3300025940 | Bacteria | 17117 |
| 506 | Ga0207691_10043103 | 3300025940 | Bacteria | 4159 |
| 507 | Ga0207691_10648383 | 3300025940 | Bacteria | 892 |
| 508 | Ga0207711_10157543 | 3300025941 | Bacteria | 2053 |
| 509 | Ga0207689_10028926 | 3300025942 | Bacteria | 4632 |
| 510 | Ga0207689_10078275 | 3300025942 | Bacteria | 2717 |
| 511 | Ga0207689_10284620 | 3300025942 | Bacteria | 1369 |
| 512 | Ga0207689_10316061 | 3300025942 | Bacteria | 1296 |
| 513 | Ga0207661_10020538 | 3300025944 | Bacteria | 4938 |
| 514 | Ga0207661_10082632 | 3300025944 | Bacteria | 2656 |
| 515 | Ga0207661_10246257 | 3300025944 | Bacteria | 1587 |
| 516 | Ga0207661_10279300 | 3300025944 | Bacteria | 1492 |
| 517 | Ga0207661_10298439 | 3300025944 | Bacteria | 1444 |
| 518 | Ga0207679_10059848 | 3300025945 | Bacteria | 2827 |
| 519 | Ga0207679_10083461 | 3300025945 | Bacteria | 2449 |
| 520 | Ga0207679_10315845 | 3300025945 | Bacteria | 1351 |
| 521 | Ga0207679_10412030 | 3300025945 | Bacteria | 1191 |
| 522 | Ga0207667_10783030 | 3300025949 | Bacteria | 951 |
| 523 | Ga0207651_10447590 | 3300025960 | Bacteria | 1108 |
| 524 | Ga0207712_10041209 | 3300025961 | Bacteria | 3173 |
| 525 | Ga0207712_10455059 | 3300025961 | Bacteria | 1086 |
| 526 | Ga0207668_10818972 | 3300025972 | Bacteria | 825 |
| 527 | Ga0207640_10034135 | 3300025981 | Bacteria | 3172 |
| 528 | Ga0207640_10485021 | 3300025981 | Bacteria | 1026 |
| 529 | Ga0207640_10592054 | 3300025981 | Bacteria | 938 |
| 530 | Ga0207677_10065603 | 3300026023 | Bacteria | 2534 |
| 531 | Ga0207677_10153779 | 3300026023 | Bacteria | 1778 |
| 532 | Ga0207677_10161080 | 3300026023 | Bacteria | 1743 |
| 533 | Ga0207677_10258882 | 3300026023 | Bacteria | 1417 |
| 534 | Ga0207677_10557749 | 3300026023 | Bacteria | 999 |
| 535 | Ga0207677_10645376 | 3300026023 | Bacteria | 934 |
| 536 | Ga0207703_10082642 | 3300026035 | Bacteria | 2681 |
| 537 | Ga0207703_10182944 | 3300026035 | Bacteria | 1850 |
| 538 | Ga0207703_10344111 | 3300026035 | Bacteria | 1371 |
| 539 | Ga0207639_10294704 | 3300026041 | Bacteria | 1432 |
| 540 | Ga0207678_10013263 | 3300026067 | Bacteria | 7232 |
| 541 | Ga0207678_10112010 | 3300026067 | Bacteria | 2328 |
| 542 | Ga0207678_10116286 | 3300026067 | Bacteria | 2282 |
| 543 | Ga0207678_10361747 | 3300026067 | Bacteria | 1252 |
| 544 | Ga0207678_10414828 | 3300026067 | Bacteria | 1167 |
| 545 | Ga0207708_10000171 | 3300026075 | Bacteria | 51434 |
| 546 | Ga0207708_10013641 | 3300026075 | Bacteria | 6070 |
| 547 | Ga0207708_10047624 | 3300026075 | Bacteria | 3263 |
| 548 | Ga0207708_10141025 | 3300026075 | Bacteria | 1891 |
| 549 | Ga0207702_10098834 | 3300026078 | Bacteria | 2572 |
| 550 | Ga0207702_10406511 | 3300026078 | Bacteria | 1314 |
| 551 | Ga0207702_10534781 | 3300026078 | Bacteria | 1145 |
| 552 | Ga0207641_10067667 | 3300026088 | Bacteria | 3061 |
| 553 | Ga0207648_10000926 | 3300026089 | Bacteria | 33052 |
| 554 | Ga0207648_10021225 | 3300026089 | Bacteria | 5838 |
| 555 | Ga0207648_10273380 | 3300026089 | Bacteria | 1510 |
| 556 | Ga0207676_10023529 | 3300026095 | Bacteria | 4547 |
| 557 | Ga0207676_10060211 | 3300026095 | Bacteria | 3002 |
| 558 | Ga0207676_10534115 | 3300026095 | Bacteria | 1118 |
| 559 | Ga0207674_10002791 | 3300026116 | Bacteria | 21738 |
| 560 | Ga0207674_10003072 | 3300026116 | Bacteria | 20651 |
| 561 | Ga0207674_10021296 | 3300026116 | Bacteria | 6986 |
| 562 | Ga0207674_10043441 | 3300026116 | Bacteria | 4634 |
| 563 | Ga0207674_10050070 | 3300026116 | Bacteria | 4269 |
| 564 | Ga0207674_10062060 | 3300026116 | Bacteria | 3775 |
| 565 | Ga0207674_10330823 | 3300026116 | Bacteria | 1473 |
| 566 | Ga0207675_100021690 | 3300026118 | Bacteria | 5978 |
| 567 | Ga0207675_100045873 | 3300026118 | Bacteria | 4082 |
| 568 | Ga0207683_10040527 | 3300026121 | Bacteria | 4065 |
| 569 | Ga0207683_10044001 | 3300026121 | Bacteria | 3902 |
| 570 | Ga0207683_10542743 | 3300026121 | Bacteria | 1075 |
| 571 | Ga0207698_10013511 | 3300026142 | Bacteria | 5390 |
| 572 | Ga0207698_10087552 | 3300026142 | Bacteria | 2537 |
| 573 | Ga0207428_10018301 | 3300027907 | Bacteria | 5986 |
| 574 | Ga0207428_10170260 | 3300027907 | Bacteria | 1650 |
| 575 | Ga0207428_10312454 | 3300027907 | Bacteria | 1162 |
| 576 | Ga0268266_10037281 | 3300028379 | Bacteria | 4143 |
| 577 | Ga0268266_10148443 | 3300028379 | Bacteria | 2111 |
| 578 | Ga0268265_10021593 | 3300028380 | Bacteria | 4513 |
| 579 | Ga0268265_10158734 | 3300028380 | Bacteria | 1918 |
| 580 | Ga0268265_10303887 | 3300028380 | Bacteria | 1438 |
| 581 | Ga0268265_10764455 | 3300028380 | Bacteria | 939 |
| 582 | Ga0268265_10838033 | 3300028380 | Bacteria | 899 |
| 583 | Ga0268264_10015344 | 3300028381 | Bacteria | 6283 |
| 584 | Ga0268264_10016885 | 3300028381 | Bacteria | 5975 |
| 585 | Ga0268264_10102534 | 3300028381 | Bacteria | 2490 |
| 586 | Ga0268264_10147125 | 3300028381 | Bacteria | 2108 |
| 587 | Ga0268264_10223668 | 3300028381 | Bacteria | 1734 |
| 588 | Ga0268264_10732260 | 3300028381 | Bacteria | 984 |
| 589 | Ga0265337_1007835 | 3300028556 | Bacteria | 3957 |
| 590 | Ga0265326_10007791 | 3300028558 | Bacteria | 3263 |
| 591 | Ga0265319_1000101 | 3300028563 | Bacteria | 66582 |
| 592 | Ga0265319_1004032 | 3300028563 | Bacteria | 7433 |
| 593 | Ga0265334_10003352 | 3300028573 | Bacteria | 7312 |
| 594 | Ga0265318_10000112 | 3300028577 | Bacteria | 75202 |
| 595 | Ga0265318_10001261 | 3300028577 | Bacteria | 15307 |
| 596 | Ga0265318_10061405 | 3300028577 | Bacteria | 1400 |
| 597 | Ga0265323_10009626 | 3300028653 | Bacteria | 3938 |
| 598 | Ga0265322_10006720 | 3300028654 | Bacteria | 3379 |
| 599 | Ga0265336_10001704 | 3300028666 | Bacteria | 9695 |
| 600 | Ga0265336_10014619 | 3300028666 | Bacteria | 2595 |
| 601 | Ga0307515_10000042 | 3300028794 | Bacteria | 309141 |
| 602 | Ga0307515_10014744 | 3300028794 | Bacteria | 14459 |
| 603 | Ga0307515_10030070 | 3300028794 | Bacteria | 9144 |
| 604 | Ga0265338_10000743 | 3300028800 | Bacteria | 55581 |
| 605 | Ga0265338_10001346 | 3300028800 | Bacteria | 40029 |
| 606 | Ga0265338_10005011 | 3300028800 | Bacteria | 17505 |
| 607 | Ga0265338_10006911 | 3300028800 | Bacteria | 14280 |
| 608 | Ga0265338_10057494 | 3300028800 | Bacteria | 3440 |
| 609 | Ga0265338_10066202 | 3300028800 | Bacteria | 3128 |
| 610 | Ga0265324_10010807 | 3300029957 | Bacteria | 3501 |
| 611 | Ga0307512_10007084 | 3300030522 | Bacteria | 11176 |
| 612 | Ga0307512_10027813 | 3300030522 | Bacteria | 4968 |
| 613 | Ga0265330_10000056 | 3300031235 | Bacteria | 100283 |
| 614 | Ga0265332_10000050 | 3300031238 | Bacteria | 112449 |
| 615 | Ga0265332_10002184 | 3300031238 | Bacteria | 10071 |
| 616 | Ga0265328_10001238 | 3300031239 | Bacteria | 11839 |
| 617 | Ga0265320_10000115 | 3300031240 | Bacteria | 69750 |
| 618 | Ga0265320_10005115 | 3300031240 | Bacteria | 8473 |
| 619 | Ga0265320_10109686 | 3300031240 | Bacteria | 1265 |
| 620 | Ga0265325_10000326 | 3300031241 | Bacteria | 33654 |
| 621 | Ga0265325_10001667 | 3300031241 | Bacteria | 15409 |
| 622 | Ga0265325_10035966 | 3300031241 | Bacteria | 2626 |
| 623 | Ga0265329_10000048 | 3300031242 | Bacteria | 51268 |
| 624 | Ga0265340_10001141 | 3300031247 | Bacteria | 15183 |
| 625 | Ga0265340_10001852 | 3300031247 | Bacteria | 12068 |
| 626 | Ga0265339_10006545 | 3300031249 | Bacteria | 7634 |
| 627 | Ga0265339_10007679 | 3300031249 | Bacteria | 6938 |
| 628 | Ga0265339_10041381 | 3300031249 | Bacteria | 2558 |
| 629 | Ga0265331_10000335 | 3300031250 | Bacteria | 50304 |
| 630 | Ga0265316_10001199 | 3300031344 | Bacteria | 28027 |
| 631 | Ga0265316_10008688 | 3300031344 | Bacteria | 9401 |
| 632 | Ga0265316_10020583 | 3300031344 | Bacteria | 5613 |
| 633 | Ga0307513_10024342 | 3300031456 | Bacteria | 7044 |
| 634 | Ga0307513_10047902 | 3300031456 | Bacteria | 4645 |
| 635 | Ga0307513_10080092 | 3300031456 | Bacteria | 3370 |
| 636 | Ga0307513_10265934 | 3300031456 | Bacteria | 1501 |
| 637 | Ga0307408_100181523 | 3300031548 | Bacteria | 1688 |
| 638 | Ga0265313_10000009 | 3300031595 | Bacteria | 169607 |
| 639 | Ga0265313_10000187 | 3300031595 | Bacteria | 66087 |
| 640 | Ga0265313_10000383 | 3300031595 | Bacteria | 47643 |
| 641 | Ga0265313_10033580 | 3300031595 | Bacteria | 2605 |
| 642 | Ga0307508_10086037 | 3300031616 | Bacteria | 2727 |
| 643 | Ga0307508_10149401 | 3300031616 | Bacteria | 1941 |
| 644 | Ga0316579_10050303 | 3300031691 | Bacteria | 1949 |
| 645 | Ga0265314_10000430 | 3300031711 | Bacteria | 56257 |
| 646 | Ga0265314_10017800 | 3300031711 | Bacteria | 5567 |
| 647 | Ga0265342_10000333 | 3300031712 | Bacteria | 52702 |
| 648 | Ga0265342_10012657 | 3300031712 | Bacteria | 5707 |
| 649 | Ga0307516_10003947 | 3300031730 | Bacteria | 18653 |
| 650 | Ga0307516_10034399 | 3300031730 | Bacteria | 5092 |
| 651 | Ga0307516_10153774 | 3300031730 | Bacteria | 2058 |
| 652 | Ga0307405_10333712 | 3300031731 | Bacteria | 1163 |
| 653 | Ga0316577_10042918 | 3300031733 | Bacteria | 2530 |
| 654 | Ga0307413_10023726 | 3300031824 | Bacteria | 3329 |
| 655 | Ga0307413_10312890 | 3300031824 | Bacteria | 1196 |
| 656 | Ga0307410_10015091 | 3300031852 | Bacteria | 4571 |
| 657 | Ga0307410_10032568 | 3300031852 | Bacteria | 3356 |
| 658 | Ga0307406_10028625 | 3300031901 | Bacteria | 3368 |
| 659 | Ga0307407_10044263 | 3300031903 | Bacteria | 2507 |
| 660 | Ga0307407_10102867 | 3300031903 | Bacteria | 1777 |
| 661 | Ga0307407_10140691 | 3300031903 | Bacteria | 1556 |
| 662 | Ga0307412_10134797 | 3300031911 | Bacteria | 1800 |
| 663 | Ga0307409_100090877 | 3300031995 | Bacteria | 2500 |
| 664 | Ga0307409_100384215 | 3300031995 | Bacteria | 1336 |
| 665 | Ga0307409_100984808 | 3300031995 | Bacteria | 861 |
| 666 | Ga0307416_100021692 | 3300032002 | Bacteria | 4617 |
| 667 | Ga0307416_100492760 | 3300032002 | Bacteria | 1288 |
| 668 | Ga0307414_10086307 | 3300032004 | Bacteria | 2315 |
| 669 | Ga0307414_10271610 | 3300032004 | Bacteria | 1420 |
| 670 | Ga0307414_10501103 | 3300032004 | Bacteria | 1074 |
| 671 | Ga0307411_10642793 | 3300032005 | Bacteria | 917 |
| 672 | Ga0307415_100002584 | 3300032126 | Bacteria | 9047 |
| 673 | Ga0307415_100035580 | 3300032126 | Bacteria | 3253 |
| 674 | Ga0307415_100489620 | 3300032126 | Bacteria | 1073 |
| 675 | Ga0307507_10147119 | 3300033179 | Bacteria | 1786 |
| 676 | Ga0316214_1002630 | 3300033545 | Bacteria | 2215 |
| 677 | Ga0373938_0044313 | 3300034957 | Bacteria | 998 |
| 678 | Ga0373926_0002315 | 3300035083 | Bacteria | 6025 |
| 679 | Ga0373926_0006977 | 3300035083 | Bacteria | 3756 |
| 680 | Ga0373934_0000101 | 3300035086 | Bacteria | 29995 |
| 681 | Ga0373934_0012313 | 3300035086 | Bacteria | 3229 |
| 682 | Ga0373934_0040878 | 3300035086 | Bacteria | 1829 |
| 683 | Ga0373934_0042417 | 3300035086 | Bacteria | 1797 |
| 684 | Ga0373949_0031357 | 3300035090 | Bacteria | 1267 |
| 685 | Ga0373951_0000271 | 3300035091 | Bacteria | 16583 |
| 686 | Ga0373923_0000967 | 3300035111 | Bacteria | 7719 |
| 687 | Ga0373923_0010902 | 3300035111 | Bacteria | 3320 |
| 688 | Ga0373923_0015587 | 3300035111 | Bacteria | 2871 |
| 689 | Ga0373923_0039155 | 3300035111 | Bacteria | 1946 |
| 690 | Ga0373923_0061499 | 3300035111 | Bacteria | 1596 |
| 691 | Ga0373923_0075589 | 3300035111 | Bacteria | 1453 |
| 692 | Ga0373936_0003980 | 3300035113 | Bacteria | 5568 |
| 693 | Ga0373936_0308040 | 3300035113 | Bacteria | 716 |
| 694 | Ga0373945_0028991 | 3300035116 | Bacteria | 1942 |
| 695 | Ga0373945_0034494 | 3300035116 | Bacteria | 1803 |
| 696 | Ga0373953_0000521 | 3300035117 | Bacteria | 10670 |
| 697 | Ga0373953_0009295 | 3300035117 | Bacteria | 3375 |
| 698 | Ga0373953_0026137 | 3300035117 | Bacteria | 2235 |
| 699 | Ga0373954_0008596 | 3300035118 | Bacteria | 4490 |
| 700 | Ga0373954_0015680 | 3300035118 | Bacteria | 3389 |
| 701 | Ga0373954_0027967 | 3300035118 | Bacteria | 2591 |
| 702 | Ga0373956_0000095 | 3300035119 | Bacteria | 29811 |
| 703 | Ga0373956_0018190 | 3300035119 | Bacteria | 2972 |
| 704 | Ga0373956_0113215 | 3300035119 | Bacteria | 1264 |
| 705 | Ga0373957_0000033 | 3300035120 | Bacteria | 35539 |
| 706 | Ga0373943_0066062 | 3300035170 | Bacteria | 1820 |
| 707 | Ga0373943_0085374 | 3300035170 | Bacteria | 1625 |
| 708 | Ga0373946_0002118 | 3300035171 | Bacteria | 6960 |
| 709 | Ga0373946_0010570 | 3300035171 | Bacteria | 3420 |
| 710 | Ga0373946_0145535 | 3300035171 | Bacteria | 1102 |
| 711 | Ga0373955_0000002 | 3300035172 | Bacteria | 125763 |
| 712 | Ga0373955_0007055 | 3300035172 | Bacteria | 5145 |
| 713 | Ga0373955_0012915 | 3300035172 | Bacteria | 4026 |
| 714 | Ga0373924_0002327 | 3300035410 | Bacteria | 6376 |
| 715 | Ga0373924_0009167 | 3300035410 | Bacteria | 3621 |
| 716 | Ga0373931_0346063 | 3300035691 | Bacteria | 929 |
| 717 | Ga0373935_0000234 | 3300035692 | Bacteria | 27285 |
| 718 | Ga0373935_0045225 | 3300035692 | Bacteria | 2777 |
| 719 | Ga0373935_0192321 | 3300035692 | Bacteria | 1406 |
| 720 | Ga0373935_0206279 | 3300035692 | Bacteria | 1360 |
| 721 | Ga0373927_0254902 | 3300035695 | Bacteria | 1153 |
| 722 | Ga0373933_0000029 | 3300035724 | Bacteria | 86829 |
| 723 | Ga0373933_0012974 | 3300035724 | Bacteria | 4609 |
| 724 | Ga0373933_0024647 | 3300035724 | Bacteria | 3444 |
| 725 | Ga0373933_0033935 | 3300035724 | Bacteria | 2971 |
| 726 | Ga0373933_0137993 | 3300035724 | Bacteria | 1538 |
| 727 | Ga0373933_0198132 | 3300035724 | Bacteria | 1284 |
| 728 | Ga0373947_0000005 | 3300035725 | Bacteria | 225129 |
| 729 | Ga0373947_0134795 | 3300035725 | Bacteria | 1579 |
| 730 | Ga0373937_0000362 | 3300036401 | Bacteria | 42228 |
| 731 | Ga0373937_0004443 | 3300036401 | Bacteria | 11918 |
| 732 | Ga0373937_0095938 | 3300036401 | Bacteria | 2750 |
| 733 | Ga0373937_0243235 | 3300036401 | Bacteria | 1695 |
| 734 | Ga0373937_0330572 | 3300036401 | Bacteria | 1442 |
| 735 | Ga0373937_0448943 | 3300036401 | Bacteria | 1224 |
| 736 | Ga0373937_0472913 | 3300036401 | Bacteria | 1190 |
| 737 | Ga0316584_0019297 | 3300036712 | Bacteria | 4928 |
| 738 | Ga0373925_0000021 | 3300037068 | Bacteria | 162277 |
| 739 | Ga0373925_0199253 | 3300037068 | Bacteria | 1591 |
| 740 | Ga0373925_0221133 | 3300037068 | Bacteria | 1511 |
| 741 | Ga0373925_0475917 | 3300037068 | Bacteria | 1024 |
| 742 | Ga0395900_0003692 | 3300037418 | Bacteria | 16457 |
| 743 | Ga0395900_0407298 | 3300037418 | Bacteria | 1323 |
| 744 | Ga0395898_0042087 | 3300037466 | Bacteria | 4509 |
| 745 | Ga0395898_0150625 | 3300037466 | Bacteria | 2226 |
| 746 | Ga0395898_0974500 | 3300037466 | Bacteria | 784 |
| 747 | Ga0316581_0039286 | 3300037588 | Bacteria | 1440 |
| 748 | Ga0436364_0115602 | 3300037853 | Bacteria | 2288 |
| 749 | Ga0436364_0361850 | 3300037853 | Bacteria | 4047 |
| 750 | Ga0436364_1130152 | 3300037853 | Bacteria | 3129 |
| 751 | Ga0436364_1225860 | 3300037853 | Bacteria | 2715 |
| 752 | Ga0395901_0059328 | 3300038443 | Bacteria | 3981 |
| 753 | Ga0436361_0546799 | 3300039447 | Bacteria | 1419 |
| 754 | Ga0436363_0208428 | 3300039450 | Bacteria | 2554 |
| 755 | Ga0451787_197248 | 3300041441 | Bacteria | 1637 |
| 756 | Ga0451789_0052206 | 3300041443 | Bacteria | 4804 |
| 757 | Ga0451791_1114879 | 3300041451 | Bacteria | 5775 |
| 758 | Ga0451791_1689531 | 3300041451 | Bacteria | 1860 |
| 759 | Ga0451793_0720655 | 3300041452 | Bacteria | 12238 |
| 760 | Ga0451797_0100726 | 3300041453 | Bacteria | 4175 |
| 761 | Ga0451800_0314848 | 3300041459 | Bacteria | 1739 |
| 762 | Ga0451807_0584294 | 3300041486 | Bacteria | 1090 |
| 763 | Ga0451839_0061394 | 3300041496 | Bacteria | 3005 |
| 764 | Ga0451841_0287715 | 3300041498 | Bacteria | 1713 |
| 765 | Ga0451843_0204342 | 3300041509 | Bacteria | 4137 |
| 766 | Ga0466965_0355675 | 3300044683 | Bacteria | 803 |
| 767 | Ga0466966_0085720 | 3300044684 | Bacteria | 1958 |
| 768 | Ga0466961_0105411 | 3300044693 | Bacteria | 1775 |
| 769 | Ga0466963_0076384 | 3300044694 | Bacteria | 2262 |
| 770 | Ga0466964_0222376 | 3300044706 | Bacteria | 917 |
| 771 | Ga0466957_0239841 | 3300044842 | Bacteria | 1202 |
| 772 | Ga0466960_0012595 | 3300044901 | Bacteria | 3575 |
| 773 | Ga0466960_0097893 | 3300044901 | Bacteria | 1506 |
| 774 | Ga0466959_0003301 | 3300045049 | Bacteria | 10527 |
| 775 | Ga0466959_0020862 | 3300045049 | Bacteria | 4828 |
| 776 | Ga0466959_0133545 | 3300045049 | Bacteria | 1758 |
| 777 | Ga0466959_0362030 | 3300045049 | Bacteria | 988 |
| 778 | Ga0466958_0090390 | 3300045836 | Bacteria | 1895 |
| 779 | Ga0466958_0121743 | 3300045836 | Bacteria | 1634 |
| 780 | Ga0466958_0259650 | 3300045836 | Bacteria | 1112 |
| 781 | Ga0466958_0276648 | 3300045836 | Bacteria | 1075 |
| 782 | Ga0466967_0000444 | 3300045976 | Bacteria | 19804 |
| 783 | Ga0466967_0004649 | 3300045976 | Bacteria | 9313 |
| 784 | Ga0466967_0015004 | 3300045976 | Bacteria | 6059 |
| 785 | Ga0466967_0026433 | 3300045976 | Bacteria | 4808 |
| 786 | Ga0466967_0044615 | 3300045976 | Bacteria | 3847 |
| 787 | Ga0466967_0050982 | 3300045976 | Bacteria | 3625 |
| 788 | Ga0466967_0076441 | 3300045976 | Bacteria | 3012 |
| 789 | Ga0466967_0127873 | 3300045976 | Bacteria | 2355 |
| 790 | Ga0466967_0154742 | 3300045976 | Bacteria | 2146 |
| 791 | Ga0466967_0573243 | 3300045976 | Bacteria | 1112 |
| 792 | Ga0466967_0943566 | 3300045976 | Bacteria | 858 |
| 793 | Ga0495592_0000043 | 3300046454 | Bacteria | 122354 |
| 794 | Ga0495592_0008890 | 3300046454 | Bacteria | 7542 |
| 795 | Ga0495592_0040782 | 3300046454 | Bacteria | 3482 |
| 796 | Ga0495592_0100369 | 3300046454 | Bacteria | 2064 |
| 797 | Ga0495592_0135693 | 3300046454 | Bacteria | 1716 |
| 798 | Ga0495592_0232868 | 3300046454 | Bacteria | 1225 |
| 799 | Ga0495603_0042928 | 3300046455 | Bacteria | 2701 |
| 800 | Ga0495629_0005691 | 3300046459 | Bacteria | 9307 |
| 801 | Ga0495629_0091124 | 3300046459 | Bacteria | 2127 |
| 802 | Ga0495629_0217170 | 3300046459 | Bacteria | 1319 |
| 803 | Ga0495641_0001864 | 3300046461 | Bacteria | 17302 |
| 804 | Ga0495651_0000135 | 3300046462 | Bacteria | 54990 |
| 805 | Ga0495651_0003167 | 3300046462 | Bacteria | 12664 |
| 806 | Ga0495651_0006755 | 3300046462 | Bacteria | 8766 |
| 807 | Ga0495651_0021269 | 3300046462 | Bacteria | 5041 |
| 808 | Ga0495651_0028970 | 3300046462 | Bacteria | 4318 |
| 809 | Ga0495651_0055294 | 3300046462 | Bacteria | 3050 |
| 810 | Ga0495653_0000571 | 3300046463 | Bacteria | 28231 |
| 811 | Ga0495653_0012759 | 3300046463 | Bacteria | 6861 |
| 812 | Ga0495653_0063902 | 3300046463 | Bacteria | 2775 |
| 813 | Ga0495653_0132596 | 3300046463 | Bacteria | 1761 |
| 814 | Ga0495653_0179118 | 3300046463 | Bacteria | 1456 |
| 815 | Ga0495653_0299490 | 3300046463 | Bacteria | 1049 |
| 816 | Ga0495580_0015800 | 3300046472 | Bacteria | 5685 |
| 817 | Ga0495582_0212637 | 3300046473 | Bacteria | 1105 |
| 818 | Ga0495582_0296301 | 3300046473 | Bacteria | 929 |
| 819 | Ga0495639_0001668 | 3300046475 | Bacteria | 9874 |
| 820 | Ga0495662_0009182 | 3300046476 | Bacteria | 4853 |
| 821 | Ga0495662_0011201 | 3300046476 | Bacteria | 4383 |
| 822 | Ga0495662_0036057 | 3300046476 | Bacteria | 2387 |
| 823 | Ga0495662_0074460 | 3300046476 | Bacteria | 1647 |
| 824 | Ga0495664_0014805 | 3300046477 | Bacteria | 4428 |
| 825 | Ga0495664_0017439 | 3300046477 | Bacteria | 4104 |
| 826 | Ga0495664_0125390 | 3300046477 | Bacteria | 1553 |
| 827 | Ga0495664_0177147 | 3300046477 | Bacteria | 1293 |
| 828 | Ga0495664_0275579 | 3300046477 | Bacteria | 1016 |
| 829 | Ga0495594_0158565 | 3300046499 | Bacteria | 1286 |
| 830 | Ga0495594_0226331 | 3300046499 | Bacteria | 1066 |
| 831 | Ga0495608_0000016 | 3300046511 | Bacteria | 196738 |
| 832 | Ga0495608_0007773 | 3300046511 | Bacteria | 7551 |
| 833 | Ga0495608_0013563 | 3300046511 | Bacteria | 5652 |
| 834 | Ga0495608_0050860 | 3300046511 | Bacteria | 2748 |
| 835 | Ga0495608_0119179 | 3300046511 | Bacteria | 1693 |
| 836 | Ga0495618_0022655 | 3300046514 | Bacteria | 3880 |
| 837 | Ga0495618_0183018 | 3300046514 | Bacteria | 1331 |
| 838 | Ga0495618_0199061 | 3300046514 | Bacteria | 1268 |
| 839 | Ga0495618_0346335 | 3300046514 | Bacteria | 916 |
| 840 | Ga0495628_0000034 | 3300046516 | Bacteria | 115264 |
| 841 | Ga0495628_0008967 | 3300046516 | Bacteria | 8554 |
| 842 | Ga0495628_0013773 | 3300046516 | Bacteria | 6795 |
| 843 | Ga0495628_0227919 | 3300046516 | Bacteria | 1397 |
| 844 | Ga0495628_0388891 | 3300046516 | Bacteria | 1020 |
| 845 | Ga0495630_0001481 | 3300046517 | Bacteria | 16232 |
| 846 | Ga0495630_0009954 | 3300046517 | Bacteria | 6846 |
| 847 | Ga0495630_0077567 | 3300046517 | Bacteria | 2505 |
| 848 | Ga0495630_0283839 | 3300046517 | Bacteria | 1265 |
| 849 | Ga0495663_0054344 | 3300046525 | Bacteria | 1247 |
| 850 | Ga0495666_0005436 | 3300046526 | Bacteria | 6418 |
| 851 | Ga0495666_0094215 | 3300046526 | Bacteria | 1412 |
| 852 | Ga0495652_0000174 | 3300046529 | Bacteria | 73044 |
| 853 | Ga0495652_0014268 | 3300046529 | Bacteria | 7133 |
| 854 | Ga0495652_0018126 | 3300046529 | Bacteria | 6283 |
| 855 | Ga0495652_0022357 | 3300046529 | Bacteria | 5610 |
| 856 | Ga0495652_0054315 | 3300046529 | Bacteria | 3411 |
| 857 | Ga0495652_0054402 | 3300046529 | Bacteria | 3408 |
| 858 | Ga0495652_0066154 | 3300046529 | Bacteria | 3034 |
| 859 | Ga0495652_0239700 | 3300046529 | Bacteria | 1350 |
| 860 | Ga0495665_0017965 | 3300046531 | Bacteria | 3801 |
| 861 | Ga0495640_0006733 | 3300046533 | Bacteria | 9067 |
| 862 | Ga0495640_0011539 | 3300046533 | Bacteria | 6795 |
| 863 | Ga0495640_0039902 | 3300046533 | Bacteria | 3291 |
| 864 | Ga0495640_0254242 | 3300046533 | Bacteria | 1099 |
| 865 | Ga0495587_0000044 | 3300046536 | Bacteria | 108443 |
| 866 | Ga0495587_0002197 | 3300046536 | Bacteria | 13041 |
| 867 | Ga0495587_0004185 | 3300046536 | Bacteria | 9552 |
| 868 | Ga0495587_0007131 | 3300046536 | Bacteria | 7253 |
| 869 | Ga0495587_0023581 | 3300046536 | Bacteria | 3781 |
| 870 | Ga0495587_0123462 | 3300046536 | Bacteria | 1482 |
| 871 | Ga0495645_0145071 | 3300046543 | Bacteria | 1654 |
| 872 | Ga0495645_0168207 | 3300046543 | Bacteria | 1510 |
| 873 | Ga0495645_0315594 | 3300046543 | Bacteria | 1016 |
| 874 | Ga0495622_0140668 | 3300046557 | Bacteria | 1096 |
| 875 | Ga0495667_0000052 | 3300046559 | Bacteria | 108432 |
| 876 | Ga0495667_0058789 | 3300046559 | Bacteria | 2524 |
| 877 | Ga0495667_0065610 | 3300046559 | Bacteria | 2374 |
| 878 | Ga0495667_0083468 | 3300046559 | Bacteria | 2075 |
| 879 | Ga0495667_0229903 | 3300046559 | Bacteria | 1182 |
| 880 | Ga0495667_0270642 | 3300046559 | Bacteria | 1079 |
| 881 | Ga0495656_0169464 | 3300046615 | Bacteria | 1066 |
| 882 | Ga0495634_0005292 | 3300046642 | Bacteria | 9963 |
| 883 | Ga0495634_0009343 | 3300046642 | Bacteria | 7234 |
| 884 | Ga0495634_0057919 | 3300046642 | Bacteria | 2584 |
| 885 | Ga0495634_0144929 | 3300046642 | Bacteria | 1505 |
| 886 | Ga0495634_0245119 | 3300046642 | Bacteria | 1098 |
| 887 | Ga0495635_0039234 | 3300046663 | Bacteria | 3276 |
| 888 | Ga0495635_0065132 | 3300046663 | Bacteria | 2500 |
| 889 | Ga0495635_0072653 | 3300046663 | Bacteria | 2356 |
| 890 | Ga0495635_0148515 | 3300046663 | Bacteria | 1596 |
| 891 | Ga0495635_0235376 | 3300046663 | Bacteria | 1236 |
| 892 | Ga0495635_0336209 | 3300046663 | Bacteria | 1009 |
| 893 | Ga0495588_0091891 | 3300046674 | Bacteria | 1590 |
| 894 | Ga0495588_0195713 | 3300046674 | Bacteria | 1068 |
| 895 | Ga0495657_0000015 | 3300046675 | Bacteria | 187657 |
| 896 | Ga0495657_0009392 | 3300046675 | Bacteria | 7416 |
| 897 | Ga0495657_0013373 | 3300046675 | Bacteria | 6059 |
| 898 | Ga0495657_0024401 | 3300046675 | Bacteria | 4307 |
| 899 | Ga0495657_0027681 | 3300046675 | Bacteria | 3997 |
| 900 | Ga0495657_0082289 | 3300046675 | Bacteria | 2080 |
| 901 | Ga0495657_0091969 | 3300046675 | Bacteria | 1944 |
| 902 | Ga0495657_0233343 | 3300046675 | Bacteria | 1112 |
| 903 | Ga0495599_0000035 | 3300046678 | Bacteria | 103981 |
| 904 | Ga0495599_0003091 | 3300046678 | Bacteria | 9690 |
| 905 | Ga0495599_0007370 | 3300046678 | Bacteria | 6669 |
| 906 | Ga0495599_0051967 | 3300046678 | Bacteria | 2567 |
| 907 | Ga0495599_0198281 | 3300046678 | Bacteria | 1233 |
| 908 | Ga0495623_0000767 | 3300046679 | Bacteria | 21507 |
| 909 | Ga0495623_0002607 | 3300046679 | Bacteria | 11904 |
| 910 | Ga0495623_0037673 | 3300046679 | Bacteria | 3093 |
| 911 | Ga0495623_0140134 | 3300046679 | Bacteria | 1440 |
| 912 | Ga0495623_0222683 | 3300046679 | Bacteria | 1074 |
| 913 | Ga0495623_0233732 | 3300046679 | Bacteria | 1041 |
| 914 | Ga0495623_0306196 | 3300046679 | Bacteria | 876 |
| 915 | Ga0495646_0002176 | 3300046680 | Bacteria | 11936 |
| 916 | Ga0495646_0014045 | 3300046680 | Bacteria | 5091 |
| 917 | Ga0495646_0040257 | 3300046680 | Bacteria | 2879 |
| 918 | Ga0495646_0382705 | 3300046680 | Bacteria | 733 |
| 919 | Ga0495658_0000676 | 3300046683 | Bacteria | 18454 |
| 920 | Ga0495613_0078282 | 3300046689 | Bacteria | 2405 |
| 921 | Ga0495624_0122064 | 3300046690 | Bacteria | 1599 |
| 922 | Ga0495624_0126680 | 3300046690 | Bacteria | 1567 |
| 923 | Ga0495600_0007475 | 3300046809 | Bacteria | 6688 |
| 924 | Ga0495600_0025656 | 3300046809 | Bacteria | 3798 |
| 925 | Ga0495600_0056237 | 3300046809 | Bacteria | 2570 |
| 926 | Ga0495600_0088286 | 3300046809 | Bacteria | 2023 |
| 927 | Ga0495600_0223031 | 3300046809 | Bacteria | 1205 |
| 928 | Ga0495600_0270490 | 3300046809 | Bacteria | 1078 |
| 929 | Ga0495581_0001515 | 3300047315 | Bacteria | 12943 |
| 930 | Ga0495581_0017534 | 3300047315 | Bacteria | 4159 |
| 931 | Ga0495581_0023897 | 3300047315 | Bacteria | 3542 |
| 932 | Ga0495581_0091086 | 3300047315 | Bacteria | 1769 |
| 933 | Ga0495604_0000048 | 3300047317 | Bacteria | 108810 |
| 934 | Ga0495604_0009246 | 3300047317 | Bacteria | 7801 |
| 935 | Ga0495604_0030548 | 3300047317 | Bacteria | 4278 |
| 936 | Ga0495604_0041434 | 3300047317 | Bacteria | 3611 |
| 937 | Ga0495604_0046676 | 3300047317 | Bacteria | 3378 |
| 938 | Ga0495604_0131706 | 3300047317 | Bacteria | 1796 |
| 939 | Ga0495604_0154282 | 3300047317 | Bacteria | 1628 |
| 940 | Ga0495674_0027236 | 3300047319 | Bacteria | 5224 |
| 941 | Ga0495674_0139615 | 3300047319 | Bacteria | 2037 |
| 942 | Ga0495676_0004969 | 3300047321 | Bacteria | 12194 |
| 943 | Ga0495676_0006692 | 3300047321 | Bacteria | 10614 |
| 944 | Ga0495680_0000069 | 3300047322 | Bacteria | 88766 |
| 945 | Ga0495680_0010239 | 3300047322 | Bacteria | 8372 |
| 946 | Ga0495680_0012666 | 3300047322 | Bacteria | 7406 |
| 947 | Ga0495680_0019087 | 3300047322 | Bacteria | 5802 |
| 948 | Ga0495680_0020724 | 3300047322 | Bacteria | 5521 |
| 949 | Ga0495680_0074021 | 3300047322 | Bacteria | 2587 |
| 950 | Ga0495680_0187849 | 3300047322 | Bacteria | 1487 |
| 951 | Ga0495675_0000685 | 3300047444 | Bacteria | 21288 |
| 952 | Ga0495675_0040750 | 3300047444 | Bacteria | 2960 |
| 953 | Ga0495675_0048135 | 3300047444 | Bacteria | 2712 |
| 954 | Ga0495675_0067482 | 3300047444 | Bacteria | 2260 |
| 955 | Ga0495684_0002558 | 3300047471 | Bacteria | 14475 |
| 956 | Ga0495684_0009605 | 3300047471 | Bacteria | 7458 |
| 957 | Ga0495684_0014538 | 3300047471 | Bacteria | 6059 |
| 958 | Ga0495684_0067033 | 3300047471 | Bacteria | 2729 |
| 959 | Ga0495684_0079004 | 3300047471 | Bacteria | 2497 |
| 960 | Ga0495684_0125480 | 3300047471 | Bacteria | 1931 |
| 961 | Ga0495684_0205211 | 3300047471 | Bacteria | 1452 |
| 962 | Ga0495593_0045862 | 3300047673 | Bacteria | 2331 |
| 963 | Ga0495593_0246927 | 3300047673 | Bacteria | 894 |
| 964 | Ga0495602_0000970 | 3300048088 | Bacteria | 27780 |
| 965 | Ga0495602_0028336 | 3300048088 | Bacteria | 5362 |
| 966 | Ga0495602_0036043 | 3300048088 | Bacteria | 4607 |
| 967 | Ga0495602_0041593 | 3300048088 | Bacteria | 4196 |
| 968 | Ga0495602_0091366 | 3300048088 | Bacteria | 2525 |
| 969 | Ga0495602_0099272 | 3300048088 | Bacteria | 2393 |
| 970 | Ga0495614_0140023 | 3300048089 | Bacteria | 1074 |
| 971 | Ga0496100_0192306 | 3300048903 | Bacteria | 1482 |
| 972 | Ga0496102_0074809 | 3300048905 | Bacteria | 3114 |
| 973 | Ga0496102_0136609 | 3300048905 | Bacteria | 2298 |
| 974 | Ga0496102_0334117 | 3300048905 | Bacteria | 1427 |
| 975 | Ga0496102_0482142 | 3300048905 | Bacteria | 1161 |
| 976 | Ga0496102_0662145 | 3300048905 | Bacteria | 967 |
| 977 | Ga0496103_0053830 | 3300048906 | Bacteria | 2494 |
| 978 | Ga0496104_0000441 | 3300048907 | Bacteria | 36043 |
| 979 | Ga0496104_0005513 | 3300048907 | Bacteria | 11084 |
| 980 | Ga0496104_0007235 | 3300048907 | Bacteria | 9794 |
| 981 | Ga0496104_0012681 | 3300048907 | Bacteria | 7590 |
| 982 | Ga0496105_0031146 | 3300048908 | Bacteria | 4372 |
| 983 | Ga0496105_0085888 | 3300048908 | Bacteria | 2600 |
| 984 | Ga0496106_0334431 | 3300048909 | Bacteria | 1216 |
| 985 | Ga0496106_0370120 | 3300048909 | Bacteria | 1151 |
| 986 | Ga0496106_0666185 | 3300048909 | Bacteria | 831 |
| 987 | Ga0496108_0000748 | 3300048911 | Bacteria | 25330 |
| 988 | Ga0496108_0018581 | 3300048911 | Bacteria | 5694 |
| 989 | Ga0496108_0022231 | 3300048911 | Bacteria | 5215 |
| 990 | Ga0496108_0022533 | 3300048911 | Bacteria | 5179 |
| 991 | Ga0496108_0034966 | 3300048911 | Bacteria | 4175 |
| 992 | Ga0496108_0148646 | 3300048911 | Bacteria | 2021 |
| 993 | Ga0496108_0180850 | 3300048911 | Bacteria | 1826 |
| 994 | Ga0496108_0213929 | 3300048911 | Bacteria | 1673 |
| 995 | Ga0496108_0546456 | 3300048911 | Bacteria | 1011 |
| 996 | Ga0496109_0001743 | 3300048912 | Bacteria | 18151 |
| 997 | Ga0496109_0110366 | 3300048912 | Bacteria | 2557 |
| 998 | Ga0496109_0152282 | 3300048912 | Bacteria | 2165 |
| 999 | Ga0496109_0170111 | 3300048912 | Bacteria | 2044 |
| 1000 | Ga0496109_0207973 | 3300048912 | Bacteria | 1840 |
| 1001 | Ga0496109_0246635 | 3300048912 | Bacteria | 1681 |
| 1002 | Ga0496109_0248074 | 3300048912 | Bacteria | 1676 |
| 1003 | Ga0496109_0458350 | 3300048912 | Bacteria | 1204 |
| 1004 | Ga0496110_0003033 | 3300048913 | Bacteria | 12739 |
| 1005 | Ga0496110_0032286 | 3300048913 | Bacteria | 4521 |
| 1006 | Ga0496110_0059346 | 3300048913 | Bacteria | 3372 |
| 1007 | Ga0496110_0061091 | 3300048913 | Bacteria | 3325 |
| 1008 | Ga0496110_0063852 | 3300048913 | Bacteria | 3254 |
| 1009 | Ga0496110_0158974 | 3300048913 | Bacteria | 2048 |
| 1010 | Ga0496111_0001177 | 3300048914 | Bacteria | 14549 |
| 1011 | Ga0496111_0161411 | 3300048914 | Bacteria | 1664 |
| 1012 | Ga0496111_0368051 | 3300048914 | Bacteria | 1063 |
| 1013 | Ga0496112_0000159 | 3300048915 | Bacteria | 42547 |
| 1014 | Ga0496112_0337142 | 3300048915 | Bacteria | 1451 |
| 1015 | Ga0496112_0412413 | 3300048915 | Bacteria | 1290 |
| 1016 | Ga0496112_0443375 | 3300048915 | Bacteria | 1236 |
| 1017 | Ga0496112_0496972 | 3300048915 | Bacteria | 1155 |
| 1018 | Ga0496112_0751517 | 3300048915 | Bacteria | 901 |
| 1019 | Ga0496113_0051315 | 3300048916 | Bacteria | 3078 |
| 1020 | Ga0496113_0054954 | 3300048916 | Bacteria | 2983 |
| 1021 | Ga0496113_0381641 | 3300048916 | Bacteria | 1131 |
| 1022 | Ga0496113_0710750 | 3300048916 | Bacteria | 801 |
| 1023 | Ga0496114_0088480 | 3300048917 | Bacteria | 2627 |
| 1024 | Ga0496114_0242525 | 3300048917 | Bacteria | 1585 |
| 1025 | Ga0496114_0286236 | 3300048917 | Bacteria | 1454 |
| 1026 | Ga0496114_0681767 | 3300048917 | Bacteria | 902 |
| 1027 | Ga0496115_0106658 | 3300048918 | Bacteria | 2300 |
| 1028 | Ga0496115_0136170 | 3300048918 | Bacteria | 2025 |
| 1029 | Ga0496115_0353438 | 3300048918 | Bacteria | 1198 |
| 1030 | Ga0496119_0083288 | 3300048922 | Bacteria | 1837 |
| 1031 | Ga0496126_0007772 | 3300048929 | Bacteria | 11685 |
| 1032 | Ga0496126_0337260 | 3300048929 | Bacteria | 1236 |
| 1033 | Ga0501031_0066544 | 3300049568 | Bacteria | 2348 |
| 1034 | Ga0501032_0142716 | 3300049569 | Bacteria | 1577 |
| 1035 | Ga0501033_0123128 | 3300049570 | Bacteria | 1881 |
| 1036 | Ga0501033_0299190 | 3300049570 | Bacteria | 1133 |
| 1037 | Ga0501036_0012617 | 3300049572 | Bacteria | 7009 |
| 1038 | Ga0501036_0031750 | 3300049572 | Bacteria | 4463 |
| 1039 | Ga0501036_0419841 | 3300049572 | Bacteria | 1115 |
| 1040 | Ga0501038_0055593 | 3300049574 | Bacteria | 3400 |
| 1041 | Ga0501039_0023712 | 3300049575 | Bacteria | 4710 |
| 1042 | Ga0501039_0183281 | 3300049575 | Bacteria | 1646 |
| 1043 | Ga0501039_0579009 | 3300049575 | Bacteria | 880 |
| 1044 | Ga0501040_0005034 | 3300049576 | Bacteria | 8539 |
| 1045 | Ga0501042_0016519 | 3300049578 | Bacteria | 5068 |
| 1046 | Ga0501042_0053553 | 3300049578 | Bacteria | 2879 |
| 1047 | Ga0501043_0238103 | 3300049579 | Bacteria | 1404 |
| 1048 | Ga0501046_0064009 | 3300049580 | Bacteria | 2871 |
| 1049 | Ga0501047_0024344 | 3300049581 | Bacteria | 5812 |
| 1050 | Ga0501048_0006698 | 3300049582 | Bacteria | 8751 |
| 1051 | Ga0501067_0002370 | 3300049583 | Bacteria | 10435 |
| 1052 | Ga0501067_0217319 | 3300049583 | Bacteria | 1064 |
| 1053 | Ga0501068_0246065 | 3300049584 | Bacteria | 1139 |
| 1054 | Ga0501068_0396983 | 3300049584 | Bacteria | 889 |
| 1055 | Ga0501070_0038435 | 3300049586 | Bacteria | 3993 |
| 1056 | Ga0501071_0004689 | 3300049587 | Bacteria | 8689 |
| 1057 | Ga0501072_0006738 | 3300049588 | Bacteria | 8728 |
| 1058 | Ga0501074_0141438 | 3300049590 | Bacteria | 1721 |
| 1059 | Ga0501076_0038370 | 3300049592 | Bacteria | 3761 |
| 1060 | Ga0501076_0221856 | 3300049592 | Bacteria | 1545 |
| 1061 | Ga0501077_0125451 | 3300049593 | Bacteria | 1627 |
| 1062 | Ga0501079_0024703 | 3300049741 | Bacteria | 4611 |
| 1063 | Ga0501079_0162120 | 3300049741 | Bacteria | 1744 |
| 1064 | Ga0501080_0028140 | 3300049742 | Bacteria | 5226 |
| 1065 | Ga0501080_0044011 | 3300049742 | Bacteria | 4157 |
| 1066 | Ga0501080_0268637 | 3300049742 | Bacteria | 1553 |
| 1067 | Ga0501081_0156214 | 3300049743 | Bacteria | 1641 |
| 1068 | Ga0501081_0443958 | 3300049743 | Bacteria | 963 |
| 1069 | Ga0501035_0036768 | 3300049822 | Bacteria | 4436 |
| 1070 | Ga0501044_0034810 | 3300049823 | Bacteria | 5279 |
| 1071 | Ga0501045_0053012 | 3300049824 | Bacteria | 2963 |
| 1072 | nmdc:mga06r32_562659_c1 | 3300050510 | Bacteria | 1113 |
| 1073 | nmdc:mga06r32_99194_c1 | 3300050510 | Bacteria | 2856 |
| 1074 | nmdc:mga08y16_1241598_c1 | 3300050511 | Bacteria | 714 |
| 1075 | nmdc:mga08y16_14122_c1 | 3300050511 | Bacteria | 8408 |
| 1076 | nmdc:mga08y16_24926_c1 | 3300050511 | Bacteria | 6309 |
| 1077 | nmdc:mga08y16_51474_c1 | 3300050511 | Bacteria | 4309 |
| 1078 | nmdc:mga0rr50_145490_c1 | 3300050513 | Bacteria | 1911 |
| 1079 | nmdc:mga0rr50_316648_c1 | 3300050513 | Bacteria | 1307 |
| 1080 | nmdc:mga0a205_30845_c1 | 3300050515 | Bacteria | 5135 |
| 1081 | Ga0495601_0085937 | 3300053077 | Bacteria | 2021 |
| 1082 | Ga0495601_0144616 | 3300053077 | Bacteria | 1552 |
| 1083 | Ga0495612_0014977 | 3300053078 | Bacteria | 3110 |
| 1084 | Ga0495612_0130935 | 3300053078 | Bacteria | 1083 |
| 1085 | Ga0495595_0000162 | 3300053084 | Bacteria | 26749 |
| 1086 | Ga0495595_0004135 | 3300053084 | Bacteria | 5826 |
| 1087 | Ga0495595_0019979 | 3300053084 | Bacteria | 2911 |
| 1088 | Ga0495595_0032891 | 3300053084 | Bacteria | 2337 |
| 1089 | Ga0495595_0154657 | 3300053084 | Bacteria | 1129 |
| 1090 | Ga0495619_0003428 | 3300053085 | Bacteria | 10234 |
| 1091 | Ga0495619_0256704 | 3300053085 | Bacteria | 1211 |
| 1092 | Ga0495619_0316284 | 3300053085 | Bacteria | 1081 |
| 1093 | Ga0495619_0338068 | 3300053085 | Bacteria | 1042 |
| 1094 | Ga0500651_0084308 | 3300053093 | Bacteria | 1965 |
| 1095 | Ga0500650_0115430 | 3300053098 | Bacteria | 1253 |
| 1096 | Ga0500569_024140 | 3300053109 | Bacteria | 1642 |
| 1097 | Ga0500594_0077090 | 3300053118 | Bacteria | 990 |
| 1098 | Ga0500652_004451 | 3300053131 | Bacteria | 4341 |
| 1099 | Ga0500611_097349 | 3300053727 | Bacteria | 757 |
| 1100 | Ga0501084_0052825 | 3300054114 | Bacteria | 3399 |
| 1101 | Ga0501082_0042883 | 3300060353 | Bacteria | 3899 |
| 1102 | Ga0501082_0448009 | 3300060353 | Bacteria | 1128 |
| 1103 | Ga0466962_0035909 | 3300061719 | Bacteria | 2372 |
| 1104 | Ga0530510_0018293 | 3300061734 | Bacteria | 4968 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300036401 | Ga0373937_0243235 | Ga0373937_0243235_37_624 | 184 |
| 2 | 3300047471 | Ga0495684_0205211 | Ga0495684_0205211_10_597 | 184 |
| 3 | 3300005356 | Ga0070674_100922664 | Ga0070674_1009226641 | 201 |
| 4 | 3300005467 | Ga0070706_100005036 | Ga0070706_1000050363 | 203 |
| 5 | 3300005467 | Ga0070706_100631577 | Ga0070706_1006315772 | 203 |
| 6 | 3300005468 | Ga0070707_100045292 | Ga0070707_1000452922 | 203 |
| 7 | 3300005471 | Ga0070698_100038643 | Ga0070698_1000386432 | 203 |
| 8 | 3300005518 | Ga0070699_100002101 | Ga0070699_1000021018 | 203 |
| 9 | 3300005518 | Ga0070699_100068500 | Ga0070699_1000685002 | 203 |
| 10 | 3300005536 | Ga0070697_100061101 | Ga0070697_1000611012 | 203 |
| 11 | 3300006028 | Ga0070717_10007804 | Ga0070717_100078042 | 203 |
| 12 | 3300006028 | Ga0070717_10052576 | Ga0070717_100525762 | 203 |
| 13 | 3300025910 | Ga0207684_10004377 | Ga0207684_100043772 | 203 |
| 14 | 3300025910 | Ga0207684_10027199 | Ga0207684_100271992 | 203 |
| 15 | 3300025922 | Ga0207646_10003277 | Ga0207646_100032776 | 203 |
| 16 | 3300025922 | Ga0207646_10006902 | Ga0207646_100069024 | 203 |
| 17 | 3300006847 | Ga0075431_100075900 | Ga0075431_1000759002 | 205 |
| 18 | 3300050510 | nmdc:mga06r32_562659_c1 | nmdc:mga06r32_562659_c1_211_891 | 205 |
| 19 | 3300031691 | Ga0316579_10050303 | Ga0316579_100503031 | 209 |
| 20 | 3300031733 | Ga0316577_10042918 | Ga0316577_100429182 | 209 |
| 21 | 3300036712 | Ga0316584_0019297 | Ga0316584_0019297_2881_3600 | 209 |
| 22 | 3300037588 | Ga0316581_0039286 | Ga0316581_0039286_395_1114 | 209 |
| 23 | 3300020070 | Ga0206356_10064106 | Ga0206356_100641061 | 210 |
| 24 | 3300048929 | Ga0496126_0337260 | Ga0496126_0337260_451_1125 | 211 |
| 25 | 3300049592 | Ga0501076_0221856 | Ga0501076_0221856_412_1104 | 213 |
| 26 | 3300005518 | Ga0070699_100529912 | Ga0070699_1005299122 | 214 |
| 27 | 3300061719 | Ga0466962_0035909 | Ga0466962_0035909_232_945 | 215 |
| 28 | 3300005467 | Ga0070706_100006933 | Ga0070706_1000069339 | 219 |
| 29 | 3300005468 | Ga0070707_100000792 | Ga0070707_10000079217 | 219 |
| 30 | 3300006028 | Ga0070717_10119623 | Ga0070717_101196232 | 219 |
| 31 | 3300025910 | Ga0207684_10098696 | Ga0207684_100986962 | 219 |
| 32 | 3300025922 | Ga0207646_10001043 | Ga0207646_100010434 | 219 |
| 33 | 3300025922 | Ga0207646_10175844 | Ga0207646_101758442 | 219 |
| 34 | 3300025922 | Ga0207646_10378277 | Ga0207646_103782771 | 219 |
| 35 | 3300037853 | Ga0436364_0115602 | Ga0436364_0115602_1539_2207 | 219 |
| 36 | iso_pu_bacteria | 2946003308 | 2946005680 | 219 |
| 37 | 3300005564 | Ga0070664_100355724 | Ga0070664_1003557242 | 220 |
| 38 | 3300005618 | Ga0068864_100012042 | Ga0068864_1000120423 | 220 |
| 39 | 3300005841 | Ga0068863_100092777 | Ga0068863_1000927773 | 220 |
| 40 | 3300006163 | Ga0070715_10179863 | Ga0070715_101798632 | 220 |
| 41 | 3300009177 | Ga0105248_10109534 | Ga0105248_101095342 | 220 |
| 42 | 3300014968 | Ga0157379_10187756 | Ga0157379_101877562 | 220 |
| 43 | 3300025941 | Ga0207711_10157543 | Ga0207711_101575432 | 220 |
| 44 | 3300025945 | Ga0207679_10083461 | Ga0207679_100834612 | 220 |
| 45 | 3300026116 | Ga0207674_10330823 | Ga0207674_103308232 | 220 |
| 46 | 3300028381 | Ga0268264_10147125 | Ga0268264_101471252 | 220 |
| 47 | 3300037068 | Ga0373925_0475917 | Ga0373925_0475917_197_862 | 220 |
| 48 | 3300037418 | Ga0395900_0407298 | Ga0395900_0407298_267_932 | 220 |
| 49 | 3300037466 | Ga0395898_0150625 | Ga0395898_0150625_937_1602 | 220 |
| 50 | 3300038443 | Ga0395901_0059328 | Ga0395901_0059328_1080_1745 | 220 |
| 51 | 3300044684 | Ga0466966_0085720 | Ga0466966_0085720_808_1470 | 220 |
| 52 | 3300045049 | Ga0466959_0020862 | Ga0466959_0020862_2045_2707 | 220 |
| 53 | 3300046517 | Ga0495630_0283839 | Ga0495630_0283839_498_1163 | 220 |
| 54 | 3300047673 | Ga0495593_0045862 | Ga0495593_0045862_687_1352 | 220 |
| 55 | 3300048907 | Ga0496104_0007235 | Ga0496104_0007235_7760_8425 | 220 |
| 56 | 3300048908 | Ga0496105_0031146 | Ga0496105_0031146_2271_2936 | 220 |
| 57 | 3300048911 | Ga0496108_0018581 | Ga0496108_0018581_2640_3305 | 220 |
| 58 | 3300048912 | Ga0496109_0110366 | Ga0496109_0110366_1309_1974 | 220 |
| 59 | 3300048913 | Ga0496110_0059346 | Ga0496110_0059346_2335_3000 | 220 |
| 60 | 3300048915 | Ga0496112_0443375 | Ga0496112_0443375_251_916 | 220 |
| 61 | iso_pu_bacteria | 2622736605 | 2623499272 | 220 |
| 62 | iso_pu_bacteria | 2904479285 | 2904482173 | 220 |
| 63 | 3300005467 | Ga0070706_100007675 | Ga0070706_1000076753 | 221 |
| 64 | 3300005468 | Ga0070707_100121840 | Ga0070707_1001218402 | 221 |
| 65 | 3300005471 | Ga0070698_100222699 | Ga0070698_1002226991 | 221 |
| 66 | 3300006028 | Ga0070717_10514079 | Ga0070717_105140792 | 221 |
| 67 | 3300025910 | Ga0207684_10011882 | Ga0207684_100118823 | 221 |
| 68 | 3300025922 | Ga0207646_10112799 | Ga0207646_101127992 | 221 |
| 69 | 3300049578 | Ga0501042_0053553 | Ga0501042_0053553_2131_2835 | 221 |
| 70 | 3300005327 | Ga0070658_10006845 | Ga0070658_100068458 | 222 |
| 71 | 3300005329 | Ga0070683_100144915 | Ga0070683_1001449152 | 222 |
| 72 | 3300005337 | Ga0070682_100576076 | Ga0070682_1005760762 | 222 |
| 73 | 3300005341 | Ga0070691_10024889 | Ga0070691_100248892 | 222 |
| 74 | 3300005344 | Ga0070661_100085981 | Ga0070661_1000859812 | 222 |
| 75 | 3300005345 | Ga0070692_10146692 | Ga0070692_101466922 | 222 |
| 76 | 3300005366 | Ga0070659_100112961 | Ga0070659_1001129614 | 222 |
| 77 | 3300005467 | Ga0070706_100001048 | Ga0070706_10000104822 | 222 |
| 78 | 3300005468 | Ga0070707_100120283 | Ga0070707_1001202832 | 222 |
| 79 | 3300005471 | Ga0070698_100006771 | Ga0070698_1000067719 | 222 |
| 80 | 3300005518 | Ga0070699_100703631 | Ga0070699_1007036311 | 222 |
| 81 | 3300005530 | Ga0070679_100008909 | Ga0070679_1000089095 | 222 |
| 82 | 3300005530 | Ga0070679_100031308 | Ga0070679_1000313084 | 222 |
| 83 | 3300005535 | Ga0070684_100880707 | Ga0070684_1008807071 | 222 |
| 84 | 3300005577 | Ga0068857_100004338 | Ga0068857_1000043382 | 222 |
| 85 | 3300009093 | Ga0105240_10609138 | Ga0105240_106091382 | 222 |
| 86 | 3300013104 | Ga0157370_10170964 | Ga0157370_101709644 | 222 |
| 87 | 3300013105 | Ga0157369_10009643 | Ga0157369_1000964314 | 222 |
| 88 | 3300020070 | Ga0206356_10374739 | Ga0206356_103747392 | 222 |
| 89 | 3300020082 | Ga0206353_10680297 | Ga0206353_106802972 | 222 |
| 90 | 3300022467 | Ga0224712_10210403 | Ga0224712_102104031 | 222 |
| 91 | 3300025906 | Ga0207699_10300896 | Ga0207699_103008962 | 222 |
| 92 | 3300025909 | Ga0207705_10020113 | Ga0207705_100201134 | 222 |
| 93 | 3300025910 | Ga0207684_10002703 | Ga0207684_100027034 | 222 |
| 94 | 3300025920 | Ga0207649_10165670 | Ga0207649_101656702 | 222 |
| 95 | 3300025921 | Ga0207652_10016769 | Ga0207652_100167694 | 222 |
| 96 | 3300025921 | Ga0207652_10341302 | Ga0207652_103413021 | 222 |
| 97 | 3300025922 | Ga0207646_10108168 | Ga0207646_101081682 | 222 |
| 98 | 3300025928 | Ga0207700_10413001 | Ga0207700_104130012 | 222 |
| 99 | 3300026078 | Ga0207702_10406511 | Ga0207702_104065112 | 222 |
| 100 | 3300026116 | Ga0207674_10003072 | Ga0207674_100030725 | 222 |
| 101 | 3300026116 | Ga0207674_10021296 | Ga0207674_100212964 | 222 |
| 102 | 3300031995 | Ga0307409_100984808 | Ga0307409_1009848082 | 222 |
| 103 | 3300048915 | Ga0496112_0496972 | Ga0496112_0496972_390_1067 | 222 |
| 104 | 3300048917 | Ga0496114_0088480 | Ga0496114_0088480_1510_2199 | 222 |
| 105 | iso_pu_bacteria | 2558860112 | 2558910879 | 222 |
| 106 | 3300005328 | Ga0070676_10104111 | Ga0070676_101041112 | 223 |
| 107 | 3300005329 | Ga0070683_100004571 | Ga0070683_1000045714 | 223 |
| 108 | 3300005329 | Ga0070683_100127961 | Ga0070683_1001279612 | 223 |
| 109 | 3300005334 | Ga0068869_100018522 | Ga0068869_1000185223 | 223 |
| 110 | 3300005338 | Ga0068868_100004265 | Ga0068868_1000042657 | 223 |
| 111 | 3300005339 | Ga0070660_100027145 | Ga0070660_1000271452 | 223 |
| 112 | 3300005353 | Ga0070669_100350604 | Ga0070669_1003506042 | 223 |
| 113 | 3300005354 | Ga0070675_100002740 | Ga0070675_1000027409 | 223 |
| 114 | 3300005441 | Ga0070700_100033665 | Ga0070700_1000336653 | 223 |
| 115 | 3300005455 | Ga0070663_100085492 | Ga0070663_1000854921 | 223 |
| 116 | 3300005456 | Ga0070678_100015224 | Ga0070678_1000152245 | 223 |
| 117 | 3300005471 | Ga0070698_100322806 | Ga0070698_1003228062 | 223 |
| 118 | 3300005530 | Ga0070679_100745761 | Ga0070679_1007457611 | 223 |
| 119 | 3300005564 | Ga0070664_100009193 | Ga0070664_1000091932 | 223 |
| 120 | 3300005615 | Ga0070702_100017373 | Ga0070702_1000173732 | 223 |
| 121 | 3300005618 | Ga0068864_101067031 | Ga0068864_1010670311 | 223 |
| 122 | 3300005843 | Ga0068860_100269611 | Ga0068860_1002696112 | 223 |
| 123 | 3300005844 | Ga0068862_100227134 | Ga0068862_1002271342 | 223 |
| 124 | 3300005985 | Ga0081539_10003383 | Ga0081539_1000338313 | 223 |
| 125 | 3300005985 | Ga0081539_10010664 | Ga0081539_100106641 | 223 |
| 126 | 3300005985 | Ga0081539_10027830 | Ga0081539_100278301 | 223 |
| 127 | 3300005985 | Ga0081539_10176204 | Ga0081539_101762041 | 223 |
| 128 | 3300006847 | Ga0075431_100073239 | Ga0075431_1000732393 | 223 |
| 129 | 3300009094 | Ga0111539_10001402 | Ga0111539_1000140216 | 223 |
| 130 | 3300009098 | Ga0105245_10500369 | Ga0105245_105003692 | 223 |
| 131 | 3300009148 | Ga0105243_10150131 | Ga0105243_101501312 | 223 |
| 132 | 3300009176 | Ga0105242_11072563 | Ga0105242_110725631 | 223 |
| 133 | 3300009551 | Ga0105238_10119356 | Ga0105238_101193562 | 223 |
| 134 | 3300009553 | Ga0105249_10697895 | Ga0105249_106978951 | 223 |
| 135 | 3300010375 | Ga0105239_10201441 | Ga0105239_102014412 | 223 |
| 136 | 3300014745 | Ga0157377_10001840 | Ga0157377_100018402 | 223 |
| 137 | 3300021388 | Ga0213875_10045485 | Ga0213875_100454852 | 223 |
| 138 | 3300025907 | Ga0207645_10094505 | Ga0207645_100945052 | 223 |
| 139 | 3300025917 | Ga0207660_10492199 | Ga0207660_104921991 | 223 |
| 140 | 3300025919 | Ga0207657_10735171 | Ga0207657_107351711 | 223 |
| 141 | 3300025924 | Ga0207694_10266117 | Ga0207694_102661172 | 223 |
| 142 | 3300025925 | Ga0207650_10781202 | Ga0207650_107812021 | 223 |
| 143 | 3300025926 | Ga0207659_10004462 | Ga0207659_100044622 | 223 |
| 144 | 3300025927 | Ga0207687_10117011 | Ga0207687_101170111 | 223 |
| 145 | 3300025931 | Ga0207644_10704144 | Ga0207644_107041441 | 223 |
| 146 | 3300025933 | Ga0207706_10188207 | Ga0207706_101882072 | 223 |
| 147 | 3300025935 | Ga0207709_10040829 | Ga0207709_100408292 | 223 |
| 148 | 3300025940 | Ga0207691_10648383 | Ga0207691_106483832 | 223 |
| 149 | 3300025942 | Ga0207689_10028926 | Ga0207689_100289263 | 223 |
| 150 | 3300025944 | Ga0207661_10298439 | Ga0207661_102984392 | 223 |
| 151 | 3300025945 | Ga0207679_10059848 | Ga0207679_100598482 | 223 |
| 152 | 3300025961 | Ga0207712_10455059 | Ga0207712_104550591 | 223 |
| 153 | 3300026023 | Ga0207677_10153779 | Ga0207677_101537792 | 223 |
| 154 | 3300026067 | Ga0207678_10112010 | Ga0207678_101120103 | 223 |
| 155 | 3300026075 | Ga0207708_10047624 | Ga0207708_100476242 | 223 |
| 156 | 3300027907 | Ga0207428_10018301 | Ga0207428_100183012 | 223 |
| 157 | 3300028381 | Ga0268264_10223668 | Ga0268264_102236682 | 223 |
| 158 | 3300028794 | Ga0307515_10014744 | Ga0307515_100147447 | 223 |
| 159 | 3300028794 | Ga0307515_10030070 | Ga0307515_100300707 | 223 |
| 160 | 3300030522 | Ga0307512_10007084 | Ga0307512_1000708411 | 223 |
| 161 | 3300030522 | Ga0307512_10027813 | Ga0307512_100278132 | 223 |
| 162 | 3300031456 | Ga0307513_10047902 | Ga0307513_100479023 | 223 |
| 163 | 3300031456 | Ga0307513_10265934 | Ga0307513_102659342 | 223 |
| 164 | 3300031616 | Ga0307508_10086037 | Ga0307508_100860372 | 223 |
| 165 | 3300031730 | Ga0307516_10034399 | Ga0307516_100343994 | 223 |
| 166 | 3300031824 | Ga0307413_10312890 | Ga0307413_103128901 | 223 |
| 167 | 3300033179 | Ga0307507_10147119 | Ga0307507_101471191 | 223 |
| 168 | 3300035091 | Ga0373951_0000271 | Ga0373951_0000271_3278_3958 | 223 |
| 169 | 3300037466 | Ga0395898_0974500 | Ga0395898_0974500_45_719 | 223 |
| 170 | 3300037853 | Ga0436364_0361850 | Ga0436364_0361850_2616_3290 | 223 |
| 171 | 3300044706 | Ga0466964_0222376 | Ga0466964_0222376_74_745 | 223 |
| 172 | 3300045976 | Ga0466967_0015004 | Ga0466967_0015004_3503_4174 | 223 |
| 173 | 3300045976 | Ga0466967_0044615 | Ga0466967_0044615_2097_2771 | 223 |
| 174 | 3300046642 | Ga0495634_0245119 | Ga0495634_0245119_313_1014 | 223 |
| 175 | 3300049741 | Ga0501079_0162120 | Ga0501079_0162120_966_1643 | 223 |
| 176 | 3300049742 | Ga0501080_0044011 | Ga0501080_0044011_324_1001 | 223 |
| 177 | 3300049743 | Ga0501081_0443958 | Ga0501081_0443958_160_840 | 223 |
| 178 | 3300050510 | nmdc:mga06r32_99194_c1 | nmdc:mga06r32_99194_c1_1869_2558 | 223 |
| 179 | 3300050511 | nmdc:mga08y16_14122_c1 | nmdc:mga08y16_14122_c1_4505_5179 | 223 |
| 180 | 3300053093 | Ga0500651_0084308 | Ga0500651_0084308_1248_1922 | 223 |
| 181 | 3300053098 | Ga0500650_0115430 | Ga0500650_0115430_223_897 | 223 |
| 182 | 3300053109 | Ga0500569_024140 | Ga0500569_024140_122_796 | 223 |
| 183 | 3300053118 | Ga0500594_0077090 | Ga0500594_0077090_68_742 | 223 |
| 184 | 3300053131 | Ga0500652_004451 | Ga0500652_004451_2780_3454 | 223 |
| 185 | 3300053727 | Ga0500611_097349 | Ga0500611_097349_16_690 | 223 |
| 186 | 3300003203 | JGI25406J46586_10006130 | JGI25406J46586_100061303 | 224 |
| 187 | 3300005327 | Ga0070658_10064156 | Ga0070658_100641562 | 224 |
| 188 | 3300005327 | Ga0070658_10257089 | Ga0070658_102570891 | 224 |
| 189 | 3300005329 | Ga0070683_100113133 | Ga0070683_1001131332 | 224 |
| 190 | 3300005329 | Ga0070683_100153307 | Ga0070683_1001533072 | 224 |
| 191 | 3300005329 | Ga0070683_100167567 | Ga0070683_1001675672 | 224 |
| 192 | 3300005329 | Ga0070683_100232294 | Ga0070683_1002322942 | 224 |
| 193 | 3300005339 | Ga0070660_100129995 | Ga0070660_1001299952 | 224 |
| 194 | 3300005340 | Ga0070689_100408094 | Ga0070689_1004080941 | 224 |
| 195 | 3300005341 | Ga0070691_10101628 | Ga0070691_101016282 | 224 |
| 196 | 3300005344 | Ga0070661_100457680 | Ga0070661_1004576801 | 224 |
| 197 | 3300005344 | Ga0070661_100499430 | Ga0070661_1004994301 | 224 |
| 198 | 3300005354 | Ga0070675_100080840 | Ga0070675_1000808403 | 224 |
| 199 | 3300005354 | Ga0070675_100450683 | Ga0070675_1004506832 | 224 |
| 200 | 3300005356 | Ga0070674_100260495 | Ga0070674_1002604952 | 224 |
| 201 | 3300005364 | Ga0070673_100117165 | Ga0070673_1001171651 | 224 |
| 202 | 3300005366 | Ga0070659_100037838 | Ga0070659_1000378381 | 224 |
| 203 | 3300005434 | Ga0070709_10003021 | Ga0070709_100030219 | 224 |
| 204 | 3300005434 | Ga0070709_10028678 | Ga0070709_100286783 | 224 |
| 205 | 3300005434 | Ga0070709_10039282 | Ga0070709_100392822 | 224 |
| 206 | 3300005434 | Ga0070709_10040725 | Ga0070709_100407252 | 224 |
| 207 | 3300005434 | Ga0070709_10067334 | Ga0070709_100673342 | 224 |
| 208 | 3300005434 | Ga0070709_10112358 | Ga0070709_101123582 | 224 |
| 209 | 3300005435 | Ga0070714_100001028 | Ga0070714_1000010286 | 224 |
| 210 | 3300005435 | Ga0070714_100005940 | Ga0070714_1000059403 | 224 |
| 211 | 3300005435 | Ga0070714_100005955 | Ga0070714_1000059558 | 224 |
| 212 | 3300005435 | Ga0070714_100082551 | Ga0070714_1000825512 | 224 |
| 213 | 3300005435 | Ga0070714_100083836 | Ga0070714_1000838362 | 224 |
| 214 | 3300005435 | Ga0070714_100276806 | Ga0070714_1002768062 | 224 |
| 215 | 3300005436 | Ga0070713_100007261 | Ga0070713_1000072616 | 224 |
| 216 | 3300005436 | Ga0070713_100010227 | Ga0070713_1000102273 | 224 |
| 217 | 3300005436 | Ga0070713_100024420 | Ga0070713_1000244202 | 224 |
| 218 | 3300005436 | Ga0070713_100065592 | Ga0070713_1000655922 | 224 |
| 219 | 3300005436 | Ga0070713_100147037 | Ga0070713_1001470373 | 224 |
| 220 | 3300005436 | Ga0070713_100280114 | Ga0070713_1002801142 | 224 |
| 221 | 3300005436 | Ga0070713_100292505 | Ga0070713_1002925051 | 224 |
| 222 | 3300005436 | Ga0070713_100330256 | Ga0070713_1003302562 | 224 |
| 223 | 3300005437 | Ga0070710_10008259 | Ga0070710_100082592 | 224 |
| 224 | 3300005437 | Ga0070710_10018475 | Ga0070710_100184753 | 224 |
| 225 | 3300005437 | Ga0070710_10082483 | Ga0070710_100824831 | 224 |
| 226 | 3300005437 | Ga0070710_10088860 | Ga0070710_100888602 | 224 |
| 227 | 3300005437 | Ga0070710_10184202 | Ga0070710_101842022 | 224 |
| 228 | 3300005438 | Ga0070701_10025713 | Ga0070701_100257132 | 224 |
| 229 | 3300005439 | Ga0070711_100021021 | Ga0070711_1000210212 | 224 |
| 230 | 3300005439 | Ga0070711_100032826 | Ga0070711_1000328263 | 224 |
| 231 | 3300005439 | Ga0070711_100043948 | Ga0070711_1000439482 | 224 |
| 232 | 3300005440 | Ga0070705_100076262 | Ga0070705_1000762622 | 224 |
| 233 | 3300005440 | Ga0070705_100123531 | Ga0070705_1001235312 | 224 |
| 234 | 3300005445 | Ga0070708_100534018 | Ga0070708_1005340181 | 224 |
| 235 | 3300005455 | Ga0070663_100026326 | Ga0070663_1000263265 | 224 |
| 236 | 3300005456 | Ga0070678_100096045 | Ga0070678_1000960452 | 224 |
| 237 | 3300005458 | Ga0070681_10009600 | Ga0070681_100096002 | 224 |
| 238 | 3300005458 | Ga0070681_10313312 | Ga0070681_103133123 | 224 |
| 239 | 3300005458 | Ga0070681_10419697 | Ga0070681_104196972 | 224 |
| 240 | 3300005466 | Ga0070685_10043361 | Ga0070685_100433612 | 224 |
| 241 | 3300005467 | Ga0070706_100003836 | Ga0070706_1000038365 | 224 |
| 242 | 3300005467 | Ga0070706_100079469 | Ga0070706_1000794693 | 224 |
| 243 | 3300005467 | Ga0070706_100088284 | Ga0070706_1000882842 | 224 |
| 244 | 3300005467 | Ga0070706_100208006 | Ga0070706_1002080063 | 224 |
| 245 | 3300005467 | Ga0070706_100906047 | Ga0070706_1009060471 | 224 |
| 246 | 3300005468 | Ga0070707_100023200 | Ga0070707_1000232002 | 224 |
| 247 | 3300005468 | Ga0070707_100029054 | Ga0070707_1000290543 | 224 |
| 248 | 3300005468 | Ga0070707_100035864 | Ga0070707_1000358642 | 224 |
| 249 | 3300005468 | Ga0070707_100233253 | Ga0070707_1002332532 | 224 |
| 250 | 3300005468 | Ga0070707_100372866 | Ga0070707_1003728662 | 224 |
| 251 | 3300005471 | Ga0070698_100008876 | Ga0070698_10000887611 | 224 |
| 252 | 3300005471 | Ga0070698_100011521 | Ga0070698_1000115212 | 224 |
| 253 | 3300005471 | Ga0070698_100037550 | Ga0070698_1000375503 | 224 |
| 254 | 3300005471 | Ga0070698_100076311 | Ga0070698_1000763112 | 224 |
| 255 | 3300005471 | Ga0070698_100077164 | Ga0070698_1000771642 | 224 |
| 256 | 3300005471 | Ga0070698_100118694 | Ga0070698_1001186942 | 224 |
| 257 | 3300005518 | Ga0070699_100001575 | Ga0070699_10000157515 | 224 |
| 258 | 3300005518 | Ga0070699_100321845 | Ga0070699_1003218452 | 224 |
| 259 | 3300005530 | Ga0070679_100003755 | Ga0070679_1000037554 | 224 |
| 260 | 3300005530 | Ga0070679_100873675 | Ga0070679_1008736751 | 224 |
| 261 | 3300005535 | Ga0070684_100019147 | Ga0070684_1000191474 | 224 |
| 262 | 3300005535 | Ga0070684_100230379 | Ga0070684_1002303791 | 224 |
| 263 | 3300005536 | Ga0070697_100010976 | Ga0070697_1000109763 | 224 |
| 264 | 3300005539 | Ga0068853_100163892 | Ga0068853_1001638921 | 224 |
| 265 | 3300005544 | Ga0070686_100020181 | Ga0070686_1000201812 | 224 |
| 266 | 3300005545 | Ga0070695_100099157 | Ga0070695_1000991572 | 224 |
| 267 | 3300005546 | Ga0070696_100103024 | Ga0070696_1001030242 | 224 |
| 268 | 3300005547 | Ga0070693_100050430 | Ga0070693_1000504302 | 224 |
| 269 | 3300005547 | Ga0070693_100152791 | Ga0070693_1001527911 | 224 |
| 270 | 3300005548 | Ga0070665_100054642 | Ga0070665_1000546425 | 224 |
| 271 | 3300005548 | Ga0070665_100589065 | Ga0070665_1005890652 | 224 |
| 272 | 3300005563 | Ga0068855_100058270 | Ga0068855_1000582703 | 224 |
| 273 | 3300005563 | Ga0068855_100097460 | Ga0068855_1000974602 | 224 |
| 274 | 3300005564 | Ga0070664_100299231 | Ga0070664_1002992311 | 224 |
| 275 | 3300005577 | Ga0068857_100045347 | Ga0068857_1000453473 | 224 |
| 276 | 3300005577 | Ga0068857_100073149 | Ga0068857_1000731492 | 224 |
| 277 | 3300005577 | Ga0068857_100497630 | Ga0068857_1004976302 | 224 |
| 278 | 3300005578 | Ga0068854_100028924 | Ga0068854_1000289241 | 224 |
| 279 | 3300005614 | Ga0068856_100108541 | Ga0068856_1001085412 | 224 |
| 280 | 3300005617 | Ga0068859_100041006 | Ga0068859_1000410063 | 224 |
| 281 | 3300005618 | Ga0068864_100645846 | Ga0068864_1006458462 | 224 |
| 282 | 3300005718 | Ga0068866_10071920 | Ga0068866_100719202 | 224 |
| 283 | 3300005842 | Ga0068858_100070389 | Ga0068858_1000703892 | 224 |
| 284 | 3300005843 | Ga0068860_100152796 | Ga0068860_1001527962 | 224 |
| 285 | 3300005843 | Ga0068860_100231940 | Ga0068860_1002319402 | 224 |
| 286 | 3300005843 | Ga0068860_100740566 | Ga0068860_1007405661 | 224 |
| 287 | 3300005844 | Ga0068862_100252439 | Ga0068862_1002524391 | 224 |
| 288 | 3300005983 | Ga0081540_1000345 | Ga0081540_10003456 | 224 |
| 289 | 3300005983 | Ga0081540_1001308 | Ga0081540_100130813 | 224 |
| 290 | 3300005985 | Ga0081539_10005543 | Ga0081539_100055434 | 224 |
| 291 | 3300005985 | Ga0081539_10027029 | Ga0081539_100270292 | 224 |
| 292 | 3300006028 | Ga0070717_10018129 | Ga0070717_100181296 | 224 |
| 293 | 3300006028 | Ga0070717_10046161 | Ga0070717_100461612 | 224 |
| 294 | 3300006028 | Ga0070717_10058504 | Ga0070717_100585042 | 224 |
| 295 | 3300006028 | Ga0070717_10368294 | Ga0070717_103682942 | 224 |
| 296 | 3300006028 | Ga0070717_10624459 | Ga0070717_106244592 | 224 |
| 297 | 3300006163 | Ga0070715_10001476 | Ga0070715_100014762 | 224 |
| 298 | 3300006163 | Ga0070715_10050842 | Ga0070715_100508422 | 224 |
| 299 | 3300006173 | Ga0070716_100001463 | Ga0070716_10000146311 | 224 |
| 300 | 3300006173 | Ga0070716_100019289 | Ga0070716_1000192892 | 224 |
| 301 | 3300006173 | Ga0070716_100076159 | Ga0070716_1000761592 | 224 |
| 302 | 3300006175 | Ga0070712_100071500 | Ga0070712_1000715002 | 224 |
| 303 | 3300006175 | Ga0070712_100260485 | Ga0070712_1002604852 | 224 |
| 304 | 3300006175 | Ga0070712_100266517 | Ga0070712_1002665172 | 224 |
| 305 | 3300006237 | Ga0097621_100215728 | Ga0097621_1002157282 | 224 |
| 306 | 3300006237 | Ga0097621_100311445 | Ga0097621_1003114452 | 224 |
| 307 | 3300006847 | Ga0075431_100106830 | Ga0075431_1001068302 | 224 |
| 308 | 3300006871 | Ga0075434_100389538 | Ga0075434_1003895382 | 224 |
| 309 | 3300006914 | Ga0075436_100004827 | Ga0075436_1000048274 | 224 |
| 310 | 3300006914 | Ga0075436_100020931 | Ga0075436_1000209312 | 224 |
| 311 | 3300006931 | Ga0097620_100041008 | Ga0097620_1000410082 | 224 |
| 312 | 3300009093 | Ga0105240_10273382 | Ga0105240_102733822 | 224 |
| 313 | 3300009093 | Ga0105240_10350751 | Ga0105240_103507511 | 224 |
| 314 | 3300009098 | Ga0105245_10028596 | Ga0105245_100285965 | 224 |
| 315 | 3300009098 | Ga0105245_10163393 | Ga0105245_101633932 | 224 |
| 316 | 3300009147 | Ga0114129_10024315 | Ga0114129_100243154 | 224 |
| 317 | 3300009148 | Ga0105243_10277580 | Ga0105243_102775802 | 224 |
| 318 | 3300009148 | Ga0105243_10341615 | Ga0105243_103416152 | 224 |
| 319 | 3300009176 | Ga0105242_10073410 | Ga0105242_100734101 | 224 |
| 320 | 3300009177 | Ga0105248_10604018 | Ga0105248_106040182 | 224 |
| 321 | 3300009551 | Ga0105238_10159425 | Ga0105238_101594252 | 224 |
| 322 | 3300009551 | Ga0105238_10291352 | Ga0105238_102913522 | 224 |
| 323 | 3300009553 | Ga0105249_10169960 | Ga0105249_101699602 | 224 |
| 324 | 3300011119 | Ga0105246_10032876 | Ga0105246_100328762 | 224 |
| 325 | 3300011119 | Ga0105246_10919680 | Ga0105246_109196801 | 224 |
| 326 | 3300012507 | Ga0157342_1008389 | Ga0157342_10083891 | 224 |
| 327 | 3300013105 | Ga0157369_10006230 | Ga0157369_1000623011 | 224 |
| 328 | 3300013105 | Ga0157369_10223548 | Ga0157369_102235482 | 224 |
| 329 | 3300013296 | Ga0157374_10649385 | Ga0157374_106493852 | 224 |
| 330 | 3300013297 | Ga0157378_10176077 | Ga0157378_101760772 | 224 |
| 331 | 3300013306 | Ga0163162_10833720 | Ga0163162_108337201 | 224 |
| 332 | 3300013307 | Ga0157372_10090164 | Ga0157372_100901643 | 224 |
| 333 | 3300013307 | Ga0157372_10770623 | Ga0157372_107706232 | 224 |
| 334 | 3300013308 | Ga0157375_10077212 | Ga0157375_100772123 | 224 |
| 335 | 3300013308 | Ga0157375_10144159 | Ga0157375_101441592 | 224 |
| 336 | 3300013308 | Ga0157375_10218869 | Ga0157375_102188691 | 224 |
| 337 | 3300014325 | Ga0163163_10003412 | Ga0163163_100034128 | 224 |
| 338 | 3300014325 | Ga0163163_10124358 | Ga0163163_101243583 | 224 |
| 339 | 3300014326 | Ga0157380_10720355 | Ga0157380_107203552 | 224 |
| 340 | 3300014745 | Ga0157377_10070554 | Ga0157377_100705542 | 224 |
| 341 | 3300014968 | Ga0157379_10005808 | Ga0157379_100058082 | 224 |
| 342 | 3300014968 | Ga0157379_10279803 | Ga0157379_102798032 | 224 |
| 343 | 3300014969 | Ga0157376_10025898 | Ga0157376_100258984 | 224 |
| 344 | 3300014969 | Ga0157376_10116353 | Ga0157376_101163532 | 224 |
| 345 | 3300014969 | Ga0157376_10154488 | Ga0157376_101544882 | 224 |
| 346 | 3300020069 | Ga0197907_11154562 | Ga0197907_111545621 | 224 |
| 347 | 3300020077 | Ga0206351_10623328 | Ga0206351_106233282 | 224 |
| 348 | 3300020080 | Ga0206350_10545162 | Ga0206350_105451622 | 224 |
| 349 | 3300020080 | Ga0206350_11332998 | Ga0206350_113329982 | 224 |
| 350 | 3300020082 | Ga0206353_10430810 | Ga0206353_104308103 | 224 |
| 351 | 3300020082 | Ga0206353_10837455 | Ga0206353_108374552 | 224 |
| 352 | 3300021388 | Ga0213875_10053546 | Ga0213875_100535461 | 224 |
| 353 | 3300022467 | Ga0224712_10003657 | Ga0224712_100036572 | 224 |
| 354 | 3300022467 | Ga0224712_10009872 | Ga0224712_100098722 | 224 |
| 355 | 3300022467 | Ga0224712_10012296 | Ga0224712_100122963 | 224 |
| 356 | 3300022467 | Ga0224712_10022462 | Ga0224712_100224621 | 224 |
| 357 | 3300022467 | Ga0224712_10172980 | Ga0224712_101729802 | 224 |
| 358 | 3300025898 | Ga0207692_10001219 | Ga0207692_100012196 | 224 |
| 359 | 3300025898 | Ga0207692_10048644 | Ga0207692_100486442 | 224 |
| 360 | 3300025898 | Ga0207692_10231762 | Ga0207692_102317622 | 224 |
| 361 | 3300025898 | Ga0207692_10379978 | Ga0207692_103799782 | 224 |
| 362 | 3300025901 | Ga0207688_10011417 | Ga0207688_100114174 | 224 |
| 363 | 3300025904 | Ga0207647_10053383 | Ga0207647_100533832 | 224 |
| 364 | 3300025904 | Ga0207647_10210887 | Ga0207647_102108872 | 224 |
| 365 | 3300025905 | Ga0207685_10017954 | Ga0207685_100179542 | 224 |
| 366 | 3300025905 | Ga0207685_10056915 | Ga0207685_100569152 | 224 |
| 367 | 3300025906 | Ga0207699_10010674 | Ga0207699_100106743 | 224 |
| 368 | 3300025906 | Ga0207699_10018548 | Ga0207699_100185484 | 224 |
| 369 | 3300025906 | Ga0207699_10069684 | Ga0207699_100696842 | 224 |
| 370 | 3300025906 | Ga0207699_10084580 | Ga0207699_100845802 | 224 |
| 371 | 3300025906 | Ga0207699_10094201 | Ga0207699_100942012 | 224 |
| 372 | 3300025909 | Ga0207705_10014311 | Ga0207705_100143113 | 224 |
| 373 | 3300025910 | Ga0207684_10020585 | Ga0207684_100205851 | 224 |
| 374 | 3300025910 | Ga0207684_10103864 | Ga0207684_101038642 | 224 |
| 375 | 3300025910 | Ga0207684_10164710 | Ga0207684_101647102 | 224 |
| 376 | 3300025910 | Ga0207684_10224693 | Ga0207684_102246932 | 224 |
| 377 | 3300025910 | Ga0207684_10281699 | Ga0207684_102816991 | 224 |
| 378 | 3300025912 | Ga0207707_10001352 | Ga0207707_1000135212 | 224 |
| 379 | 3300025912 | Ga0207707_10303303 | Ga0207707_103033033 | 224 |
| 380 | 3300025915 | Ga0207693_10011242 | Ga0207693_100112422 | 224 |
| 381 | 3300025915 | Ga0207693_10055473 | Ga0207693_100554732 | 224 |
| 382 | 3300025915 | Ga0207693_10122229 | Ga0207693_101222292 | 224 |
| 383 | 3300025915 | Ga0207693_10177362 | Ga0207693_101773622 | 224 |
| 384 | 3300025916 | Ga0207663_10016400 | Ga0207663_100164003 | 224 |
| 385 | 3300025916 | Ga0207663_10176131 | Ga0207663_101761311 | 224 |
| 386 | 3300025916 | Ga0207663_10517600 | Ga0207663_105176002 | 224 |
| 387 | 3300025918 | Ga0207662_10039032 | Ga0207662_100390322 | 224 |
| 388 | 3300025919 | Ga0207657_10013739 | Ga0207657_100137392 | 224 |
| 389 | 3300025921 | Ga0207652_10008724 | Ga0207652_100087245 | 224 |
| 390 | 3300025921 | Ga0207652_10147526 | Ga0207652_101475262 | 224 |
| 391 | 3300025921 | Ga0207652_10351540 | Ga0207652_103515401 | 224 |
| 392 | 3300025922 | Ga0207646_10036661 | Ga0207646_100366614 | 224 |
| 393 | 3300025922 | Ga0207646_10066969 | Ga0207646_100669692 | 224 |
| 394 | 3300025922 | Ga0207646_10125319 | Ga0207646_101253192 | 224 |
| 395 | 3300025922 | Ga0207646_10214371 | Ga0207646_102143712 | 224 |
| 396 | 3300025928 | Ga0207700_10012464 | Ga0207700_100124642 | 224 |
| 397 | 3300025928 | Ga0207700_10017983 | Ga0207700_100179832 | 224 |
| 398 | 3300025928 | Ga0207700_10032895 | Ga0207700_100328952 | 224 |
| 399 | 3300025928 | Ga0207700_10034300 | Ga0207700_100343003 | 224 |
| 400 | 3300025928 | Ga0207700_10050547 | Ga0207700_100505472 | 224 |
| 401 | 3300025928 | Ga0207700_10118893 | Ga0207700_101188932 | 224 |
| 402 | 3300025928 | Ga0207700_10223870 | Ga0207700_102238703 | 224 |
| 403 | 3300025928 | Ga0207700_10279193 | Ga0207700_102791932 | 224 |
| 404 | 3300025928 | Ga0207700_10319977 | Ga0207700_103199772 | 224 |
| 405 | 3300025929 | Ga0207664_10001219 | Ga0207664_1000121915 | 224 |
| 406 | 3300025929 | Ga0207664_10001859 | Ga0207664_100018594 | 224 |
| 407 | 3300025929 | Ga0207664_10010461 | Ga0207664_100104612 | 224 |
| 408 | 3300025929 | Ga0207664_10045207 | Ga0207664_100452072 | 224 |
| 409 | 3300025929 | Ga0207664_10050425 | Ga0207664_100504253 | 224 |
| 410 | 3300025929 | Ga0207664_10078311 | Ga0207664_100783111 | 224 |
| 411 | 3300025929 | Ga0207664_10130081 | Ga0207664_101300812 | 224 |
| 412 | 3300025929 | Ga0207664_10154753 | Ga0207664_101547532 | 224 |
| 413 | 3300025929 | Ga0207664_10199746 | Ga0207664_101997462 | 224 |
| 414 | 3300025932 | Ga0207690_10262610 | Ga0207690_102626102 | 224 |
| 415 | 3300025934 | Ga0207686_10233304 | Ga0207686_102333042 | 224 |
| 416 | 3300025937 | Ga0207669_10199851 | Ga0207669_101998512 | 224 |
| 417 | 3300025937 | Ga0207669_10354556 | Ga0207669_103545561 | 224 |
| 418 | 3300025939 | Ga0207665_10000937 | Ga0207665_1000093712 | 224 |
| 419 | 3300025939 | Ga0207665_10025697 | Ga0207665_100256972 | 224 |
| 420 | 3300025939 | Ga0207665_10044338 | Ga0207665_100443382 | 224 |
| 421 | 3300025940 | Ga0207691_10043103 | Ga0207691_100431032 | 224 |
| 422 | 3300025942 | Ga0207689_10316061 | Ga0207689_103160611 | 224 |
| 423 | 3300025944 | Ga0207661_10279300 | Ga0207661_102793002 | 224 |
| 424 | 3300025945 | Ga0207679_10315845 | Ga0207679_103158451 | 224 |
| 425 | 3300026023 | Ga0207677_10161080 | Ga0207677_101610801 | 224 |
| 426 | 3300026023 | Ga0207677_10645376 | Ga0207677_106453761 | 224 |
| 427 | 3300026035 | Ga0207703_10182944 | Ga0207703_101829442 | 224 |
| 428 | 3300026067 | Ga0207678_10013263 | Ga0207678_100132633 | 224 |
| 429 | 3300026067 | Ga0207678_10414828 | Ga0207678_104148281 | 224 |
| 430 | 3300026078 | Ga0207702_10098834 | Ga0207702_100988342 | 224 |
| 431 | 3300026089 | Ga0207648_10273380 | Ga0207648_102733802 | 224 |
| 432 | 3300026095 | Ga0207676_10023529 | Ga0207676_100235292 | 224 |
| 433 | 3300026095 | Ga0207676_10534115 | Ga0207676_105341152 | 224 |
| 434 | 3300026116 | Ga0207674_10002791 | Ga0207674_1000279115 | 224 |
| 435 | 3300026116 | Ga0207674_10043441 | Ga0207674_100434413 | 224 |
| 436 | 3300026116 | Ga0207674_10062060 | Ga0207674_100620603 | 224 |
| 437 | 3300026118 | Ga0207675_100045873 | Ga0207675_1000458732 | 224 |
| 438 | 3300026121 | Ga0207683_10044001 | Ga0207683_100440013 | 224 |
| 439 | 3300026121 | Ga0207683_10542743 | Ga0207683_105427432 | 224 |
| 440 | 3300028379 | Ga0268266_10037281 | Ga0268266_100372812 | 224 |
| 441 | 3300028379 | Ga0268266_10148443 | Ga0268266_101484432 | 224 |
| 442 | 3300028380 | Ga0268265_10303887 | Ga0268265_103038872 | 224 |
| 443 | 3300028380 | Ga0268265_10764455 | Ga0268265_107644552 | 224 |
| 444 | 3300028381 | Ga0268264_10016885 | Ga0268264_100168855 | 224 |
| 445 | 3300028381 | Ga0268264_10102534 | Ga0268264_101025342 | 224 |
| 446 | 3300028381 | Ga0268264_10732260 | Ga0268264_107322602 | 224 |
| 447 | 3300028556 | Ga0265337_1007835 | Ga0265337_10078354 | 224 |
| 448 | 3300028558 | Ga0265326_10007791 | Ga0265326_100077914 | 224 |
| 449 | 3300028563 | Ga0265319_1000101 | Ga0265319_100010125 | 224 |
| 450 | 3300028563 | Ga0265319_1004032 | Ga0265319_10040323 | 224 |
| 451 | 3300028573 | Ga0265334_10003352 | Ga0265334_100033523 | 224 |
| 452 | 3300028577 | Ga0265318_10000112 | Ga0265318_1000011245 | 224 |
| 453 | 3300028577 | Ga0265318_10001261 | Ga0265318_100012612 | 224 |
| 454 | 3300028577 | Ga0265318_10061405 | Ga0265318_100614052 | 224 |
| 455 | 3300028653 | Ga0265323_10009626 | Ga0265323_100096263 | 224 |
| 456 | 3300028654 | Ga0265322_10006720 | Ga0265322_100067203 | 224 |
| 457 | 3300028666 | Ga0265336_10001704 | Ga0265336_100017045 | 224 |
| 458 | 3300028666 | Ga0265336_10014619 | Ga0265336_100146192 | 224 |
| 459 | 3300028794 | Ga0307515_10000042 | Ga0307515_10000042265 | 224 |
| 460 | 3300028800 | Ga0265338_10000743 | Ga0265338_100007436 | 224 |
| 461 | 3300028800 | Ga0265338_10001346 | Ga0265338_100013464 | 224 |
| 462 | 3300028800 | Ga0265338_10005011 | Ga0265338_100050116 | 224 |
| 463 | 3300028800 | Ga0265338_10006911 | Ga0265338_100069114 | 224 |
| 464 | 3300028800 | Ga0265338_10057494 | Ga0265338_100574942 | 224 |
| 465 | 3300028800 | Ga0265338_10066202 | Ga0265338_100662022 | 224 |
| 466 | 3300029957 | Ga0265324_10010807 | Ga0265324_100108072 | 224 |
| 467 | 3300031235 | Ga0265330_10000056 | Ga0265330_1000005626 | 224 |
| 468 | 3300031238 | Ga0265332_10000050 | Ga0265332_1000005030 | 224 |
| 469 | 3300031238 | Ga0265332_10002184 | Ga0265332_100021846 | 224 |
| 470 | 3300031239 | Ga0265328_10001238 | Ga0265328_100012387 | 224 |
| 471 | 3300031240 | Ga0265320_10000115 | Ga0265320_100001153 | 224 |
| 472 | 3300031240 | Ga0265320_10005115 | Ga0265320_100051154 | 224 |
| 473 | 3300031240 | Ga0265320_10109686 | Ga0265320_101096862 | 224 |
| 474 | 3300031241 | Ga0265325_10000326 | Ga0265325_100003268 | 224 |
| 475 | 3300031241 | Ga0265325_10001667 | Ga0265325_1000166710 | 224 |
| 476 | 3300031241 | Ga0265325_10035966 | Ga0265325_100359663 | 224 |
| 477 | 3300031242 | Ga0265329_10000048 | Ga0265329_1000004822 | 224 |
| 478 | 3300031247 | Ga0265340_10001141 | Ga0265340_100011414 | 224 |
| 479 | 3300031247 | Ga0265340_10001852 | Ga0265340_100018528 | 224 |
| 480 | 3300031249 | Ga0265339_10006545 | Ga0265339_100065453 | 224 |
| 481 | 3300031249 | Ga0265339_10007679 | Ga0265339_100076792 | 224 |
| 482 | 3300031249 | Ga0265339_10041381 | Ga0265339_100413812 | 224 |
| 483 | 3300031250 | Ga0265331_10000335 | Ga0265331_1000033514 | 224 |
| 484 | 3300031344 | Ga0265316_10001199 | Ga0265316_1000119919 | 224 |
| 485 | 3300031344 | Ga0265316_10008688 | Ga0265316_100086882 | 224 |
| 486 | 3300031344 | Ga0265316_10020583 | Ga0265316_100205833 | 224 |
| 487 | 3300031548 | Ga0307408_100181523 | Ga0307408_1001815232 | 224 |
| 488 | 3300031595 | Ga0265313_10000009 | Ga0265313_10000009128 | 224 |
| 489 | 3300031595 | Ga0265313_10000187 | Ga0265313_100001875 | 224 |
| 490 | 3300031595 | Ga0265313_10000383 | Ga0265313_1000038317 | 224 |
| 491 | 3300031595 | Ga0265313_10033580 | Ga0265313_100335802 | 224 |
| 492 | 3300031616 | Ga0307508_10149401 | Ga0307508_101494012 | 224 |
| 493 | 3300031711 | Ga0265314_10000430 | Ga0265314_1000043034 | 224 |
| 494 | 3300031711 | Ga0265314_10017800 | Ga0265314_100178005 | 224 |
| 495 | 3300031712 | Ga0265342_10000333 | Ga0265342_1000033334 | 224 |
| 496 | 3300031712 | Ga0265342_10012657 | Ga0265342_100126576 | 224 |
| 497 | 3300031730 | Ga0307516_10003947 | Ga0307516_100039475 | 224 |
| 498 | 3300031731 | Ga0307405_10333712 | Ga0307405_103337121 | 224 |
| 499 | 3300031824 | Ga0307413_10023726 | Ga0307413_100237263 | 224 |
| 500 | 3300031852 | Ga0307410_10015091 | Ga0307410_100150912 | 224 |
| 501 | 3300031852 | Ga0307410_10032568 | Ga0307410_100325683 | 224 |
| 502 | 3300031901 | Ga0307406_10028625 | Ga0307406_100286253 | 224 |
| 503 | 3300031903 | Ga0307407_10044263 | Ga0307407_100442632 | 224 |
| 504 | 3300031903 | Ga0307407_10102867 | Ga0307407_101028672 | 224 |
| 505 | 3300031903 | Ga0307407_10140691 | Ga0307407_101406912 | 224 |
| 506 | 3300031911 | Ga0307412_10134797 | Ga0307412_101347972 | 224 |
| 507 | 3300031995 | Ga0307409_100090877 | Ga0307409_1000908773 | 224 |
| 508 | 3300031995 | Ga0307409_100384215 | Ga0307409_1003842151 | 224 |
| 509 | 3300032002 | Ga0307416_100021692 | Ga0307416_1000216922 | 224 |
| 510 | 3300032002 | Ga0307416_100492760 | Ga0307416_1004927602 | 224 |
| 511 | 3300032004 | Ga0307414_10086307 | Ga0307414_100863072 | 224 |
| 512 | 3300032004 | Ga0307414_10271610 | Ga0307414_102716102 | 224 |
| 513 | 3300032004 | Ga0307414_10501103 | Ga0307414_105011032 | 224 |
| 514 | 3300032005 | Ga0307411_10642793 | Ga0307411_106427931 | 224 |
| 515 | 3300032126 | Ga0307415_100002584 | Ga0307415_1000025847 | 224 |
| 516 | 3300032126 | Ga0307415_100035580 | Ga0307415_1000355802 | 224 |
| 517 | 3300032126 | Ga0307415_100489620 | Ga0307415_1004896202 | 224 |
| 518 | 3300033545 | Ga0316214_1002630 | Ga0316214_10026302 | 224 |
| 519 | 3300034957 | Ga0373938_0044313 | Ga0373938_0044313_31_708 | 224 |
| 520 | 3300035083 | Ga0373926_0002315 | Ga0373926_0002315_1770_2459 | 224 |
| 521 | 3300035083 | Ga0373926_0006977 | Ga0373926_0006977_1612_2289 | 224 |
| 522 | 3300035086 | Ga0373934_0000101 | Ga0373934_0000101_27196_27906 | 224 |
| 523 | 3300035086 | Ga0373934_0012313 | Ga0373934_0012313_1058_1765 | 224 |
| 524 | 3300035086 | Ga0373934_0040878 | Ga0373934_0040878_428_1105 | 224 |
| 525 | 3300035086 | Ga0373934_0042417 | Ga0373934_0042417_565_1272 | 224 |
| 526 | 3300035090 | Ga0373949_0031357 | Ga0373949_0031357_224_901 | 224 |
| 527 | 3300035111 | Ga0373923_0000967 | Ga0373923_0000967_4169_4879 | 224 |
| 528 | 3300035111 | Ga0373923_0010902 | Ga0373923_0010902_1316_1999 | 224 |
| 529 | 3300035111 | Ga0373923_0015587 | Ga0373923_0015587_1339_2016 | 224 |
| 530 | 3300035111 | Ga0373923_0039155 | Ga0373923_0039155_552_1259 | 224 |
| 531 | 3300035111 | Ga0373923_0061499 | Ga0373923_0061499_711_1391 | 224 |
| 532 | 3300035111 | Ga0373923_0075589 | Ga0373923_0075589_602_1387 | 224 |
| 533 | 3300035113 | Ga0373936_0003980 | Ga0373936_0003980_556_1233 | 224 |
| 534 | 3300035113 | Ga0373936_0308040 | Ga0373936_0308040_26_703 | 224 |
| 535 | 3300035116 | Ga0373945_0028991 | Ga0373945_0028991_611_1354 | 224 |
| 536 | 3300035116 | Ga0373945_0034494 | Ga0373945_0034494_733_1410 | 224 |
| 537 | 3300035117 | Ga0373953_0000521 | Ga0373953_0000521_4638_5348 | 224 |
| 538 | 3300035117 | Ga0373953_0009295 | Ga0373953_0009295_1021_1704 | 224 |
| 539 | 3300035117 | Ga0373953_0026137 | Ga0373953_0026137_1183_1890 | 224 |
| 540 | 3300035118 | Ga0373954_0008596 | Ga0373954_0008596_1842_2525 | 224 |
| 541 | 3300035118 | Ga0373954_0015680 | Ga0373954_0015680_1767_2552 | 224 |
| 542 | 3300035118 | Ga0373954_0027967 | Ga0373954_0027967_1078_1785 | 224 |
| 543 | 3300035119 | Ga0373956_0000095 | Ga0373956_0000095_27054_27764 | 224 |
| 544 | 3300035119 | Ga0373956_0018190 | Ga0373956_0018190_48_731 | 224 |
| 545 | 3300035119 | Ga0373956_0113215 | Ga0373956_0113215_268_1053 | 224 |
| 546 | 3300035120 | Ga0373957_0000033 | Ga0373957_0000033_1262_1972 | 224 |
| 547 | 3300035170 | Ga0373943_0066062 | Ga0373943_0066062_860_1645 | 224 |
| 548 | 3300035170 | Ga0373943_0085374 | Ga0373943_0085374_584_1261 | 224 |
| 549 | 3300035171 | Ga0373946_0002118 | Ga0373946_0002118_3327_4004 | 224 |
| 550 | 3300035171 | Ga0373946_0010570 | Ga0373946_0010570_2138_2827 | 224 |
| 551 | 3300035171 | Ga0373946_0145535 | Ga0373946_0145535_132_812 | 224 |
| 552 | 3300035172 | Ga0373955_0000002 | Ga0373955_0000002_81130_81840 | 224 |
| 553 | 3300035172 | Ga0373955_0007055 | Ga0373955_0007055_4420_5097 | 224 |
| 554 | 3300035172 | Ga0373955_0012915 | Ga0373955_0012915_1014_1697 | 224 |
| 555 | 3300035410 | Ga0373924_0002327 | Ga0373924_0002327_452_1129 | 224 |
| 556 | 3300035410 | Ga0373924_0009167 | Ga0373924_0009167_2130_2840 | 224 |
| 557 | 3300035691 | Ga0373931_0346063 | Ga0373931_0346063_183_860 | 224 |
| 558 | 3300035692 | Ga0373935_0000234 | Ga0373935_0000234_9247_9936 | 224 |
| 559 | 3300035692 | Ga0373935_0045225 | Ga0373935_0045225_783_1466 | 224 |
| 560 | 3300035692 | Ga0373935_0192321 | Ga0373935_0192321_318_1031 | 224 |
| 561 | 3300035695 | Ga0373927_0254902 | Ga0373927_0254902_165_908 | 224 |
| 562 | 3300035724 | Ga0373933_0000029 | Ga0373933_0000029_60438_61148 | 224 |
| 563 | 3300035724 | Ga0373933_0012974 | Ga0373933_0012974_2620_3303 | 224 |
| 564 | 3300035724 | Ga0373933_0024647 | Ga0373933_0024647_26_703 | 224 |
| 565 | 3300035724 | Ga0373933_0033935 | Ga0373933_0033935_1503_2210 | 224 |
| 566 | 3300035724 | Ga0373933_0137993 | Ga0373933_0137993_584_1288 | 224 |
| 567 | 3300035724 | Ga0373933_0198132 | Ga0373933_0198132_55_732 | 224 |
| 568 | 3300035725 | Ga0373947_0000005 | Ga0373947_0000005_160832_161521 | 224 |
| 569 | 3300036401 | Ga0373937_0000362 | Ga0373937_0000362_28589_29299 | 224 |
| 570 | 3300036401 | Ga0373937_0004443 | Ga0373937_0004443_7919_8626 | 224 |
| 571 | 3300036401 | Ga0373937_0095938 | Ga0373937_0095938_962_1645 | 224 |
| 572 | 3300036401 | Ga0373937_0330572 | Ga0373937_0330572_728_1405 | 224 |
| 573 | 3300036401 | Ga0373937_0448943 | Ga0373937_0448943_408_1088 | 224 |
| 574 | 3300036401 | Ga0373937_0472913 | Ga0373937_0472913_142_819 | 224 |
| 575 | 3300037068 | Ga0373925_0000021 | Ga0373925_0000021_55758_56432 | 224 |
| 576 | 3300037068 | Ga0373925_0199253 | Ga0373925_0199253_331_1008 | 224 |
| 577 | 3300037068 | Ga0373925_0221133 | Ga0373925_0221133_359_1102 | 224 |
| 578 | 3300037418 | Ga0395900_0003692 | Ga0395900_0003692_13318_13992 | 224 |
| 579 | 3300037466 | Ga0395898_0042087 | Ga0395898_0042087_3364_4038 | 224 |
| 580 | 3300037853 | Ga0436364_1130152 | Ga0436364_1130152_562_1239 | 224 |
| 581 | 3300037853 | Ga0436364_1225860 | Ga0436364_1225860_1137_1814 | 224 |
| 582 | 3300039447 | Ga0436361_0546799 | Ga0436361_0546799_205_885 | 224 |
| 583 | 3300039450 | Ga0436363_0208428 | Ga0436363_0208428_1079_1834 | 224 |
| 584 | 3300041441 | Ga0451787_197248 | Ga0451787_197248_484_1164 | 224 |
| 585 | 3300041443 | Ga0451789_0052206 | Ga0451789_0052206_303_983 | 224 |
| 586 | 3300041451 | Ga0451791_1114879 | Ga0451791_1114879_1121_1801 | 224 |
| 587 | 3300041451 | Ga0451791_1689531 | Ga0451791_1689531_1165_1842 | 224 |
| 588 | 3300041452 | Ga0451793_0720655 | Ga0451793_0720655_7544_8224 | 224 |
| 589 | 3300041453 | Ga0451797_0100726 | Ga0451797_0100726_326_1006 | 224 |
| 590 | 3300041459 | Ga0451800_0314848 | Ga0451800_0314848_76_756 | 224 |
| 591 | 3300041486 | Ga0451807_0584294 | Ga0451807_0584294_268_948 | 224 |
| 592 | 3300041496 | Ga0451839_0061394 | Ga0451839_0061394_2285_2965 | 224 |
| 593 | 3300041498 | Ga0451841_0287715 | Ga0451841_0287715_277_957 | 224 |
| 594 | 3300041509 | Ga0451843_0204342 | Ga0451843_0204342_55_735 | 224 |
| 595 | 3300044683 | Ga0466965_0355675 | Ga0466965_0355675_97_792 | 224 |
| 596 | 3300044693 | Ga0466961_0105411 | Ga0466961_0105411_272_964 | 224 |
| 597 | 3300044694 | Ga0466963_0076384 | Ga0466963_0076384_148_825 | 224 |
| 598 | 3300044842 | Ga0466957_0239841 | Ga0466957_0239841_364_1038 | 224 |
| 599 | 3300044901 | Ga0466960_0012595 | Ga0466960_0012595_446_1120 | 224 |
| 600 | 3300044901 | Ga0466960_0097893 | Ga0466960_0097893_211_885 | 224 |
| 601 | 3300045049 | Ga0466959_0003301 | Ga0466959_0003301_8416_9090 | 224 |
| 602 | 3300045049 | Ga0466959_0133545 | Ga0466959_0133545_562_1236 | 224 |
| 603 | 3300045836 | Ga0466958_0090390 | Ga0466958_0090390_319_1008 | 224 |
| 604 | 3300045836 | Ga0466958_0121743 | Ga0466958_0121743_306_983 | 224 |
| 605 | 3300045836 | Ga0466958_0259650 | Ga0466958_0259650_12_686 | 224 |
| 606 | 3300045836 | Ga0466958_0276648 | Ga0466958_0276648_165_839 | 224 |
| 607 | 3300045976 | Ga0466967_0000444 | Ga0466967_0000444_10292_10966 | 224 |
| 608 | 3300045976 | Ga0466967_0004649 | Ga0466967_0004649_5705_6379 | 224 |
| 609 | 3300045976 | Ga0466967_0026433 | Ga0466967_0026433_1437_2114 | 224 |
| 610 | 3300045976 | Ga0466967_0050982 | Ga0466967_0050982_1957_2631 | 224 |
| 611 | 3300045976 | Ga0466967_0127873 | Ga0466967_0127873_1585_2262 | 224 |
| 612 | 3300045976 | Ga0466967_0154742 | Ga0466967_0154742_50_724 | 224 |
| 613 | 3300045976 | Ga0466967_0573243 | Ga0466967_0573243_221_922 | 224 |
| 614 | 3300046454 | Ga0495592_0000043 | Ga0495592_0000043_82530_83240 | 224 |
| 615 | 3300046454 | Ga0495592_0008890 | Ga0495592_0008890_586_1260 | 224 |
| 616 | 3300046454 | Ga0495592_0040782 | Ga0495592_0040782_1157_1837 | 224 |
| 617 | 3300046454 | Ga0495592_0100369 | Ga0495592_0100369_862_1569 | 224 |
| 618 | 3300046454 | Ga0495592_0135693 | Ga0495592_0135693_456_1133 | 224 |
| 619 | 3300046454 | Ga0495592_0232868 | Ga0495592_0232868_443_1126 | 224 |
| 620 | 3300046455 | Ga0495603_0042928 | Ga0495603_0042928_918_1592 | 224 |
| 621 | 3300046459 | Ga0495629_0005691 | Ga0495629_0005691_985_1659 | 224 |
| 622 | 3300046459 | Ga0495629_0091124 | Ga0495629_0091124_812_1597 | 224 |
| 623 | 3300046459 | Ga0495629_0217170 | Ga0495629_0217170_584_1261 | 224 |
| 624 | 3300046461 | Ga0495641_0001864 | Ga0495641_0001864_8923_9600 | 224 |
| 625 | 3300046462 | Ga0495651_0000135 | Ga0495651_0000135_28695_29405 | 224 |
| 626 | 3300046462 | Ga0495651_0003167 | Ga0495651_0003167_1987_2694 | 224 |
| 627 | 3300046462 | Ga0495651_0006755 | Ga0495651_0006755_1890_2567 | 224 |
| 628 | 3300046462 | Ga0495651_0021269 | Ga0495651_0021269_3354_4139 | 224 |
| 629 | 3300046462 | Ga0495651_0028970 | Ga0495651_0028970_1296_1979 | 224 |
| 630 | 3300046462 | Ga0495651_0055294 | Ga0495651_0055294_2146_2826 | 224 |
| 631 | 3300046463 | Ga0495653_0000571 | Ga0495653_0000571_1077_1787 | 224 |
| 632 | 3300046463 | Ga0495653_0012759 | Ga0495653_0012759_2345_3025 | 224 |
| 633 | 3300046463 | Ga0495653_0063902 | Ga0495653_0063902_1707_2414 | 224 |
| 634 | 3300046463 | Ga0495653_0132596 | Ga0495653_0132596_501_1178 | 224 |
| 635 | 3300046463 | Ga0495653_0179118 | Ga0495653_0179118_177_854 | 224 |
| 636 | 3300046463 | Ga0495653_0299490 | Ga0495653_0299490_142_843 | 224 |
| 637 | 3300046472 | Ga0495580_0015800 | Ga0495580_0015800_2002_2679 | 224 |
| 638 | 3300046473 | Ga0495582_0212637 | Ga0495582_0212637_294_1067 | 224 |
| 639 | 3300046473 | Ga0495582_0296301 | Ga0495582_0296301_166_843 | 224 |
| 640 | 3300046475 | Ga0495639_0001668 | Ga0495639_0001668_95_772 | 224 |
| 641 | 3300046476 | Ga0495662_0009182 | Ga0495662_0009182_1667_2350 | 224 |
| 642 | 3300046476 | Ga0495662_0011201 | Ga0495662_0011201_1327_2004 | 224 |
| 643 | 3300046476 | Ga0495662_0036057 | Ga0495662_0036057_315_1100 | 224 |
| 644 | 3300046476 | Ga0495662_0074460 | Ga0495662_0074460_182_862 | 224 |
| 645 | 3300046477 | Ga0495664_0014805 | Ga0495664_0014805_2683_3363 | 224 |
| 646 | 3300046477 | Ga0495664_0017439 | Ga0495664_0017439_742_1425 | 224 |
| 647 | 3300046477 | Ga0495664_0125390 | Ga0495664_0125390_517_1194 | 224 |
| 648 | 3300046477 | Ga0495664_0177147 | Ga0495664_0177147_336_1016 | 224 |
| 649 | 3300046477 | Ga0495664_0275579 | Ga0495664_0275579_108_785 | 224 |
| 650 | 3300046499 | Ga0495594_0158565 | Ga0495594_0158565_274_1047 | 224 |
| 651 | 3300046499 | Ga0495594_0226331 | Ga0495594_0226331_33_707 | 224 |
| 652 | 3300046511 | Ga0495608_0000016 | Ga0495608_0000016_82185_82895 | 224 |
| 653 | 3300046511 | Ga0495608_0007773 | Ga0495608_0007773_2176_2856 | 224 |
| 654 | 3300046511 | Ga0495608_0013563 | Ga0495608_0013563_4310_4987 | 224 |
| 655 | 3300046511 | Ga0495608_0050860 | Ga0495608_0050860_521_1204 | 224 |
| 656 | 3300046511 | Ga0495608_0119179 | Ga0495608_0119179_656_1333 | 224 |
| 657 | 3300046514 | Ga0495618_0022655 | Ga0495618_0022655_383_1066 | 224 |
| 658 | 3300046514 | Ga0495618_0183018 | Ga0495618_0183018_143_823 | 224 |
| 659 | 3300046514 | Ga0495618_0199061 | Ga0495618_0199061_278_955 | 224 |
| 660 | 3300046514 | Ga0495618_0346335 | Ga0495618_0346335_48_722 | 224 |
| 661 | 3300046516 | Ga0495628_0000034 | Ga0495628_0000034_31921_32631 | 224 |
| 662 | 3300046516 | Ga0495628_0008967 | Ga0495628_0008967_1595_2269 | 224 |
| 663 | 3300046516 | Ga0495628_0013773 | Ga0495628_0013773_3219_3920 | 224 |
| 664 | 3300046516 | Ga0495628_0227919 | Ga0495628_0227919_584_1264 | 224 |
| 665 | 3300046516 | Ga0495628_0388891 | Ga0495628_0388891_237_914 | 224 |
| 666 | 3300046517 | Ga0495630_0001481 | Ga0495630_0001481_14684_15361 | 224 |
| 667 | 3300046517 | Ga0495630_0009954 | Ga0495630_0009954_1632_2315 | 224 |
| 668 | 3300046517 | Ga0495630_0077567 | Ga0495630_0077567_143_823 | 224 |
| 669 | 3300046525 | Ga0495663_0054344 | Ga0495663_0054344_454_1128 | 224 |
| 670 | 3300046526 | Ga0495666_0005436 | Ga0495666_0005436_616_1293 | 224 |
| 671 | 3300046526 | Ga0495666_0094215 | Ga0495666_0094215_576_1319 | 224 |
| 672 | 3300046529 | Ga0495652_0000174 | Ga0495652_0000174_46764_47474 | 224 |
| 673 | 3300046529 | Ga0495652_0014268 | Ga0495652_0014268_627_1304 | 224 |
| 674 | 3300046529 | Ga0495652_0018126 | Ga0495652_0018126_3492_4175 | 224 |
| 675 | 3300046529 | Ga0495652_0022357 | Ga0495652_0022357_2233_2913 | 224 |
| 676 | 3300046529 | Ga0495652_0054315 | Ga0495652_0054315_1442_2116 | 224 |
| 677 | 3300046529 | Ga0495652_0054402 | Ga0495652_0054402_1234_1941 | 224 |
| 678 | 3300046529 | Ga0495652_0066154 | Ga0495652_0066154_1540_2217 | 224 |
| 679 | 3300046529 | Ga0495652_0239700 | Ga0495652_0239700_309_986 | 224 |
| 680 | 3300046531 | Ga0495665_0017965 | Ga0495665_0017965_2435_3112 | 224 |
| 681 | 3300046533 | Ga0495640_0006733 | Ga0495640_0006733_6470_7147 | 224 |
| 682 | 3300046533 | Ga0495640_0011539 | Ga0495640_0011539_3168_3842 | 224 |
| 683 | 3300046533 | Ga0495640_0039902 | Ga0495640_0039902_2213_2896 | 224 |
| 684 | 3300046533 | Ga0495640_0254242 | Ga0495640_0254242_47_832 | 224 |
| 685 | 3300046536 | Ga0495587_0000044 | Ga0495587_0000044_25552_26262 | 224 |
| 686 | 3300046536 | Ga0495587_0002197 | Ga0495587_0002197_6817_7494 | 224 |
| 687 | 3300046536 | Ga0495587_0004185 | Ga0495587_0004185_8059_8844 | 224 |
| 688 | 3300046536 | Ga0495587_0007131 | Ga0495587_0007131_4579_5259 | 224 |
| 689 | 3300046536 | Ga0495587_0023581 | Ga0495587_0023581_2065_2748 | 224 |
| 690 | 3300046536 | Ga0495587_0123462 | Ga0495587_0123462_177_854 | 224 |
| 691 | 3300046543 | Ga0495645_0145071 | Ga0495645_0145071_459_1139 | 224 |
| 692 | 3300046543 | Ga0495645_0168207 | Ga0495645_0168207_795_1475 | 224 |
| 693 | 3300046543 | Ga0495645_0315594 | Ga0495645_0315594_272_949 | 224 |
| 694 | 3300046557 | Ga0495622_0140668 | Ga0495622_0140668_255_932 | 224 |
| 695 | 3300046559 | Ga0495667_0000052 | Ga0495667_0000052_82174_82884 | 224 |
| 696 | 3300046559 | Ga0495667_0058789 | Ga0495667_0058789_1754_2461 | 224 |
| 697 | 3300046559 | Ga0495667_0065610 | Ga0495667_0065610_1434_2117 | 224 |
| 698 | 3300046559 | Ga0495667_0083468 | Ga0495667_0083468_779_1453 | 224 |
| 699 | 3300046559 | Ga0495667_0229903 | Ga0495667_0229903_11_688 | 224 |
| 700 | 3300046559 | Ga0495667_0270642 | Ga0495667_0270642_227_904 | 224 |
| 701 | 3300046615 | Ga0495656_0169464 | Ga0495656_0169464_21_695 | 224 |
| 702 | 3300046642 | Ga0495634_0005292 | Ga0495634_0005292_85_762 | 224 |
| 703 | 3300046642 | Ga0495634_0009343 | Ga0495634_0009343_1295_1969 | 224 |
| 704 | 3300046642 | Ga0495634_0057919 | Ga0495634_0057919_48_731 | 224 |
| 705 | 3300046642 | Ga0495634_0144929 | Ga0495634_0144929_732_1409 | 224 |
| 706 | 3300046663 | Ga0495635_0039234 | Ga0495635_0039234_2301_2981 | 224 |
| 707 | 3300046663 | Ga0495635_0065132 | Ga0495635_0065132_351_1136 | 224 |
| 708 | 3300046663 | Ga0495635_0072653 | Ga0495635_0072653_332_1015 | 224 |
| 709 | 3300046663 | Ga0495635_0148515 | Ga0495635_0148515_395_1102 | 224 |
| 710 | 3300046663 | Ga0495635_0235376 | Ga0495635_0235376_289_966 | 224 |
| 711 | 3300046663 | Ga0495635_0336209 | Ga0495635_0336209_318_998 | 224 |
| 712 | 3300046674 | Ga0495588_0091891 | Ga0495588_0091891_781_1458 | 224 |
| 713 | 3300046674 | Ga0495588_0195713 | Ga0495588_0195713_180_860 | 224 |
| 714 | 3300046675 | Ga0495657_0000015 | Ga0495657_0000015_82180_82890 | 224 |
| 715 | 3300046675 | Ga0495657_0009392 | Ga0495657_0009392_5406_6083 | 224 |
| 716 | 3300046675 | Ga0495657_0013373 | Ga0495657_0013373_4599_5279 | 224 |
| 717 | 3300046675 | Ga0495657_0024401 | Ga0495657_0024401_1920_2594 | 224 |
| 718 | 3300046675 | Ga0495657_0027681 | Ga0495657_0027681_2226_2933 | 224 |
| 719 | 3300046675 | Ga0495657_0082289 | Ga0495657_0082289_393_1178 | 224 |
| 720 | 3300046675 | Ga0495657_0091969 | Ga0495657_0091969_935_1618 | 224 |
| 721 | 3300046675 | Ga0495657_0233343 | Ga0495657_0233343_148_825 | 224 |
| 722 | 3300046678 | Ga0495599_0000035 | Ga0495599_0000035_20742_21452 | 224 |
| 723 | 3300046678 | Ga0495599_0003091 | Ga0495599_0003091_7314_8099 | 224 |
| 724 | 3300046678 | Ga0495599_0007370 | Ga0495599_0007370_4527_5210 | 224 |
| 725 | 3300046678 | Ga0495599_0051967 | Ga0495599_0051967_1435_2112 | 224 |
| 726 | 3300046678 | Ga0495599_0198281 | Ga0495599_0198281_230_910 | 224 |
| 727 | 3300046679 | Ga0495623_0000767 | Ga0495623_0000767_19820_20530 | 224 |
| 728 | 3300046679 | Ga0495623_0002607 | Ga0495623_0002607_4386_5171 | 224 |
| 729 | 3300046679 | Ga0495623_0037673 | Ga0495623_0037673_972_1655 | 224 |
| 730 | 3300046679 | Ga0495623_0140134 | Ga0495623_0140134_276_950 | 224 |
| 731 | 3300046679 | Ga0495623_0222683 | Ga0495623_0222683_232_912 | 224 |
| 732 | 3300046679 | Ga0495623_0233732 | Ga0495623_0233732_16_723 | 224 |
| 733 | 3300046679 | Ga0495623_0306196 | Ga0495623_0306196_164_841 | 224 |
| 734 | 3300046680 | Ga0495646_0002176 | Ga0495646_0002176_1635_2345 | 224 |
| 735 | 3300046680 | Ga0495646_0014045 | Ga0495646_0014045_1144_1929 | 224 |
| 736 | 3300046680 | Ga0495646_0040257 | Ga0495646_0040257_456_1133 | 224 |
| 737 | 3300046680 | Ga0495646_0382705 | Ga0495646_0382705_26_703 | 224 |
| 738 | 3300046683 | Ga0495658_0000676 | Ga0495658_0000676_16238_16915 | 224 |
| 739 | 3300046689 | Ga0495613_0078282 | Ga0495613_0078282_1370_2047 | 224 |
| 740 | 3300046690 | Ga0495624_0122064 | Ga0495624_0122064_114_791 | 224 |
| 741 | 3300046690 | Ga0495624_0126680 | Ga0495624_0126680_503_1183 | 224 |
| 742 | 3300046809 | Ga0495600_0007475 | Ga0495600_0007475_1588_2268 | 224 |
| 743 | 3300046809 | Ga0495600_0025656 | Ga0495600_0025656_1240_1914 | 224 |
| 744 | 3300046809 | Ga0495600_0056237 | Ga0495600_0056237_163_873 | 224 |
| 745 | 3300046809 | Ga0495600_0088286 | Ga0495600_0088286_916_1596 | 224 |
| 746 | 3300046809 | Ga0495600_0223031 | Ga0495600_0223031_406_1191 | 224 |
| 747 | 3300046809 | Ga0495600_0270490 | Ga0495600_0270490_97_804 | 224 |
| 748 | 3300047315 | Ga0495581_0001515 | Ga0495581_0001515_11766_12443 | 224 |
| 749 | 3300047315 | Ga0495581_0017534 | Ga0495581_0017534_527_1201 | 224 |
| 750 | 3300047315 | Ga0495581_0023897 | Ga0495581_0023897_1002_1787 | 224 |
| 751 | 3300047317 | Ga0495604_0000048 | Ga0495604_0000048_82530_83240 | 224 |
| 752 | 3300047317 | Ga0495604_0009246 | Ga0495604_0009246_352_1137 | 224 |
| 753 | 3300047317 | Ga0495604_0030548 | Ga0495604_0030548_519_1202 | 224 |
| 754 | 3300047317 | Ga0495604_0041434 | Ga0495604_0041434_138_812 | 224 |
| 755 | 3300047317 | Ga0495604_0046676 | Ga0495604_0046676_498_1178 | 224 |
| 756 | 3300047317 | Ga0495604_0131706 | Ga0495604_0131706_370_1047 | 224 |
| 757 | 3300047317 | Ga0495604_0154282 | Ga0495604_0154282_64_771 | 224 |
| 758 | 3300047319 | Ga0495674_0027236 | Ga0495674_0027236_601_1281 | 224 |
| 759 | 3300047319 | Ga0495674_0139615 | Ga0495674_0139615_1131_1811 | 224 |
| 760 | 3300047321 | Ga0495676_0004969 | Ga0495676_0004969_2710_3384 | 224 |
| 761 | 3300047321 | Ga0495676_0006692 | Ga0495676_0006692_814_1491 | 224 |
| 762 | 3300047322 | Ga0495680_0000069 | Ga0495680_0000069_5464_6174 | 224 |
| 763 | 3300047322 | Ga0495680_0010239 | Ga0495680_0010239_6824_7501 | 224 |
| 764 | 3300047322 | Ga0495680_0012666 | Ga0495680_0012666_6040_6825 | 224 |
| 765 | 3300047322 | Ga0495680_0019087 | Ga0495680_0019087_528_1208 | 224 |
| 766 | 3300047322 | Ga0495680_0020724 | Ga0495680_0020724_1967_2674 | 224 |
| 767 | 3300047322 | Ga0495680_0074021 | Ga0495680_0074021_1486_2163 | 224 |
| 768 | 3300047322 | Ga0495680_0187849 | Ga0495680_0187849_601_1284 | 224 |
| 769 | 3300047444 | Ga0495675_0000685 | Ga0495675_0000685_16935_17645 | 224 |
| 770 | 3300047444 | Ga0495675_0040750 | Ga0495675_0040750_1198_1905 | 224 |
| 771 | 3300047444 | Ga0495675_0048135 | Ga0495675_0048135_953_1738 | 224 |
| 772 | 3300047444 | Ga0495675_0067482 | Ga0495675_0067482_740_1414 | 224 |
| 773 | 3300047471 | Ga0495684_0002558 | Ga0495684_0002558_5899_6684 | 224 |
| 774 | 3300047471 | Ga0495684_0009605 | Ga0495684_0009605_6166_6843 | 224 |
| 775 | 3300047471 | Ga0495684_0014538 | Ga0495684_0014538_3431_4132 | 224 |
| 776 | 3300047471 | Ga0495684_0067033 | Ga0495684_0067033_243_926 | 224 |
| 777 | 3300047471 | Ga0495684_0079004 | Ga0495684_0079004_1221_1901 | 224 |
| 778 | 3300047471 | Ga0495684_0125480 | Ga0495684_0125480_616_1326 | 224 |
| 779 | 3300047673 | Ga0495593_0246927 | Ga0495593_0246927_29_709 | 224 |
| 780 | 3300048088 | Ga0495602_0000970 | Ga0495602_0000970_25571_26281 | 224 |
| 781 | 3300048088 | Ga0495602_0028336 | Ga0495602_0028336_1435_2112 | 224 |
| 782 | 3300048088 | Ga0495602_0036043 | Ga0495602_0036043_2933_3616 | 224 |
| 783 | 3300048088 | Ga0495602_0041593 | Ga0495602_0041593_1025_1702 | 224 |
| 784 | 3300048088 | Ga0495602_0091366 | Ga0495602_0091366_938_1645 | 224 |
| 785 | 3300048088 | Ga0495602_0099272 | Ga0495602_0099272_334_1041 | 224 |
| 786 | 3300048089 | Ga0495614_0140023 | Ga0495614_0140023_68_745 | 224 |
| 787 | 3300048903 | Ga0496100_0192306 | Ga0496100_0192306_582_1256 | 224 |
| 788 | 3300048905 | Ga0496102_0074809 | Ga0496102_0074809_537_1250 | 224 |
| 789 | 3300048905 | Ga0496102_0334117 | Ga0496102_0334117_181_864 | 224 |
| 790 | 3300048905 | Ga0496102_0482142 | Ga0496102_0482142_244_921 | 224 |
| 791 | 3300048906 | Ga0496103_0053830 | Ga0496103_0053830_1283_1960 | 224 |
| 792 | 3300048907 | Ga0496104_0000441 | Ga0496104_0000441_22785_23465 | 224 |
| 793 | 3300048907 | Ga0496104_0005513 | Ga0496104_0005513_8535_9209 | 224 |
| 794 | 3300048907 | Ga0496104_0012681 | Ga0496104_0012681_4586_5380 | 224 |
| 795 | 3300048908 | Ga0496105_0085888 | Ga0496105_0085888_58_738 | 224 |
| 796 | 3300048909 | Ga0496106_0334431 | Ga0496106_0334431_113_787 | 224 |
| 797 | 3300048909 | Ga0496106_0370120 | Ga0496106_0370120_420_1097 | 224 |
| 798 | 3300048909 | Ga0496106_0666185 | Ga0496106_0666185_121_798 | 224 |
| 799 | 3300048911 | Ga0496108_0000748 | Ga0496108_0000748_12516_13196 | 224 |
| 800 | 3300048911 | Ga0496108_0022231 | Ga0496108_0022231_4238_5032 | 224 |
| 801 | 3300048911 | Ga0496108_0022533 | Ga0496108_0022533_3406_4080 | 224 |
| 802 | 3300048911 | Ga0496108_0180850 | Ga0496108_0180850_629_1306 | 224 |
| 803 | 3300048911 | Ga0496108_0213929 | Ga0496108_0213929_81_758 | 224 |
| 804 | 3300048911 | Ga0496108_0546456 | Ga0496108_0546456_92_772 | 224 |
| 805 | 3300048912 | Ga0496109_0001743 | Ga0496109_0001743_4354_5034 | 224 |
| 806 | 3300048912 | Ga0496109_0152282 | Ga0496109_0152282_488_1282 | 224 |
| 807 | 3300048912 | Ga0496109_0170111 | Ga0496109_0170111_695_1375 | 224 |
| 808 | 3300048912 | Ga0496109_0207973 | Ga0496109_0207973_379_1053 | 224 |
| 809 | 3300048912 | Ga0496109_0246635 | Ga0496109_0246635_393_1070 | 224 |
| 810 | 3300048912 | Ga0496109_0458350 | Ga0496109_0458350_93_776 | 224 |
| 811 | 3300048913 | Ga0496110_0003033 | Ga0496110_0003033_2860_3540 | 224 |
| 812 | 3300048913 | Ga0496110_0032286 | Ga0496110_0032286_1714_2397 | 224 |
| 813 | 3300048913 | Ga0496110_0063852 | Ga0496110_0063852_134_847 | 224 |
| 814 | 3300048914 | Ga0496111_0001177 | Ga0496111_0001177_10914_11594 | 224 |
| 815 | 3300048914 | Ga0496111_0368051 | Ga0496111_0368051_373_1050 | 224 |
| 816 | 3300048915 | Ga0496112_0000159 | Ga0496112_0000159_1872_2546 | 224 |
| 817 | 3300048915 | Ga0496112_0337142 | Ga0496112_0337142_331_1125 | 224 |
| 818 | 3300048915 | Ga0496112_0412413 | Ga0496112_0412413_214_897 | 224 |
| 819 | 3300048916 | Ga0496113_0051315 | Ga0496113_0051315_2130_2810 | 224 |
| 820 | 3300048916 | Ga0496113_0054954 | Ga0496113_0054954_498_1292 | 224 |
| 821 | 3300048916 | Ga0496113_0710750 | Ga0496113_0710750_66_743 | 224 |
| 822 | 3300048917 | Ga0496114_0242525 | Ga0496114_0242525_823_1506 | 224 |
| 823 | 3300048917 | Ga0496114_0681767 | Ga0496114_0681767_195_875 | 224 |
| 824 | 3300048918 | Ga0496115_0106658 | Ga0496115_0106658_202_885 | 224 |
| 825 | 3300048918 | Ga0496115_0136170 | Ga0496115_0136170_512_1186 | 224 |
| 826 | 3300048918 | Ga0496115_0353438 | Ga0496115_0353438_85_798 | 224 |
| 827 | 3300048922 | Ga0496119_0083288 | Ga0496119_0083288_499_1176 | 224 |
| 828 | 3300048929 | Ga0496126_0007772 | Ga0496126_0007772_6297_6971 | 224 |
| 829 | 3300049568 | Ga0501031_0066544 | Ga0501031_0066544_831_1505 | 224 |
| 830 | 3300049569 | Ga0501032_0142716 | Ga0501032_0142716_660_1343 | 224 |
| 831 | 3300049570 | Ga0501033_0123128 | Ga0501033_0123128_1000_1686 | 224 |
| 832 | 3300049570 | Ga0501033_0299190 | Ga0501033_0299190_429_1103 | 224 |
| 833 | 3300049572 | Ga0501036_0012617 | Ga0501036_0012617_6321_6995 | 224 |
| 834 | 3300049572 | Ga0501036_0031750 | Ga0501036_0031750_943_1629 | 224 |
| 835 | 3300049572 | Ga0501036_0419841 | Ga0501036_0419841_219_902 | 224 |
| 836 | 3300049574 | Ga0501038_0055593 | Ga0501038_0055593_1733_2407 | 224 |
| 837 | 3300049575 | Ga0501039_0023712 | Ga0501039_0023712_3713_4399 | 224 |
| 838 | 3300049575 | Ga0501039_0183281 | Ga0501039_0183281_216_899 | 224 |
| 839 | 3300049575 | Ga0501039_0579009 | Ga0501039_0579009_68_742 | 224 |
| 840 | 3300049576 | Ga0501040_0005034 | Ga0501040_0005034_7266_7952 | 224 |
| 841 | 3300049578 | Ga0501042_0016519 | Ga0501042_0016519_3696_4382 | 224 |
| 842 | 3300049579 | Ga0501043_0238103 | Ga0501043_0238103_424_1098 | 224 |
| 843 | 3300049580 | Ga0501046_0064009 | Ga0501046_0064009_1503_2189 | 224 |
| 844 | 3300049581 | Ga0501047_0024344 | Ga0501047_0024344_118_792 | 224 |
| 845 | 3300049582 | Ga0501048_0006698 | Ga0501048_0006698_7919_8605 | 224 |
| 846 | 3300049583 | Ga0501067_0002370 | Ga0501067_0002370_8618_9292 | 224 |
| 847 | 3300049583 | Ga0501067_0217319 | Ga0501067_0217319_186_860 | 224 |
| 848 | 3300049584 | Ga0501068_0246065 | Ga0501068_0246065_313_999 | 224 |
| 849 | 3300049584 | Ga0501068_0396983 | Ga0501068_0396983_194_868 | 224 |
| 850 | 3300049586 | Ga0501070_0038435 | Ga0501070_0038435_2724_3416 | 224 |
| 851 | 3300049587 | Ga0501071_0004689 | Ga0501071_0004689_567_1253 | 224 |
| 852 | 3300049588 | Ga0501072_0006738 | Ga0501072_0006738_872_1558 | 224 |
| 853 | 3300049590 | Ga0501074_0141438 | Ga0501074_0141438_565_1251 | 224 |
| 854 | 3300049592 | Ga0501076_0038370 | Ga0501076_0038370_2016_2702 | 224 |
| 855 | 3300049593 | Ga0501077_0125451 | Ga0501077_0125451_40_726 | 224 |
| 856 | 3300049741 | Ga0501079_0024703 | Ga0501079_0024703_2880_3566 | 224 |
| 857 | 3300049742 | Ga0501080_0028140 | Ga0501080_0028140_3230_3904 | 224 |
| 858 | 3300049742 | Ga0501080_0268637 | Ga0501080_0268637_650_1333 | 224 |
| 859 | 3300049743 | Ga0501081_0156214 | Ga0501081_0156214_391_1077 | 224 |
| 860 | 3300049822 | Ga0501035_0036768 | Ga0501035_0036768_1181_1855 | 224 |
| 861 | 3300049823 | Ga0501044_0034810 | Ga0501044_0034810_2571_3245 | 224 |
| 862 | 3300049824 | Ga0501045_0053012 | Ga0501045_0053012_447_1133 | 224 |
| 863 | 3300050511 | nmdc:mga08y16_24926_c1 | nmdc:mga08y16_24926_c1_3609_4286 | 224 |
| 864 | 3300050513 | nmdc:mga0rr50_145490_c1 | nmdc:mga0rr50_145490_c1_326_1003 | 224 |
| 865 | 3300050513 | nmdc:mga0rr50_316648_c1 | nmdc:mga0rr50_316648_c1_13_804 | 224 |
| 866 | 3300050515 | nmdc:mga0a205_30845_c1 | nmdc:mga0a205_30845_c1_3035_3712 | 224 |
| 867 | 3300053077 | Ga0495601_0085937 | Ga0495601_0085937_527_1204 | 224 |
| 868 | 3300053077 | Ga0495601_0144616 | Ga0495601_0144616_841_1518 | 224 |
| 869 | 3300053078 | Ga0495612_0014977 | Ga0495612_0014977_28_711 | 224 |
| 870 | 3300053078 | Ga0495612_0130935 | Ga0495612_0130935_75_752 | 224 |
| 871 | 3300053084 | Ga0495595_0000162 | Ga0495595_0000162_9841_10551 | 224 |
| 872 | 3300053084 | Ga0495595_0004135 | Ga0495595_0004135_542_1327 | 224 |
| 873 | 3300053084 | Ga0495595_0019979 | Ga0495595_0019979_1603_2280 | 224 |
| 874 | 3300053084 | Ga0495595_0032891 | Ga0495595_0032891_1343_2026 | 224 |
| 875 | 3300053084 | Ga0495595_0154657 | Ga0495595_0154657_93_770 | 224 |
| 876 | 3300053085 | Ga0495619_0003428 | Ga0495619_0003428_100_777 | 224 |
| 877 | 3300053085 | Ga0495619_0256704 | Ga0495619_0256704_289_1074 | 224 |
| 878 | 3300053085 | Ga0495619_0316284 | Ga0495619_0316284_107_820 | 224 |
| 879 | 3300053085 | Ga0495619_0338068 | Ga0495619_0338068_206_889 | 224 |
| 880 | 3300054114 | Ga0501084_0052825 | Ga0501084_0052825_1232_1918 | 224 |
| 881 | 3300060353 | Ga0501082_0042883 | Ga0501082_0042883_986_1672 | 224 |
| 882 | 3300060353 | Ga0501082_0448009 | Ga0501082_0448009_152_832 | 224 |
| 883 | 3300061734 | Ga0530510_0018293 | Ga0530510_0018293_3543_4229 | 224 |
| 884 | 3300002077 | JGI24744J21845_10005151 | JGI24744J21845_100051512 | 225 |
| 885 | 3300005327 | Ga0070658_10023598 | Ga0070658_100235984 | 225 |
| 886 | 3300005329 | Ga0070683_100059709 | Ga0070683_1000597092 | 225 |
| 887 | 3300005329 | Ga0070683_100064566 | Ga0070683_1000645662 | 225 |
| 888 | 3300005331 | Ga0070670_100081101 | Ga0070670_1000811012 | 225 |
| 889 | 3300005336 | Ga0070680_100290980 | Ga0070680_1002909802 | 225 |
| 890 | 3300005337 | Ga0070682_100008855 | Ga0070682_1000088552 | 225 |
| 891 | 3300005339 | Ga0070660_100019041 | Ga0070660_1000190412 | 225 |
| 892 | 3300005347 | Ga0070668_100225900 | Ga0070668_1002259002 | 225 |
| 893 | 3300005354 | Ga0070675_100085263 | Ga0070675_1000852632 | 225 |
| 894 | 3300005438 | Ga0070701_10006868 | Ga0070701_100068683 | 225 |
| 895 | 3300005441 | Ga0070700_100009488 | Ga0070700_1000094884 | 225 |
| 896 | 3300005455 | Ga0070663_100331677 | Ga0070663_1003316772 | 225 |
| 897 | 3300005459 | Ga0068867_100007002 | Ga0068867_1000070024 | 225 |
| 898 | 3300005466 | Ga0070685_10391648 | Ga0070685_103916482 | 225 |
| 899 | 3300005530 | Ga0070679_100111734 | Ga0070679_1001117342 | 225 |
| 900 | 3300005535 | Ga0070684_100019292 | Ga0070684_1000192924 | 225 |
| 901 | 3300005535 | Ga0070684_100158834 | Ga0070684_1001588342 | 225 |
| 902 | 3300005543 | Ga0070672_100001312 | Ga0070672_10000131212 | 225 |
| 903 | 3300005544 | Ga0070686_100154360 | Ga0070686_1001543602 | 225 |
| 904 | 3300005547 | Ga0070693_100060807 | Ga0070693_1000608072 | 225 |
| 905 | 3300005564 | Ga0070664_100460177 | Ga0070664_1004601772 | 225 |
| 906 | 3300005578 | Ga0068854_100013890 | Ga0068854_1000138905 | 225 |
| 907 | 3300005614 | Ga0068856_100530346 | Ga0068856_1005303462 | 225 |
| 908 | 3300005615 | Ga0070702_100007486 | Ga0070702_1000074863 | 225 |
| 909 | 3300005615 | Ga0070702_100025155 | Ga0070702_1000251551 | 225 |
| 910 | 3300005618 | Ga0068864_100403177 | Ga0068864_1004031772 | 225 |
| 911 | 3300005719 | Ga0068861_100014698 | Ga0068861_1000146984 | 225 |
| 912 | 3300005840 | Ga0068870_10007764 | Ga0068870_100077644 | 225 |
| 913 | 3300005983 | Ga0081540_1006178 | Ga0081540_10061782 | 225 |
| 914 | 3300006844 | Ga0075428_100717706 | Ga0075428_1007177061 | 225 |
| 915 | 3300006881 | Ga0068865_100011812 | Ga0068865_1000118122 | 225 |
| 916 | 3300006881 | Ga0068865_100096507 | Ga0068865_1000965072 | 225 |
| 917 | 3300009094 | Ga0111539_10024563 | Ga0111539_100245632 | 225 |
| 918 | 3300009098 | Ga0105245_10017866 | Ga0105245_100178665 | 225 |
| 919 | 3300009147 | Ga0114129_10333104 | Ga0114129_103331042 | 225 |
| 920 | 3300009148 | Ga0105243_10002861 | Ga0105243_1000286116 | 225 |
| 921 | 3300009148 | Ga0105243_10275198 | Ga0105243_102751982 | 225 |
| 922 | 3300009551 | Ga0105238_10049831 | Ga0105238_100498314 | 225 |
| 923 | 3300009553 | Ga0105249_10016248 | Ga0105249_100162487 | 225 |
| 924 | 3300009553 | Ga0105249_10130704 | Ga0105249_101307042 | 225 |
| 925 | 3300010375 | Ga0105239_10130301 | Ga0105239_101303012 | 225 |
| 926 | 3300013104 | Ga0157370_10304658 | Ga0157370_103046582 | 225 |
| 927 | 3300013105 | Ga0157369_10043686 | Ga0157369_100436862 | 225 |
| 928 | 3300013306 | Ga0163162_10033664 | Ga0163162_100336642 | 225 |
| 929 | 3300013307 | Ga0157372_10070802 | Ga0157372_100708022 | 225 |
| 930 | 3300013307 | Ga0157372_10750118 | Ga0157372_107501181 | 225 |
| 931 | 3300014325 | Ga0163163_10357935 | Ga0163163_103579352 | 225 |
| 932 | 3300014326 | Ga0157380_10014664 | Ga0157380_100146644 | 225 |
| 933 | 3300014326 | Ga0157380_10482740 | Ga0157380_104827402 | 225 |
| 934 | 3300014968 | Ga0157379_10941423 | Ga0157379_109414232 | 225 |
| 935 | 3300020082 | Ga0206353_11138628 | Ga0206353_111386282 | 225 |
| 936 | 3300025315 | Ga0207697_10076100 | Ga0207697_100761002 | 225 |
| 937 | 3300025899 | Ga0207642_10046425 | Ga0207642_100464252 | 225 |
| 938 | 3300025901 | Ga0207688_10003336 | Ga0207688_100033369 | 225 |
| 939 | 3300025908 | Ga0207643_10014808 | Ga0207643_100148085 | 225 |
| 940 | 3300025909 | Ga0207705_10262640 | Ga0207705_102626402 | 225 |
| 941 | 3300025919 | Ga0207657_10028157 | Ga0207657_100281574 | 225 |
| 942 | 3300025921 | Ga0207652_10437911 | Ga0207652_104379112 | 225 |
| 943 | 3300025926 | Ga0207659_10301483 | Ga0207659_103014832 | 225 |
| 944 | 3300025927 | Ga0207687_10012294 | Ga0207687_100122944 | 225 |
| 945 | 3300025935 | Ga0207709_10021557 | Ga0207709_100215572 | 225 |
| 946 | 3300025935 | Ga0207709_10056214 | Ga0207709_100562142 | 225 |
| 947 | 3300025938 | Ga0207704_10060273 | Ga0207704_100602732 | 225 |
| 948 | 3300025940 | Ga0207691_10002759 | Ga0207691_1000275914 | 225 |
| 949 | 3300025944 | Ga0207661_10020538 | Ga0207661_100205383 | 225 |
| 950 | 3300025961 | Ga0207712_10041209 | Ga0207712_100412092 | 225 |
| 951 | 3300025972 | Ga0207668_10818972 | Ga0207668_108189721 | 225 |
| 952 | 3300025981 | Ga0207640_10592054 | Ga0207640_105920542 | 225 |
| 953 | 3300026023 | Ga0207677_10065603 | Ga0207677_100656032 | 225 |
| 954 | 3300026041 | Ga0207639_10294704 | Ga0207639_102947042 | 225 |
| 955 | 3300026067 | Ga0207678_10361747 | Ga0207678_103617472 | 225 |
| 956 | 3300026075 | Ga0207708_10000171 | Ga0207708_1000017112 | 225 |
| 957 | 3300026078 | Ga0207702_10534781 | Ga0207702_105347811 | 225 |
| 958 | 3300026089 | Ga0207648_10000926 | Ga0207648_100009265 | 225 |
| 959 | 3300026118 | Ga0207675_100021690 | Ga0207675_1000216904 | 225 |
| 960 | 3300026121 | Ga0207683_10040527 | Ga0207683_100405272 | 225 |
| 961 | 3300026142 | Ga0207698_10013511 | Ga0207698_100135115 | 225 |
| 962 | 3300027907 | Ga0207428_10170260 | Ga0207428_101702603 | 225 |
| 963 | 3300028380 | Ga0268265_10158734 | Ga0268265_101587342 | 225 |
| 964 | 3300035692 | Ga0373935_0206279 | Ga0373935_0206279_63_776 | 225 |
| 965 | 3300035725 | Ga0373947_0134795 | Ga0373947_0134795_183_896 | 225 |
| 966 | 3300045976 | Ga0466967_0076441 | Ga0466967_0076441_198_911 | 225 |
| 967 | 3300047315 | Ga0495581_0091086 | Ga0495581_0091086_723_1463 | 225 |
| 968 | 3300048905 | Ga0496102_0136609 | Ga0496102_0136609_655_1332 | 225 |
| 969 | 3300048911 | Ga0496108_0034966 | Ga0496108_0034966_445_1122 | 225 |
| 970 | 3300048913 | Ga0496110_0061091 | Ga0496110_0061091_1215_1892 | 225 |
| 971 | 3300050511 | nmdc:mga08y16_51474_c1 | nmdc:mga08y16_51474_c1_3400_4077 | 225 |
| 972 | 3300005435 | Ga0070714_100000452 | Ga0070714_10000045210 | 226 |
| 973 | 3300005435 | Ga0070714_100256254 | Ga0070714_1002562541 | 226 |
| 974 | 3300009147 | Ga0114129_10216522 | Ga0114129_102165225 | 226 |
| 975 | 3300009176 | Ga0105242_10010464 | Ga0105242_100104642 | 226 |
| 976 | 3300014325 | Ga0163163_10101314 | Ga0163163_101013142 | 226 |
| 977 | 3300025929 | Ga0207664_10002401 | Ga0207664_100024016 | 226 |
| 978 | 3300031456 | Ga0307513_10080092 | Ga0307513_100800922 | 226 |
| 979 | 3300031730 | Ga0307516_10153774 | Ga0307516_101537742 | 226 |
| 980 | 3300045049 | Ga0466959_0362030 | Ga0466959_0362030_122_802 | 226 |
| 981 | 3300045976 | Ga0466967_0943566 | Ga0466967_0943566_120_800 | 226 |
| 982 | iso_pu_bacteria | 2870782633 | 2870784859 | 226 |
| 983 | 3300005340 | Ga0070689_100564929 | Ga0070689_1005649292 | 227 |
| 984 | 3300013102 | Ga0157371_10431412 | Ga0157371_104314121 | 227 |
| 985 | iso_pu_bacteria | 8054472261 | 8054476347 | 227 |
| 986 | 3300005327 | Ga0070658_10283857 | Ga0070658_102838571 | 228 |
| 987 | 3300005328 | Ga0070676_10452015 | Ga0070676_104520151 | 228 |
| 988 | 3300005329 | Ga0070683_100101131 | Ga0070683_1001011312 | 228 |
| 989 | 3300005329 | Ga0070683_100321577 | Ga0070683_1003215771 | 228 |
| 990 | 3300005331 | Ga0070670_100628995 | Ga0070670_1006289951 | 228 |
| 991 | 3300005334 | Ga0068869_100030074 | Ga0068869_1000300742 | 228 |
| 992 | 3300005337 | Ga0070682_100151536 | Ga0070682_1001515361 | 228 |
| 993 | 3300005338 | Ga0068868_100024352 | Ga0068868_1000243523 | 228 |
| 994 | 3300005339 | Ga0070660_100397204 | Ga0070660_1003972041 | 228 |
| 995 | 3300005344 | Ga0070661_100030787 | Ga0070661_1000307874 | 228 |
| 996 | 3300005345 | Ga0070692_10195973 | Ga0070692_101959732 | 228 |
| 997 | 3300005347 | Ga0070668_100017010 | Ga0070668_1000170103 | 228 |
| 998 | 3300005353 | Ga0070669_100436787 | Ga0070669_1004367872 | 228 |
| 999 | 3300005354 | Ga0070675_100167581 | Ga0070675_1001675812 | 228 |
| 1000 | 3300005356 | Ga0070674_100068747 | Ga0070674_1000687472 | 228 |
| 1001 | 3300005365 | Ga0070688_100287082 | Ga0070688_1002870822 | 228 |
| 1002 | 3300005366 | Ga0070659_100155108 | Ga0070659_1001551082 | 228 |
| 1003 | 3300005436 | Ga0070713_100037406 | Ga0070713_1000374062 | 228 |
| 1004 | 3300005441 | Ga0070700_100278561 | Ga0070700_1002785611 | 228 |
| 1005 | 3300005455 | Ga0070663_100055561 | Ga0070663_1000555614 | 228 |
| 1006 | 3300005455 | Ga0070663_100233430 | Ga0070663_1002334302 | 228 |
| 1007 | 3300005456 | Ga0070678_100224580 | Ga0070678_1002245802 | 228 |
| 1008 | 3300005457 | Ga0070662_100063633 | Ga0070662_1000636332 | 228 |
| 1009 | 3300005466 | Ga0070685_10060364 | Ga0070685_100603642 | 228 |
| 1010 | 3300005466 | Ga0070685_10064127 | Ga0070685_100641272 | 228 |
| 1011 | 3300005535 | Ga0070684_100200043 | Ga0070684_1002000432 | 228 |
| 1012 | 3300005535 | Ga0070684_100743007 | Ga0070684_1007430071 | 228 |
| 1013 | 3300005539 | Ga0068853_100257281 | Ga0068853_1002572812 | 228 |
| 1014 | 3300005544 | Ga0070686_100112921 | Ga0070686_1001129211 | 228 |
| 1015 | 3300005547 | Ga0070693_100223269 | Ga0070693_1002232692 | 228 |
| 1016 | 3300005564 | Ga0070664_100548494 | Ga0070664_1005484941 | 228 |
| 1017 | 3300005577 | Ga0068857_100400311 | Ga0068857_1004003112 | 228 |
| 1018 | 3300005578 | Ga0068854_100011357 | Ga0068854_1000113574 | 228 |
| 1019 | 3300005615 | Ga0070702_100237246 | Ga0070702_1002372462 | 228 |
| 1020 | 3300005615 | Ga0070702_100379323 | Ga0070702_1003793231 | 228 |
| 1021 | 3300005616 | Ga0068852_100192661 | Ga0068852_1001926612 | 228 |
| 1022 | 3300005618 | Ga0068864_100068223 | Ga0068864_1000682233 | 228 |
| 1023 | 3300005618 | Ga0068864_100244236 | Ga0068864_1002442362 | 228 |
| 1024 | 3300005718 | Ga0068866_10092394 | Ga0068866_100923942 | 228 |
| 1025 | 3300005719 | Ga0068861_100069261 | Ga0068861_1000692614 | 228 |
| 1026 | 3300005834 | Ga0068851_10114771 | Ga0068851_101147712 | 228 |
| 1027 | 3300005840 | Ga0068870_10068076 | Ga0068870_100680761 | 228 |
| 1028 | 3300005841 | Ga0068863_100853033 | Ga0068863_1008530331 | 228 |
| 1029 | 3300005842 | Ga0068858_100224105 | Ga0068858_1002241052 | 228 |
| 1030 | 3300005842 | Ga0068858_100573081 | Ga0068858_1005730812 | 228 |
| 1031 | 3300005843 | Ga0068860_100021498 | Ga0068860_1000214984 | 228 |
| 1032 | 3300005843 | Ga0068860_100115439 | Ga0068860_1001154393 | 228 |
| 1033 | 3300005844 | Ga0068862_100014232 | Ga0068862_1000142324 | 228 |
| 1034 | 3300006028 | Ga0070717_10175368 | Ga0070717_101753683 | 228 |
| 1035 | 3300006237 | Ga0097621_100627844 | Ga0097621_1006278441 | 228 |
| 1036 | 3300006844 | Ga0075428_100553200 | Ga0075428_1005532002 | 228 |
| 1037 | 3300006881 | Ga0068865_100374407 | Ga0068865_1003744071 | 228 |
| 1038 | 3300009098 | Ga0105245_10101497 | Ga0105245_101014972 | 228 |
| 1039 | 3300009101 | Ga0105247_10540866 | Ga0105247_105408661 | 228 |
| 1040 | 3300009148 | Ga0105243_10362608 | Ga0105243_103626082 | 228 |
| 1041 | 3300009176 | Ga0105242_10208554 | Ga0105242_102085541 | 228 |
| 1042 | 3300009551 | Ga0105238_10229245 | Ga0105238_102292452 | 228 |
| 1043 | 3300010375 | Ga0105239_10109864 | Ga0105239_101098642 | 228 |
| 1044 | 3300011119 | Ga0105246_10095239 | Ga0105246_100952393 | 228 |
| 1045 | 3300013297 | Ga0157378_10498396 | Ga0157378_104983962 | 228 |
| 1046 | 3300013306 | Ga0163162_10236810 | Ga0163162_102368101 | 228 |
| 1047 | 3300013307 | Ga0157372_10634069 | Ga0157372_106340692 | 228 |
| 1048 | 3300014326 | Ga0157380_10532211 | Ga0157380_105322112 | 228 |
| 1049 | 3300017792 | Ga0163161_10052133 | Ga0163161_100521333 | 228 |
| 1050 | 3300025321 | Ga0207656_10105874 | Ga0207656_101058742 | 228 |
| 1051 | 3300025901 | Ga0207688_10121591 | Ga0207688_101215912 | 228 |
| 1052 | 3300025901 | Ga0207688_10128231 | Ga0207688_101282312 | 228 |
| 1053 | 3300025904 | Ga0207647_10045140 | Ga0207647_100451402 | 228 |
| 1054 | 3300025907 | Ga0207645_10031739 | Ga0207645_100317392 | 228 |
| 1055 | 3300025908 | Ga0207643_10023975 | Ga0207643_100239751 | 228 |
| 1056 | 3300025911 | Ga0207654_10051541 | Ga0207654_100515412 | 228 |
| 1057 | 3300025920 | Ga0207649_10066986 | Ga0207649_100669862 | 228 |
| 1058 | 3300025927 | Ga0207687_10044430 | Ga0207687_100444303 | 228 |
| 1059 | 3300025927 | Ga0207687_10242425 | Ga0207687_102424252 | 228 |
| 1060 | 3300025928 | Ga0207700_10085111 | Ga0207700_100851112 | 228 |
| 1061 | 3300025929 | Ga0207664_10017597 | Ga0207664_100175973 | 228 |
| 1062 | 3300025933 | Ga0207706_10101311 | Ga0207706_101013112 | 228 |
| 1063 | 3300025934 | Ga0207686_10199327 | Ga0207686_101993273 | 228 |
| 1064 | 3300025935 | Ga0207709_10049174 | Ga0207709_100491742 | 228 |
| 1065 | 3300025936 | Ga0207670_10076188 | Ga0207670_100761882 | 228 |
| 1066 | 3300025937 | Ga0207669_10050661 | Ga0207669_100506611 | 228 |
| 1067 | 3300025938 | Ga0207704_10676032 | Ga0207704_106760321 | 228 |
| 1068 | 3300025942 | Ga0207689_10078275 | Ga0207689_100782752 | 228 |
| 1069 | 3300025942 | Ga0207689_10284620 | Ga0207689_102846202 | 228 |
| 1070 | 3300025944 | Ga0207661_10082632 | Ga0207661_100826322 | 228 |
| 1071 | 3300025944 | Ga0207661_10246257 | Ga0207661_102462572 | 228 |
| 1072 | 3300025945 | Ga0207679_10412030 | Ga0207679_104120302 | 228 |
| 1073 | 3300025949 | Ga0207667_10783030 | Ga0207667_107830302 | 228 |
| 1074 | 3300025960 | Ga0207651_10447590 | Ga0207651_104475902 | 228 |
| 1075 | 3300025981 | Ga0207640_10034135 | Ga0207640_100341352 | 228 |
| 1076 | 3300025981 | Ga0207640_10485021 | Ga0207640_104850211 | 228 |
| 1077 | 3300026023 | Ga0207677_10258882 | Ga0207677_102588822 | 228 |
| 1078 | 3300026023 | Ga0207677_10557749 | Ga0207677_105577492 | 228 |
| 1079 | 3300026035 | Ga0207703_10082642 | Ga0207703_100826422 | 228 |
| 1080 | 3300026035 | Ga0207703_10344111 | Ga0207703_103441111 | 228 |
| 1081 | 3300026067 | Ga0207678_10116286 | Ga0207678_101162862 | 228 |
| 1082 | 3300026075 | Ga0207708_10013641 | Ga0207708_100136414 | 228 |
| 1083 | 3300026075 | Ga0207708_10141025 | Ga0207708_101410252 | 228 |
| 1084 | 3300026088 | Ga0207641_10067667 | Ga0207641_100676672 | 228 |
| 1085 | 3300026089 | Ga0207648_10021225 | Ga0207648_100212252 | 228 |
| 1086 | 3300026095 | Ga0207676_10060211 | Ga0207676_100602112 | 228 |
| 1087 | 3300026116 | Ga0207674_10050070 | Ga0207674_100500702 | 228 |
| 1088 | 3300026142 | Ga0207698_10087552 | Ga0207698_100875523 | 228 |
| 1089 | 3300027907 | Ga0207428_10312454 | Ga0207428_103124541 | 228 |
| 1090 | 3300028380 | Ga0268265_10021593 | Ga0268265_100215933 | 228 |
| 1091 | 3300028380 | Ga0268265_10838033 | Ga0268265_108380332 | 228 |
| 1092 | 3300028381 | Ga0268264_10015344 | Ga0268264_100153445 | 228 |
| 1093 | 3300048905 | Ga0496102_0662145 | Ga0496102_0662145_252_938 | 228 |
| 1094 | 3300048911 | Ga0496108_0148646 | Ga0496108_0148646_672_1358 | 228 |
| 1095 | 3300048912 | Ga0496109_0248074 | Ga0496109_0248074_979_1665 | 228 |
| 1096 | 3300048913 | Ga0496110_0158974 | Ga0496110_0158974_374_1060 | 228 |
| 1097 | 3300048914 | Ga0496111_0161411 | Ga0496111_0161411_507_1193 | 228 |
| 1098 | 3300048915 | Ga0496112_0751517 | Ga0496112_0751517_148_834 | 228 |
| 1099 | 3300002067 | JGI24735J21928_10093592 | JGI24735J21928_100935921 | 229 |
| 1100 | 3300009094 | Ga0111539_10865089 | Ga0111539_108650891 | 229 |
| 1101 | 3300009148 | Ga0105243_10316852 | Ga0105243_103168522 | 229 |
| 1102 | 3300009174 | Ga0105241_10103218 | Ga0105241_101032183 | 229 |
| 1103 | 3300010375 | Ga0105239_10238761 | Ga0105239_102387612 | 229 |
| 1104 | 3300011119 | Ga0105246_10093187 | Ga0105246_100931872 | 229 |
| 1105 | 3300013296 | Ga0157374_10223871 | Ga0157374_102238712 | 229 |
| 1106 | 3300014325 | Ga0163163_10327439 | Ga0163163_103274392 | 229 |
| 1107 | 3300031456 | Ga0307513_10024342 | Ga0307513_100243421 | 229 |
| 1108 | 3300048916 | Ga0496113_0381641 | Ga0496113_0381641_325_1017 | 229 |
| 1109 | 3300048917 | Ga0496114_0286236 | Ga0496114_0286236_366_1058 | 229 |
| 1110 | 3300050511 | nmdc:mga08y16_1241598_c1 | nmdc:mga08y16_1241598_c1_12_704 | 229 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2a9r-assembly1.cif.gz_A-2 | rr02-rec phosphate in the active site | 0.9689 | 5 | 120 |
| 1nxt-assembly1.cif.gz_A-2 | micarec ph 4.0 | 0.9687 | 5 | 120 |
| 1nxx-assembly1.cif.gz_A-2 | micarec ph 5.5 | 0.9667 | 5 | 120 |
| 8fk2-assembly1.cif.gz_B | the n-terminal vicr from streptococcus mutans | 0.9619 | 4 | 121 |
| 2zwm-assembly1.cif.gz_B | crystal structure of yycf receiver domain from bacillus subtilis | 0.9613 | 4 | 120 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WGN1_2_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9964 | 5 | 82 | 3.40.50.2300 |
| af_P21866_1_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9898 | 4 | 82 | 3.40.50.2300 |
| af_O69730_8_88_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9777 | 4 | 82 | 3.40.50.2300 |
| af_P9WGM1_5_87_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9765 | 1 | 82 | 3.40.50.2300 |
| af_P9WGN1_2_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9716 | 5 | 82 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X9Q292-F1-model_v4 | DNA-binding response regulator | 0.9805 | 128 | 228 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A7C1YRM9-F1-model_v4 | Winged helix family transcriptional regulator | 0.967 | 144 | 228 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A0B0H5R4-F1-model_v4 | Response regulator | 0.9663 | 3 | 116 |
GO:0000160
|
| AF-A0A7V2QLS0-F1-model_v4 | Response regulator | 0.9649 | 2 | 119 |
GO:0000160
|
| AF-A0A496VL76-F1-model_v4 | Response regulatory domain-containing protein | 0.9635 | 3 | 119 |
GO:0000160
GO:0016772 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar