F490213

General Info

Members Datasets Scaffolds Average Seq Length
1110 415 2220 325

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10011732|Ga0081455_100117328
Length 373
Sequence MHGFSLEMHLHVTGCAFAGMTVEKDDSSATGHTRDAQQDERICDMRHAVTLKGLACLTALVLAAAPWDARAQSYPSRPITVVVPFPAGGPSDVVARIVTEQMGTILGQSMVIENVGGAGGTIGSARVAGAQPDGYTLLAGSMGSHVAAPVLTPNVKYDSERDFEPIGFTAHAPAVIVARKDFPAKDLREFVDYLKKNGDAVKQAHGGIGASSHMACLLFAAKAGVKPTLVAYRGTAPAMNDLVGGHVDFFCEQAVSVAPQISSGAIKAYGVSARERLAILPDVPTAKEAGIDYDMSIWAGIFAPKGTPKDVIDKLARALDQALDDPGVKKRLADLGGSLPTKDERTPAKFDAFVKAEIARWSPILKTANTETK

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
79 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
80 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
81 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
82 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
83 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
84 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
85 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
86 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
87 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
88 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
89 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
90 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
91 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
92 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
93 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
95 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
96 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
97 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
98 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
99 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
100 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
101 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
102 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
103 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
104 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
106 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
107 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
108 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
109 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
110 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
112 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
113 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
115 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
116 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
117 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
118 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
119 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
120 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
121 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
122 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
123 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
124 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
125 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
126 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
127 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
128 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
129 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
130 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
131 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
132 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
133 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
134 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
135 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
136 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
137 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
138 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
139 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
198 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
199 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
203 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
204 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
205 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
206 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
207 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
208 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
209 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
210 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
211 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
212 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
213 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
214 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
215 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
216 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
217 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
218 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
219 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
220 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
221 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
222 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
223 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
224 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
225 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
226 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
227 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
228 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
229 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
230 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
231 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
232 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
233 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
234 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
235 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
236 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
237 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
238 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
239 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
240 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
241 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
242 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
243 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
244 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
245 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
246 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
247 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
248 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
249 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
250 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
251 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
252 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
253 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
254 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
255 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
256 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
257 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
258 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
259 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
260 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
261 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
262 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
263 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
264 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
265 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
266 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
267 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
268 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
269 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
270 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
271 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
272 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
273 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
274 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
275 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
276 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
277 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
278 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
279 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
280 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
281 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
282 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
283 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
284 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
285 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
286 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
287 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
288 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
289 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
290 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
291 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
292 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
293 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
294 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
295 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
296 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
297 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
298 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
299 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
300 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
301 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
302 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
303 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
304 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
305 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
306 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
307 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
308 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
309 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
310 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
311 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
312 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
313 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
314 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
315 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
316 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
317 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
318 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
319 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
320 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
321 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
322 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
323 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
324 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
325 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
326 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
327 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
328 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
329 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
330 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
331 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
332 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
333 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
334 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
335 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
336 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
337 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
338 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
339 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
340 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
347 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
348 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
349 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
350 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
351 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
352 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
353 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
354 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
355 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
356 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
359 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
360 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
361 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
362 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
363 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
364 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
365 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
366 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
367 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
368 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
369 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
370 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
371 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
372 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
373 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
374 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
375 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
376 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
377 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
378 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
379 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
380 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
381 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
382 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
383 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
384 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
385 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
386 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
387 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
388 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
389 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
390 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
391 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
392 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
393 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
394 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
395 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
396 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
397 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
398 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
399 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
400 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
401 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
402 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
403 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
404 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
405 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
406 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
407 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
408 2791355199
409 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
410 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
411 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
412 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
413 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
414 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
415 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.28
Metatranscriptomes 0
Isolates 0.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.92
Nodule 0.27
Rhizoplane 8.56
Rhizosphere 80.09
Stem 0
Stem Tuber 0
Unclassified 5.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10011732 3300005937 Bacteria 8782
2 JGI24750J21931_1000889 3300002070 Bacteria 4093
3 JGI24744J21845_10000391 3300002077 Bacteria 7532
4 JGI24742J22300_10025552 3300002244 Bacteria 1021
5 JGI25406J46586_10004281 3300003203 Bacteria 6668
6 JGI25406J46586_10005104 3300003203 Bacteria 6091
7 JGI25153J46596_10002190 3300003215 Bacteria 11406
8 JGI25404J52841_10002634 3300003659 Bacteria 3424
9 JGI25404J52841_10015190 3300003659 Bacteria 1672
10 Ga0070676_10174554 3300005328 Bacteria 1393
11 Ga0070683_100591791 3300005329 Bacteria 1061
12 Ga0070670_100017319 3300005331 Bacteria 6180
13 Ga0070670_100226205 3300005331 Bacteria 1628
14 Ga0070677_10155014 3300005333 Bacteria 1069
15 Ga0068869_100024381 3300005334 Bacteria 4190
16 Ga0068869_100210379 3300005334 Bacteria 1537
17 Ga0070666_10050373 3300005335 Unclassified 2801
18 Ga0070680_100130833 3300005336 Bacteria 2100
19 Ga0070680_100208752 3300005336 Bacteria 1647
20 Ga0070682_100115362 3300005337 Bacteria 1796
21 Ga0068868_100033796 3300005338 Bacteria 3944
22 Ga0068868_100055724 3300005338 Bacteria 3120
23 Ga0068868_100056637 3300005338 Bacteria 3096
24 Ga0070660_100131451 3300005339 Bacteria 2003
25 Ga0070689_100010283 3300005340 Bacteria 6668
26 Ga0070689_100019103 3300005340 Bacteria 5062
27 Ga0070689_100067415 3300005340 Bacteria 2790
28 Ga0070689_100124664 3300005340 Bacteria 2060
29 Ga0070689_100192611 3300005340 Bacteria 1661
30 Ga0070689_100296181 3300005340 Bacteria 1346
31 Ga0070691_10028162 3300005341 Bacteria 2624
32 Ga0070687_100024371 3300005343 Bacteria 2888
33 Ga0070687_100070446 3300005343 Bacteria 1876
34 Ga0070687_100190436 3300005343 Unclassified 1236
35 Ga0070661_100090767 3300005344 Bacteria 2262
36 Ga0070692_10030726 3300005345 Bacteria 2688
37 Ga0070692_10036227 3300005345 Plasmid 2503
38 Ga0070692_10130013 3300005345 Bacteria 1414
39 Ga0070668_100046375 3300005347 Bacteria 3337
40 Ga0070668_100049732 3300005347 Unclassified 3225
41 Ga0070669_100006968 3300005353 Bacteria 8122
42 Ga0070669_100058552 3300005353 Bacteria 2828
43 Ga0070669_100164406 3300005353 Bacteria 1727
44 Ga0070669_100292720 3300005353 Bacteria 1308
45 Ga0070675_100010672 3300005354 Bacteria 7182
46 Ga0070675_100061551 3300005354 Bacteria 3099
47 Ga0070675_100092950 3300005354 Bacteria 2529
48 Ga0070675_100118964 3300005354 Unclassified 2243
49 Ga0070671_100003829 3300005355 Bacteria 11817
50 Ga0070671_100028496 3300005355 Bacteria 4598
51 Ga0070671_100064321 3300005355 Bacteria 3055
52 Ga0070671_100083958 3300005355 Bacteria 2663
53 Ga0070671_100098269 3300005355 Unclassified 2455
54 Ga0070671_100426887 3300005355 Unclassified 1136
55 Ga0070674_100006772 3300005356 Bacteria 6711
56 Ga0070674_100010698 3300005356 Bacteria 5559
57 Ga0070674_100024307 3300005356 Bacteria 3931
58 Ga0070674_100033803 3300005356 Bacteria 3407
59 Ga0070674_100084156 3300005356 Bacteria 2280
60 Ga0070674_100142174 3300005356 Bacteria 1802
61 Ga0070674_100161819 3300005356 Bacteria 1699
62 Ga0070674_100198831 3300005356 Bacteria 1546
63 Ga0070673_100021834 3300005364 Bacteria 4650
64 Ga0070673_100046783 3300005364 Bacteria 3362
65 Ga0070673_100066975 3300005364 Bacteria 2870
66 Ga0070688_100056381 3300005365 Bacteria 2468
67 Ga0070688_100104682 3300005365 Bacteria 1872
68 Ga0070688_100195804 3300005365 Bacteria 1411
69 Ga0070659_100031532 3300005366 Bacteria 4106
70 Ga0070659_100142622 3300005366 Bacteria 1951
71 Ga0070659_100257732 3300005366 Unclassified 1447
72 Ga0070659_100406829 3300005366 Bacteria 1149
73 Ga0070667_100015027 3300005367 Bacteria 6396
74 Ga0070667_100027938 3300005367 Bacteria 4694
75 Ga0070667_100083681 3300005367 Bacteria 2734
76 Ga0070709_10005461 3300005434 Bacteria 6886
77 Ga0070709_10220297 3300005434 Bacteria 1353
78 Ga0070714_100031250 3300005435 Bacteria 4442
79 Ga0070714_100061470 3300005435 Bacteria 3226
80 Ga0070714_100337216 3300005435 Bacteria 1413
81 Ga0070713_100014160 3300005436 Bacteria 5910
82 Ga0070713_100145400 3300005436 Bacteria 2104
83 Ga0070713_100150250 3300005436 Bacteria 2071
84 Ga0070713_100199301 3300005436 Bacteria 1807
85 Ga0070713_100241346 3300005436 Bacteria 1645
86 Ga0070710_10010533 3300005437 Bacteria 4545
87 Ga0070710_10012586 3300005437 Bacteria 4207
88 Ga0070710_10042502 3300005437 Bacteria 2513
89 Ga0070710_10058428 3300005437 Bacteria 2188
90 Ga0070701_10004472 3300005438 Bacteria 5672
91 Ga0070701_10145532 3300005438 Bacteria 1359
92 Ga0070711_100041381 3300005439 Bacteria 3112
93 Ga0070711_100080723 3300005439 Bacteria 2317
94 Ga0070711_100102224 3300005439 Bacteria 2087
95 Ga0070711_100185592 3300005439 Bacteria 1594
96 Ga0070711_100257011 3300005439 Bacteria 1373
97 Ga0070705_100061390 3300005440 Bacteria 2234
98 Ga0070705_100078880 3300005440 Bacteria 2015
99 Ga0070700_100056600 3300005441 Bacteria 2459
100 Ga0070700_100072768 3300005441 Bacteria 2198
101 Ga0070700_100100530 3300005441 Unclassified 1904
102 Ga0070700_100112083 3300005441 Bacteria 1815
103 Ga0070700_100119797 3300005441 Bacteria 1762
104 Ga0070694_100019929 3300005444 Bacteria 4271
105 Ga0070708_100069806 3300005445 Bacteria 3160
106 Ga0070708_100189853 3300005445 Bacteria 1921
107 Ga0070663_100003523 3300005455 Bacteria 9032
108 Ga0070663_100057583 3300005455 Bacteria 2788
109 Ga0070663_100088698 3300005455 Bacteria 2287
110 Ga0070663_100344084 3300005455 Bacteria 1206
111 Ga0070678_100047943 3300005456 Bacteria 3073
112 Ga0070678_100074012 3300005456 Bacteria 2558
113 Ga0070678_100118789 3300005456 Bacteria 2081
114 Ga0070678_100122452 3300005456 Bacteria 2053
115 Ga0070678_100148650 3300005456 Bacteria 1884
116 Ga0070662_100073619 3300005457 Bacteria 2524
117 Ga0070662_100099204 3300005457 Bacteria 2201
118 Ga0070662_100129384 3300005457 Bacteria 1944
119 Ga0070662_100147207 3300005457 Bacteria 1830
120 Ga0070681_10132681 3300005458 Bacteria 2422
121 Ga0070681_10204374 3300005458 Bacteria 1893
122 Ga0068867_100009135 3300005459 Bacteria 6994
123 Ga0070685_10003711 3300005466 Bacteria 7729
124 Ga0070685_10024316 3300005466 Unclassified 3326
125 Ga0070685_10040183 3300005466 Bacteria 2661
126 Ga0070685_10226995 3300005466 Bacteria 1226
127 Ga0070706_100037571 3300005467 Unclassified 4472
128 Ga0070698_100389246 3300005471 Bacteria 1327
129 Ga0070699_100044495 3300005518 Bacteria 3843
130 Ga0070699_100369125 3300005518 Unclassified 1294
131 Ga0070684_100050829 3300005535 Unclassified 3601
132 Ga0070684_100090261 3300005535 Bacteria 2724
133 Ga0070697_100039116 3300005536 Bacteria 3834
134 Ga0070697_100120632 3300005536 Bacteria 2193
135 Ga0070697_100133465 3300005536 Bacteria 2083
136 Ga0068853_100071702 3300005539 Bacteria 3017
137 Ga0068853_100113939 3300005539 Bacteria 2405
138 Ga0068853_100141681 3300005539 Bacteria 2158
139 Ga0068853_100161258 3300005539 Unclassified 2024
140 Ga0070672_100037653 3300005543 Bacteria 3691
141 Ga0070672_100061976 3300005543 Bacteria 2950
142 Ga0070672_100188998 3300005543 Bacteria 1719
143 Ga0070672_100493386 3300005543 Bacteria 1059
144 Ga0070686_100002493 3300005544 Bacteria 10135
145 Ga0070686_100204398 3300005544 Bacteria 1418
146 Ga0070695_100002513 3300005545 Bacteria 10572
147 Ga0070695_100004291 3300005545 Bacteria 8344
148 Ga0070696_100105837 3300005546 Bacteria 2021
149 Ga0070696_100315380 3300005546 Bacteria 1202
150 Ga0070693_100050186 3300005547 Bacteria 2384
151 Ga0070693_100171287 3300005547 Bacteria 1391
152 Ga0070665_100026385 3300005548 Bacteria 5851
153 Ga0070665_100120172 3300005548 Bacteria 2629
154 Ga0070704_100446560 3300005549 Bacteria 1113
155 Ga0068855_100210694 3300005563 Bacteria 2184
156 Ga0070664_100091097 3300005564 Bacteria 2639
157 Ga0070664_100126126 3300005564 Bacteria 2246
158 Ga0068857_100104663 3300005577 Bacteria 2541
159 Ga0068854_100338084 3300005578 Bacteria 1229
160 Ga0068854_100377911 3300005578 Unclassified 1167
161 Ga0068854_100389033 3300005578 Bacteria 1151
162 Ga0068856_100074656 3300005614 Bacteria 3357
163 Ga0068856_100134560 3300005614 Bacteria 2477
164 Ga0068856_100234108 3300005614 Bacteria 1852
165 Ga0070702_100012167 3300005615 Bacteria 4302
166 Ga0070702_100015685 3300005615 Unclassified 3874
167 Ga0068852_100079355 3300005616 Unclassified 2907
168 Ga0068852_100088389 3300005616 Bacteria 2767
169 Ga0068859_100104992 3300005617 Bacteria 2885
170 Ga0068859_100121689 3300005617 Bacteria 2676
171 Ga0068859_100122305 3300005617 Bacteria 2670
172 Ga0068859_100167891 3300005617 Bacteria 2274
173 Ga0068859_100307471 3300005617 Bacteria 1679
174 Ga0068859_100382420 3300005617 Bacteria 1503
175 Ga0068864_100011177 3300005618 Bacteria 7418
176 Ga0068864_100036792 3300005618 Bacteria 4174
177 Ga0068864_100047643 3300005618 Unclassified 3682
178 Ga0068864_100066167 3300005618 Bacteria 3136
179 Ga0068866_10017075 3300005718 Bacteria 3257
180 Ga0068866_10023911 3300005718 Bacteria 2848
181 Ga0068866_10110868 3300005718 Bacteria 1531
182 Ga0068866_10135016 3300005718 Bacteria 1409
183 Ga0068861_100078096 3300005719 Bacteria 2584
184 Ga0068861_100124851 3300005719 Bacteria 2081
185 Ga0068861_100394379 3300005719 Unclassified 1226
186 Ga0068851_10083567 3300005834 Bacteria 1671
187 Ga0068870_10001278 3300005840 Bacteria 10113
188 Ga0068870_10040514 3300005840 Bacteria 2416
189 Ga0068870_10164593 3300005840 Bacteria 1319
190 Ga0068863_100077713 3300005841 Bacteria 3141
191 Ga0068863_100473032 3300005841 Bacteria 1231
192 Ga0068863_100511551 3300005841 Unclassified 1183
193 Ga0068863_100518417 3300005841 Bacteria 1175
194 Ga0068858_100003359 3300005842 Bacteria 15938
195 Ga0068858_100038474 3300005842 Bacteria 4437
196 Ga0068858_100350278 3300005842 Bacteria 1415
197 Ga0068860_100047356 3300005843 Bacteria 4098
198 Ga0068860_100054250 3300005843 Bacteria 3810
199 Ga0068860_100245889 3300005843 Bacteria 1741
200 Ga0068860_100632286 3300005843 Bacteria 1077
201 Ga0068862_100010721 3300005844 Bacteria 7568
202 Ga0068862_100011858 3300005844 Bacteria 7198
203 Ga0068862_100068511 3300005844 Bacteria 3061
204 Ga0068862_100098142 3300005844 Bacteria 2559
205 Ga0068862_100147137 3300005844 Bacteria 2094
206 Ga0081455_10006073 3300005937 Bacteria 13074
207 Ga0081455_10006153 3300005937 Bacteria 12947
208 Ga0081455_10007998 3300005937 Bacteria 11052
209 Ga0081455_10024867 3300005937 Bacteria 5536
210 Ga0081455_10058745 3300005937 Bacteria 3252
211 Ga0081455_10167377 3300005937 Unclassified 1678
212 Ga0081538_10009001 3300005981 Bacteria 8386
213 Ga0081538_10024689 3300005981 Bacteria 4274
214 Ga0081538_10036784 3300005981 Bacteria 3187
215 Ga0081540_1000338 3300005983 Bacteria 48150
216 Ga0081540_1001883 3300005983 Bacteria 17565
217 Ga0081540_1005306 3300005983 Bacteria 9644
218 Ga0081540_1005989 3300005983 Bacteria 8956
219 Ga0081540_1014606 3300005983 Bacteria 5019
220 Ga0081540_1017298 3300005983 Bacteria 4468
221 Ga0081540_1035157 3300005983 Bacteria 2690
222 Ga0081540_1050305 3300005983 Bacteria 2071
223 Ga0081540_1077100 3300005983 Bacteria 1516
224 Ga0081539_10001094 3300005985 Bacteria 49286
225 Ga0081539_10002062 3300005985 Bacteria 30115
226 Ga0081539_10052260 3300005985 Bacteria 2297
227 Ga0070717_10003746 3300006028 Bacteria 10919
228 Ga0070717_10119097 3300006028 Bacteria 2260
229 Ga0070717_10139481 3300006028 Bacteria 2090
230 Ga0070717_10379216 3300006028 Bacteria 1268
231 Ga0070717_10388707 3300006028 Bacteria 1252
232 Ga0075365_10000347 3300006038 Bacteria 16588
233 Ga0075365_10005992 3300006038 Bacteria 6635
234 Ga0075365_10007347 3300006038 Bacteria 6162
235 Ga0075365_10018670 3300006038 Unclassified 4269
236 Ga0075365_10019141 3300006038 Bacteria 4220
237 Ga0075365_10042158 3300006038 Bacteria 2983
238 Ga0075365_10112619 3300006038 Bacteria 1871
239 Ga0075365_10139950 3300006038 Bacteria 1679
240 Ga0075368_10003192 3300006042 Bacteria 5447
241 Ga0075368_10010918 3300006042 Bacteria 3294
242 Ga0075368_10014306 3300006042 Bacteria 2928
243 Ga0075368_10024541 3300006042 Bacteria 2311
244 Ga0075368_10073427 3300006042 Bacteria 1384
245 Ga0075363_100011774 3300006048 Bacteria 4197
246 Ga0075363_100029709 3300006048 Bacteria 2824
247 Ga0075364_10014842 3300006051 Bacteria 4820
248 Ga0075364_10095053 3300006051 Bacteria 1981
249 Ga0075364_10113145 3300006051 Bacteria 1812
250 Ga0070715_10004466 3300006163 Bacteria 4594
251 Ga0070715_10031473 3300006163 Bacteria 2154
252 Ga0070716_100136132 3300006173 Bacteria 1560
253 Ga0070712_100053086 3300006175 Bacteria 2829
254 Ga0070712_100323446 3300006175 Bacteria 1255
255 Ga0075362_10054948 3300006177 Bacteria 1791
256 Ga0075362_10085255 3300006177 Bacteria 1460
257 Ga0075367_10009833 3300006178 Bacteria 5011
258 Ga0075367_10035076 3300006178 Bacteria 2901
259 Ga0075367_10036670 3300006178 Bacteria 2845
260 Ga0075367_10059545 3300006178 Bacteria 2274
261 Ga0075367_10064015 3300006178 Bacteria 2199
262 Ga0075367_10067304 3300006178 Bacteria 2147
263 Ga0075367_10071557 3300006178 Bacteria 2086
264 Ga0075367_10125567 3300006178 Bacteria 1583
265 Ga0075369_10040923 3300006186 Bacteria 1982
266 Ga0075366_10031572 3300006195 Plasmid 3117
267 Ga0075366_10054064 3300006195 Bacteria 2385
268 Ga0097621_100021567 3300006237 Bacteria 4986
269 Ga0097621_100071368 3300006237 Plasmid 2870
270 Ga0097621_100097497 3300006237 Bacteria 2468
271 Ga0097621_100159309 3300006237 Bacteria 1939
272 Ga0097621_100267820 3300006237 Bacteria 1500
273 Ga0075370_10018836 3300006353 Bacteria 3749
274 Ga0075370_10082039 3300006353 Bacteria 1854
275 Ga0068871_100088999 3300006358 Bacteria 2569
276 Ga0075428_100004072 3300006844 Bacteria 16071
277 Ga0075428_100070572 3300006844 Bacteria 3819
278 Ga0075428_100124305 3300006844 Bacteria 2808
279 Ga0075428_100194510 3300006844 Bacteria 2194
280 Ga0075428_100236159 3300006844 Bacteria 1973
281 Ga0075428_100285113 3300006844 Bacteria 1777
282 Ga0075428_100503652 3300006844 Bacteria 1296
283 Ga0075428_100557468 3300006844 Bacteria 1225
284 Ga0075430_100010962 3300006846 Bacteria 7680
285 Ga0075430_100043636 3300006846 Bacteria 3791
286 Ga0075430_100058315 3300006846 Bacteria 3245
287 Ga0075430_100109479 3300006846 Bacteria 2304
288 Ga0075431_100000021 3300006847 Bacteria 82774
289 Ga0075431_100040334 3300006847 Bacteria 4811
290 Ga0075431_100095125 3300006847 Bacteria 3075
291 Ga0075431_100300640 3300006847 Bacteria 1621
292 Ga0075433_10104205 3300006852 Bacteria 2513
293 Ga0075433_10419190 3300006852 Bacteria 1181
294 Ga0075434_100003972 3300006871 Bacteria 13246
295 Ga0075434_100046006 3300006871 Bacteria 4331
296 Ga0075429_100022600 3300006880 Bacteria 5452
297 Ga0075429_100045168 3300006880 Bacteria 3832
298 Ga0075429_100142580 3300006880 Bacteria 2097
299 Ga0068865_100013556 3300006881 Bacteria 5155
300 Ga0068865_100025863 3300006881 Bacteria 3865
301 Ga0075436_100037211 3300006914 Bacteria 3360
302 Ga0075436_100070687 3300006914 Bacteria 2413
303 Ga0097620_100104990 3300006931 Bacteria 2885
304 Ga0097620_100121693 3300006931 Bacteria 2676
305 Ga0097620_100122310 3300006931 Bacteria 2670
306 Ga0097620_100167895 3300006931 Bacteria 2274
307 Ga0097620_100307489 3300006931 Bacteria 1679
308 Ga0097620_100382384 3300006931 Bacteria 1503
309 Ga0075435_100003318 3300007076 Bacteria 10917
310 Ga0075435_100053822 3300007076 Bacteria 3247
311 Ga0075435_100103814 3300007076 Bacteria 2358
312 Ga0099794_10001204 3300007265 Bacteria 8916
313 Ga0099795_10036431 3300007788 Bacteria 1726
314 Ga0105250_10041945 3300009092 Bacteria 1834
315 Ga0105240_10540807 3300009093 Bacteria 1290
316 Ga0111539_10001676 3300009094 Bacteria 29539
317 Ga0111539_10019188 3300009094 Bacteria 8448
318 Ga0111539_10181331 3300009094 Bacteria 2459
319 Ga0111539_10289874 3300009094 Bacteria 1905
320 Ga0111539_10355627 3300009094 Bacteria 1704
321 Ga0105245_10008525 3300009098 Bacteria 8942
322 Ga0105245_10044105 3300009098 Bacteria 3979
323 Ga0105245_10212793 3300009098 Bacteria 1861
324 Ga0105245_10226751 3300009098 Unclassified 1805
325 Ga0105245_10361400 3300009098 Bacteria 1441
326 Ga0105247_10006686 3300009101 Bacteria 7118
327 Ga0105247_10007853 3300009101 Bacteria 6529
328 Ga0105247_10036593 3300009101 Bacteria 2992
329 Ga0105247_10078275 3300009101 Bacteria 2079
330 Ga0105247_10235050 3300009101 Bacteria 1246
331 Ga0114129_10000068 3300009147 Bacteria 93579
332 Ga0114129_10062125 3300009147 Bacteria 5219
333 Ga0114129_10069665 3300009147 Bacteria 4902
334 Ga0114129_10094433 3300009147 Bacteria 4142
335 Ga0114129_10129902 3300009147 Bacteria 3461
336 Ga0114129_10130192 3300009147 Bacteria 3457
337 Ga0114129_10136370 3300009147 Bacteria 3367
338 Ga0114129_10170504 3300009147 Bacteria 2967
339 Ga0114129_10243588 3300009147 Bacteria 2416
340 Ga0114129_10302240 3300009147 Bacteria 2132
341 Ga0114129_10415796 3300009147 Bacteria 1770
342 Ga0105243_10007460 3300009148 Bacteria 8405
343 Ga0105243_10022206 3300009148 Bacteria 4821
344 Ga0105243_10050293 3300009148 Bacteria 3292
345 Ga0105243_10155426 3300009148 Bacteria 1966
346 Ga0105241_10097564 3300009174 Bacteria 2330
347 Ga0105241_10217511 3300009174 Bacteria 1604
348 Ga0105241_10223567 3300009174 Bacteria 1584
349 Ga0105242_10044861 3300009176 Bacteria 3581
350 Ga0105242_10172149 3300009176 Bacteria 1904
351 Ga0105242_10192718 3300009176 Bacteria 1806
352 Ga0105248_10183607 3300009177 Unclassified 2357
353 Ga0105237_10113091 3300009545 Unclassified 2707
354 Ga0105237_10297757 3300009545 Bacteria 1616
355 Ga0105238_10029419 3300009551 Bacteria 5596
356 Ga0105238_10124467 3300009551 Bacteria 2557
357 Ga0105249_10003555 3300009553 Bacteria 13481
358 Ga0105249_10011297 3300009553 Bacteria 7839
359 Ga0105249_10106250 3300009553 Bacteria 2648
360 Ga0105249_10319880 3300009553 Bacteria 1562
361 Ga0099796_10034004 3300010159 Bacteria 1681
362 Ga0105239_10109631 3300010375 Bacteria 3059
363 Ga0105239_10329180 3300010375 Bacteria 1723
364 Ga0105246_10035693 3300011119 Bacteria 3325
365 Ga0105246_10099988 3300011119 Bacteria 2109
366 Ga0105246_10109613 3300011119 Bacteria 2026
367 Ga0105246_10262861 3300011119 Bacteria 1376
368 Ga0105246_10331868 3300011119 Bacteria 1240
369 Ga0157373_10081779 3300013100 Bacteria 2277
370 Ga0157371_10135289 3300013102 Bacteria 1755
371 Ga0157374_10010555 3300013296 Bacteria 7951
372 Ga0157374_10012705 3300013296 Bacteria 7334
373 Ga0157374_10128778 3300013296 Unclassified 2448
374 Ga0157374_10327507 3300013296 Bacteria 1519
375 Ga0157374_10368308 3300013296 Bacteria 1430
376 Ga0163162_10078540 3300013306 Bacteria 3366
377 Ga0163162_10089608 3300013306 Bacteria 3157
378 Ga0163162_10219275 3300013306 Bacteria 2032
379 Ga0163162_10219863 3300013306 Bacteria 2029
380 Ga0163162_10290924 3300013306 Bacteria 1766
381 Ga0157372_10190342 3300013307 Bacteria 2376
382 Ga0157372_10355098 3300013307 Bacteria 1708
383 Ga0157375_10040338 3300013308 Bacteria 4500
384 Ga0157375_10076779 3300013308 Bacteria 3368
385 Ga0157375_10114778 3300013308 Bacteria 2795
386 Ga0157375_10228834 3300013308 Bacteria 2018
387 Ga0157375_10343704 3300013308 Bacteria 1657
388 Ga0163163_10043454 3300014325 Bacteria 4406
389 Ga0163163_10050766 3300014325 Bacteria 4086
390 Ga0163163_10096848 3300014325 Bacteria 2971
391 Ga0157380_10030033 3300014326 Bacteria 4159
392 Ga0157380_10118134 3300014326 Bacteria 2241
393 Ga0157380_10136107 3300014326 Bacteria 2103
394 Ga0157380_10191036 3300014326 Bacteria 1808
395 Ga0157380_10263980 3300014326 Bacteria 1566
396 Ga0157379_10011977 3300014968 Bacteria 7577
397 Ga0157376_10018166 3300014969 Bacteria 5383
398 Ga0163161_10055522 3300017792 Bacteria 2875
399 Ga0163161_10218078 3300017792 Bacteria 1476
400 Ga0213872_10068820 3300021361 Bacteria 1597
401 Ga0213876_10104940 3300021384 Bacteria 1499
402 Ga0209758_1000613 3300025297 Bacteria 55154
403 Ga0209758_1002704 3300025297 Bacteria 17484
404 Ga0209758_1068034 3300025297 Bacteria 1136
405 Ga0207426_1046380 3300025302 Bacteria 1316
406 Ga0207697_10027198 3300025315 Bacteria 2339
407 Ga0207682_10003199 3300025893 Bacteria 7166
408 Ga0207682_10014389 3300025893 Bacteria 3081
409 Ga0207682_10072015 3300025893 Bacteria 1466
410 Ga0207692_10003985 3300025898 Bacteria 5802
411 Ga0207692_10010794 3300025898 Bacteria 3865
412 Ga0207692_10021013 3300025898 Plasmid 2980
413 Ga0207692_10085035 3300025898 Bacteria 1701
414 Ga0207692_10242300 3300025898 Bacteria 1077
415 Ga0207642_10012038 3300025899 Bacteria 3110
416 Ga0207642_10014784 3300025899 Bacteria 2890
417 Ga0207642_10028738 3300025899 Bacteria 2294
418 Ga0207642_10145727 3300025899 Bacteria 1254
419 Ga0207710_10034621 3300025900 Bacteria 2221
420 Ga0207710_10084977 3300025900 Bacteria 1473
421 Ga0207688_10002540 3300025901 Bacteria 9852
422 Ga0207688_10011975 3300025901 Bacteria 4719
423 Ga0207688_10016159 3300025901 Unclassified 4047
424 Ga0207688_10028038 3300025901 Bacteria 3098
425 Ga0207688_10057972 3300025901 Bacteria 2178
426 Ga0207647_10013439 3300025904 Bacteria 5673
427 Ga0207685_10077549 3300025905 Unclassified 1365
428 Ga0207699_10014440 3300025906 Bacteria 4072
429 Ga0207699_10019700 3300025906 Bacteria 3603
430 Ga0207645_10061779 3300025907 Bacteria 2393
431 Ga0207645_10184888 3300025907 Unclassified 1368
432 Ga0207643_10000967 3300025908 Bacteria 17260
433 Ga0207643_10033684 3300025908 Unclassified 2867
434 Ga0207643_10042084 3300025908 Bacteria 2575
435 Ga0207684_10003027 3300025910 Bacteria 16653
436 Ga0207684_10140872 3300025910 Bacteria 2073
437 Ga0207707_10193705 3300025912 Bacteria 1773
438 Ga0207671_10339045 3300025914 Bacteria 1191
439 Ga0207693_10004220 3300025915 Bacteria 12189
440 Ga0207693_10012252 3300025915 Bacteria 6931
441 Ga0207693_10097589 3300025915 Bacteria 2304
442 Ga0207693_10122885 3300025915 Bacteria 2039
443 Ga0207693_10172088 3300025915 Bacteria 1705
444 Ga0207663_10046299 3300025916 Bacteria 2679
445 Ga0207663_10057001 3300025916 Bacteria 2460
446 Ga0207663_10070614 3300025916 Bacteria 2250
447 Ga0207663_10093574 3300025916 Bacteria 2001
448 Ga0207663_10259595 3300025916 Bacteria 1282
449 Ga0207660_10099352 3300025917 Bacteria 2171
450 Ga0207660_10161018 3300025917 Unclassified 1731
451 Ga0207662_10011477 3300025918 Bacteria 4917
452 Ga0207662_10084162 3300025918 Bacteria 1946
453 Ga0207652_10260840 3300025921 Bacteria 1563
454 Ga0207646_10039144 3300025922 Bacteria 4266
455 Ga0207646_10269202 3300025922 Unclassified 1540
456 Ga0207681_10009139 3300025923 Bacteria 6052
457 Ga0207694_10257318 3300025924 Bacteria 1429
458 Ga0207694_10283753 3300025924 Bacteria 1360
459 Ga0207650_10053772 3300025925 Bacteria 2985
460 Ga0207650_10067708 3300025925 Bacteria 2680
461 Ga0207650_10142180 3300025925 Bacteria 1887
462 Ga0207659_10019858 3300025926 Bacteria 4431
463 Ga0207659_10058280 3300025926 Bacteria 2772
464 Ga0207659_10069639 3300025926 Bacteria 2563
465 Ga0207659_10124369 3300025926 Bacteria 1981
466 Ga0207659_10204227 3300025926 Bacteria 1580
467 Ga0207687_10026708 3300025927 Bacteria 3868
468 Ga0207687_10033406 3300025927 Bacteria 3490
469 Ga0207687_10132680 3300025927 Bacteria 1880
470 Ga0207700_10014481 3300025928 Bacteria 5168
471 Ga0207700_10052461 3300025928 Bacteria 3049
472 Ga0207700_10275010 3300025928 Bacteria 1446
473 Ga0207664_10021410 3300025929 Bacteria 4807
474 Ga0207664_10076975 3300025929 Unclassified 2702
475 Ga0207644_10025738 3300025931 Bacteria 4048
476 Ga0207706_10007796 3300025933 Bacteria 9880
477 Ga0207706_10011027 3300025933 Bacteria 8238
478 Ga0207706_10014313 3300025933 Bacteria 7189
479 Ga0207706_10033052 3300025933 Bacteria 4605
480 Ga0207706_10033732 3300025933 Bacteria 4555
481 Ga0207706_10043930 3300025933 Bacteria 3960
482 Ga0207686_10007031 3300025934 Bacteria 6055
483 Ga0207686_10079263 3300025934 Unclassified 2138
484 Ga0207709_10008517 3300025935 Bacteria 5671
485 Ga0207709_10009791 3300025935 Bacteria 5281
486 Ga0207709_10027652 3300025935 Bacteria 3270
487 Ga0207709_10035136 3300025935 Bacteria 2961
488 Ga0207709_10193804 3300025935 Bacteria 1446
489 Ga0207670_10019846 3300025936 Bacteria 4115
490 Ga0207670_10068147 3300025936 Bacteria 2451
491 Ga0207670_10192720 3300025936 Bacteria 1543
492 Ga0207669_10012290 3300025937 Bacteria 4204
493 Ga0207669_10013751 3300025937 Bacteria 4033
494 Ga0207669_10035536 3300025937 Bacteria 2836
495 Ga0207669_10074471 3300025937 Bacteria 2147
496 Ga0207704_10010940 3300025938 Bacteria 4448
497 Ga0207704_10022313 3300025938 Bacteria 3389
498 Ga0207665_10001994 3300025939 Bacteria 13772
499 Ga0207665_10054389 3300025939 Bacteria 2699
500 Ga0207665_10168927 3300025939 Bacteria 1578
501 Ga0207665_10263166 3300025939 Bacteria 1278
502 Ga0207691_10024270 3300025940 Bacteria 5702
503 Ga0207691_10050650 3300025940 Bacteria 3801
504 Ga0207691_10080508 3300025940 Bacteria 2929
505 Ga0207691_10125092 3300025940 Unclassified 2275
506 Ga0207691_10201093 3300025940 Bacteria 1734
507 Ga0207711_10008863 3300025941 Bacteria 8411
508 Ga0207711_10048377 3300025941 Bacteria 3638
509 Ga0207711_10153792 3300025941 Bacteria 2078
510 Ga0207711_10228374 3300025941 Bacteria 1704
511 Ga0207689_10012734 3300025942 Bacteria 7185
512 Ga0207689_10062666 3300025942 Bacteria 3058
513 Ga0207689_10227112 3300025942 Bacteria 1543
514 Ga0207689_10274304 3300025942 Bacteria 1396
515 Ga0207679_10019653 3300025945 Bacteria 4543
516 Ga0207679_10493858 3300025945 Bacteria 1091
517 Ga0207667_10093335 3300025949 Bacteria 3108
518 Ga0207667_10180699 3300025949 Bacteria 2167
519 Ga0207651_10019208 3300025960 Bacteria 4088
520 Ga0207651_10114348 3300025960 Bacteria 2032
521 Ga0207651_10144470 3300025960 Bacteria 1843
522 Ga0207651_10394920 3300025960 Bacteria 1175
523 Ga0207712_10015690 3300025961 Bacteria 4891
524 Ga0207712_10022315 3300025961 Bacteria 4167
525 Ga0207712_10026871 3300025961 Bacteria 3839
526 Ga0207712_10099491 3300025961 Bacteria 2159
527 Ga0207712_10275096 3300025961 Bacteria 1372
528 Ga0207668_10003464 3300025972 Bacteria 9260
529 Ga0207668_10069010 3300025972 Bacteria 2515
530 Ga0207640_10151858 3300025981 Bacteria 1702
531 Ga0207640_10235682 3300025981 Bacteria 1411
532 Ga0207677_10083341 3300026023 Bacteria 2301
533 Ga0207677_10184476 3300026023 Bacteria 1644
534 Ga0207703_10098000 3300026035 Bacteria 2478
535 Ga0207639_10054958 3300026041 Bacteria 3045
536 Ga0207639_10213818 3300026041 Unclassified 1661
537 Ga0207678_10010626 3300026067 Bacteria 8088
538 Ga0207678_10015172 3300026067 Bacteria 6777
539 Ga0207678_10038156 3300026067 Bacteria 4175
540 Ga0207678_10041400 3300026067 Unclassified 3995
541 Ga0207678_10093743 3300026067 Bacteria 2565
542 Ga0207678_10211721 3300026067 Bacteria 1658
543 Ga0207708_10001893 3300026075 Bacteria 15454
544 Ga0207708_10001982 3300026075 Bacteria 15088
545 Ga0207708_10021646 3300026075 Unclassified 4849
546 Ga0207708_10031086 3300026075 Bacteria 4051
547 Ga0207708_10034508 3300026075 Bacteria 3847
548 Ga0207708_10098027 3300026075 Bacteria 2266
549 Ga0207708_10105517 3300026075 Bacteria 2184
550 Ga0207702_10045702 3300026078 Bacteria 3684
551 Ga0207702_10260214 3300026078 Bacteria 1633
552 Ga0207702_10301905 3300026078 Bacteria 1520
553 Ga0207641_10008033 3300026088 Bacteria 8746
554 Ga0207641_10462747 3300026088 Bacteria 1227
555 Ga0207648_10000930 3300026089 Bacteria 32957
556 Ga0207648_10001640 3300026089 Bacteria 24524
557 Ga0207648_10005439 3300026089 Bacteria 12834
558 Ga0207648_10008314 3300026089 Bacteria 10072
559 Ga0207648_10053736 3300026089 Bacteria 3520
560 Ga0207648_10156449 3300026089 Bacteria 2012
561 Ga0207648_10191343 3300026089 Bacteria 1813
562 Ga0207676_10037062 3300026095 Bacteria 3713
563 Ga0207676_10094244 3300026095 Bacteria 2466
564 Ga0207676_10097222 3300026095 Bacteria 2432
565 Ga0207674_10077499 3300026116 Bacteria 3329
566 Ga0207674_10147936 3300026116 Bacteria 2307
567 Ga0207675_100003662 3300026118 Bacteria 14985
568 Ga0207675_100007548 3300026118 Bacteria 10274
569 Ga0207675_100023222 3300026118 Bacteria 5768
570 Ga0207675_100031749 3300026118 Bacteria 4921
571 Ga0207675_100159483 3300026118 Bacteria 2151
572 Ga0207675_100237983 3300026118 Bacteria 1758
573 Ga0207683_10006631 3300026121 Bacteria 9905
574 Ga0207683_10015287 3300026121 Bacteria 6533
575 Ga0207683_10024348 3300026121 Bacteria 5213
576 Ga0207683_10043509 3300026121 Unclassified 3925
577 Ga0207683_10044403 3300026121 Bacteria 3885
578 Ga0207683_10104176 3300026121 Bacteria 2535
579 Ga0207683_10236169 3300026121 Bacteria 1667
580 Ga0207683_10297025 3300026121 Unclassified 1478
581 Ga0207683_10303956 3300026121 Bacteria 1460
582 Ga0207698_10037686 3300026142 Bacteria 3564
583 Ga0207698_10060552 3300026142 Unclassified 2944
584 Ga0209179_1004682 3300027512 Bacteria 2085
585 Ga0209813_10000171 3300027866 Bacteria 21130
586 Ga0209813_10015289 3300027866 Bacteria 2077
587 Ga0209813_10029792 3300027866 Bacteria 1600
588 Ga0207428_10008060 3300027907 Bacteria 9557
589 Ga0207428_10018287 3300027907 Bacteria 5989
590 Ga0207428_10075460 3300027907 Bacteria 2642
591 Ga0207428_10120998 3300027907 Bacteria 2007
592 Ga0207428_10290521 3300027907 Bacteria 1212
593 Ga0268266_10001685 3300028379 Bacteria 25417
594 Ga0268266_10018266 3300028379 Bacteria 5979
595 Ga0268266_10045547 3300028379 Bacteria 3752
596 Ga0268266_10046622 3300028379 Bacteria 3710
597 Ga0268266_10046802 3300028379 Bacteria 3703
598 Ga0268265_10013298 3300028380 Bacteria 5592
599 Ga0268265_10014407 3300028380 Bacteria 5386
600 Ga0268265_10070907 3300028380 Bacteria 2712
601 Ga0268265_10089156 3300028380 Bacteria 2459
602 Ga0268265_10121974 3300028380 Bacteria 2149
603 Ga0268265_10139426 3300028380 Bacteria 2028
604 Ga0268264_10184569 3300028381 Bacteria 1897
605 Ga0268264_10197026 3300028381 Bacteria 1840
606 Ga0268264_10331799 3300028381 Bacteria 1442
607 Ga0268264_10419225 3300028381 Unclassified 1290
608 Ga0268264_10608294 3300028381 Bacteria 1078
609 Ga0265338_10120807 3300028800 Bacteria 2088
610 Ga0265330_10013169 3300031235 Bacteria 3857
611 Ga0265325_10000004 3300031241 Bacteria 347347
612 Ga0265325_10028878 3300031241 Bacteria 2985
613 Ga0265325_10075214 3300031241 Bacteria 1687
614 Ga0265329_10009404 3300031242 Bacteria 3652
615 Ga0265329_10046160 3300031242 Bacteria 1392
616 Ga0265340_10025003 3300031247 Bacteria 3028
617 Ga0265340_10050316 3300031247 Bacteria 2021
618 Ga0265340_10127286 3300031247 Bacteria 1170
619 Ga0265339_10173581 3300031249 Bacteria 1078
620 Ga0265331_10095816 3300031250 Bacteria 1369
621 Ga0265316_10021306 3300031344 Bacteria 5493
622 Ga0307509_10174846 3300031507 Bacteria 2021
623 Ga0265313_10020510 3300031595 Bacteria 3644
624 Ga0265313_10026917 3300031595 Bacteria 3018
625 Ga0265313_10110096 3300031595 Bacteria 1212
626 Ga0307508_10000557 3300031616 Bacteria 44307
627 Ga0265342_10067459 3300031712 Bacteria 2093
628 Ga0307516_10007912 3300031730 Bacteria 12110
629 Ga0307516_10182259 3300031730 Bacteria 1832
630 Ga0307507_10022361 3300033179 Bacteria 6989
631 Ga0307510_10006581 3300033180 Bacteria 13858
632 Ga0307510_10051168 3300033180 Bacteria 4372
633 Ga0373940_0005232 3300035088 Bacteria 2797
634 Ga0373944_0015814 3300035089 Bacteria 2120
635 Ga0373944_0024740 3300035089 Bacteria 1763
636 Ga0373932_0025073 3300035112 Bacteria 1611
637 Ga0373936_0059667 3300035113 Bacteria 1555
638 Ga0373936_0089062 3300035113 Bacteria 1292
639 Ga0373939_0031876 3300035114 Bacteria 1527
640 Ga0373945_0008749 3300035116 Bacteria 3304
641 Ga0373945_0078181 3300035116 Bacteria 1263
642 Ga0373953_0043926 3300035117 Bacteria 1785
643 Ga0373954_0007914 3300035118 Bacteria 4655
644 Ga0373954_0014684 3300035118 Bacteria 3494
645 Ga0373956_0015153 3300035119 Bacteria 3226
646 Ga0373943_0000789 3300035170 Bacteria 13880
647 Ga0373943_0023389 3300035170 Bacteria 2873
648 Ga0373943_0036254 3300035170 Bacteria 2361
649 Ga0373943_0170701 3300035170 Bacteria 1190
650 Ga0373946_0006277 3300035171 Bacteria 4307
651 Ga0373955_0002543 3300035172 Bacteria 7981
652 Ga0373955_0004726 3300035172 Bacteria 6055
653 Ga0373955_0009435 3300035172 Bacteria 4568
654 Ga0373955_0028671 3300035172 Bacteria 2889
655 Ga0373942_0008505 3300035207 Bacteria 2393
656 Ga0373942_0010104 3300035207 Bacteria 2214
657 Ga0373962_0028297 3300035242 Unclassified 1520
658 Ga0373924_0020264 3300035410 Bacteria 2583
659 Ga0373931_0000929 3300035691 Bacteria 12312
660 Ga0373931_0005106 3300035691 Bacteria 6043
661 Ga0373931_0051355 3300035691 Bacteria 2196
662 Ga0373935_0000272 3300035692 Bacteria 25407
663 Ga0373935_0023128 3300035692 Bacteria 3817
664 Ga0373935_0025862 3300035692 Bacteria 3618
665 Ga0373935_0034682 3300035692 Bacteria 3147
666 Ga0373935_0087425 3300035692 Bacteria 2035
667 Ga0373927_0000980 3300035695 Bacteria 21707
668 Ga0373927_0146535 3300035695 Bacteria 1546
669 Ga0373933_0000342 3300035724 Bacteria 29960
670 Ga0373933_0004825 3300035724 Bacteria 7368
671 Ga0373947_0000563 3300035725 Bacteria 21638
672 Ga0373947_0029410 3300035725 Bacteria 3224
673 Ga0373947_0090170 3300035725 Bacteria 1910
674 Ga0373947_0099913 3300035725 Bacteria 1822
675 Ga0373947_0166421 3300035725 Bacteria 1428
676 Ga0373937_0014119 3300036401 Bacteria 7044
677 Ga0373937_0015092 3300036401 Bacteria 6825
678 Ga0373937_0016767 3300036401 Bacteria 6511
679 Ga0373937_0017936 3300036401 Bacteria 6314
680 Ga0373937_0122423 3300036401 Bacteria 2425
681 Ga0373937_0192866 3300036401 Bacteria 1915
682 Ga0373925_0001601 3300037068 Bacteria 19118
683 Ga0373925_0030638 3300037068 Bacteria 3949
684 Ga0373925_0041679 3300037068 Bacteria 3404
685 Ga0373925_0062852 3300037068 Unclassified 2792
686 Ga0395898_0237820 3300037466 Bacteria 1737
687 Ga0395905_0249861 3300037471 Unclassified 1657
688 Ga0436365_0424004 3300039437 Bacteria 14497
689 Ga0436365_1317488 3300039437 Bacteria 1680
690 Ga0436361_0707516 3300039447 Bacteria 3991
691 Ga0439453_0001434 3300041408 Bacteria 3060
692 Ga0451853_3534647 3300041512 Bacteria 2105
693 Ga0439446_0019995 3300042156 Bacteria 1884
694 Ga0495617_042446 3300046452 Bacteria 1520
695 Ga0495617_065707 3300046452 Bacteria 1196
696 Ga0495592_0001183 3300046454 Bacteria 18097
697 Ga0495592_0147310 3300046454 Bacteria 1631
698 Ga0495603_0000766 3300046455 Bacteria 18342
699 Ga0495603_0013119 3300046455 Bacteria 5008
700 Ga0495603_0044959 3300046455 Bacteria 2635
701 Ga0495603_0053860 3300046455 Bacteria 2386
702 Ga0495603_0169289 3300046455 Bacteria 1266
703 Ga0495629_0000499 3300046459 Bacteria 32883
704 Ga0495629_0100280 3300046459 Bacteria 2021
705 Ga0495638_0030282 3300046460 Bacteria 3485
706 Ga0495641_0009138 3300046461 Bacteria 5932
707 Ga0495641_0016576 3300046461 Bacteria 3876
708 Ga0495641_0072960 3300046461 Bacteria 1540
709 Ga0495651_0012555 3300046462 Bacteria 6536
710 Ga0495651_0067206 3300046462 Bacteria 2735
711 Ga0495653_0009651 3300046463 Bacteria 7893
712 Ga0495653_0026510 3300046463 Bacteria 4646
713 Ga0495580_0001242 3300046472 Bacteria 22494
714 Ga0495582_0001185 3300046473 Bacteria 14686
715 Ga0495582_0169315 3300046473 Bacteria 1243
716 Ga0495639_0000003 3300046475 Bacteria 118479
717 Ga0495639_0075874 3300046475 Bacteria 1559
718 Ga0495662_0000185 3300046476 Bacteria 25164
719 Ga0495662_0026927 3300046476 Bacteria 2777
720 Ga0495662_0090295 3300046476 Bacteria 1493
721 Ga0495664_0001147 3300046477 Bacteria 13762
722 Ga0495664_0201651 3300046477 Bacteria 1205
723 Ga0495584_0033275 3300046491 Bacteria 2608
724 Ga0495584_0122167 3300046491 Bacteria 1319
725 Ga0495584_0190274 3300046491 Unclassified 1043
726 Ga0495585_0061619 3300046492 Bacteria 2062
727 Ga0495585_0098639 3300046492 Bacteria 1565
728 Ga0495585_0176257 3300046492 Bacteria 1101
729 Ga0495594_0001056 3300046499 Bacteria 14337
730 Ga0495594_0039434 3300046499 Bacteria 2583
731 Ga0495594_0106088 3300046499 Bacteria 1582
732 Ga0495596_0038744 3300046500 Bacteria 1884
733 Ga0495608_0005264 3300046511 Bacteria 9241
734 Ga0495616_0154308 3300046513 Bacteria 1037
735 Ga0495618_0013776 3300046514 Bacteria 4919
736 Ga0495618_0297408 3300046514 Bacteria 1003
737 Ga0495628_0001064 3300046516 Bacteria 25180
738 Ga0495628_0009740 3300046516 Bacteria 8194
739 Ga0495628_0074799 3300046516 Bacteria 2638
740 Ga0495628_0278393 3300046516 Bacteria 1243
741 Ga0495630_0000566 3300046517 Bacteria 26945
742 Ga0495630_0046821 3300046517 Bacteria 3233
743 Ga0495644_0038917 3300046523 Bacteria 1793
744 Ga0495644_0047264 3300046523 Bacteria 1617
745 Ga0495666_0143752 3300046526 Bacteria 1111
746 Ga0495652_0001634 3300046529 Bacteria 24442
747 Ga0495652_0014266 3300046529 Bacteria 7134
748 Ga0495652_0075353 3300046529 Bacteria 2802
749 Ga0495652_0124160 3300046529 Bacteria 2054
750 Ga0495654_0031846 3300046530 Bacteria 2676
751 Ga0495665_0000138 3300046531 Bacteria 35409
752 Ga0495640_0000274 3300046533 Bacteria 35048
753 Ga0495640_0009232 3300046533 Bacteria 7692
754 Ga0495640_0054421 3300046533 Bacteria 2741
755 Ga0495640_0092072 3300046533 Bacteria 2000
756 Ga0495640_0111493 3300046533 Bacteria 1788
757 Ga0495587_0030465 3300046536 Bacteria 3271
758 Ga0495587_0031234 3300046536 Bacteria 3226
759 Ga0495598_0023365 3300046537 Bacteria 1664
760 Ga0495598_0024329 3300046537 Bacteria 1641
761 Ga0495598_0032303 3300046537 Bacteria 1478
762 Ga0495598_0077165 3300046537 Bacteria 1061
763 Ga0495621_0019492 3300046539 Bacteria 2216
764 Ga0495597_0112379 3300046542 Bacteria 1141
765 Ga0495645_0000368 3300046543 Bacteria 31407
766 Ga0495645_0044172 3300046543 Bacteria 3250
767 Ga0495622_0005994 3300046557 Bacteria 5647
768 Ga0495622_0015157 3300046557 Bacteria 3584
769 Ga0495622_0084514 3300046557 Bacteria 1460
770 Ga0495633_0071844 3300046558 Bacteria 1614
771 Ga0495633_0102146 3300046558 Bacteria 1331
772 Ga0495667_0001463 3300046559 Bacteria 15533
773 Ga0495667_0005593 3300046559 Bacteria 8498
774 Ga0495667_0270296 3300046559 Bacteria 1080
775 Ga0495656_0008186 3300046615 Bacteria 3724
776 Ga0495656_0032309 3300046615 Bacteria 2129
777 Ga0495656_0075708 3300046615 Bacteria 1506
778 Ga0495656_0089444 3300046615 Bacteria 1405
779 Ga0495668_0021357 3300046616 Bacteria 3713
780 Ga0495668_0134706 3300046616 Bacteria 1352
781 Ga0495668_0177322 3300046616 Bacteria 1168
782 Ga0495634_0000360 3300046642 Bacteria 44196
783 Ga0495611_0120049 3300046648 Unclassified 1226
784 Ga0495625_0060466 3300046660 Bacteria 2684
785 Ga0495635_0005840 3300046663 Bacteria 8576
786 Ga0495635_0098331 3300046663 Bacteria 2000
787 Ga0495588_0003118 3300046674 Bacteria 7174
788 Ga0495588_0003814 3300046674 Bacteria 6602
789 Ga0495588_0041292 3300046674 Bacteria 2355
790 Ga0495588_0046322 3300046674 Unclassified 2231
791 Ga0495657_0004684 3300046675 Bacteria 10903
792 Ga0495657_0029673 3300046675 Bacteria 3835
793 Ga0495599_0003753 3300046678 Bacteria 8912
794 Ga0495599_0137722 3300046678 Bacteria 1515
795 Ga0495623_0001952 3300046679 Bacteria 13848
796 Ga0495623_0012684 3300046679 Bacteria 5456
797 Ga0495646_0025109 3300046680 Bacteria 3749
798 Ga0495646_0073236 3300046680 Unclassified 2012
799 Ga0495647_0032336 3300046681 Bacteria 1949
800 Ga0495658_0000136 3300046683 Bacteria 40715
801 Ga0495669_0030515 3300046684 Bacteria 2366
802 Ga0495669_0134625 3300046684 Unclassified 1165
803 Ga0495613_0056803 3300046689 Bacteria 2874
804 Ga0495613_0077761 3300046689 Bacteria 2414
805 Ga0495624_0047913 3300046690 Bacteria 2714
806 Ga0495624_0050434 3300046690 Unclassified 2636
807 Ga0495670_0065432 3300046691 Bacteria 1832
808 Ga0495670_0068531 3300046691 Bacteria 1793
809 Ga0495671_0107799 3300046692 Bacteria 1360
810 Ga0495649_0055083 3300046694 Unclassified 2150
811 Ga0495649_0101955 3300046694 Bacteria 1525
812 Ga0495589_0108656 3300046794 Bacteria 1340
813 Ga0495600_0003190 3300046809 Bacteria 9600
814 Ga0495600_0005894 3300046809 Bacteria 7413
815 Ga0495600_0039933 3300046809 Bacteria 3056
816 Ga0495600_0353871 3300046809 Bacteria 919
817 Ga0495581_0000614 3300047315 Bacteria 18660
818 Ga0495604_0001623 3300047317 Bacteria 18549
819 Ga0495604_0003305 3300047317 Bacteria 12871
820 Ga0495604_0183999 3300047317 Bacteria 1460
821 Ga0495636_0035467 3300047318 Bacteria 2055
822 Ga0495674_0001053 3300047319 Bacteria 26515
823 Ga0495674_0266420 3300047319 Bacteria 1407
824 Ga0495676_0042243 3300047321 Bacteria 3744
825 Ga0495676_0148389 3300047321 Bacteria 1672
826 Ga0495676_0218563 3300047321 Bacteria 1314
827 Ga0495680_0001148 3300047322 Bacteria 29161
828 Ga0495680_0013379 3300047322 Bacteria 7161
829 Ga0495675_0055623 3300047444 Bacteria 2510
830 Ga0495675_0056778 3300047444 Bacteria 2482
831 Ga0495675_0252367 3300047444 Bacteria 1059
832 Ga0495677_0069961 3300047445 Unclassified 1308
833 Ga0495677_0138958 3300047445 Bacteria 932
834 Ga0495679_047269 3300047446 Bacteria 1306
835 Ga0495684_0066616 3300047471 Bacteria 2738
836 Ga0495686_0054902 3300047472 Bacteria 2493
837 Ga0495686_0211866 3300047472 Bacteria 1107
838 Ga0495593_0000819 3300047673 Bacteria 18024
839 Ga0495602_0000791 3300048088 Bacteria 30188
840 Ga0495602_0007047 3300048088 Bacteria 11799
841 Ga0495614_0029765 3300048089 Bacteria 2349
842 Ga0496100_0019077 3300048903 Bacteria 4083
843 Ga0496100_0024781 3300048903 Bacteria 3663
844 Ga0496100_0138034 3300048903 Bacteria 1725
845 Ga0496100_0187172 3300048903 Bacteria 1501
846 Ga0496101_0002847 3300048904 Bacteria 10634
847 Ga0496101_0008762 3300048904 Bacteria 6619
848 Ga0496101_0118958 3300048904 Unclassified 1996
849 Ga0496101_0285406 3300048904 Bacteria 1291
850 Ga0496102_0007982 3300048905 Bacteria 9045
851 Ga0496102_0010414 3300048905 Bacteria 8000
852 Ga0496102_0130126 3300048905 Bacteria 2355
853 Ga0496102_0354937 3300048905 Bacteria 1380
854 Ga0496102_0415056 3300048905 Bacteria 1264
855 Ga0496103_0012799 3300048906 Bacteria 4975
856 Ga0496103_0034715 3300048906 Bacteria 3085
857 Ga0496103_0211699 3300048906 Bacteria 1246
858 Ga0496104_0000280 3300048907 Bacteria 45178
859 Ga0496104_0000524 3300048907 Bacteria 32873
860 Ga0496104_0011213 3300048907 Bacteria 8020
861 Ga0496104_0016202 3300048907 Bacteria 6767
862 Ga0496104_0033659 3300048907 Bacteria 4776
863 Ga0496104_0043242 3300048907 Bacteria 4231
864 Ga0496104_0112459 3300048907 Unclassified 2611
865 Ga0496104_0136405 3300048907 Bacteria 2357
866 Ga0496104_0213421 3300048907 Bacteria 1842
867 Ga0496105_0000835 3300048908 Bacteria 20959
868 Ga0496105_0004323 3300048908 Bacteria 10701
869 Ga0496105_0039502 3300048908 Bacteria 3889
870 Ga0496105_0048175 3300048908 Bacteria 3517
871 Ga0496105_0052634 3300048908 Bacteria 3362
872 Ga0496106_0008620 3300048909 Bacteria 7545
873 Ga0496106_0030643 3300048909 Bacteria 4009
874 Ga0496106_0060992 3300048909 Bacteria 2860
875 Ga0496106_0119844 3300048909 Unclassified 2056
876 Ga0496106_0142501 3300048909 Bacteria 1886
877 Ga0496106_0197782 3300048909 Bacteria 1599
878 Ga0496107_0038168 3300048910 Bacteria 3447
879 Ga0496107_0051888 3300048910 Plasmid 2959
880 Ga0496107_0071006 3300048910 Bacteria 2529
881 Ga0496107_0088952 3300048910 Bacteria 2254
882 Ga0496107_0233876 3300048910 Bacteria 1367
883 Ga0496107_0234676 3300048910 Bacteria 1365
884 Ga0496108_0002485 3300048911 Bacteria 14755
885 Ga0496108_0007938 3300048911 Bacteria 8603
886 Ga0496108_0009402 3300048911 Bacteria 7916
887 Ga0496108_0143504 3300048911 Bacteria 2057
888 Ga0496108_0158095 3300048911 Bacteria 1958
889 Ga0496108_0160355 3300048911 Unclassified 1943
890 Ga0496108_0185823 3300048911 Bacteria 1800
891 Ga0496109_0001072 3300048912 Bacteria 22689
892 Ga0496109_0004069 3300048912 Bacteria 12225
893 Ga0496109_0023447 3300048912 Bacteria 5479
894 Ga0496109_0230823 3300048912 Bacteria 1741
895 Ga0496109_0314536 3300048912 Unclassified 1477
896 Ga0496109_0349405 3300048912 Bacteria 1397
897 Ga0496110_0000570 3300048913 Bacteria 25287
898 Ga0496110_0015271 3300048913 Bacteria 6388
899 Ga0496110_0032674 3300048913 Bacteria 4497
900 Ga0496110_0233555 3300048913 Bacteria 1673
901 Ga0496110_0282296 3300048913 Bacteria 1512
902 Ga0496111_0001744 3300048914 Bacteria 12736
903 Ga0496111_0030148 3300048914 Bacteria 3857
904 Ga0496111_0042471 3300048914 Bacteria 3265
905 Ga0496111_0066849 3300048914 Bacteria 2611
906 Ga0496111_0068204 3300048914 Bacteria 2584
907 Ga0496111_0106349 3300048914 Bacteria 2065
908 Ga0496112_0005539 3300048915 Bacteria 10941
909 Ga0496112_0005780 3300048915 Bacteria 10758
910 Ga0496112_0057633 3300048915 Bacteria 3825
911 Ga0496112_0079356 3300048915 Bacteria 3247
912 Ga0496112_0086196 3300048915 Bacteria 3107
913 Ga0496112_0216385 3300048915 Bacteria 1872
914 Ga0496112_0226696 3300048915 Bacteria 1824
915 Ga0496113_0021882 3300048916 Bacteria 4515
916 Ga0496113_0024976 3300048916 Bacteria 4255
917 Ga0496113_0025168 3300048916 Bacteria 4239
918 Ga0496113_0049941 3300048916 Bacteria 3116
919 Ga0496113_0106077 3300048916 Bacteria 2182
920 Ga0496113_0194707 3300048916 Bacteria 1610
921 Ga0496113_0242570 3300048916 Bacteria 1438
922 Ga0496113_0291594 3300048916 Bacteria 1305
923 Ga0496114_0014562 3300048917 Bacteria 6318
924 Ga0496114_0025784 3300048917 Bacteria 4808
925 Ga0496114_0030671 3300048917 Bacteria 4424
926 Ga0496114_0101752 3300048917 Bacteria 2453
927 Ga0496114_0106374 3300048917 Bacteria 2400
928 Ga0496114_0195337 3300048917 Bacteria 1771
929 Ga0496114_0497721 3300048917 Bacteria 1078
930 Ga0496115_0009034 3300048918 Bacteria 7393
931 Ga0496115_0034492 3300048918 Bacteria 3999
932 Ga0496115_0060227 3300048918 Bacteria 3058
933 Ga0496115_0062323 3300048918 Unclassified 3008
934 Ga0496115_0090382 3300048918 Bacteria 2501
935 Ga0496115_0105997 3300048918 Bacteria 2307
936 Ga0496115_0182700 3300048918 Bacteria 1733
937 Ga0496116_0141584 3300048919 Bacteria 1352
938 Ga0496117_0099206 3300048920 Bacteria 1849
939 Ga0496118_0005620 3300048921 Bacteria 14161
940 Ga0496121_0003623 3300048924 Bacteria 21781
941 Ga0496124_0002607 3300048927 Bacteria 23290
942 Ga0496125_0058423 3300048928 Bacteria 3116
943 Ga0496126_0004495 3300048929 Bacteria 16639
944 Ga0496126_0024524 3300048929 Bacteria 5822
945 Ga0501031_0060675 3300049568 Bacteria 2465
946 Ga0501038_0030200 3300049574 Bacteria 4798
947 Ga0501038_0411238 3300049574 Bacteria 1045
948 Ga0501039_0030686 3300049575 Bacteria 4145
949 Ga0501040_0116731 3300049576 Bacteria 1870
950 Ga0501043_0271010 3300049579 Bacteria 1303
951 Ga0501048_0349747 3300049582 Bacteria 1054
952 Ga0501068_0057486 3300049584 Bacteria 2359
953 Ga0501068_0096020 3300049584 Bacteria 1833
954 Ga0501069_0048387 3300049585 Bacteria 2361
955 Ga0501070_0172743 3300049586 Bacteria 1780
956 Ga0501071_0088048 3300049587 Bacteria 2278
957 Ga0501072_0005974 3300049588 Bacteria 9283
958 Ga0501072_0045450 3300049588 Bacteria 3453
959 Ga0501074_0364669 3300049590 Bacteria 1025
960 Ga0501075_0150910 3300049591 Bacteria 1771
961 Ga0501075_0328081 3300049591 Bacteria 1166
962 Ga0501076_0026966 3300049592 Bacteria 4454
963 Ga0501076_0117799 3300049592 Bacteria 2150
964 Ga0501076_0156766 3300049592 Bacteria 1854
965 Ga0501080_0029336 3300049742 Bacteria 5121
966 Ga0501080_0292529 3300049742 Bacteria 1479
967 Ga0501081_0133096 3300049743 Bacteria 1778
968 Ga0501035_0037084 3300049822 Bacteria 4416
969 Ga0501044_0010126 3300049823 Bacteria 10244
970 Ga0501045_0257373 3300049824 Bacteria 1299
971 nmdc:mga03683_1400_c1 3300050489 Bacteria 7180
972 nmdc:mga03683_48740_c1 3300050489 Unclassified 1761
973 nmdc:mga03n38_107706_c1 3300050490 Bacteria 1353
974 nmdc:mga03n38_3003_c1 3300050490 Bacteria 5338
975 nmdc:mga00v17_237648_c1 3300050491 Bacteria 1181
976 nmdc:mga00v17_68044_c1 3300050491 Bacteria 2201
977 nmdc:mga0yw44_119190_c1 3300050492 Bacteria 1699
978 nmdc:mga0yw44_157697_c1 3300050492 Bacteria 1484
979 nmdc:mga0yw44_172202_c1 3300050492 Bacteria 1422
980 nmdc:mga0yw44_281628_c1 3300050492 Bacteria 1111
981 nmdc:mga0yw44_34681_c1 3300050492 Bacteria 2959
982 nmdc:mga0yw44_35615_c1 3300050492 Bacteria 2926
983 nmdc:mga0yw44_48639_c1 3300050492 Bacteria 2557
984 nmdc:mga0yw44_6629_c1 3300050492 Bacteria 5613
985 nmdc:mga0yw44_8711_c1 3300050492 Bacteria 5074
986 nmdc:mga0yw44_9174_c1 3300050492 Bacteria 4980
987 nmdc:mga0k408_28510_c1 3300050493 Bacteria 3174
988 nmdc:mga0k408_69721_c1 3300050493 Bacteria 2052
989 nmdc:mga06z11_17762_c1 3300050494 Bacteria 3236
990 nmdc:mga06z11_187542_c1 3300050494 Bacteria 1196
991 nmdc:mga06z11_30638_c1 3300050494 Bacteria 2605
992 nmdc:mga06z11_35179_c1 3300050494 Bacteria 2464
993 nmdc:mga06z11_42150_c1 3300050494 Bacteria 2288
994 nmdc:mga06z11_46444_c1 3300050494 Bacteria 2201
995 nmdc:mga06z11_484_c1 3300050494 Bacteria 14688
996 nmdc:mga06z11_51745_c1 3300050494 Bacteria 2104
997 nmdc:mga06z11_79408_c1 3300050494 Bacteria 1757
998 nmdc:mga04h51_2413_c1 3300050495 Bacteria 4431
999 nmdc:mga04h51_28088_c1 3300050495 Bacteria 1753
1000 nmdc:mga04h51_3408_c1 3300050495 Bacteria 3863
1001 nmdc:mga07m45_117980_c1 3300050496 Bacteria 1532
1002 nmdc:mga07m45_32693_c1 3300050496 Bacteria 2885
1003 nmdc:mga05p37_151234_c1 3300050507 Bacteria 2839
1004 nmdc:mga05p37_268074_c1 3300050507 Bacteria 2041
1005 nmdc:mga05p37_299254_c1 3300050507 Bacteria 1912
1006 nmdc:mga05p37_498971_c1 3300050507 Bacteria 1397
1007 nmdc:mga05p37_52_c1 3300050507 Bacteria 102932
1008 nmdc:mga05p37_57225_c1 3300050507 Bacteria 4802
1009 nmdc:mga05p37_60269_c1 3300050507 Bacteria 4673
1010 nmdc:mga05p37_655533_c1 3300050507 Bacteria 1174
1011 nmdc:mga05p37_94209_c1 3300050507 Bacteria 3690
1012 nmdc:mga05p37_98281_c1 3300050507 Bacteria 3605
1013 nmdc:mga09592_126_c2 3300050508 Bacteria 13804
1014 nmdc:mga09592_159889_c1 3300050508 Bacteria 1946
1015 nmdc:mga09592_230200_c1 3300050508 Bacteria 1606
1016 nmdc:mga09592_255929_c1 3300050508 Bacteria 1518
1017 nmdc:mga09592_5425_c1 3300050508 Bacteria 10364
1018 nmdc:mga09592_73456_c1 3300050508 Bacteria 2906
1019 nmdc:mga0qj67_19482_c1 3300050509 Bacteria 5184
1020 nmdc:mga0qj67_19920_c1 3300050509 Bacteria 5133
1021 nmdc:mga0qj67_21393_c1 3300050509 Bacteria 4962
1022 nmdc:mga0qj67_297718_c1 3300050509 Bacteria 1307
1023 nmdc:mga0qj67_332365_c1 3300050509 Bacteria 1230
1024 nmdc:mga0qj67_47_c1 3300050509 Bacteria 86979
1025 nmdc:mga06r32_274569_c1 3300050510 Bacteria 1673
1026 nmdc:mga06r32_299694_c1 3300050510 Bacteria 1594
1027 nmdc:mga06r32_299709_c1 3300050510 Bacteria 1594
1028 nmdc:mga06r32_299934_c1 3300050510 Bacteria 1593
1029 nmdc:mga06r32_35443_c2 3300050510 Bacteria 4290
1030 nmdc:mga06r32_387919_c1 3300050510 Bacteria 1379
1031 nmdc:mga06r32_4_c1 3300050510 Bacteria 144637
1032 nmdc:mga06r32_507974_c1 3300050510 Bacteria 1182
1033 nmdc:mga06r32_57624_c1 3300050510 Bacteria 3732
1034 nmdc:mga06r32_62018_c1 3300050510 Unclassified 3601
1035 nmdc:mga08y16_140765_c1 3300050511 Bacteria 2508
1036 nmdc:mga08y16_17963_c1 3300050511 Bacteria 7451
1037 nmdc:mga08y16_2104_c1 3300050511 Bacteria 20397
1038 nmdc:mga0n895_121556_c1 3300050512 Bacteria 2632
1039 nmdc:mga0n895_13734_c1 3300050512 Bacteria 7322
1040 nmdc:mga0n895_142005_c1 3300050512 Bacteria 2430
1041 nmdc:mga0n895_151376_c1 3300050512 Bacteria 2350
1042 nmdc:mga0n895_229499_c1 3300050512 Bacteria 1884
1043 nmdc:mga0rr50_13041_c1 3300050513 Bacteria 5394
1044 nmdc:mga0rr50_200654_c1 3300050513 Bacteria 1639
1045 nmdc:mga0rr50_3169_c1 3300050513 Bacteria 9406
1046 nmdc:mga08x19_161341_c1 3300050514 Bacteria 1522
1047 nmdc:mga08x19_30895_c1 3300050514 Bacteria 3366
1048 nmdc:mga0a205_210960_c1 3300050515 Bacteria 1830
1049 nmdc:mga0a205_360096_c1 3300050515 Bacteria 1321
1050 nmdc:mga0sz30_7423_c1 3300050516 Bacteria 4111
1051 Ga0495601_0000152 3300053077 Bacteria 38651
1052 Ga0495601_0011509 3300053077 Bacteria 5297
1053 Ga0495601_0049432 3300053077 Bacteria 2651
1054 Ga0495601_0273049 3300053077 Bacteria 1103
1055 Ga0495601_0290689 3300053077 Unclassified 1065
1056 Ga0495612_0000244 3300053078 Bacteria 22545
1057 Ga0495612_0010585 3300053078 Bacteria 3729
1058 Ga0500635_0009055 3300053080 Bacteria 2750
1059 Ga0495655_0062184 3300053083 Bacteria 1021
1060 Ga0495595_0000630 3300053084 Bacteria 13416
1061 Ga0495595_0000791 3300053084 Bacteria 12040
1062 Ga0495595_0002676 3300053084 Bacteria 6987
1063 Ga0495595_0009750 3300053084 Bacteria 3979
1064 Ga0495619_0000115 3300053085 Bacteria 58866
1065 Ga0495619_0002237 3300053085 Bacteria 12800
1066 Ga0495619_0008613 3300053085 Bacteria 6452
1067 Ga0495619_0027135 3300053085 Bacteria 3689
1068 Ga0495619_0085216 3300053085 Bacteria 2133
1069 Ga0500644_0018798 3300053088 Bacteria 2031
1070 Ga0500583_0074743 3300053092 Bacteria 1626
1071 Ga0500566_0000012 3300053094 Bacteria 117873
1072 Ga0500640_003280 3300053095 Bacteria 5610
1073 Ga0500562_014828 3300053108 Bacteria 1997
1074 Ga0500572_001242 3300053111 Bacteria 7199
1075 Ga0500595_000859 3300053119 Bacteria 17361
1076 Ga0500595_070702 3300053119 Bacteria 1036
1077 Ga0500614_001494 3300053123 Bacteria 5575
1078 Ga0500559_0005620 3300053136 Bacteria 5745
1079 Ga0500568_0052787 3300053139 Bacteria 1595
1080 Ga0500603_000575 3300053150 Bacteria 9226
1081 Ga0500603_000585 3300053150 Bacteria 9138
1082 Ga0500616_0005716 3300053153 Bacteria 8371
1083 Ga0500630_001334 3300053159 Bacteria 11605
1084 Ga0500634_0051253 3300053161 Bacteria 2221
1085 Ga0500638_054741 3300053162 Bacteria 1924
1086 Ga0500639_000095 3300053163 Bacteria 41536
1087 Ga0500639_098922 3300053163 Bacteria 1440
1088 Ga0500636_0133044 3300053177 Bacteria 1383
1089 Ga0500637_0115947 3300053178 Bacteria 1553
1090 Ga0500609_004628 3300053731 Bacteria 1896
1091 Ga0500596_000600 3300053735 Bacteria 6928
1092 Ga0500596_008690 3300053735 Bacteria 1613
1093 Ga0501084_0031511 3300054114 Bacteria 4433
1094 Ga0501084_0061580 3300054114 Bacteria 3142
1095 Ga0501084_0480948 3300054114 Bacteria 1050
1096 Ga0590077_006676 3300059426 Bacteria 2363
1097 Ga0501082_0000264 3300060353 Bacteria 46205
1098 Ga0501082_0106658 3300060353 Bacteria 2424
1099 Ga0501082_0270207 3300060353 Bacteria 1480
1100 Ga0530510_0076444 3300061734 Bacteria 2433
1101 Ga0530510_0132768 3300061734 Bacteria 1832
1102 2513693094 2513237101 Bacteria 7952346
1103 2793080737
1104 2854899012 2854896431 Bacteria 5869725
1105 2876816068 2876808645 Bacteria 8824342
1106 2879110842 2879110137 Bacteria 8907982
1107 2883580517 2883577096 Bacteria 4709178
1108 2889037590 2889033259 Bacteria 9099371
1109 8006985075 8006984368 Bacteria 9651211
1110 8056677585 8056673599 Bacteria 7871253
1111 Ga0081455_10011732
1112 JGI24750J21931_1000889
1113 JGI24744J21845_10000391
1114 JGI24742J22300_10025552
1115 JGI25406J46586_10004281
1116 JGI25406J46586_10005104
1117 JGI25153J46596_10002190
1118 JGI25404J52841_10002634
1119 JGI25404J52841_10015190
1120 Ga0070676_10174554
1121 Ga0070683_100591791
1122 Ga0070670_100017319
1123 Ga0070670_100226205
1124 Ga0070677_10155014
1125 Ga0068869_100024381
1126 Ga0068869_100210379
1127 Ga0070666_10050373
1128 Ga0070680_100130833
1129 Ga0070680_100208752
1130 Ga0070682_100115362
1131 Ga0068868_100033796
1132 Ga0068868_100055724
1133 Ga0068868_100056637
1134 Ga0070660_100131451
1135 Ga0070689_100010283
1136 Ga0070689_100019103
1137 Ga0070689_100067415
1138 Ga0070689_100124664
1139 Ga0070689_100192611
1140 Ga0070689_100296181
1141 Ga0070691_10028162
1142 Ga0070687_100024371
1143 Ga0070687_100070446
1144 Ga0070687_100190436
1145 Ga0070661_100090767
1146 Ga0070692_10030726
1147 Ga0070692_10036227
1148 Ga0070692_10130013
1149 Ga0070668_100046375
1150 Ga0070668_100049732
1151 Ga0070669_100006968
1152 Ga0070669_100058552
1153 Ga0070669_100164406
1154 Ga0070669_100292720
1155 Ga0070675_100010672
1156 Ga0070675_100061551
1157 Ga0070675_100092950
1158 Ga0070675_100118964
1159 Ga0070671_100003829
1160 Ga0070671_100028496
1161 Ga0070671_100064321
1162 Ga0070671_100083958
1163 Ga0070671_100098269
1164 Ga0070671_100426887
1165 Ga0070674_100006772
1166 Ga0070674_100010698
1167 Ga0070674_100024307
1168 Ga0070674_100033803
1169 Ga0070674_100084156
1170 Ga0070674_100142174
1171 Ga0070674_100161819
1172 Ga0070674_100198831
1173 Ga0070673_100021834
1174 Ga0070673_100046783
1175 Ga0070673_100066975
1176 Ga0070688_100056381
1177 Ga0070688_100104682
1178 Ga0070688_100195804
1179 Ga0070659_100031532
1180 Ga0070659_100142622
1181 Ga0070659_100257732
1182 Ga0070659_100406829
1183 Ga0070667_100015027
1184 Ga0070667_100027938
1185 Ga0070667_100083681
1186 Ga0070709_10005461
1187 Ga0070709_10220297
1188 Ga0070714_100031250
1189 Ga0070714_100061470
1190 Ga0070714_100337216
1191 Ga0070713_100014160
1192 Ga0070713_100145400
1193 Ga0070713_100150250
1194 Ga0070713_100199301
1195 Ga0070713_100241346
1196 Ga0070710_10010533
1197 Ga0070710_10012586
1198 Ga0070710_10042502
1199 Ga0070710_10058428
1200 Ga0070701_10004472
1201 Ga0070701_10145532
1202 Ga0070711_100041381
1203 Ga0070711_100080723
1204 Ga0070711_100102224
1205 Ga0070711_100185592
1206 Ga0070711_100257011
1207 Ga0070705_100061390
1208 Ga0070705_100078880
1209 Ga0070700_100056600
1210 Ga0070700_100072768
1211 Ga0070700_100100530
1212 Ga0070700_100112083
1213 Ga0070700_100119797
1214 Ga0070694_100019929
1215 Ga0070708_100069806
1216 Ga0070708_100189853
1217 Ga0070663_100003523
1218 Ga0070663_100057583
1219 Ga0070663_100088698
1220 Ga0070663_100344084
1221 Ga0070678_100047943
1222 Ga0070678_100074012
1223 Ga0070678_100118789
1224 Ga0070678_100122452
1225 Ga0070678_100148650
1226 Ga0070662_100073619
1227 Ga0070662_100099204
1228 Ga0070662_100129384
1229 Ga0070662_100147207
1230 Ga0070681_10132681
1231 Ga0070681_10204374
1232 Ga0068867_100009135
1233 Ga0070685_10003711
1234 Ga0070685_10024316
1235 Ga0070685_10040183
1236 Ga0070685_10226995
1237 Ga0070706_100037571
1238 Ga0070698_100389246
1239 Ga0070699_100044495
1240 Ga0070699_100369125
1241 Ga0070684_100050829
1242 Ga0070684_100090261
1243 Ga0070697_100039116
1244 Ga0070697_100120632
1245 Ga0070697_100133465
1246 Ga0068853_100071702
1247 Ga0068853_100113939
1248 Ga0068853_100141681
1249 Ga0068853_100161258
1250 Ga0070672_100037653
1251 Ga0070672_100061976
1252 Ga0070672_100188998
1253 Ga0070672_100493386
1254 Ga0070686_100002493
1255 Ga0070686_100204398
1256 Ga0070695_100002513
1257 Ga0070695_100004291
1258 Ga0070696_100105837
1259 Ga0070696_100315380
1260 Ga0070693_100050186
1261 Ga0070693_100171287
1262 Ga0070665_100026385
1263 Ga0070665_100120172
1264 Ga0070704_100446560
1265 Ga0068855_100210694
1266 Ga0070664_100091097
1267 Ga0070664_100126126
1268 Ga0068857_100104663
1269 Ga0068854_100338084
1270 Ga0068854_100377911
1271 Ga0068854_100389033
1272 Ga0068856_100074656
1273 Ga0068856_100134560
1274 Ga0068856_100234108
1275 Ga0070702_100012167
1276 Ga0070702_100015685
1277 Ga0068852_100079355
1278 Ga0068852_100088389
1279 Ga0068859_100104992
1280 Ga0068859_100121689
1281 Ga0068859_100122305
1282 Ga0068859_100167891
1283 Ga0068859_100307471
1284 Ga0068859_100382420
1285 Ga0068864_100011177
1286 Ga0068864_100036792
1287 Ga0068864_100047643
1288 Ga0068864_100066167
1289 Ga0068866_10017075
1290 Ga0068866_10023911
1291 Ga0068866_10110868
1292 Ga0068866_10135016
1293 Ga0068861_100078096
1294 Ga0068861_100124851
1295 Ga0068861_100394379
1296 Ga0068851_10083567
1297 Ga0068870_10001278
1298 Ga0068870_10040514
1299 Ga0068870_10164593
1300 Ga0068863_100077713
1301 Ga0068863_100473032
1302 Ga0068863_100511551
1303 Ga0068863_100518417
1304 Ga0068858_100003359
1305 Ga0068858_100038474
1306 Ga0068858_100350278
1307 Ga0068860_100047356
1308 Ga0068860_100054250
1309 Ga0068860_100245889
1310 Ga0068860_100632286
1311 Ga0068862_100010721
1312 Ga0068862_100011858
1313 Ga0068862_100068511
1314 Ga0068862_100098142
1315 Ga0068862_100147137
1316 Ga0081455_10006073
1317 Ga0081455_10006153
1318 Ga0081455_10007998
1319 Ga0081455_10024867
1320 Ga0081455_10058745
1321 Ga0081455_10167377
1322 Ga0081538_10009001
1323 Ga0081538_10024689
1324 Ga0081538_10036784
1325 Ga0081540_1000338
1326 Ga0081540_1001883
1327 Ga0081540_1005306
1328 Ga0081540_1005989
1329 Ga0081540_1014606
1330 Ga0081540_1017298
1331 Ga0081540_1035157
1332 Ga0081540_1050305
1333 Ga0081540_1077100
1334 Ga0081539_10001094
1335 Ga0081539_10002062
1336 Ga0081539_10052260
1337 Ga0070717_10003746
1338 Ga0070717_10119097
1339 Ga0070717_10139481
1340 Ga0070717_10379216
1341 Ga0070717_10388707
1342 Ga0075365_10000347
1343 Ga0075365_10005992
1344 Ga0075365_10007347
1345 Ga0075365_10018670
1346 Ga0075365_10019141
1347 Ga0075365_10042158
1348 Ga0075365_10112619
1349 Ga0075365_10139950
1350 Ga0075368_10003192
1351 Ga0075368_10010918
1352 Ga0075368_10014306
1353 Ga0075368_10024541
1354 Ga0075368_10073427
1355 Ga0075363_100011774
1356 Ga0075363_100029709
1357 Ga0075364_10014842
1358 Ga0075364_10095053
1359 Ga0075364_10113145
1360 Ga0070715_10004466
1361 Ga0070715_10031473
1362 Ga0070716_100136132
1363 Ga0070712_100053086
1364 Ga0070712_100323446
1365 Ga0075362_10054948
1366 Ga0075362_10085255
1367 Ga0075367_10009833
1368 Ga0075367_10035076
1369 Ga0075367_10036670
1370 Ga0075367_10059545
1371 Ga0075367_10064015
1372 Ga0075367_10067304
1373 Ga0075367_10071557
1374 Ga0075367_10125567
1375 Ga0075369_10040923
1376 Ga0075366_10031572
1377 Ga0075366_10054064
1378 Ga0097621_100021567
1379 Ga0097621_100071368
1380 Ga0097621_100097497
1381 Ga0097621_100159309
1382 Ga0097621_100267820
1383 Ga0075370_10018836
1384 Ga0075370_10082039
1385 Ga0068871_100088999
1386 Ga0075428_100004072
1387 Ga0075428_100070572
1388 Ga0075428_100124305
1389 Ga0075428_100194510
1390 Ga0075428_100236159
1391 Ga0075428_100285113
1392 Ga0075428_100503652
1393 Ga0075428_100557468
1394 Ga0075430_100010962
1395 Ga0075430_100043636
1396 Ga0075430_100058315
1397 Ga0075430_100109479
1398 Ga0075431_100000021
1399 Ga0075431_100040334
1400 Ga0075431_100095125
1401 Ga0075431_100300640
1402 Ga0075433_10104205
1403 Ga0075433_10419190
1404 Ga0075434_100003972
1405 Ga0075434_100046006
1406 Ga0075429_100022600
1407 Ga0075429_100045168
1408 Ga0075429_100142580
1409 Ga0068865_100013556
1410 Ga0068865_100025863
1411 Ga0075436_100037211
1412 Ga0075436_100070687
1413 Ga0097620_100104990
1414 Ga0097620_100121693
1415 Ga0097620_100122310
1416 Ga0097620_100167895
1417 Ga0097620_100307489
1418 Ga0097620_100382384
1419 Ga0075435_100003318
1420 Ga0075435_100053822
1421 Ga0075435_100103814
1422 Ga0099794_10001204
1423 Ga0099795_10036431
1424 Ga0105250_10041945
1425 Ga0105240_10540807
1426 Ga0111539_10001676
1427 Ga0111539_10019188
1428 Ga0111539_10181331
1429 Ga0111539_10289874
1430 Ga0111539_10355627
1431 Ga0105245_10008525
1432 Ga0105245_10044105
1433 Ga0105245_10212793
1434 Ga0105245_10226751
1435 Ga0105245_10361400
1436 Ga0105247_10006686
1437 Ga0105247_10007853
1438 Ga0105247_10036593
1439 Ga0105247_10078275
1440 Ga0105247_10235050
1441 Ga0114129_10000068
1442 Ga0114129_10062125
1443 Ga0114129_10069665
1444 Ga0114129_10094433
1445 Ga0114129_10129902
1446 Ga0114129_10130192
1447 Ga0114129_10136370
1448 Ga0114129_10170504
1449 Ga0114129_10243588
1450 Ga0114129_10302240
1451 Ga0114129_10415796
1452 Ga0105243_10007460
1453 Ga0105243_10022206
1454 Ga0105243_10050293
1455 Ga0105243_10155426
1456 Ga0105241_10097564
1457 Ga0105241_10217511
1458 Ga0105241_10223567
1459 Ga0105242_10044861
1460 Ga0105242_10172149
1461 Ga0105242_10192718
1462 Ga0105248_10183607
1463 Ga0105237_10113091
1464 Ga0105237_10297757
1465 Ga0105238_10029419
1466 Ga0105238_10124467
1467 Ga0105249_10003555
1468 Ga0105249_10011297
1469 Ga0105249_10106250
1470 Ga0105249_10319880
1471 Ga0099796_10034004
1472 Ga0105239_10109631
1473 Ga0105239_10329180
1474 Ga0105246_10035693
1475 Ga0105246_10099988
1476 Ga0105246_10109613
1477 Ga0105246_10262861
1478 Ga0105246_10331868
1479 Ga0157373_10081779
1480 Ga0157371_10135289
1481 Ga0157374_10010555
1482 Ga0157374_10012705
1483 Ga0157374_10128778
1484 Ga0157374_10327507
1485 Ga0157374_10368308
1486 Ga0163162_10078540
1487 Ga0163162_10089608
1488 Ga0163162_10219275
1489 Ga0163162_10219863
1490 Ga0163162_10290924
1491 Ga0157372_10190342
1492 Ga0157372_10355098
1493 Ga0157375_10040338
1494 Ga0157375_10076779
1495 Ga0157375_10114778
1496 Ga0157375_10228834
1497 Ga0157375_10343704
1498 Ga0163163_10043454
1499 Ga0163163_10050766
1500 Ga0163163_10096848
1501 Ga0157380_10030033
1502 Ga0157380_10118134
1503 Ga0157380_10136107
1504 Ga0157380_10191036
1505 Ga0157380_10263980
1506 Ga0157379_10011977
1507 Ga0157376_10018166
1508 Ga0163161_10055522
1509 Ga0163161_10218078
1510 Ga0213872_10068820
1511 Ga0213876_10104940
1512 Ga0209758_1000613
1513 Ga0209758_1002704
1514 Ga0209758_1068034
1515 Ga0207426_1046380
1516 Ga0207697_10027198
1517 Ga0207682_10003199
1518 Ga0207682_10014389
1519 Ga0207682_10072015
1520 Ga0207692_10003985
1521 Ga0207692_10010794
1522 Ga0207692_10021013
1523 Ga0207692_10085035
1524 Ga0207692_10242300
1525 Ga0207642_10012038
1526 Ga0207642_10014784
1527 Ga0207642_10028738
1528 Ga0207642_10145727
1529 Ga0207710_10034621
1530 Ga0207710_10084977
1531 Ga0207688_10002540
1532 Ga0207688_10011975
1533 Ga0207688_10016159
1534 Ga0207688_10028038
1535 Ga0207688_10057972
1536 Ga0207647_10013439
1537 Ga0207685_10077549
1538 Ga0207699_10014440
1539 Ga0207699_10019700
1540 Ga0207645_10061779
1541 Ga0207645_10184888
1542 Ga0207643_10000967
1543 Ga0207643_10033684
1544 Ga0207643_10042084
1545 Ga0207684_10003027
1546 Ga0207684_10140872
1547 Ga0207707_10193705
1548 Ga0207671_10339045
1549 Ga0207693_10004220
1550 Ga0207693_10012252
1551 Ga0207693_10097589
1552 Ga0207693_10122885
1553 Ga0207693_10172088
1554 Ga0207663_10046299
1555 Ga0207663_10057001
1556 Ga0207663_10070614
1557 Ga0207663_10093574
1558 Ga0207663_10259595
1559 Ga0207660_10099352
1560 Ga0207660_10161018
1561 Ga0207662_10011477
1562 Ga0207662_10084162
1563 Ga0207652_10260840
1564 Ga0207646_10039144
1565 Ga0207646_10269202
1566 Ga0207681_10009139
1567 Ga0207694_10257318
1568 Ga0207694_10283753
1569 Ga0207650_10053772
1570 Ga0207650_10067708
1571 Ga0207650_10142180
1572 Ga0207659_10019858
1573 Ga0207659_10058280
1574 Ga0207659_10069639
1575 Ga0207659_10124369
1576 Ga0207659_10204227
1577 Ga0207687_10026708
1578 Ga0207687_10033406
1579 Ga0207687_10132680
1580 Ga0207700_10014481
1581 Ga0207700_10052461
1582 Ga0207700_10275010
1583 Ga0207664_10021410
1584 Ga0207664_10076975
1585 Ga0207644_10025738
1586 Ga0207706_10007796
1587 Ga0207706_10011027
1588 Ga0207706_10014313
1589 Ga0207706_10033052
1590 Ga0207706_10033732
1591 Ga0207706_10043930
1592 Ga0207686_10007031
1593 Ga0207686_10079263
1594 Ga0207709_10008517
1595 Ga0207709_10009791
1596 Ga0207709_10027652
1597 Ga0207709_10035136
1598 Ga0207709_10193804
1599 Ga0207670_10019846
1600 Ga0207670_10068147
1601 Ga0207670_10192720
1602 Ga0207669_10012290
1603 Ga0207669_10013751
1604 Ga0207669_10035536
1605 Ga0207669_10074471
1606 Ga0207704_10010940
1607 Ga0207704_10022313
1608 Ga0207665_10001994
1609 Ga0207665_10054389
1610 Ga0207665_10168927
1611 Ga0207665_10263166
1612 Ga0207691_10024270
1613 Ga0207691_10050650
1614 Ga0207691_10080508
1615 Ga0207691_10125092
1616 Ga0207691_10201093
1617 Ga0207711_10008863
1618 Ga0207711_10048377
1619 Ga0207711_10153792
1620 Ga0207711_10228374
1621 Ga0207689_10012734
1622 Ga0207689_10062666
1623 Ga0207689_10227112
1624 Ga0207689_10274304
1625 Ga0207679_10019653
1626 Ga0207679_10493858
1627 Ga0207667_10093335
1628 Ga0207667_10180699
1629 Ga0207651_10019208
1630 Ga0207651_10114348
1631 Ga0207651_10144470
1632 Ga0207651_10394920
1633 Ga0207712_10015690
1634 Ga0207712_10022315
1635 Ga0207712_10026871
1636 Ga0207712_10099491
1637 Ga0207712_10275096
1638 Ga0207668_10003464
1639 Ga0207668_10069010
1640 Ga0207640_10151858
1641 Ga0207640_10235682
1642 Ga0207677_10083341
1643 Ga0207677_10184476
1644 Ga0207703_10098000
1645 Ga0207639_10054958
1646 Ga0207639_10213818
1647 Ga0207678_10010626
1648 Ga0207678_10015172
1649 Ga0207678_10038156
1650 Ga0207678_10041400
1651 Ga0207678_10093743
1652 Ga0207678_10211721
1653 Ga0207708_10001893
1654 Ga0207708_10001982
1655 Ga0207708_10021646
1656 Ga0207708_10031086
1657 Ga0207708_10034508
1658 Ga0207708_10098027
1659 Ga0207708_10105517
1660 Ga0207702_10045702
1661 Ga0207702_10260214
1662 Ga0207702_10301905
1663 Ga0207641_10008033
1664 Ga0207641_10462747
1665 Ga0207648_10000930
1666 Ga0207648_10001640
1667 Ga0207648_10005439
1668 Ga0207648_10008314
1669 Ga0207648_10053736
1670 Ga0207648_10156449
1671 Ga0207648_10191343
1672 Ga0207676_10037062
1673 Ga0207676_10094244
1674 Ga0207676_10097222
1675 Ga0207674_10077499
1676 Ga0207674_10147936
1677 Ga0207675_100003662
1678 Ga0207675_100007548
1679 Ga0207675_100023222
1680 Ga0207675_100031749
1681 Ga0207675_100159483
1682 Ga0207675_100237983
1683 Ga0207683_10006631
1684 Ga0207683_10015287
1685 Ga0207683_10024348
1686 Ga0207683_10043509
1687 Ga0207683_10044403
1688 Ga0207683_10104176
1689 Ga0207683_10236169
1690 Ga0207683_10297025
1691 Ga0207683_10303956
1692 Ga0207698_10037686
1693 Ga0207698_10060552
1694 Ga0209179_1004682
1695 Ga0209813_10000171
1696 Ga0209813_10015289
1697 Ga0209813_10029792
1698 Ga0207428_10008060
1699 Ga0207428_10018287
1700 Ga0207428_10075460
1701 Ga0207428_10120998
1702 Ga0207428_10290521
1703 Ga0268266_10001685
1704 Ga0268266_10018266
1705 Ga0268266_10045547
1706 Ga0268266_10046622
1707 Ga0268266_10046802
1708 Ga0268265_10013298
1709 Ga0268265_10014407
1710 Ga0268265_10070907
1711 Ga0268265_10089156
1712 Ga0268265_10121974
1713 Ga0268265_10139426
1714 Ga0268264_10184569
1715 Ga0268264_10197026
1716 Ga0268264_10331799
1717 Ga0268264_10419225
1718 Ga0268264_10608294
1719 Ga0265338_10120807
1720 Ga0265330_10013169
1721 Ga0265325_10000004
1722 Ga0265325_10028878
1723 Ga0265325_10075214
1724 Ga0265329_10009404
1725 Ga0265329_10046160
1726 Ga0265340_10025003
1727 Ga0265340_10050316
1728 Ga0265340_10127286
1729 Ga0265339_10173581
1730 Ga0265331_10095816
1731 Ga0265316_10021306
1732 Ga0307509_10174846
1733 Ga0265313_10020510
1734 Ga0265313_10026917
1735 Ga0265313_10110096
1736 Ga0307508_10000557
1737 Ga0265342_10067459
1738 Ga0307516_10007912
1739 Ga0307516_10182259
1740 Ga0307507_10022361
1741 Ga0307510_10006581
1742 Ga0307510_10051168
1743 Ga0373940_0005232
1744 Ga0373944_0015814
1745 Ga0373944_0024740
1746 Ga0373932_0025073
1747 Ga0373936_0059667
1748 Ga0373936_0089062
1749 Ga0373939_0031876
1750 Ga0373945_0008749
1751 Ga0373945_0078181
1752 Ga0373953_0043926
1753 Ga0373954_0007914
1754 Ga0373954_0014684
1755 Ga0373956_0015153
1756 Ga0373943_0000789
1757 Ga0373943_0023389
1758 Ga0373943_0036254
1759 Ga0373943_0170701
1760 Ga0373946_0006277
1761 Ga0373955_0002543
1762 Ga0373955_0004726
1763 Ga0373955_0009435
1764 Ga0373955_0028671
1765 Ga0373942_0008505
1766 Ga0373942_0010104
1767 Ga0373962_0028297
1768 Ga0373924_0020264
1769 Ga0373931_0000929
1770 Ga0373931_0005106
1771 Ga0373931_0051355
1772 Ga0373935_0000272
1773 Ga0373935_0023128
1774 Ga0373935_0025862
1775 Ga0373935_0034682
1776 Ga0373935_0087425
1777 Ga0373927_0000980
1778 Ga0373927_0146535
1779 Ga0373933_0000342
1780 Ga0373933_0004825
1781 Ga0373947_0000563
1782 Ga0373947_0029410
1783 Ga0373947_0090170
1784 Ga0373947_0099913
1785 Ga0373947_0166421
1786 Ga0373937_0014119
1787 Ga0373937_0015092
1788 Ga0373937_0016767
1789 Ga0373937_0017936
1790 Ga0373937_0122423
1791 Ga0373937_0192866
1792 Ga0373925_0001601
1793 Ga0373925_0030638
1794 Ga0373925_0041679
1795 Ga0373925_0062852
1796 Ga0395898_0237820
1797 Ga0395905_0249861
1798 Ga0436365_0424004
1799 Ga0436365_1317488
1800 Ga0436361_0707516
1801 Ga0439453_0001434
1802 Ga0451853_3534647
1803 Ga0439446_0019995
1804 Ga0495617_042446
1805 Ga0495617_065707
1806 Ga0495592_0001183
1807 Ga0495592_0147310
1808 Ga0495603_0000766
1809 Ga0495603_0013119
1810 Ga0495603_0044959
1811 Ga0495603_0053860
1812 Ga0495603_0169289
1813 Ga0495629_0000499
1814 Ga0495629_0100280
1815 Ga0495638_0030282
1816 Ga0495641_0009138
1817 Ga0495641_0016576
1818 Ga0495641_0072960
1819 Ga0495651_0012555
1820 Ga0495651_0067206
1821 Ga0495653_0009651
1822 Ga0495653_0026510
1823 Ga0495580_0001242
1824 Ga0495582_0001185
1825 Ga0495582_0169315
1826 Ga0495639_0000003
1827 Ga0495639_0075874
1828 Ga0495662_0000185
1829 Ga0495662_0026927
1830 Ga0495662_0090295
1831 Ga0495664_0001147
1832 Ga0495664_0201651
1833 Ga0495584_0033275
1834 Ga0495584_0122167
1835 Ga0495584_0190274
1836 Ga0495585_0061619
1837 Ga0495585_0098639
1838 Ga0495585_0176257
1839 Ga0495594_0001056
1840 Ga0495594_0039434
1841 Ga0495594_0106088
1842 Ga0495596_0038744
1843 Ga0495608_0005264
1844 Ga0495616_0154308
1845 Ga0495618_0013776
1846 Ga0495618_0297408
1847 Ga0495628_0001064
1848 Ga0495628_0009740
1849 Ga0495628_0074799
1850 Ga0495628_0278393
1851 Ga0495630_0000566
1852 Ga0495630_0046821
1853 Ga0495644_0038917
1854 Ga0495644_0047264
1855 Ga0495666_0143752
1856 Ga0495652_0001634
1857 Ga0495652_0014266
1858 Ga0495652_0075353
1859 Ga0495652_0124160
1860 Ga0495654_0031846
1861 Ga0495665_0000138
1862 Ga0495640_0000274
1863 Ga0495640_0009232
1864 Ga0495640_0054421
1865 Ga0495640_0092072
1866 Ga0495640_0111493
1867 Ga0495587_0030465
1868 Ga0495587_0031234
1869 Ga0495598_0023365
1870 Ga0495598_0024329
1871 Ga0495598_0032303
1872 Ga0495598_0077165
1873 Ga0495621_0019492
1874 Ga0495597_0112379
1875 Ga0495645_0000368
1876 Ga0495645_0044172
1877 Ga0495622_0005994
1878 Ga0495622_0015157
1879 Ga0495622_0084514
1880 Ga0495633_0071844
1881 Ga0495633_0102146
1882 Ga0495667_0001463
1883 Ga0495667_0005593
1884 Ga0495667_0270296
1885 Ga0495656_0008186
1886 Ga0495656_0032309
1887 Ga0495656_0075708
1888 Ga0495656_0089444
1889 Ga0495668_0021357
1890 Ga0495668_0134706
1891 Ga0495668_0177322
1892 Ga0495634_0000360
1893 Ga0495611_0120049
1894 Ga0495625_0060466
1895 Ga0495635_0005840
1896 Ga0495635_0098331
1897 Ga0495588_0003118
1898 Ga0495588_0003814
1899 Ga0495588_0041292
1900 Ga0495588_0046322
1901 Ga0495657_0004684
1902 Ga0495657_0029673
1903 Ga0495599_0003753
1904 Ga0495599_0137722
1905 Ga0495623_0001952
1906 Ga0495623_0012684
1907 Ga0495646_0025109
1908 Ga0495646_0073236
1909 Ga0495647_0032336
1910 Ga0495658_0000136
1911 Ga0495669_0030515
1912 Ga0495669_0134625
1913 Ga0495613_0056803
1914 Ga0495613_0077761
1915 Ga0495624_0047913
1916 Ga0495624_0050434
1917 Ga0495670_0065432
1918 Ga0495670_0068531
1919 Ga0495671_0107799
1920 Ga0495649_0055083
1921 Ga0495649_0101955
1922 Ga0495589_0108656
1923 Ga0495600_0003190
1924 Ga0495600_0005894
1925 Ga0495600_0039933
1926 Ga0495600_0353871
1927 Ga0495581_0000614
1928 Ga0495604_0001623
1929 Ga0495604_0003305
1930 Ga0495604_0183999
1931 Ga0495636_0035467
1932 Ga0495674_0001053
1933 Ga0495674_0266420
1934 Ga0495676_0042243
1935 Ga0495676_0148389
1936 Ga0495676_0218563
1937 Ga0495680_0001148
1938 Ga0495680_0013379
1939 Ga0495675_0055623
1940 Ga0495675_0056778
1941 Ga0495675_0252367
1942 Ga0495677_0069961
1943 Ga0495677_0138958
1944 Ga0495679_047269
1945 Ga0495684_0066616
1946 Ga0495686_0054902
1947 Ga0495686_0211866
1948 Ga0495593_0000819
1949 Ga0495602_0000791
1950 Ga0495602_0007047
1951 Ga0495614_0029765
1952 Ga0496100_0019077
1953 Ga0496100_0024781
1954 Ga0496100_0138034
1955 Ga0496100_0187172
1956 Ga0496101_0002847
1957 Ga0496101_0008762
1958 Ga0496101_0118958
1959 Ga0496101_0285406
1960 Ga0496102_0007982
1961 Ga0496102_0010414
1962 Ga0496102_0130126
1963 Ga0496102_0354937
1964 Ga0496102_0415056
1965 Ga0496103_0012799
1966 Ga0496103_0034715
1967 Ga0496103_0211699
1968 Ga0496104_0000280
1969 Ga0496104_0000524
1970 Ga0496104_0011213
1971 Ga0496104_0016202
1972 Ga0496104_0033659
1973 Ga0496104_0043242
1974 Ga0496104_0112459
1975 Ga0496104_0136405
1976 Ga0496104_0213421
1977 Ga0496105_0000835
1978 Ga0496105_0004323
1979 Ga0496105_0039502
1980 Ga0496105_0048175
1981 Ga0496105_0052634
1982 Ga0496106_0008620
1983 Ga0496106_0030643
1984 Ga0496106_0060992
1985 Ga0496106_0119844
1986 Ga0496106_0142501
1987 Ga0496106_0197782
1988 Ga0496107_0038168
1989 Ga0496107_0051888
1990 Ga0496107_0071006
1991 Ga0496107_0088952
1992 Ga0496107_0233876
1993 Ga0496107_0234676
1994 Ga0496108_0002485
1995 Ga0496108_0007938
1996 Ga0496108_0009402
1997 Ga0496108_0143504
1998 Ga0496108_0158095
1999 Ga0496108_0160355
2000 Ga0496108_0185823
2001 Ga0496109_0001072
2002 Ga0496109_0004069
2003 Ga0496109_0023447
2004 Ga0496109_0230823
2005 Ga0496109_0314536
2006 Ga0496109_0349405
2007 Ga0496110_0000570
2008 Ga0496110_0015271
2009 Ga0496110_0032674
2010 Ga0496110_0233555
2011 Ga0496110_0282296
2012 Ga0496111_0001744
2013 Ga0496111_0030148
2014 Ga0496111_0042471
2015 Ga0496111_0066849
2016 Ga0496111_0068204
2017 Ga0496111_0106349
2018 Ga0496112_0005539
2019 Ga0496112_0005780
2020 Ga0496112_0057633
2021 Ga0496112_0079356
2022 Ga0496112_0086196
2023 Ga0496112_0216385
2024 Ga0496112_0226696
2025 Ga0496113_0021882
2026 Ga0496113_0024976
2027 Ga0496113_0025168
2028 Ga0496113_0049941
2029 Ga0496113_0106077
2030 Ga0496113_0194707
2031 Ga0496113_0242570
2032 Ga0496113_0291594
2033 Ga0496114_0014562
2034 Ga0496114_0025784
2035 Ga0496114_0030671
2036 Ga0496114_0101752
2037 Ga0496114_0106374
2038 Ga0496114_0195337
2039 Ga0496114_0497721
2040 Ga0496115_0009034
2041 Ga0496115_0034492
2042 Ga0496115_0060227
2043 Ga0496115_0062323
2044 Ga0496115_0090382
2045 Ga0496115_0105997
2046 Ga0496115_0182700
2047 Ga0496116_0141584
2048 Ga0496117_0099206
2049 Ga0496118_0005620
2050 Ga0496121_0003623
2051 Ga0496124_0002607
2052 Ga0496125_0058423
2053 Ga0496126_0004495
2054 Ga0496126_0024524
2055 Ga0501031_0060675
2056 Ga0501038_0030200
2057 Ga0501038_0411238
2058 Ga0501039_0030686
2059 Ga0501040_0116731
2060 Ga0501043_0271010
2061 Ga0501048_0349747
2062 Ga0501068_0057486
2063 Ga0501068_0096020
2064 Ga0501069_0048387
2065 Ga0501070_0172743
2066 Ga0501071_0088048
2067 Ga0501072_0005974
2068 Ga0501072_0045450
2069 Ga0501074_0364669
2070 Ga0501075_0150910
2071 Ga0501075_0328081
2072 Ga0501076_0026966
2073 Ga0501076_0117799
2074 Ga0501076_0156766
2075 Ga0501080_0029336
2076 Ga0501080_0292529
2077 Ga0501081_0133096
2078 Ga0501035_0037084
2079 Ga0501044_0010126
2080 Ga0501045_0257373
2081 nmdc:mga03683_1400_c1
2082 nmdc:mga03683_48740_c1
2083 nmdc:mga03n38_107706_c1
2084 nmdc:mga03n38_3003_c1
2085 nmdc:mga00v17_237648_c1
2086 nmdc:mga00v17_68044_c1
2087 nmdc:mga0yw44_119190_c1
2088 nmdc:mga0yw44_157697_c1
2089 nmdc:mga0yw44_172202_c1
2090 nmdc:mga0yw44_281628_c1
2091 nmdc:mga0yw44_34681_c1
2092 nmdc:mga0yw44_35615_c1
2093 nmdc:mga0yw44_48639_c1
2094 nmdc:mga0yw44_6629_c1
2095 nmdc:mga0yw44_8711_c1
2096 nmdc:mga0yw44_9174_c1
2097 nmdc:mga0k408_28510_c1
2098 nmdc:mga0k408_69721_c1
2099 nmdc:mga06z11_17762_c1
2100 nmdc:mga06z11_187542_c1
2101 nmdc:mga06z11_30638_c1
2102 nmdc:mga06z11_35179_c1
2103 nmdc:mga06z11_42150_c1
2104 nmdc:mga06z11_46444_c1
2105 nmdc:mga06z11_484_c1
2106 nmdc:mga06z11_51745_c1
2107 nmdc:mga06z11_79408_c1
2108 nmdc:mga04h51_2413_c1
2109 nmdc:mga04h51_28088_c1
2110 nmdc:mga04h51_3408_c1
2111 nmdc:mga07m45_117980_c1
2112 nmdc:mga07m45_32693_c1
2113 nmdc:mga05p37_151234_c1
2114 nmdc:mga05p37_268074_c1
2115 nmdc:mga05p37_299254_c1
2116 nmdc:mga05p37_498971_c1
2117 nmdc:mga05p37_52_c1
2118 nmdc:mga05p37_57225_c1
2119 nmdc:mga05p37_60269_c1
2120 nmdc:mga05p37_655533_c1
2121 nmdc:mga05p37_94209_c1
2122 nmdc:mga05p37_98281_c1
2123 nmdc:mga09592_126_c2
2124 nmdc:mga09592_159889_c1
2125 nmdc:mga09592_230200_c1
2126 nmdc:mga09592_255929_c1
2127 nmdc:mga09592_5425_c1
2128 nmdc:mga09592_73456_c1
2129 nmdc:mga0qj67_19482_c1
2130 nmdc:mga0qj67_19920_c1
2131 nmdc:mga0qj67_21393_c1
2132 nmdc:mga0qj67_297718_c1
2133 nmdc:mga0qj67_332365_c1
2134 nmdc:mga0qj67_47_c1
2135 nmdc:mga06r32_274569_c1
2136 nmdc:mga06r32_299694_c1
2137 nmdc:mga06r32_299709_c1
2138 nmdc:mga06r32_299934_c1
2139 nmdc:mga06r32_35443_c2
2140 nmdc:mga06r32_387919_c1
2141 nmdc:mga06r32_4_c1
2142 nmdc:mga06r32_507974_c1
2143 nmdc:mga06r32_57624_c1
2144 nmdc:mga06r32_62018_c1
2145 nmdc:mga08y16_140765_c1
2146 nmdc:mga08y16_17963_c1
2147 nmdc:mga08y16_2104_c1
2148 nmdc:mga0n895_121556_c1
2149 nmdc:mga0n895_13734_c1
2150 nmdc:mga0n895_142005_c1
2151 nmdc:mga0n895_151376_c1
2152 nmdc:mga0n895_229499_c1
2153 nmdc:mga0rr50_13041_c1
2154 nmdc:mga0rr50_200654_c1
2155 nmdc:mga0rr50_3169_c1
2156 nmdc:mga08x19_161341_c1
2157 nmdc:mga08x19_30895_c1
2158 nmdc:mga0a205_210960_c1
2159 nmdc:mga0a205_360096_c1
2160 nmdc:mga0sz30_7423_c1
2161 Ga0495601_0000152
2162 Ga0495601_0011509
2163 Ga0495601_0049432
2164 Ga0495601_0273049
2165 Ga0495601_0290689
2166 Ga0495612_0000244
2167 Ga0495612_0010585
2168 Ga0500635_0009055
2169 Ga0495655_0062184
2170 Ga0495595_0000630
2171 Ga0495595_0000791
2172 Ga0495595_0002676
2173 Ga0495595_0009750
2174 Ga0495619_0000115
2175 Ga0495619_0002237
2176 Ga0495619_0008613
2177 Ga0495619_0027135
2178 Ga0495619_0085216
2179 Ga0500644_0018798
2180 Ga0500583_0074743
2181 Ga0500566_0000012
2182 Ga0500640_003280
2183 Ga0500562_014828
2184 Ga0500572_001242
2185 Ga0500595_000859
2186 Ga0500595_070702
2187 Ga0500614_001494
2188 Ga0500559_0005620
2189 Ga0500568_0052787
2190 Ga0500603_000575
2191 Ga0500603_000585
2192 Ga0500616_0005716
2193 Ga0500630_001334
2194 Ga0500634_0051253
2195 Ga0500638_054741
2196 Ga0500639_000095
2197 Ga0500639_098922
2198 Ga0500636_0133044
2199 Ga0500637_0115947
2200 Ga0500609_004628
2201 Ga0500596_000600
2202 Ga0500596_008690
2203 Ga0501084_0031511
2204 Ga0501084_0061580
2205 Ga0501084_0480948
2206 Ga0590077_006676
2207 Ga0501082_0000264
2208 Ga0501082_0106658
2209 Ga0501082_0270207
2210 Ga0530510_0076444
2211 Ga0530510_0132768
2212 2513693094
2213 2793080737
2214 2854899012
2215 2876816068
2216 2879110842
2217 2883580517
2218 2889037590
2219 8006985075
2220 8056677585

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

94

370

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6hke-assembly1.cif.gz_A matc (rpa3494) from rhodopseudomonas palustris with bound malate 0.9654 29 320
2f5x-assembly3.cif.gz_C structure of periplasmic binding protein bugd 0.9639 29 325
2dvz-assembly1.cif.gz_A structure of a periplasmic transporter 0.9577 29 328
8hkb-assembly1.cif.gz_A tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d 0.9558 32 325
6hke-assembly1.cif.gz_A matc (rpa3494) from rhodopseudomonas palustris with bound malate 0.9558 29 320
ID Description Score Start End Superfamily
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9674 128 250 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9523 128 250 3.40.190.10
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9406 128 250 3.40.190.10
2f5xC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9376 130 250 3.40.190.10
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9333 128 250 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A327KHH5-F1-model_v4 ABC transporter substrate-binding protein 0.9676 19 328
AF-A0A1F4CWQ1-F1-model_v4 LacI family transcriptional regulator 0.9664 22 324
AF-A0A7C2YWG0-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9661 19 325
AF-A0A1J5PQ67-F1-model_v4 Tripartite tricarboxylate transporter family receptor 0.9659 72 319
AF-A0A1H8YFB1-F1-model_v4 Tripartite-type tricarboxylate transporter, receptor component TctC 0.9633 19 324

Map