F490213
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1110 | 415 | 2220 | 325 |
Family's Representative Sequence
| Representative Sequence | 3300005937|Ga0081455_10011732|Ga0081455_100117328 |
| Length | 373 |
| Sequence | MHGFSLEMHLHVTGCAFAGMTVEKDDSSATGHTRDAQQDERICDMRHAVTLKGLACLTALVLAAAPWDARAQSYPSRPITVVVPFPAGGPSDVVARIVTEQMGTILGQSMVIENVGGAGGTIGSARVAGAQPDGYTLLAGSMGSHVAAPVLTPNVKYDSERDFEPIGFTAHAPAVIVARKDFPAKDLREFVDYLKKNGDAVKQAHGGIGASSHMACLLFAAKAGVKPTLVAYRGTAPAMNDLVGGHVDFFCEQAVSVAPQISSGAIKAYGVSARERLAILPDVPTAKEAGIDYDMSIWAGIFAPKGTPKDVIDKLARALDQALDDPGVKKRLADLGGSLPTKDERTPAKFDAFVKAEIARWSPILKTANTETK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 2 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 3 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 4 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 7 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 73 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 79 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 80 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 81 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 83 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 84 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 85 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 86 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 90 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 91 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 92 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 93 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 95 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 96 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 97 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 98 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 99 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 100 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 101 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 102 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 103 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 104 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 106 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 107 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 108 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 122 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 136 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 137 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 199 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 203 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 204 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 205 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 206 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 207 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 208 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 209 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 210 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 211 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 212 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 213 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 214 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 215 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 216 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 217 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 218 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 219 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 221 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 222 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 223 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 224 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 225 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 226 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 227 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 228 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 229 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 230 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 231 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 232 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 233 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 234 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 235 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 236 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 237 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 238 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 239 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 240 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 241 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 242 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 243 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 244 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 245 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 246 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 320 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 321 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 322 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 323 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 324 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 325 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 326 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 327 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 328 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 329 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 330 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 331 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 332 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 333 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 334 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 335 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 336 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 337 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 338 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 339 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 340 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 360 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 361 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 362 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 363 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 364 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 365 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 366 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 367 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 377 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 380 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 384 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 385 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 386 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 387 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 388 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 389 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 390 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 391 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 392 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 393 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 394 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 395 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 396 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 397 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 398 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 399 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 400 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 401 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 402 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 403 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 404 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 405 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 406 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 407 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 408 | 2791355199 | |||
| 409 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 410 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 411 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 412 | 2883577096 | Roseococcus sp. SYP-B2431 | Isolate | Rhizosphere |
| 413 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 414 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 415 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.28 |
| Metatranscriptomes | 0 |
| Isolates | 0.72 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.92 |
| Nodule | 0.27 |
| Rhizoplane | 8.56 |
| Rhizosphere | 80.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.5 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0081455_10011732 | 3300005937 | Bacteria | 8782 |
| 2 | JGI24750J21931_1000889 | 3300002070 | Bacteria | 4093 |
| 3 | JGI24744J21845_10000391 | 3300002077 | Bacteria | 7532 |
| 4 | JGI24742J22300_10025552 | 3300002244 | Bacteria | 1021 |
| 5 | JGI25406J46586_10004281 | 3300003203 | Bacteria | 6668 |
| 6 | JGI25406J46586_10005104 | 3300003203 | Bacteria | 6091 |
| 7 | JGI25153J46596_10002190 | 3300003215 | Bacteria | 11406 |
| 8 | JGI25404J52841_10002634 | 3300003659 | Bacteria | 3424 |
| 9 | JGI25404J52841_10015190 | 3300003659 | Bacteria | 1672 |
| 10 | Ga0070676_10174554 | 3300005328 | Bacteria | 1393 |
| 11 | Ga0070683_100591791 | 3300005329 | Bacteria | 1061 |
| 12 | Ga0070670_100017319 | 3300005331 | Bacteria | 6180 |
| 13 | Ga0070670_100226205 | 3300005331 | Bacteria | 1628 |
| 14 | Ga0070677_10155014 | 3300005333 | Bacteria | 1069 |
| 15 | Ga0068869_100024381 | 3300005334 | Bacteria | 4190 |
| 16 | Ga0068869_100210379 | 3300005334 | Bacteria | 1537 |
| 17 | Ga0070666_10050373 | 3300005335 | Unclassified | 2801 |
| 18 | Ga0070680_100130833 | 3300005336 | Bacteria | 2100 |
| 19 | Ga0070680_100208752 | 3300005336 | Bacteria | 1647 |
| 20 | Ga0070682_100115362 | 3300005337 | Bacteria | 1796 |
| 21 | Ga0068868_100033796 | 3300005338 | Bacteria | 3944 |
| 22 | Ga0068868_100055724 | 3300005338 | Bacteria | 3120 |
| 23 | Ga0068868_100056637 | 3300005338 | Bacteria | 3096 |
| 24 | Ga0070660_100131451 | 3300005339 | Bacteria | 2003 |
| 25 | Ga0070689_100010283 | 3300005340 | Bacteria | 6668 |
| 26 | Ga0070689_100019103 | 3300005340 | Bacteria | 5062 |
| 27 | Ga0070689_100067415 | 3300005340 | Bacteria | 2790 |
| 28 | Ga0070689_100124664 | 3300005340 | Bacteria | 2060 |
| 29 | Ga0070689_100192611 | 3300005340 | Bacteria | 1661 |
| 30 | Ga0070689_100296181 | 3300005340 | Bacteria | 1346 |
| 31 | Ga0070691_10028162 | 3300005341 | Bacteria | 2624 |
| 32 | Ga0070687_100024371 | 3300005343 | Bacteria | 2888 |
| 33 | Ga0070687_100070446 | 3300005343 | Bacteria | 1876 |
| 34 | Ga0070687_100190436 | 3300005343 | Unclassified | 1236 |
| 35 | Ga0070661_100090767 | 3300005344 | Bacteria | 2262 |
| 36 | Ga0070692_10030726 | 3300005345 | Bacteria | 2688 |
| 37 | Ga0070692_10036227 | 3300005345 | Plasmid | 2503 |
| 38 | Ga0070692_10130013 | 3300005345 | Bacteria | 1414 |
| 39 | Ga0070668_100046375 | 3300005347 | Bacteria | 3337 |
| 40 | Ga0070668_100049732 | 3300005347 | Unclassified | 3225 |
| 41 | Ga0070669_100006968 | 3300005353 | Bacteria | 8122 |
| 42 | Ga0070669_100058552 | 3300005353 | Bacteria | 2828 |
| 43 | Ga0070669_100164406 | 3300005353 | Bacteria | 1727 |
| 44 | Ga0070669_100292720 | 3300005353 | Bacteria | 1308 |
| 45 | Ga0070675_100010672 | 3300005354 | Bacteria | 7182 |
| 46 | Ga0070675_100061551 | 3300005354 | Bacteria | 3099 |
| 47 | Ga0070675_100092950 | 3300005354 | Bacteria | 2529 |
| 48 | Ga0070675_100118964 | 3300005354 | Unclassified | 2243 |
| 49 | Ga0070671_100003829 | 3300005355 | Bacteria | 11817 |
| 50 | Ga0070671_100028496 | 3300005355 | Bacteria | 4598 |
| 51 | Ga0070671_100064321 | 3300005355 | Bacteria | 3055 |
| 52 | Ga0070671_100083958 | 3300005355 | Bacteria | 2663 |
| 53 | Ga0070671_100098269 | 3300005355 | Unclassified | 2455 |
| 54 | Ga0070671_100426887 | 3300005355 | Unclassified | 1136 |
| 55 | Ga0070674_100006772 | 3300005356 | Bacteria | 6711 |
| 56 | Ga0070674_100010698 | 3300005356 | Bacteria | 5559 |
| 57 | Ga0070674_100024307 | 3300005356 | Bacteria | 3931 |
| 58 | Ga0070674_100033803 | 3300005356 | Bacteria | 3407 |
| 59 | Ga0070674_100084156 | 3300005356 | Bacteria | 2280 |
| 60 | Ga0070674_100142174 | 3300005356 | Bacteria | 1802 |
| 61 | Ga0070674_100161819 | 3300005356 | Bacteria | 1699 |
| 62 | Ga0070674_100198831 | 3300005356 | Bacteria | 1546 |
| 63 | Ga0070673_100021834 | 3300005364 | Bacteria | 4650 |
| 64 | Ga0070673_100046783 | 3300005364 | Bacteria | 3362 |
| 65 | Ga0070673_100066975 | 3300005364 | Bacteria | 2870 |
| 66 | Ga0070688_100056381 | 3300005365 | Bacteria | 2468 |
| 67 | Ga0070688_100104682 | 3300005365 | Bacteria | 1872 |
| 68 | Ga0070688_100195804 | 3300005365 | Bacteria | 1411 |
| 69 | Ga0070659_100031532 | 3300005366 | Bacteria | 4106 |
| 70 | Ga0070659_100142622 | 3300005366 | Bacteria | 1951 |
| 71 | Ga0070659_100257732 | 3300005366 | Unclassified | 1447 |
| 72 | Ga0070659_100406829 | 3300005366 | Bacteria | 1149 |
| 73 | Ga0070667_100015027 | 3300005367 | Bacteria | 6396 |
| 74 | Ga0070667_100027938 | 3300005367 | Bacteria | 4694 |
| 75 | Ga0070667_100083681 | 3300005367 | Bacteria | 2734 |
| 76 | Ga0070709_10005461 | 3300005434 | Bacteria | 6886 |
| 77 | Ga0070709_10220297 | 3300005434 | Bacteria | 1353 |
| 78 | Ga0070714_100031250 | 3300005435 | Bacteria | 4442 |
| 79 | Ga0070714_100061470 | 3300005435 | Bacteria | 3226 |
| 80 | Ga0070714_100337216 | 3300005435 | Bacteria | 1413 |
| 81 | Ga0070713_100014160 | 3300005436 | Bacteria | 5910 |
| 82 | Ga0070713_100145400 | 3300005436 | Bacteria | 2104 |
| 83 | Ga0070713_100150250 | 3300005436 | Bacteria | 2071 |
| 84 | Ga0070713_100199301 | 3300005436 | Bacteria | 1807 |
| 85 | Ga0070713_100241346 | 3300005436 | Bacteria | 1645 |
| 86 | Ga0070710_10010533 | 3300005437 | Bacteria | 4545 |
| 87 | Ga0070710_10012586 | 3300005437 | Bacteria | 4207 |
| 88 | Ga0070710_10042502 | 3300005437 | Bacteria | 2513 |
| 89 | Ga0070710_10058428 | 3300005437 | Bacteria | 2188 |
| 90 | Ga0070701_10004472 | 3300005438 | Bacteria | 5672 |
| 91 | Ga0070701_10145532 | 3300005438 | Bacteria | 1359 |
| 92 | Ga0070711_100041381 | 3300005439 | Bacteria | 3112 |
| 93 | Ga0070711_100080723 | 3300005439 | Bacteria | 2317 |
| 94 | Ga0070711_100102224 | 3300005439 | Bacteria | 2087 |
| 95 | Ga0070711_100185592 | 3300005439 | Bacteria | 1594 |
| 96 | Ga0070711_100257011 | 3300005439 | Bacteria | 1373 |
| 97 | Ga0070705_100061390 | 3300005440 | Bacteria | 2234 |
| 98 | Ga0070705_100078880 | 3300005440 | Bacteria | 2015 |
| 99 | Ga0070700_100056600 | 3300005441 | Bacteria | 2459 |
| 100 | Ga0070700_100072768 | 3300005441 | Bacteria | 2198 |
| 101 | Ga0070700_100100530 | 3300005441 | Unclassified | 1904 |
| 102 | Ga0070700_100112083 | 3300005441 | Bacteria | 1815 |
| 103 | Ga0070700_100119797 | 3300005441 | Bacteria | 1762 |
| 104 | Ga0070694_100019929 | 3300005444 | Bacteria | 4271 |
| 105 | Ga0070708_100069806 | 3300005445 | Bacteria | 3160 |
| 106 | Ga0070708_100189853 | 3300005445 | Bacteria | 1921 |
| 107 | Ga0070663_100003523 | 3300005455 | Bacteria | 9032 |
| 108 | Ga0070663_100057583 | 3300005455 | Bacteria | 2788 |
| 109 | Ga0070663_100088698 | 3300005455 | Bacteria | 2287 |
| 110 | Ga0070663_100344084 | 3300005455 | Bacteria | 1206 |
| 111 | Ga0070678_100047943 | 3300005456 | Bacteria | 3073 |
| 112 | Ga0070678_100074012 | 3300005456 | Bacteria | 2558 |
| 113 | Ga0070678_100118789 | 3300005456 | Bacteria | 2081 |
| 114 | Ga0070678_100122452 | 3300005456 | Bacteria | 2053 |
| 115 | Ga0070678_100148650 | 3300005456 | Bacteria | 1884 |
| 116 | Ga0070662_100073619 | 3300005457 | Bacteria | 2524 |
| 117 | Ga0070662_100099204 | 3300005457 | Bacteria | 2201 |
| 118 | Ga0070662_100129384 | 3300005457 | Bacteria | 1944 |
| 119 | Ga0070662_100147207 | 3300005457 | Bacteria | 1830 |
| 120 | Ga0070681_10132681 | 3300005458 | Bacteria | 2422 |
| 121 | Ga0070681_10204374 | 3300005458 | Bacteria | 1893 |
| 122 | Ga0068867_100009135 | 3300005459 | Bacteria | 6994 |
| 123 | Ga0070685_10003711 | 3300005466 | Bacteria | 7729 |
| 124 | Ga0070685_10024316 | 3300005466 | Unclassified | 3326 |
| 125 | Ga0070685_10040183 | 3300005466 | Bacteria | 2661 |
| 126 | Ga0070685_10226995 | 3300005466 | Bacteria | 1226 |
| 127 | Ga0070706_100037571 | 3300005467 | Unclassified | 4472 |
| 128 | Ga0070698_100389246 | 3300005471 | Bacteria | 1327 |
| 129 | Ga0070699_100044495 | 3300005518 | Bacteria | 3843 |
| 130 | Ga0070699_100369125 | 3300005518 | Unclassified | 1294 |
| 131 | Ga0070684_100050829 | 3300005535 | Unclassified | 3601 |
| 132 | Ga0070684_100090261 | 3300005535 | Bacteria | 2724 |
| 133 | Ga0070697_100039116 | 3300005536 | Bacteria | 3834 |
| 134 | Ga0070697_100120632 | 3300005536 | Bacteria | 2193 |
| 135 | Ga0070697_100133465 | 3300005536 | Bacteria | 2083 |
| 136 | Ga0068853_100071702 | 3300005539 | Bacteria | 3017 |
| 137 | Ga0068853_100113939 | 3300005539 | Bacteria | 2405 |
| 138 | Ga0068853_100141681 | 3300005539 | Bacteria | 2158 |
| 139 | Ga0068853_100161258 | 3300005539 | Unclassified | 2024 |
| 140 | Ga0070672_100037653 | 3300005543 | Bacteria | 3691 |
| 141 | Ga0070672_100061976 | 3300005543 | Bacteria | 2950 |
| 142 | Ga0070672_100188998 | 3300005543 | Bacteria | 1719 |
| 143 | Ga0070672_100493386 | 3300005543 | Bacteria | 1059 |
| 144 | Ga0070686_100002493 | 3300005544 | Bacteria | 10135 |
| 145 | Ga0070686_100204398 | 3300005544 | Bacteria | 1418 |
| 146 | Ga0070695_100002513 | 3300005545 | Bacteria | 10572 |
| 147 | Ga0070695_100004291 | 3300005545 | Bacteria | 8344 |
| 148 | Ga0070696_100105837 | 3300005546 | Bacteria | 2021 |
| 149 | Ga0070696_100315380 | 3300005546 | Bacteria | 1202 |
| 150 | Ga0070693_100050186 | 3300005547 | Bacteria | 2384 |
| 151 | Ga0070693_100171287 | 3300005547 | Bacteria | 1391 |
| 152 | Ga0070665_100026385 | 3300005548 | Bacteria | 5851 |
| 153 | Ga0070665_100120172 | 3300005548 | Bacteria | 2629 |
| 154 | Ga0070704_100446560 | 3300005549 | Bacteria | 1113 |
| 155 | Ga0068855_100210694 | 3300005563 | Bacteria | 2184 |
| 156 | Ga0070664_100091097 | 3300005564 | Bacteria | 2639 |
| 157 | Ga0070664_100126126 | 3300005564 | Bacteria | 2246 |
| 158 | Ga0068857_100104663 | 3300005577 | Bacteria | 2541 |
| 159 | Ga0068854_100338084 | 3300005578 | Bacteria | 1229 |
| 160 | Ga0068854_100377911 | 3300005578 | Unclassified | 1167 |
| 161 | Ga0068854_100389033 | 3300005578 | Bacteria | 1151 |
| 162 | Ga0068856_100074656 | 3300005614 | Bacteria | 3357 |
| 163 | Ga0068856_100134560 | 3300005614 | Bacteria | 2477 |
| 164 | Ga0068856_100234108 | 3300005614 | Bacteria | 1852 |
| 165 | Ga0070702_100012167 | 3300005615 | Bacteria | 4302 |
| 166 | Ga0070702_100015685 | 3300005615 | Unclassified | 3874 |
| 167 | Ga0068852_100079355 | 3300005616 | Unclassified | 2907 |
| 168 | Ga0068852_100088389 | 3300005616 | Bacteria | 2767 |
| 169 | Ga0068859_100104992 | 3300005617 | Bacteria | 2885 |
| 170 | Ga0068859_100121689 | 3300005617 | Bacteria | 2676 |
| 171 | Ga0068859_100122305 | 3300005617 | Bacteria | 2670 |
| 172 | Ga0068859_100167891 | 3300005617 | Bacteria | 2274 |
| 173 | Ga0068859_100307471 | 3300005617 | Bacteria | 1679 |
| 174 | Ga0068859_100382420 | 3300005617 | Bacteria | 1503 |
| 175 | Ga0068864_100011177 | 3300005618 | Bacteria | 7418 |
| 176 | Ga0068864_100036792 | 3300005618 | Bacteria | 4174 |
| 177 | Ga0068864_100047643 | 3300005618 | Unclassified | 3682 |
| 178 | Ga0068864_100066167 | 3300005618 | Bacteria | 3136 |
| 179 | Ga0068866_10017075 | 3300005718 | Bacteria | 3257 |
| 180 | Ga0068866_10023911 | 3300005718 | Bacteria | 2848 |
| 181 | Ga0068866_10110868 | 3300005718 | Bacteria | 1531 |
| 182 | Ga0068866_10135016 | 3300005718 | Bacteria | 1409 |
| 183 | Ga0068861_100078096 | 3300005719 | Bacteria | 2584 |
| 184 | Ga0068861_100124851 | 3300005719 | Bacteria | 2081 |
| 185 | Ga0068861_100394379 | 3300005719 | Unclassified | 1226 |
| 186 | Ga0068851_10083567 | 3300005834 | Bacteria | 1671 |
| 187 | Ga0068870_10001278 | 3300005840 | Bacteria | 10113 |
| 188 | Ga0068870_10040514 | 3300005840 | Bacteria | 2416 |
| 189 | Ga0068870_10164593 | 3300005840 | Bacteria | 1319 |
| 190 | Ga0068863_100077713 | 3300005841 | Bacteria | 3141 |
| 191 | Ga0068863_100473032 | 3300005841 | Bacteria | 1231 |
| 192 | Ga0068863_100511551 | 3300005841 | Unclassified | 1183 |
| 193 | Ga0068863_100518417 | 3300005841 | Bacteria | 1175 |
| 194 | Ga0068858_100003359 | 3300005842 | Bacteria | 15938 |
| 195 | Ga0068858_100038474 | 3300005842 | Bacteria | 4437 |
| 196 | Ga0068858_100350278 | 3300005842 | Bacteria | 1415 |
| 197 | Ga0068860_100047356 | 3300005843 | Bacteria | 4098 |
| 198 | Ga0068860_100054250 | 3300005843 | Bacteria | 3810 |
| 199 | Ga0068860_100245889 | 3300005843 | Bacteria | 1741 |
| 200 | Ga0068860_100632286 | 3300005843 | Bacteria | 1077 |
| 201 | Ga0068862_100010721 | 3300005844 | Bacteria | 7568 |
| 202 | Ga0068862_100011858 | 3300005844 | Bacteria | 7198 |
| 203 | Ga0068862_100068511 | 3300005844 | Bacteria | 3061 |
| 204 | Ga0068862_100098142 | 3300005844 | Bacteria | 2559 |
| 205 | Ga0068862_100147137 | 3300005844 | Bacteria | 2094 |
| 206 | Ga0081455_10006073 | 3300005937 | Bacteria | 13074 |
| 207 | Ga0081455_10006153 | 3300005937 | Bacteria | 12947 |
| 208 | Ga0081455_10007998 | 3300005937 | Bacteria | 11052 |
| 209 | Ga0081455_10024867 | 3300005937 | Bacteria | 5536 |
| 210 | Ga0081455_10058745 | 3300005937 | Bacteria | 3252 |
| 211 | Ga0081455_10167377 | 3300005937 | Unclassified | 1678 |
| 212 | Ga0081538_10009001 | 3300005981 | Bacteria | 8386 |
| 213 | Ga0081538_10024689 | 3300005981 | Bacteria | 4274 |
| 214 | Ga0081538_10036784 | 3300005981 | Bacteria | 3187 |
| 215 | Ga0081540_1000338 | 3300005983 | Bacteria | 48150 |
| 216 | Ga0081540_1001883 | 3300005983 | Bacteria | 17565 |
| 217 | Ga0081540_1005306 | 3300005983 | Bacteria | 9644 |
| 218 | Ga0081540_1005989 | 3300005983 | Bacteria | 8956 |
| 219 | Ga0081540_1014606 | 3300005983 | Bacteria | 5019 |
| 220 | Ga0081540_1017298 | 3300005983 | Bacteria | 4468 |
| 221 | Ga0081540_1035157 | 3300005983 | Bacteria | 2690 |
| 222 | Ga0081540_1050305 | 3300005983 | Bacteria | 2071 |
| 223 | Ga0081540_1077100 | 3300005983 | Bacteria | 1516 |
| 224 | Ga0081539_10001094 | 3300005985 | Bacteria | 49286 |
| 225 | Ga0081539_10002062 | 3300005985 | Bacteria | 30115 |
| 226 | Ga0081539_10052260 | 3300005985 | Bacteria | 2297 |
| 227 | Ga0070717_10003746 | 3300006028 | Bacteria | 10919 |
| 228 | Ga0070717_10119097 | 3300006028 | Bacteria | 2260 |
| 229 | Ga0070717_10139481 | 3300006028 | Bacteria | 2090 |
| 230 | Ga0070717_10379216 | 3300006028 | Bacteria | 1268 |
| 231 | Ga0070717_10388707 | 3300006028 | Bacteria | 1252 |
| 232 | Ga0075365_10000347 | 3300006038 | Bacteria | 16588 |
| 233 | Ga0075365_10005992 | 3300006038 | Bacteria | 6635 |
| 234 | Ga0075365_10007347 | 3300006038 | Bacteria | 6162 |
| 235 | Ga0075365_10018670 | 3300006038 | Unclassified | 4269 |
| 236 | Ga0075365_10019141 | 3300006038 | Bacteria | 4220 |
| 237 | Ga0075365_10042158 | 3300006038 | Bacteria | 2983 |
| 238 | Ga0075365_10112619 | 3300006038 | Bacteria | 1871 |
| 239 | Ga0075365_10139950 | 3300006038 | Bacteria | 1679 |
| 240 | Ga0075368_10003192 | 3300006042 | Bacteria | 5447 |
| 241 | Ga0075368_10010918 | 3300006042 | Bacteria | 3294 |
| 242 | Ga0075368_10014306 | 3300006042 | Bacteria | 2928 |
| 243 | Ga0075368_10024541 | 3300006042 | Bacteria | 2311 |
| 244 | Ga0075368_10073427 | 3300006042 | Bacteria | 1384 |
| 245 | Ga0075363_100011774 | 3300006048 | Bacteria | 4197 |
| 246 | Ga0075363_100029709 | 3300006048 | Bacteria | 2824 |
| 247 | Ga0075364_10014842 | 3300006051 | Bacteria | 4820 |
| 248 | Ga0075364_10095053 | 3300006051 | Bacteria | 1981 |
| 249 | Ga0075364_10113145 | 3300006051 | Bacteria | 1812 |
| 250 | Ga0070715_10004466 | 3300006163 | Bacteria | 4594 |
| 251 | Ga0070715_10031473 | 3300006163 | Bacteria | 2154 |
| 252 | Ga0070716_100136132 | 3300006173 | Bacteria | 1560 |
| 253 | Ga0070712_100053086 | 3300006175 | Bacteria | 2829 |
| 254 | Ga0070712_100323446 | 3300006175 | Bacteria | 1255 |
| 255 | Ga0075362_10054948 | 3300006177 | Bacteria | 1791 |
| 256 | Ga0075362_10085255 | 3300006177 | Bacteria | 1460 |
| 257 | Ga0075367_10009833 | 3300006178 | Bacteria | 5011 |
| 258 | Ga0075367_10035076 | 3300006178 | Bacteria | 2901 |
| 259 | Ga0075367_10036670 | 3300006178 | Bacteria | 2845 |
| 260 | Ga0075367_10059545 | 3300006178 | Bacteria | 2274 |
| 261 | Ga0075367_10064015 | 3300006178 | Bacteria | 2199 |
| 262 | Ga0075367_10067304 | 3300006178 | Bacteria | 2147 |
| 263 | Ga0075367_10071557 | 3300006178 | Bacteria | 2086 |
| 264 | Ga0075367_10125567 | 3300006178 | Bacteria | 1583 |
| 265 | Ga0075369_10040923 | 3300006186 | Bacteria | 1982 |
| 266 | Ga0075366_10031572 | 3300006195 | Plasmid | 3117 |
| 267 | Ga0075366_10054064 | 3300006195 | Bacteria | 2385 |
| 268 | Ga0097621_100021567 | 3300006237 | Bacteria | 4986 |
| 269 | Ga0097621_100071368 | 3300006237 | Plasmid | 2870 |
| 270 | Ga0097621_100097497 | 3300006237 | Bacteria | 2468 |
| 271 | Ga0097621_100159309 | 3300006237 | Bacteria | 1939 |
| 272 | Ga0097621_100267820 | 3300006237 | Bacteria | 1500 |
| 273 | Ga0075370_10018836 | 3300006353 | Bacteria | 3749 |
| 274 | Ga0075370_10082039 | 3300006353 | Bacteria | 1854 |
| 275 | Ga0068871_100088999 | 3300006358 | Bacteria | 2569 |
| 276 | Ga0075428_100004072 | 3300006844 | Bacteria | 16071 |
| 277 | Ga0075428_100070572 | 3300006844 | Bacteria | 3819 |
| 278 | Ga0075428_100124305 | 3300006844 | Bacteria | 2808 |
| 279 | Ga0075428_100194510 | 3300006844 | Bacteria | 2194 |
| 280 | Ga0075428_100236159 | 3300006844 | Bacteria | 1973 |
| 281 | Ga0075428_100285113 | 3300006844 | Bacteria | 1777 |
| 282 | Ga0075428_100503652 | 3300006844 | Bacteria | 1296 |
| 283 | Ga0075428_100557468 | 3300006844 | Bacteria | 1225 |
| 284 | Ga0075430_100010962 | 3300006846 | Bacteria | 7680 |
| 285 | Ga0075430_100043636 | 3300006846 | Bacteria | 3791 |
| 286 | Ga0075430_100058315 | 3300006846 | Bacteria | 3245 |
| 287 | Ga0075430_100109479 | 3300006846 | Bacteria | 2304 |
| 288 | Ga0075431_100000021 | 3300006847 | Bacteria | 82774 |
| 289 | Ga0075431_100040334 | 3300006847 | Bacteria | 4811 |
| 290 | Ga0075431_100095125 | 3300006847 | Bacteria | 3075 |
| 291 | Ga0075431_100300640 | 3300006847 | Bacteria | 1621 |
| 292 | Ga0075433_10104205 | 3300006852 | Bacteria | 2513 |
| 293 | Ga0075433_10419190 | 3300006852 | Bacteria | 1181 |
| 294 | Ga0075434_100003972 | 3300006871 | Bacteria | 13246 |
| 295 | Ga0075434_100046006 | 3300006871 | Bacteria | 4331 |
| 296 | Ga0075429_100022600 | 3300006880 | Bacteria | 5452 |
| 297 | Ga0075429_100045168 | 3300006880 | Bacteria | 3832 |
| 298 | Ga0075429_100142580 | 3300006880 | Bacteria | 2097 |
| 299 | Ga0068865_100013556 | 3300006881 | Bacteria | 5155 |
| 300 | Ga0068865_100025863 | 3300006881 | Bacteria | 3865 |
| 301 | Ga0075436_100037211 | 3300006914 | Bacteria | 3360 |
| 302 | Ga0075436_100070687 | 3300006914 | Bacteria | 2413 |
| 303 | Ga0097620_100104990 | 3300006931 | Bacteria | 2885 |
| 304 | Ga0097620_100121693 | 3300006931 | Bacteria | 2676 |
| 305 | Ga0097620_100122310 | 3300006931 | Bacteria | 2670 |
| 306 | Ga0097620_100167895 | 3300006931 | Bacteria | 2274 |
| 307 | Ga0097620_100307489 | 3300006931 | Bacteria | 1679 |
| 308 | Ga0097620_100382384 | 3300006931 | Bacteria | 1503 |
| 309 | Ga0075435_100003318 | 3300007076 | Bacteria | 10917 |
| 310 | Ga0075435_100053822 | 3300007076 | Bacteria | 3247 |
| 311 | Ga0075435_100103814 | 3300007076 | Bacteria | 2358 |
| 312 | Ga0099794_10001204 | 3300007265 | Bacteria | 8916 |
| 313 | Ga0099795_10036431 | 3300007788 | Bacteria | 1726 |
| 314 | Ga0105250_10041945 | 3300009092 | Bacteria | 1834 |
| 315 | Ga0105240_10540807 | 3300009093 | Bacteria | 1290 |
| 316 | Ga0111539_10001676 | 3300009094 | Bacteria | 29539 |
| 317 | Ga0111539_10019188 | 3300009094 | Bacteria | 8448 |
| 318 | Ga0111539_10181331 | 3300009094 | Bacteria | 2459 |
| 319 | Ga0111539_10289874 | 3300009094 | Bacteria | 1905 |
| 320 | Ga0111539_10355627 | 3300009094 | Bacteria | 1704 |
| 321 | Ga0105245_10008525 | 3300009098 | Bacteria | 8942 |
| 322 | Ga0105245_10044105 | 3300009098 | Bacteria | 3979 |
| 323 | Ga0105245_10212793 | 3300009098 | Bacteria | 1861 |
| 324 | Ga0105245_10226751 | 3300009098 | Unclassified | 1805 |
| 325 | Ga0105245_10361400 | 3300009098 | Bacteria | 1441 |
| 326 | Ga0105247_10006686 | 3300009101 | Bacteria | 7118 |
| 327 | Ga0105247_10007853 | 3300009101 | Bacteria | 6529 |
| 328 | Ga0105247_10036593 | 3300009101 | Bacteria | 2992 |
| 329 | Ga0105247_10078275 | 3300009101 | Bacteria | 2079 |
| 330 | Ga0105247_10235050 | 3300009101 | Bacteria | 1246 |
| 331 | Ga0114129_10000068 | 3300009147 | Bacteria | 93579 |
| 332 | Ga0114129_10062125 | 3300009147 | Bacteria | 5219 |
| 333 | Ga0114129_10069665 | 3300009147 | Bacteria | 4902 |
| 334 | Ga0114129_10094433 | 3300009147 | Bacteria | 4142 |
| 335 | Ga0114129_10129902 | 3300009147 | Bacteria | 3461 |
| 336 | Ga0114129_10130192 | 3300009147 | Bacteria | 3457 |
| 337 | Ga0114129_10136370 | 3300009147 | Bacteria | 3367 |
| 338 | Ga0114129_10170504 | 3300009147 | Bacteria | 2967 |
| 339 | Ga0114129_10243588 | 3300009147 | Bacteria | 2416 |
| 340 | Ga0114129_10302240 | 3300009147 | Bacteria | 2132 |
| 341 | Ga0114129_10415796 | 3300009147 | Bacteria | 1770 |
| 342 | Ga0105243_10007460 | 3300009148 | Bacteria | 8405 |
| 343 | Ga0105243_10022206 | 3300009148 | Bacteria | 4821 |
| 344 | Ga0105243_10050293 | 3300009148 | Bacteria | 3292 |
| 345 | Ga0105243_10155426 | 3300009148 | Bacteria | 1966 |
| 346 | Ga0105241_10097564 | 3300009174 | Bacteria | 2330 |
| 347 | Ga0105241_10217511 | 3300009174 | Bacteria | 1604 |
| 348 | Ga0105241_10223567 | 3300009174 | Bacteria | 1584 |
| 349 | Ga0105242_10044861 | 3300009176 | Bacteria | 3581 |
| 350 | Ga0105242_10172149 | 3300009176 | Bacteria | 1904 |
| 351 | Ga0105242_10192718 | 3300009176 | Bacteria | 1806 |
| 352 | Ga0105248_10183607 | 3300009177 | Unclassified | 2357 |
| 353 | Ga0105237_10113091 | 3300009545 | Unclassified | 2707 |
| 354 | Ga0105237_10297757 | 3300009545 | Bacteria | 1616 |
| 355 | Ga0105238_10029419 | 3300009551 | Bacteria | 5596 |
| 356 | Ga0105238_10124467 | 3300009551 | Bacteria | 2557 |
| 357 | Ga0105249_10003555 | 3300009553 | Bacteria | 13481 |
| 358 | Ga0105249_10011297 | 3300009553 | Bacteria | 7839 |
| 359 | Ga0105249_10106250 | 3300009553 | Bacteria | 2648 |
| 360 | Ga0105249_10319880 | 3300009553 | Bacteria | 1562 |
| 361 | Ga0099796_10034004 | 3300010159 | Bacteria | 1681 |
| 362 | Ga0105239_10109631 | 3300010375 | Bacteria | 3059 |
| 363 | Ga0105239_10329180 | 3300010375 | Bacteria | 1723 |
| 364 | Ga0105246_10035693 | 3300011119 | Bacteria | 3325 |
| 365 | Ga0105246_10099988 | 3300011119 | Bacteria | 2109 |
| 366 | Ga0105246_10109613 | 3300011119 | Bacteria | 2026 |
| 367 | Ga0105246_10262861 | 3300011119 | Bacteria | 1376 |
| 368 | Ga0105246_10331868 | 3300011119 | Bacteria | 1240 |
| 369 | Ga0157373_10081779 | 3300013100 | Bacteria | 2277 |
| 370 | Ga0157371_10135289 | 3300013102 | Bacteria | 1755 |
| 371 | Ga0157374_10010555 | 3300013296 | Bacteria | 7951 |
| 372 | Ga0157374_10012705 | 3300013296 | Bacteria | 7334 |
| 373 | Ga0157374_10128778 | 3300013296 | Unclassified | 2448 |
| 374 | Ga0157374_10327507 | 3300013296 | Bacteria | 1519 |
| 375 | Ga0157374_10368308 | 3300013296 | Bacteria | 1430 |
| 376 | Ga0163162_10078540 | 3300013306 | Bacteria | 3366 |
| 377 | Ga0163162_10089608 | 3300013306 | Bacteria | 3157 |
| 378 | Ga0163162_10219275 | 3300013306 | Bacteria | 2032 |
| 379 | Ga0163162_10219863 | 3300013306 | Bacteria | 2029 |
| 380 | Ga0163162_10290924 | 3300013306 | Bacteria | 1766 |
| 381 | Ga0157372_10190342 | 3300013307 | Bacteria | 2376 |
| 382 | Ga0157372_10355098 | 3300013307 | Bacteria | 1708 |
| 383 | Ga0157375_10040338 | 3300013308 | Bacteria | 4500 |
| 384 | Ga0157375_10076779 | 3300013308 | Bacteria | 3368 |
| 385 | Ga0157375_10114778 | 3300013308 | Bacteria | 2795 |
| 386 | Ga0157375_10228834 | 3300013308 | Bacteria | 2018 |
| 387 | Ga0157375_10343704 | 3300013308 | Bacteria | 1657 |
| 388 | Ga0163163_10043454 | 3300014325 | Bacteria | 4406 |
| 389 | Ga0163163_10050766 | 3300014325 | Bacteria | 4086 |
| 390 | Ga0163163_10096848 | 3300014325 | Bacteria | 2971 |
| 391 | Ga0157380_10030033 | 3300014326 | Bacteria | 4159 |
| 392 | Ga0157380_10118134 | 3300014326 | Bacteria | 2241 |
| 393 | Ga0157380_10136107 | 3300014326 | Bacteria | 2103 |
| 394 | Ga0157380_10191036 | 3300014326 | Bacteria | 1808 |
| 395 | Ga0157380_10263980 | 3300014326 | Bacteria | 1566 |
| 396 | Ga0157379_10011977 | 3300014968 | Bacteria | 7577 |
| 397 | Ga0157376_10018166 | 3300014969 | Bacteria | 5383 |
| 398 | Ga0163161_10055522 | 3300017792 | Bacteria | 2875 |
| 399 | Ga0163161_10218078 | 3300017792 | Bacteria | 1476 |
| 400 | Ga0213872_10068820 | 3300021361 | Bacteria | 1597 |
| 401 | Ga0213876_10104940 | 3300021384 | Bacteria | 1499 |
| 402 | Ga0209758_1000613 | 3300025297 | Bacteria | 55154 |
| 403 | Ga0209758_1002704 | 3300025297 | Bacteria | 17484 |
| 404 | Ga0209758_1068034 | 3300025297 | Bacteria | 1136 |
| 405 | Ga0207426_1046380 | 3300025302 | Bacteria | 1316 |
| 406 | Ga0207697_10027198 | 3300025315 | Bacteria | 2339 |
| 407 | Ga0207682_10003199 | 3300025893 | Bacteria | 7166 |
| 408 | Ga0207682_10014389 | 3300025893 | Bacteria | 3081 |
| 409 | Ga0207682_10072015 | 3300025893 | Bacteria | 1466 |
| 410 | Ga0207692_10003985 | 3300025898 | Bacteria | 5802 |
| 411 | Ga0207692_10010794 | 3300025898 | Bacteria | 3865 |
| 412 | Ga0207692_10021013 | 3300025898 | Plasmid | 2980 |
| 413 | Ga0207692_10085035 | 3300025898 | Bacteria | 1701 |
| 414 | Ga0207692_10242300 | 3300025898 | Bacteria | 1077 |
| 415 | Ga0207642_10012038 | 3300025899 | Bacteria | 3110 |
| 416 | Ga0207642_10014784 | 3300025899 | Bacteria | 2890 |
| 417 | Ga0207642_10028738 | 3300025899 | Bacteria | 2294 |
| 418 | Ga0207642_10145727 | 3300025899 | Bacteria | 1254 |
| 419 | Ga0207710_10034621 | 3300025900 | Bacteria | 2221 |
| 420 | Ga0207710_10084977 | 3300025900 | Bacteria | 1473 |
| 421 | Ga0207688_10002540 | 3300025901 | Bacteria | 9852 |
| 422 | Ga0207688_10011975 | 3300025901 | Bacteria | 4719 |
| 423 | Ga0207688_10016159 | 3300025901 | Unclassified | 4047 |
| 424 | Ga0207688_10028038 | 3300025901 | Bacteria | 3098 |
| 425 | Ga0207688_10057972 | 3300025901 | Bacteria | 2178 |
| 426 | Ga0207647_10013439 | 3300025904 | Bacteria | 5673 |
| 427 | Ga0207685_10077549 | 3300025905 | Unclassified | 1365 |
| 428 | Ga0207699_10014440 | 3300025906 | Bacteria | 4072 |
| 429 | Ga0207699_10019700 | 3300025906 | Bacteria | 3603 |
| 430 | Ga0207645_10061779 | 3300025907 | Bacteria | 2393 |
| 431 | Ga0207645_10184888 | 3300025907 | Unclassified | 1368 |
| 432 | Ga0207643_10000967 | 3300025908 | Bacteria | 17260 |
| 433 | Ga0207643_10033684 | 3300025908 | Unclassified | 2867 |
| 434 | Ga0207643_10042084 | 3300025908 | Bacteria | 2575 |
| 435 | Ga0207684_10003027 | 3300025910 | Bacteria | 16653 |
| 436 | Ga0207684_10140872 | 3300025910 | Bacteria | 2073 |
| 437 | Ga0207707_10193705 | 3300025912 | Bacteria | 1773 |
| 438 | Ga0207671_10339045 | 3300025914 | Bacteria | 1191 |
| 439 | Ga0207693_10004220 | 3300025915 | Bacteria | 12189 |
| 440 | Ga0207693_10012252 | 3300025915 | Bacteria | 6931 |
| 441 | Ga0207693_10097589 | 3300025915 | Bacteria | 2304 |
| 442 | Ga0207693_10122885 | 3300025915 | Bacteria | 2039 |
| 443 | Ga0207693_10172088 | 3300025915 | Bacteria | 1705 |
| 444 | Ga0207663_10046299 | 3300025916 | Bacteria | 2679 |
| 445 | Ga0207663_10057001 | 3300025916 | Bacteria | 2460 |
| 446 | Ga0207663_10070614 | 3300025916 | Bacteria | 2250 |
| 447 | Ga0207663_10093574 | 3300025916 | Bacteria | 2001 |
| 448 | Ga0207663_10259595 | 3300025916 | Bacteria | 1282 |
| 449 | Ga0207660_10099352 | 3300025917 | Bacteria | 2171 |
| 450 | Ga0207660_10161018 | 3300025917 | Unclassified | 1731 |
| 451 | Ga0207662_10011477 | 3300025918 | Bacteria | 4917 |
| 452 | Ga0207662_10084162 | 3300025918 | Bacteria | 1946 |
| 453 | Ga0207652_10260840 | 3300025921 | Bacteria | 1563 |
| 454 | Ga0207646_10039144 | 3300025922 | Bacteria | 4266 |
| 455 | Ga0207646_10269202 | 3300025922 | Unclassified | 1540 |
| 456 | Ga0207681_10009139 | 3300025923 | Bacteria | 6052 |
| 457 | Ga0207694_10257318 | 3300025924 | Bacteria | 1429 |
| 458 | Ga0207694_10283753 | 3300025924 | Bacteria | 1360 |
| 459 | Ga0207650_10053772 | 3300025925 | Bacteria | 2985 |
| 460 | Ga0207650_10067708 | 3300025925 | Bacteria | 2680 |
| 461 | Ga0207650_10142180 | 3300025925 | Bacteria | 1887 |
| 462 | Ga0207659_10019858 | 3300025926 | Bacteria | 4431 |
| 463 | Ga0207659_10058280 | 3300025926 | Bacteria | 2772 |
| 464 | Ga0207659_10069639 | 3300025926 | Bacteria | 2563 |
| 465 | Ga0207659_10124369 | 3300025926 | Bacteria | 1981 |
| 466 | Ga0207659_10204227 | 3300025926 | Bacteria | 1580 |
| 467 | Ga0207687_10026708 | 3300025927 | Bacteria | 3868 |
| 468 | Ga0207687_10033406 | 3300025927 | Bacteria | 3490 |
| 469 | Ga0207687_10132680 | 3300025927 | Bacteria | 1880 |
| 470 | Ga0207700_10014481 | 3300025928 | Bacteria | 5168 |
| 471 | Ga0207700_10052461 | 3300025928 | Bacteria | 3049 |
| 472 | Ga0207700_10275010 | 3300025928 | Bacteria | 1446 |
| 473 | Ga0207664_10021410 | 3300025929 | Bacteria | 4807 |
| 474 | Ga0207664_10076975 | 3300025929 | Unclassified | 2702 |
| 475 | Ga0207644_10025738 | 3300025931 | Bacteria | 4048 |
| 476 | Ga0207706_10007796 | 3300025933 | Bacteria | 9880 |
| 477 | Ga0207706_10011027 | 3300025933 | Bacteria | 8238 |
| 478 | Ga0207706_10014313 | 3300025933 | Bacteria | 7189 |
| 479 | Ga0207706_10033052 | 3300025933 | Bacteria | 4605 |
| 480 | Ga0207706_10033732 | 3300025933 | Bacteria | 4555 |
| 481 | Ga0207706_10043930 | 3300025933 | Bacteria | 3960 |
| 482 | Ga0207686_10007031 | 3300025934 | Bacteria | 6055 |
| 483 | Ga0207686_10079263 | 3300025934 | Unclassified | 2138 |
| 484 | Ga0207709_10008517 | 3300025935 | Bacteria | 5671 |
| 485 | Ga0207709_10009791 | 3300025935 | Bacteria | 5281 |
| 486 | Ga0207709_10027652 | 3300025935 | Bacteria | 3270 |
| 487 | Ga0207709_10035136 | 3300025935 | Bacteria | 2961 |
| 488 | Ga0207709_10193804 | 3300025935 | Bacteria | 1446 |
| 489 | Ga0207670_10019846 | 3300025936 | Bacteria | 4115 |
| 490 | Ga0207670_10068147 | 3300025936 | Bacteria | 2451 |
| 491 | Ga0207670_10192720 | 3300025936 | Bacteria | 1543 |
| 492 | Ga0207669_10012290 | 3300025937 | Bacteria | 4204 |
| 493 | Ga0207669_10013751 | 3300025937 | Bacteria | 4033 |
| 494 | Ga0207669_10035536 | 3300025937 | Bacteria | 2836 |
| 495 | Ga0207669_10074471 | 3300025937 | Bacteria | 2147 |
| 496 | Ga0207704_10010940 | 3300025938 | Bacteria | 4448 |
| 497 | Ga0207704_10022313 | 3300025938 | Bacteria | 3389 |
| 498 | Ga0207665_10001994 | 3300025939 | Bacteria | 13772 |
| 499 | Ga0207665_10054389 | 3300025939 | Bacteria | 2699 |
| 500 | Ga0207665_10168927 | 3300025939 | Bacteria | 1578 |
| 501 | Ga0207665_10263166 | 3300025939 | Bacteria | 1278 |
| 502 | Ga0207691_10024270 | 3300025940 | Bacteria | 5702 |
| 503 | Ga0207691_10050650 | 3300025940 | Bacteria | 3801 |
| 504 | Ga0207691_10080508 | 3300025940 | Bacteria | 2929 |
| 505 | Ga0207691_10125092 | 3300025940 | Unclassified | 2275 |
| 506 | Ga0207691_10201093 | 3300025940 | Bacteria | 1734 |
| 507 | Ga0207711_10008863 | 3300025941 | Bacteria | 8411 |
| 508 | Ga0207711_10048377 | 3300025941 | Bacteria | 3638 |
| 509 | Ga0207711_10153792 | 3300025941 | Bacteria | 2078 |
| 510 | Ga0207711_10228374 | 3300025941 | Bacteria | 1704 |
| 511 | Ga0207689_10012734 | 3300025942 | Bacteria | 7185 |
| 512 | Ga0207689_10062666 | 3300025942 | Bacteria | 3058 |
| 513 | Ga0207689_10227112 | 3300025942 | Bacteria | 1543 |
| 514 | Ga0207689_10274304 | 3300025942 | Bacteria | 1396 |
| 515 | Ga0207679_10019653 | 3300025945 | Bacteria | 4543 |
| 516 | Ga0207679_10493858 | 3300025945 | Bacteria | 1091 |
| 517 | Ga0207667_10093335 | 3300025949 | Bacteria | 3108 |
| 518 | Ga0207667_10180699 | 3300025949 | Bacteria | 2167 |
| 519 | Ga0207651_10019208 | 3300025960 | Bacteria | 4088 |
| 520 | Ga0207651_10114348 | 3300025960 | Bacteria | 2032 |
| 521 | Ga0207651_10144470 | 3300025960 | Bacteria | 1843 |
| 522 | Ga0207651_10394920 | 3300025960 | Bacteria | 1175 |
| 523 | Ga0207712_10015690 | 3300025961 | Bacteria | 4891 |
| 524 | Ga0207712_10022315 | 3300025961 | Bacteria | 4167 |
| 525 | Ga0207712_10026871 | 3300025961 | Bacteria | 3839 |
| 526 | Ga0207712_10099491 | 3300025961 | Bacteria | 2159 |
| 527 | Ga0207712_10275096 | 3300025961 | Bacteria | 1372 |
| 528 | Ga0207668_10003464 | 3300025972 | Bacteria | 9260 |
| 529 | Ga0207668_10069010 | 3300025972 | Bacteria | 2515 |
| 530 | Ga0207640_10151858 | 3300025981 | Bacteria | 1702 |
| 531 | Ga0207640_10235682 | 3300025981 | Bacteria | 1411 |
| 532 | Ga0207677_10083341 | 3300026023 | Bacteria | 2301 |
| 533 | Ga0207677_10184476 | 3300026023 | Bacteria | 1644 |
| 534 | Ga0207703_10098000 | 3300026035 | Bacteria | 2478 |
| 535 | Ga0207639_10054958 | 3300026041 | Bacteria | 3045 |
| 536 | Ga0207639_10213818 | 3300026041 | Unclassified | 1661 |
| 537 | Ga0207678_10010626 | 3300026067 | Bacteria | 8088 |
| 538 | Ga0207678_10015172 | 3300026067 | Bacteria | 6777 |
| 539 | Ga0207678_10038156 | 3300026067 | Bacteria | 4175 |
| 540 | Ga0207678_10041400 | 3300026067 | Unclassified | 3995 |
| 541 | Ga0207678_10093743 | 3300026067 | Bacteria | 2565 |
| 542 | Ga0207678_10211721 | 3300026067 | Bacteria | 1658 |
| 543 | Ga0207708_10001893 | 3300026075 | Bacteria | 15454 |
| 544 | Ga0207708_10001982 | 3300026075 | Bacteria | 15088 |
| 545 | Ga0207708_10021646 | 3300026075 | Unclassified | 4849 |
| 546 | Ga0207708_10031086 | 3300026075 | Bacteria | 4051 |
| 547 | Ga0207708_10034508 | 3300026075 | Bacteria | 3847 |
| 548 | Ga0207708_10098027 | 3300026075 | Bacteria | 2266 |
| 549 | Ga0207708_10105517 | 3300026075 | Bacteria | 2184 |
| 550 | Ga0207702_10045702 | 3300026078 | Bacteria | 3684 |
| 551 | Ga0207702_10260214 | 3300026078 | Bacteria | 1633 |
| 552 | Ga0207702_10301905 | 3300026078 | Bacteria | 1520 |
| 553 | Ga0207641_10008033 | 3300026088 | Bacteria | 8746 |
| 554 | Ga0207641_10462747 | 3300026088 | Bacteria | 1227 |
| 555 | Ga0207648_10000930 | 3300026089 | Bacteria | 32957 |
| 556 | Ga0207648_10001640 | 3300026089 | Bacteria | 24524 |
| 557 | Ga0207648_10005439 | 3300026089 | Bacteria | 12834 |
| 558 | Ga0207648_10008314 | 3300026089 | Bacteria | 10072 |
| 559 | Ga0207648_10053736 | 3300026089 | Bacteria | 3520 |
| 560 | Ga0207648_10156449 | 3300026089 | Bacteria | 2012 |
| 561 | Ga0207648_10191343 | 3300026089 | Bacteria | 1813 |
| 562 | Ga0207676_10037062 | 3300026095 | Bacteria | 3713 |
| 563 | Ga0207676_10094244 | 3300026095 | Bacteria | 2466 |
| 564 | Ga0207676_10097222 | 3300026095 | Bacteria | 2432 |
| 565 | Ga0207674_10077499 | 3300026116 | Bacteria | 3329 |
| 566 | Ga0207674_10147936 | 3300026116 | Bacteria | 2307 |
| 567 | Ga0207675_100003662 | 3300026118 | Bacteria | 14985 |
| 568 | Ga0207675_100007548 | 3300026118 | Bacteria | 10274 |
| 569 | Ga0207675_100023222 | 3300026118 | Bacteria | 5768 |
| 570 | Ga0207675_100031749 | 3300026118 | Bacteria | 4921 |
| 571 | Ga0207675_100159483 | 3300026118 | Bacteria | 2151 |
| 572 | Ga0207675_100237983 | 3300026118 | Bacteria | 1758 |
| 573 | Ga0207683_10006631 | 3300026121 | Bacteria | 9905 |
| 574 | Ga0207683_10015287 | 3300026121 | Bacteria | 6533 |
| 575 | Ga0207683_10024348 | 3300026121 | Bacteria | 5213 |
| 576 | Ga0207683_10043509 | 3300026121 | Unclassified | 3925 |
| 577 | Ga0207683_10044403 | 3300026121 | Bacteria | 3885 |
| 578 | Ga0207683_10104176 | 3300026121 | Bacteria | 2535 |
| 579 | Ga0207683_10236169 | 3300026121 | Bacteria | 1667 |
| 580 | Ga0207683_10297025 | 3300026121 | Unclassified | 1478 |
| 581 | Ga0207683_10303956 | 3300026121 | Bacteria | 1460 |
| 582 | Ga0207698_10037686 | 3300026142 | Bacteria | 3564 |
| 583 | Ga0207698_10060552 | 3300026142 | Unclassified | 2944 |
| 584 | Ga0209179_1004682 | 3300027512 | Bacteria | 2085 |
| 585 | Ga0209813_10000171 | 3300027866 | Bacteria | 21130 |
| 586 | Ga0209813_10015289 | 3300027866 | Bacteria | 2077 |
| 587 | Ga0209813_10029792 | 3300027866 | Bacteria | 1600 |
| 588 | Ga0207428_10008060 | 3300027907 | Bacteria | 9557 |
| 589 | Ga0207428_10018287 | 3300027907 | Bacteria | 5989 |
| 590 | Ga0207428_10075460 | 3300027907 | Bacteria | 2642 |
| 591 | Ga0207428_10120998 | 3300027907 | Bacteria | 2007 |
| 592 | Ga0207428_10290521 | 3300027907 | Bacteria | 1212 |
| 593 | Ga0268266_10001685 | 3300028379 | Bacteria | 25417 |
| 594 | Ga0268266_10018266 | 3300028379 | Bacteria | 5979 |
| 595 | Ga0268266_10045547 | 3300028379 | Bacteria | 3752 |
| 596 | Ga0268266_10046622 | 3300028379 | Bacteria | 3710 |
| 597 | Ga0268266_10046802 | 3300028379 | Bacteria | 3703 |
| 598 | Ga0268265_10013298 | 3300028380 | Bacteria | 5592 |
| 599 | Ga0268265_10014407 | 3300028380 | Bacteria | 5386 |
| 600 | Ga0268265_10070907 | 3300028380 | Bacteria | 2712 |
| 601 | Ga0268265_10089156 | 3300028380 | Bacteria | 2459 |
| 602 | Ga0268265_10121974 | 3300028380 | Bacteria | 2149 |
| 603 | Ga0268265_10139426 | 3300028380 | Bacteria | 2028 |
| 604 | Ga0268264_10184569 | 3300028381 | Bacteria | 1897 |
| 605 | Ga0268264_10197026 | 3300028381 | Bacteria | 1840 |
| 606 | Ga0268264_10331799 | 3300028381 | Bacteria | 1442 |
| 607 | Ga0268264_10419225 | 3300028381 | Unclassified | 1290 |
| 608 | Ga0268264_10608294 | 3300028381 | Bacteria | 1078 |
| 609 | Ga0265338_10120807 | 3300028800 | Bacteria | 2088 |
| 610 | Ga0265330_10013169 | 3300031235 | Bacteria | 3857 |
| 611 | Ga0265325_10000004 | 3300031241 | Bacteria | 347347 |
| 612 | Ga0265325_10028878 | 3300031241 | Bacteria | 2985 |
| 613 | Ga0265325_10075214 | 3300031241 | Bacteria | 1687 |
| 614 | Ga0265329_10009404 | 3300031242 | Bacteria | 3652 |
| 615 | Ga0265329_10046160 | 3300031242 | Bacteria | 1392 |
| 616 | Ga0265340_10025003 | 3300031247 | Bacteria | 3028 |
| 617 | Ga0265340_10050316 | 3300031247 | Bacteria | 2021 |
| 618 | Ga0265340_10127286 | 3300031247 | Bacteria | 1170 |
| 619 | Ga0265339_10173581 | 3300031249 | Bacteria | 1078 |
| 620 | Ga0265331_10095816 | 3300031250 | Bacteria | 1369 |
| 621 | Ga0265316_10021306 | 3300031344 | Bacteria | 5493 |
| 622 | Ga0307509_10174846 | 3300031507 | Bacteria | 2021 |
| 623 | Ga0265313_10020510 | 3300031595 | Bacteria | 3644 |
| 624 | Ga0265313_10026917 | 3300031595 | Bacteria | 3018 |
| 625 | Ga0265313_10110096 | 3300031595 | Bacteria | 1212 |
| 626 | Ga0307508_10000557 | 3300031616 | Bacteria | 44307 |
| 627 | Ga0265342_10067459 | 3300031712 | Bacteria | 2093 |
| 628 | Ga0307516_10007912 | 3300031730 | Bacteria | 12110 |
| 629 | Ga0307516_10182259 | 3300031730 | Bacteria | 1832 |
| 630 | Ga0307507_10022361 | 3300033179 | Bacteria | 6989 |
| 631 | Ga0307510_10006581 | 3300033180 | Bacteria | 13858 |
| 632 | Ga0307510_10051168 | 3300033180 | Bacteria | 4372 |
| 633 | Ga0373940_0005232 | 3300035088 | Bacteria | 2797 |
| 634 | Ga0373944_0015814 | 3300035089 | Bacteria | 2120 |
| 635 | Ga0373944_0024740 | 3300035089 | Bacteria | 1763 |
| 636 | Ga0373932_0025073 | 3300035112 | Bacteria | 1611 |
| 637 | Ga0373936_0059667 | 3300035113 | Bacteria | 1555 |
| 638 | Ga0373936_0089062 | 3300035113 | Bacteria | 1292 |
| 639 | Ga0373939_0031876 | 3300035114 | Bacteria | 1527 |
| 640 | Ga0373945_0008749 | 3300035116 | Bacteria | 3304 |
| 641 | Ga0373945_0078181 | 3300035116 | Bacteria | 1263 |
| 642 | Ga0373953_0043926 | 3300035117 | Bacteria | 1785 |
| 643 | Ga0373954_0007914 | 3300035118 | Bacteria | 4655 |
| 644 | Ga0373954_0014684 | 3300035118 | Bacteria | 3494 |
| 645 | Ga0373956_0015153 | 3300035119 | Bacteria | 3226 |
| 646 | Ga0373943_0000789 | 3300035170 | Bacteria | 13880 |
| 647 | Ga0373943_0023389 | 3300035170 | Bacteria | 2873 |
| 648 | Ga0373943_0036254 | 3300035170 | Bacteria | 2361 |
| 649 | Ga0373943_0170701 | 3300035170 | Bacteria | 1190 |
| 650 | Ga0373946_0006277 | 3300035171 | Bacteria | 4307 |
| 651 | Ga0373955_0002543 | 3300035172 | Bacteria | 7981 |
| 652 | Ga0373955_0004726 | 3300035172 | Bacteria | 6055 |
| 653 | Ga0373955_0009435 | 3300035172 | Bacteria | 4568 |
| 654 | Ga0373955_0028671 | 3300035172 | Bacteria | 2889 |
| 655 | Ga0373942_0008505 | 3300035207 | Bacteria | 2393 |
| 656 | Ga0373942_0010104 | 3300035207 | Bacteria | 2214 |
| 657 | Ga0373962_0028297 | 3300035242 | Unclassified | 1520 |
| 658 | Ga0373924_0020264 | 3300035410 | Bacteria | 2583 |
| 659 | Ga0373931_0000929 | 3300035691 | Bacteria | 12312 |
| 660 | Ga0373931_0005106 | 3300035691 | Bacteria | 6043 |
| 661 | Ga0373931_0051355 | 3300035691 | Bacteria | 2196 |
| 662 | Ga0373935_0000272 | 3300035692 | Bacteria | 25407 |
| 663 | Ga0373935_0023128 | 3300035692 | Bacteria | 3817 |
| 664 | Ga0373935_0025862 | 3300035692 | Bacteria | 3618 |
| 665 | Ga0373935_0034682 | 3300035692 | Bacteria | 3147 |
| 666 | Ga0373935_0087425 | 3300035692 | Bacteria | 2035 |
| 667 | Ga0373927_0000980 | 3300035695 | Bacteria | 21707 |
| 668 | Ga0373927_0146535 | 3300035695 | Bacteria | 1546 |
| 669 | Ga0373933_0000342 | 3300035724 | Bacteria | 29960 |
| 670 | Ga0373933_0004825 | 3300035724 | Bacteria | 7368 |
| 671 | Ga0373947_0000563 | 3300035725 | Bacteria | 21638 |
| 672 | Ga0373947_0029410 | 3300035725 | Bacteria | 3224 |
| 673 | Ga0373947_0090170 | 3300035725 | Bacteria | 1910 |
| 674 | Ga0373947_0099913 | 3300035725 | Bacteria | 1822 |
| 675 | Ga0373947_0166421 | 3300035725 | Bacteria | 1428 |
| 676 | Ga0373937_0014119 | 3300036401 | Bacteria | 7044 |
| 677 | Ga0373937_0015092 | 3300036401 | Bacteria | 6825 |
| 678 | Ga0373937_0016767 | 3300036401 | Bacteria | 6511 |
| 679 | Ga0373937_0017936 | 3300036401 | Bacteria | 6314 |
| 680 | Ga0373937_0122423 | 3300036401 | Bacteria | 2425 |
| 681 | Ga0373937_0192866 | 3300036401 | Bacteria | 1915 |
| 682 | Ga0373925_0001601 | 3300037068 | Bacteria | 19118 |
| 683 | Ga0373925_0030638 | 3300037068 | Bacteria | 3949 |
| 684 | Ga0373925_0041679 | 3300037068 | Bacteria | 3404 |
| 685 | Ga0373925_0062852 | 3300037068 | Unclassified | 2792 |
| 686 | Ga0395898_0237820 | 3300037466 | Bacteria | 1737 |
| 687 | Ga0395905_0249861 | 3300037471 | Unclassified | 1657 |
| 688 | Ga0436365_0424004 | 3300039437 | Bacteria | 14497 |
| 689 | Ga0436365_1317488 | 3300039437 | Bacteria | 1680 |
| 690 | Ga0436361_0707516 | 3300039447 | Bacteria | 3991 |
| 691 | Ga0439453_0001434 | 3300041408 | Bacteria | 3060 |
| 692 | Ga0451853_3534647 | 3300041512 | Bacteria | 2105 |
| 693 | Ga0439446_0019995 | 3300042156 | Bacteria | 1884 |
| 694 | Ga0495617_042446 | 3300046452 | Bacteria | 1520 |
| 695 | Ga0495617_065707 | 3300046452 | Bacteria | 1196 |
| 696 | Ga0495592_0001183 | 3300046454 | Bacteria | 18097 |
| 697 | Ga0495592_0147310 | 3300046454 | Bacteria | 1631 |
| 698 | Ga0495603_0000766 | 3300046455 | Bacteria | 18342 |
| 699 | Ga0495603_0013119 | 3300046455 | Bacteria | 5008 |
| 700 | Ga0495603_0044959 | 3300046455 | Bacteria | 2635 |
| 701 | Ga0495603_0053860 | 3300046455 | Bacteria | 2386 |
| 702 | Ga0495603_0169289 | 3300046455 | Bacteria | 1266 |
| 703 | Ga0495629_0000499 | 3300046459 | Bacteria | 32883 |
| 704 | Ga0495629_0100280 | 3300046459 | Bacteria | 2021 |
| 705 | Ga0495638_0030282 | 3300046460 | Bacteria | 3485 |
| 706 | Ga0495641_0009138 | 3300046461 | Bacteria | 5932 |
| 707 | Ga0495641_0016576 | 3300046461 | Bacteria | 3876 |
| 708 | Ga0495641_0072960 | 3300046461 | Bacteria | 1540 |
| 709 | Ga0495651_0012555 | 3300046462 | Bacteria | 6536 |
| 710 | Ga0495651_0067206 | 3300046462 | Bacteria | 2735 |
| 711 | Ga0495653_0009651 | 3300046463 | Bacteria | 7893 |
| 712 | Ga0495653_0026510 | 3300046463 | Bacteria | 4646 |
| 713 | Ga0495580_0001242 | 3300046472 | Bacteria | 22494 |
| 714 | Ga0495582_0001185 | 3300046473 | Bacteria | 14686 |
| 715 | Ga0495582_0169315 | 3300046473 | Bacteria | 1243 |
| 716 | Ga0495639_0000003 | 3300046475 | Bacteria | 118479 |
| 717 | Ga0495639_0075874 | 3300046475 | Bacteria | 1559 |
| 718 | Ga0495662_0000185 | 3300046476 | Bacteria | 25164 |
| 719 | Ga0495662_0026927 | 3300046476 | Bacteria | 2777 |
| 720 | Ga0495662_0090295 | 3300046476 | Bacteria | 1493 |
| 721 | Ga0495664_0001147 | 3300046477 | Bacteria | 13762 |
| 722 | Ga0495664_0201651 | 3300046477 | Bacteria | 1205 |
| 723 | Ga0495584_0033275 | 3300046491 | Bacteria | 2608 |
| 724 | Ga0495584_0122167 | 3300046491 | Bacteria | 1319 |
| 725 | Ga0495584_0190274 | 3300046491 | Unclassified | 1043 |
| 726 | Ga0495585_0061619 | 3300046492 | Bacteria | 2062 |
| 727 | Ga0495585_0098639 | 3300046492 | Bacteria | 1565 |
| 728 | Ga0495585_0176257 | 3300046492 | Bacteria | 1101 |
| 729 | Ga0495594_0001056 | 3300046499 | Bacteria | 14337 |
| 730 | Ga0495594_0039434 | 3300046499 | Bacteria | 2583 |
| 731 | Ga0495594_0106088 | 3300046499 | Bacteria | 1582 |
| 732 | Ga0495596_0038744 | 3300046500 | Bacteria | 1884 |
| 733 | Ga0495608_0005264 | 3300046511 | Bacteria | 9241 |
| 734 | Ga0495616_0154308 | 3300046513 | Bacteria | 1037 |
| 735 | Ga0495618_0013776 | 3300046514 | Bacteria | 4919 |
| 736 | Ga0495618_0297408 | 3300046514 | Bacteria | 1003 |
| 737 | Ga0495628_0001064 | 3300046516 | Bacteria | 25180 |
| 738 | Ga0495628_0009740 | 3300046516 | Bacteria | 8194 |
| 739 | Ga0495628_0074799 | 3300046516 | Bacteria | 2638 |
| 740 | Ga0495628_0278393 | 3300046516 | Bacteria | 1243 |
| 741 | Ga0495630_0000566 | 3300046517 | Bacteria | 26945 |
| 742 | Ga0495630_0046821 | 3300046517 | Bacteria | 3233 |
| 743 | Ga0495644_0038917 | 3300046523 | Bacteria | 1793 |
| 744 | Ga0495644_0047264 | 3300046523 | Bacteria | 1617 |
| 745 | Ga0495666_0143752 | 3300046526 | Bacteria | 1111 |
| 746 | Ga0495652_0001634 | 3300046529 | Bacteria | 24442 |
| 747 | Ga0495652_0014266 | 3300046529 | Bacteria | 7134 |
| 748 | Ga0495652_0075353 | 3300046529 | Bacteria | 2802 |
| 749 | Ga0495652_0124160 | 3300046529 | Bacteria | 2054 |
| 750 | Ga0495654_0031846 | 3300046530 | Bacteria | 2676 |
| 751 | Ga0495665_0000138 | 3300046531 | Bacteria | 35409 |
| 752 | Ga0495640_0000274 | 3300046533 | Bacteria | 35048 |
| 753 | Ga0495640_0009232 | 3300046533 | Bacteria | 7692 |
| 754 | Ga0495640_0054421 | 3300046533 | Bacteria | 2741 |
| 755 | Ga0495640_0092072 | 3300046533 | Bacteria | 2000 |
| 756 | Ga0495640_0111493 | 3300046533 | Bacteria | 1788 |
| 757 | Ga0495587_0030465 | 3300046536 | Bacteria | 3271 |
| 758 | Ga0495587_0031234 | 3300046536 | Bacteria | 3226 |
| 759 | Ga0495598_0023365 | 3300046537 | Bacteria | 1664 |
| 760 | Ga0495598_0024329 | 3300046537 | Bacteria | 1641 |
| 761 | Ga0495598_0032303 | 3300046537 | Bacteria | 1478 |
| 762 | Ga0495598_0077165 | 3300046537 | Bacteria | 1061 |
| 763 | Ga0495621_0019492 | 3300046539 | Bacteria | 2216 |
| 764 | Ga0495597_0112379 | 3300046542 | Bacteria | 1141 |
| 765 | Ga0495645_0000368 | 3300046543 | Bacteria | 31407 |
| 766 | Ga0495645_0044172 | 3300046543 | Bacteria | 3250 |
| 767 | Ga0495622_0005994 | 3300046557 | Bacteria | 5647 |
| 768 | Ga0495622_0015157 | 3300046557 | Bacteria | 3584 |
| 769 | Ga0495622_0084514 | 3300046557 | Bacteria | 1460 |
| 770 | Ga0495633_0071844 | 3300046558 | Bacteria | 1614 |
| 771 | Ga0495633_0102146 | 3300046558 | Bacteria | 1331 |
| 772 | Ga0495667_0001463 | 3300046559 | Bacteria | 15533 |
| 773 | Ga0495667_0005593 | 3300046559 | Bacteria | 8498 |
| 774 | Ga0495667_0270296 | 3300046559 | Bacteria | 1080 |
| 775 | Ga0495656_0008186 | 3300046615 | Bacteria | 3724 |
| 776 | Ga0495656_0032309 | 3300046615 | Bacteria | 2129 |
| 777 | Ga0495656_0075708 | 3300046615 | Bacteria | 1506 |
| 778 | Ga0495656_0089444 | 3300046615 | Bacteria | 1405 |
| 779 | Ga0495668_0021357 | 3300046616 | Bacteria | 3713 |
| 780 | Ga0495668_0134706 | 3300046616 | Bacteria | 1352 |
| 781 | Ga0495668_0177322 | 3300046616 | Bacteria | 1168 |
| 782 | Ga0495634_0000360 | 3300046642 | Bacteria | 44196 |
| 783 | Ga0495611_0120049 | 3300046648 | Unclassified | 1226 |
| 784 | Ga0495625_0060466 | 3300046660 | Bacteria | 2684 |
| 785 | Ga0495635_0005840 | 3300046663 | Bacteria | 8576 |
| 786 | Ga0495635_0098331 | 3300046663 | Bacteria | 2000 |
| 787 | Ga0495588_0003118 | 3300046674 | Bacteria | 7174 |
| 788 | Ga0495588_0003814 | 3300046674 | Bacteria | 6602 |
| 789 | Ga0495588_0041292 | 3300046674 | Bacteria | 2355 |
| 790 | Ga0495588_0046322 | 3300046674 | Unclassified | 2231 |
| 791 | Ga0495657_0004684 | 3300046675 | Bacteria | 10903 |
| 792 | Ga0495657_0029673 | 3300046675 | Bacteria | 3835 |
| 793 | Ga0495599_0003753 | 3300046678 | Bacteria | 8912 |
| 794 | Ga0495599_0137722 | 3300046678 | Bacteria | 1515 |
| 795 | Ga0495623_0001952 | 3300046679 | Bacteria | 13848 |
| 796 | Ga0495623_0012684 | 3300046679 | Bacteria | 5456 |
| 797 | Ga0495646_0025109 | 3300046680 | Bacteria | 3749 |
| 798 | Ga0495646_0073236 | 3300046680 | Unclassified | 2012 |
| 799 | Ga0495647_0032336 | 3300046681 | Bacteria | 1949 |
| 800 | Ga0495658_0000136 | 3300046683 | Bacteria | 40715 |
| 801 | Ga0495669_0030515 | 3300046684 | Bacteria | 2366 |
| 802 | Ga0495669_0134625 | 3300046684 | Unclassified | 1165 |
| 803 | Ga0495613_0056803 | 3300046689 | Bacteria | 2874 |
| 804 | Ga0495613_0077761 | 3300046689 | Bacteria | 2414 |
| 805 | Ga0495624_0047913 | 3300046690 | Bacteria | 2714 |
| 806 | Ga0495624_0050434 | 3300046690 | Unclassified | 2636 |
| 807 | Ga0495670_0065432 | 3300046691 | Bacteria | 1832 |
| 808 | Ga0495670_0068531 | 3300046691 | Bacteria | 1793 |
| 809 | Ga0495671_0107799 | 3300046692 | Bacteria | 1360 |
| 810 | Ga0495649_0055083 | 3300046694 | Unclassified | 2150 |
| 811 | Ga0495649_0101955 | 3300046694 | Bacteria | 1525 |
| 812 | Ga0495589_0108656 | 3300046794 | Bacteria | 1340 |
| 813 | Ga0495600_0003190 | 3300046809 | Bacteria | 9600 |
| 814 | Ga0495600_0005894 | 3300046809 | Bacteria | 7413 |
| 815 | Ga0495600_0039933 | 3300046809 | Bacteria | 3056 |
| 816 | Ga0495600_0353871 | 3300046809 | Bacteria | 919 |
| 817 | Ga0495581_0000614 | 3300047315 | Bacteria | 18660 |
| 818 | Ga0495604_0001623 | 3300047317 | Bacteria | 18549 |
| 819 | Ga0495604_0003305 | 3300047317 | Bacteria | 12871 |
| 820 | Ga0495604_0183999 | 3300047317 | Bacteria | 1460 |
| 821 | Ga0495636_0035467 | 3300047318 | Bacteria | 2055 |
| 822 | Ga0495674_0001053 | 3300047319 | Bacteria | 26515 |
| 823 | Ga0495674_0266420 | 3300047319 | Bacteria | 1407 |
| 824 | Ga0495676_0042243 | 3300047321 | Bacteria | 3744 |
| 825 | Ga0495676_0148389 | 3300047321 | Bacteria | 1672 |
| 826 | Ga0495676_0218563 | 3300047321 | Bacteria | 1314 |
| 827 | Ga0495680_0001148 | 3300047322 | Bacteria | 29161 |
| 828 | Ga0495680_0013379 | 3300047322 | Bacteria | 7161 |
| 829 | Ga0495675_0055623 | 3300047444 | Bacteria | 2510 |
| 830 | Ga0495675_0056778 | 3300047444 | Bacteria | 2482 |
| 831 | Ga0495675_0252367 | 3300047444 | Bacteria | 1059 |
| 832 | Ga0495677_0069961 | 3300047445 | Unclassified | 1308 |
| 833 | Ga0495677_0138958 | 3300047445 | Bacteria | 932 |
| 834 | Ga0495679_047269 | 3300047446 | Bacteria | 1306 |
| 835 | Ga0495684_0066616 | 3300047471 | Bacteria | 2738 |
| 836 | Ga0495686_0054902 | 3300047472 | Bacteria | 2493 |
| 837 | Ga0495686_0211866 | 3300047472 | Bacteria | 1107 |
| 838 | Ga0495593_0000819 | 3300047673 | Bacteria | 18024 |
| 839 | Ga0495602_0000791 | 3300048088 | Bacteria | 30188 |
| 840 | Ga0495602_0007047 | 3300048088 | Bacteria | 11799 |
| 841 | Ga0495614_0029765 | 3300048089 | Bacteria | 2349 |
| 842 | Ga0496100_0019077 | 3300048903 | Bacteria | 4083 |
| 843 | Ga0496100_0024781 | 3300048903 | Bacteria | 3663 |
| 844 | Ga0496100_0138034 | 3300048903 | Bacteria | 1725 |
| 845 | Ga0496100_0187172 | 3300048903 | Bacteria | 1501 |
| 846 | Ga0496101_0002847 | 3300048904 | Bacteria | 10634 |
| 847 | Ga0496101_0008762 | 3300048904 | Bacteria | 6619 |
| 848 | Ga0496101_0118958 | 3300048904 | Unclassified | 1996 |
| 849 | Ga0496101_0285406 | 3300048904 | Bacteria | 1291 |
| 850 | Ga0496102_0007982 | 3300048905 | Bacteria | 9045 |
| 851 | Ga0496102_0010414 | 3300048905 | Bacteria | 8000 |
| 852 | Ga0496102_0130126 | 3300048905 | Bacteria | 2355 |
| 853 | Ga0496102_0354937 | 3300048905 | Bacteria | 1380 |
| 854 | Ga0496102_0415056 | 3300048905 | Bacteria | 1264 |
| 855 | Ga0496103_0012799 | 3300048906 | Bacteria | 4975 |
| 856 | Ga0496103_0034715 | 3300048906 | Bacteria | 3085 |
| 857 | Ga0496103_0211699 | 3300048906 | Bacteria | 1246 |
| 858 | Ga0496104_0000280 | 3300048907 | Bacteria | 45178 |
| 859 | Ga0496104_0000524 | 3300048907 | Bacteria | 32873 |
| 860 | Ga0496104_0011213 | 3300048907 | Bacteria | 8020 |
| 861 | Ga0496104_0016202 | 3300048907 | Bacteria | 6767 |
| 862 | Ga0496104_0033659 | 3300048907 | Bacteria | 4776 |
| 863 | Ga0496104_0043242 | 3300048907 | Bacteria | 4231 |
| 864 | Ga0496104_0112459 | 3300048907 | Unclassified | 2611 |
| 865 | Ga0496104_0136405 | 3300048907 | Bacteria | 2357 |
| 866 | Ga0496104_0213421 | 3300048907 | Bacteria | 1842 |
| 867 | Ga0496105_0000835 | 3300048908 | Bacteria | 20959 |
| 868 | Ga0496105_0004323 | 3300048908 | Bacteria | 10701 |
| 869 | Ga0496105_0039502 | 3300048908 | Bacteria | 3889 |
| 870 | Ga0496105_0048175 | 3300048908 | Bacteria | 3517 |
| 871 | Ga0496105_0052634 | 3300048908 | Bacteria | 3362 |
| 872 | Ga0496106_0008620 | 3300048909 | Bacteria | 7545 |
| 873 | Ga0496106_0030643 | 3300048909 | Bacteria | 4009 |
| 874 | Ga0496106_0060992 | 3300048909 | Bacteria | 2860 |
| 875 | Ga0496106_0119844 | 3300048909 | Unclassified | 2056 |
| 876 | Ga0496106_0142501 | 3300048909 | Bacteria | 1886 |
| 877 | Ga0496106_0197782 | 3300048909 | Bacteria | 1599 |
| 878 | Ga0496107_0038168 | 3300048910 | Bacteria | 3447 |
| 879 | Ga0496107_0051888 | 3300048910 | Plasmid | 2959 |
| 880 | Ga0496107_0071006 | 3300048910 | Bacteria | 2529 |
| 881 | Ga0496107_0088952 | 3300048910 | Bacteria | 2254 |
| 882 | Ga0496107_0233876 | 3300048910 | Bacteria | 1367 |
| 883 | Ga0496107_0234676 | 3300048910 | Bacteria | 1365 |
| 884 | Ga0496108_0002485 | 3300048911 | Bacteria | 14755 |
| 885 | Ga0496108_0007938 | 3300048911 | Bacteria | 8603 |
| 886 | Ga0496108_0009402 | 3300048911 | Bacteria | 7916 |
| 887 | Ga0496108_0143504 | 3300048911 | Bacteria | 2057 |
| 888 | Ga0496108_0158095 | 3300048911 | Bacteria | 1958 |
| 889 | Ga0496108_0160355 | 3300048911 | Unclassified | 1943 |
| 890 | Ga0496108_0185823 | 3300048911 | Bacteria | 1800 |
| 891 | Ga0496109_0001072 | 3300048912 | Bacteria | 22689 |
| 892 | Ga0496109_0004069 | 3300048912 | Bacteria | 12225 |
| 893 | Ga0496109_0023447 | 3300048912 | Bacteria | 5479 |
| 894 | Ga0496109_0230823 | 3300048912 | Bacteria | 1741 |
| 895 | Ga0496109_0314536 | 3300048912 | Unclassified | 1477 |
| 896 | Ga0496109_0349405 | 3300048912 | Bacteria | 1397 |
| 897 | Ga0496110_0000570 | 3300048913 | Bacteria | 25287 |
| 898 | Ga0496110_0015271 | 3300048913 | Bacteria | 6388 |
| 899 | Ga0496110_0032674 | 3300048913 | Bacteria | 4497 |
| 900 | Ga0496110_0233555 | 3300048913 | Bacteria | 1673 |
| 901 | Ga0496110_0282296 | 3300048913 | Bacteria | 1512 |
| 902 | Ga0496111_0001744 | 3300048914 | Bacteria | 12736 |
| 903 | Ga0496111_0030148 | 3300048914 | Bacteria | 3857 |
| 904 | Ga0496111_0042471 | 3300048914 | Bacteria | 3265 |
| 905 | Ga0496111_0066849 | 3300048914 | Bacteria | 2611 |
| 906 | Ga0496111_0068204 | 3300048914 | Bacteria | 2584 |
| 907 | Ga0496111_0106349 | 3300048914 | Bacteria | 2065 |
| 908 | Ga0496112_0005539 | 3300048915 | Bacteria | 10941 |
| 909 | Ga0496112_0005780 | 3300048915 | Bacteria | 10758 |
| 910 | Ga0496112_0057633 | 3300048915 | Bacteria | 3825 |
| 911 | Ga0496112_0079356 | 3300048915 | Bacteria | 3247 |
| 912 | Ga0496112_0086196 | 3300048915 | Bacteria | 3107 |
| 913 | Ga0496112_0216385 | 3300048915 | Bacteria | 1872 |
| 914 | Ga0496112_0226696 | 3300048915 | Bacteria | 1824 |
| 915 | Ga0496113_0021882 | 3300048916 | Bacteria | 4515 |
| 916 | Ga0496113_0024976 | 3300048916 | Bacteria | 4255 |
| 917 | Ga0496113_0025168 | 3300048916 | Bacteria | 4239 |
| 918 | Ga0496113_0049941 | 3300048916 | Bacteria | 3116 |
| 919 | Ga0496113_0106077 | 3300048916 | Bacteria | 2182 |
| 920 | Ga0496113_0194707 | 3300048916 | Bacteria | 1610 |
| 921 | Ga0496113_0242570 | 3300048916 | Bacteria | 1438 |
| 922 | Ga0496113_0291594 | 3300048916 | Bacteria | 1305 |
| 923 | Ga0496114_0014562 | 3300048917 | Bacteria | 6318 |
| 924 | Ga0496114_0025784 | 3300048917 | Bacteria | 4808 |
| 925 | Ga0496114_0030671 | 3300048917 | Bacteria | 4424 |
| 926 | Ga0496114_0101752 | 3300048917 | Bacteria | 2453 |
| 927 | Ga0496114_0106374 | 3300048917 | Bacteria | 2400 |
| 928 | Ga0496114_0195337 | 3300048917 | Bacteria | 1771 |
| 929 | Ga0496114_0497721 | 3300048917 | Bacteria | 1078 |
| 930 | Ga0496115_0009034 | 3300048918 | Bacteria | 7393 |
| 931 | Ga0496115_0034492 | 3300048918 | Bacteria | 3999 |
| 932 | Ga0496115_0060227 | 3300048918 | Bacteria | 3058 |
| 933 | Ga0496115_0062323 | 3300048918 | Unclassified | 3008 |
| 934 | Ga0496115_0090382 | 3300048918 | Bacteria | 2501 |
| 935 | Ga0496115_0105997 | 3300048918 | Bacteria | 2307 |
| 936 | Ga0496115_0182700 | 3300048918 | Bacteria | 1733 |
| 937 | Ga0496116_0141584 | 3300048919 | Bacteria | 1352 |
| 938 | Ga0496117_0099206 | 3300048920 | Bacteria | 1849 |
| 939 | Ga0496118_0005620 | 3300048921 | Bacteria | 14161 |
| 940 | Ga0496121_0003623 | 3300048924 | Bacteria | 21781 |
| 941 | Ga0496124_0002607 | 3300048927 | Bacteria | 23290 |
| 942 | Ga0496125_0058423 | 3300048928 | Bacteria | 3116 |
| 943 | Ga0496126_0004495 | 3300048929 | Bacteria | 16639 |
| 944 | Ga0496126_0024524 | 3300048929 | Bacteria | 5822 |
| 945 | Ga0501031_0060675 | 3300049568 | Bacteria | 2465 |
| 946 | Ga0501038_0030200 | 3300049574 | Bacteria | 4798 |
| 947 | Ga0501038_0411238 | 3300049574 | Bacteria | 1045 |
| 948 | Ga0501039_0030686 | 3300049575 | Bacteria | 4145 |
| 949 | Ga0501040_0116731 | 3300049576 | Bacteria | 1870 |
| 950 | Ga0501043_0271010 | 3300049579 | Bacteria | 1303 |
| 951 | Ga0501048_0349747 | 3300049582 | Bacteria | 1054 |
| 952 | Ga0501068_0057486 | 3300049584 | Bacteria | 2359 |
| 953 | Ga0501068_0096020 | 3300049584 | Bacteria | 1833 |
| 954 | Ga0501069_0048387 | 3300049585 | Bacteria | 2361 |
| 955 | Ga0501070_0172743 | 3300049586 | Bacteria | 1780 |
| 956 | Ga0501071_0088048 | 3300049587 | Bacteria | 2278 |
| 957 | Ga0501072_0005974 | 3300049588 | Bacteria | 9283 |
| 958 | Ga0501072_0045450 | 3300049588 | Bacteria | 3453 |
| 959 | Ga0501074_0364669 | 3300049590 | Bacteria | 1025 |
| 960 | Ga0501075_0150910 | 3300049591 | Bacteria | 1771 |
| 961 | Ga0501075_0328081 | 3300049591 | Bacteria | 1166 |
| 962 | Ga0501076_0026966 | 3300049592 | Bacteria | 4454 |
| 963 | Ga0501076_0117799 | 3300049592 | Bacteria | 2150 |
| 964 | Ga0501076_0156766 | 3300049592 | Bacteria | 1854 |
| 965 | Ga0501080_0029336 | 3300049742 | Bacteria | 5121 |
| 966 | Ga0501080_0292529 | 3300049742 | Bacteria | 1479 |
| 967 | Ga0501081_0133096 | 3300049743 | Bacteria | 1778 |
| 968 | Ga0501035_0037084 | 3300049822 | Bacteria | 4416 |
| 969 | Ga0501044_0010126 | 3300049823 | Bacteria | 10244 |
| 970 | Ga0501045_0257373 | 3300049824 | Bacteria | 1299 |
| 971 | nmdc:mga03683_1400_c1 | 3300050489 | Bacteria | 7180 |
| 972 | nmdc:mga03683_48740_c1 | 3300050489 | Unclassified | 1761 |
| 973 | nmdc:mga03n38_107706_c1 | 3300050490 | Bacteria | 1353 |
| 974 | nmdc:mga03n38_3003_c1 | 3300050490 | Bacteria | 5338 |
| 975 | nmdc:mga00v17_237648_c1 | 3300050491 | Bacteria | 1181 |
| 976 | nmdc:mga00v17_68044_c1 | 3300050491 | Bacteria | 2201 |
| 977 | nmdc:mga0yw44_119190_c1 | 3300050492 | Bacteria | 1699 |
| 978 | nmdc:mga0yw44_157697_c1 | 3300050492 | Bacteria | 1484 |
| 979 | nmdc:mga0yw44_172202_c1 | 3300050492 | Bacteria | 1422 |
| 980 | nmdc:mga0yw44_281628_c1 | 3300050492 | Bacteria | 1111 |
| 981 | nmdc:mga0yw44_34681_c1 | 3300050492 | Bacteria | 2959 |
| 982 | nmdc:mga0yw44_35615_c1 | 3300050492 | Bacteria | 2926 |
| 983 | nmdc:mga0yw44_48639_c1 | 3300050492 | Bacteria | 2557 |
| 984 | nmdc:mga0yw44_6629_c1 | 3300050492 | Bacteria | 5613 |
| 985 | nmdc:mga0yw44_8711_c1 | 3300050492 | Bacteria | 5074 |
| 986 | nmdc:mga0yw44_9174_c1 | 3300050492 | Bacteria | 4980 |
| 987 | nmdc:mga0k408_28510_c1 | 3300050493 | Bacteria | 3174 |
| 988 | nmdc:mga0k408_69721_c1 | 3300050493 | Bacteria | 2052 |
| 989 | nmdc:mga06z11_17762_c1 | 3300050494 | Bacteria | 3236 |
| 990 | nmdc:mga06z11_187542_c1 | 3300050494 | Bacteria | 1196 |
| 991 | nmdc:mga06z11_30638_c1 | 3300050494 | Bacteria | 2605 |
| 992 | nmdc:mga06z11_35179_c1 | 3300050494 | Bacteria | 2464 |
| 993 | nmdc:mga06z11_42150_c1 | 3300050494 | Bacteria | 2288 |
| 994 | nmdc:mga06z11_46444_c1 | 3300050494 | Bacteria | 2201 |
| 995 | nmdc:mga06z11_484_c1 | 3300050494 | Bacteria | 14688 |
| 996 | nmdc:mga06z11_51745_c1 | 3300050494 | Bacteria | 2104 |
| 997 | nmdc:mga06z11_79408_c1 | 3300050494 | Bacteria | 1757 |
| 998 | nmdc:mga04h51_2413_c1 | 3300050495 | Bacteria | 4431 |
| 999 | nmdc:mga04h51_28088_c1 | 3300050495 | Bacteria | 1753 |
| 1000 | nmdc:mga04h51_3408_c1 | 3300050495 | Bacteria | 3863 |
| 1001 | nmdc:mga07m45_117980_c1 | 3300050496 | Bacteria | 1532 |
| 1002 | nmdc:mga07m45_32693_c1 | 3300050496 | Bacteria | 2885 |
| 1003 | nmdc:mga05p37_151234_c1 | 3300050507 | Bacteria | 2839 |
| 1004 | nmdc:mga05p37_268074_c1 | 3300050507 | Bacteria | 2041 |
| 1005 | nmdc:mga05p37_299254_c1 | 3300050507 | Bacteria | 1912 |
| 1006 | nmdc:mga05p37_498971_c1 | 3300050507 | Bacteria | 1397 |
| 1007 | nmdc:mga05p37_52_c1 | 3300050507 | Bacteria | 102932 |
| 1008 | nmdc:mga05p37_57225_c1 | 3300050507 | Bacteria | 4802 |
| 1009 | nmdc:mga05p37_60269_c1 | 3300050507 | Bacteria | 4673 |
| 1010 | nmdc:mga05p37_655533_c1 | 3300050507 | Bacteria | 1174 |
| 1011 | nmdc:mga05p37_94209_c1 | 3300050507 | Bacteria | 3690 |
| 1012 | nmdc:mga05p37_98281_c1 | 3300050507 | Bacteria | 3605 |
| 1013 | nmdc:mga09592_126_c2 | 3300050508 | Bacteria | 13804 |
| 1014 | nmdc:mga09592_159889_c1 | 3300050508 | Bacteria | 1946 |
| 1015 | nmdc:mga09592_230200_c1 | 3300050508 | Bacteria | 1606 |
| 1016 | nmdc:mga09592_255929_c1 | 3300050508 | Bacteria | 1518 |
| 1017 | nmdc:mga09592_5425_c1 | 3300050508 | Bacteria | 10364 |
| 1018 | nmdc:mga09592_73456_c1 | 3300050508 | Bacteria | 2906 |
| 1019 | nmdc:mga0qj67_19482_c1 | 3300050509 | Bacteria | 5184 |
| 1020 | nmdc:mga0qj67_19920_c1 | 3300050509 | Bacteria | 5133 |
| 1021 | nmdc:mga0qj67_21393_c1 | 3300050509 | Bacteria | 4962 |
| 1022 | nmdc:mga0qj67_297718_c1 | 3300050509 | Bacteria | 1307 |
| 1023 | nmdc:mga0qj67_332365_c1 | 3300050509 | Bacteria | 1230 |
| 1024 | nmdc:mga0qj67_47_c1 | 3300050509 | Bacteria | 86979 |
| 1025 | nmdc:mga06r32_274569_c1 | 3300050510 | Bacteria | 1673 |
| 1026 | nmdc:mga06r32_299694_c1 | 3300050510 | Bacteria | 1594 |
| 1027 | nmdc:mga06r32_299709_c1 | 3300050510 | Bacteria | 1594 |
| 1028 | nmdc:mga06r32_299934_c1 | 3300050510 | Bacteria | 1593 |
| 1029 | nmdc:mga06r32_35443_c2 | 3300050510 | Bacteria | 4290 |
| 1030 | nmdc:mga06r32_387919_c1 | 3300050510 | Bacteria | 1379 |
| 1031 | nmdc:mga06r32_4_c1 | 3300050510 | Bacteria | 144637 |
| 1032 | nmdc:mga06r32_507974_c1 | 3300050510 | Bacteria | 1182 |
| 1033 | nmdc:mga06r32_57624_c1 | 3300050510 | Bacteria | 3732 |
| 1034 | nmdc:mga06r32_62018_c1 | 3300050510 | Unclassified | 3601 |
| 1035 | nmdc:mga08y16_140765_c1 | 3300050511 | Bacteria | 2508 |
| 1036 | nmdc:mga08y16_17963_c1 | 3300050511 | Bacteria | 7451 |
| 1037 | nmdc:mga08y16_2104_c1 | 3300050511 | Bacteria | 20397 |
| 1038 | nmdc:mga0n895_121556_c1 | 3300050512 | Bacteria | 2632 |
| 1039 | nmdc:mga0n895_13734_c1 | 3300050512 | Bacteria | 7322 |
| 1040 | nmdc:mga0n895_142005_c1 | 3300050512 | Bacteria | 2430 |
| 1041 | nmdc:mga0n895_151376_c1 | 3300050512 | Bacteria | 2350 |
| 1042 | nmdc:mga0n895_229499_c1 | 3300050512 | Bacteria | 1884 |
| 1043 | nmdc:mga0rr50_13041_c1 | 3300050513 | Bacteria | 5394 |
| 1044 | nmdc:mga0rr50_200654_c1 | 3300050513 | Bacteria | 1639 |
| 1045 | nmdc:mga0rr50_3169_c1 | 3300050513 | Bacteria | 9406 |
| 1046 | nmdc:mga08x19_161341_c1 | 3300050514 | Bacteria | 1522 |
| 1047 | nmdc:mga08x19_30895_c1 | 3300050514 | Bacteria | 3366 |
| 1048 | nmdc:mga0a205_210960_c1 | 3300050515 | Bacteria | 1830 |
| 1049 | nmdc:mga0a205_360096_c1 | 3300050515 | Bacteria | 1321 |
| 1050 | nmdc:mga0sz30_7423_c1 | 3300050516 | Bacteria | 4111 |
| 1051 | Ga0495601_0000152 | 3300053077 | Bacteria | 38651 |
| 1052 | Ga0495601_0011509 | 3300053077 | Bacteria | 5297 |
| 1053 | Ga0495601_0049432 | 3300053077 | Bacteria | 2651 |
| 1054 | Ga0495601_0273049 | 3300053077 | Bacteria | 1103 |
| 1055 | Ga0495601_0290689 | 3300053077 | Unclassified | 1065 |
| 1056 | Ga0495612_0000244 | 3300053078 | Bacteria | 22545 |
| 1057 | Ga0495612_0010585 | 3300053078 | Bacteria | 3729 |
| 1058 | Ga0500635_0009055 | 3300053080 | Bacteria | 2750 |
| 1059 | Ga0495655_0062184 | 3300053083 | Bacteria | 1021 |
| 1060 | Ga0495595_0000630 | 3300053084 | Bacteria | 13416 |
| 1061 | Ga0495595_0000791 | 3300053084 | Bacteria | 12040 |
| 1062 | Ga0495595_0002676 | 3300053084 | Bacteria | 6987 |
| 1063 | Ga0495595_0009750 | 3300053084 | Bacteria | 3979 |
| 1064 | Ga0495619_0000115 | 3300053085 | Bacteria | 58866 |
| 1065 | Ga0495619_0002237 | 3300053085 | Bacteria | 12800 |
| 1066 | Ga0495619_0008613 | 3300053085 | Bacteria | 6452 |
| 1067 | Ga0495619_0027135 | 3300053085 | Bacteria | 3689 |
| 1068 | Ga0495619_0085216 | 3300053085 | Bacteria | 2133 |
| 1069 | Ga0500644_0018798 | 3300053088 | Bacteria | 2031 |
| 1070 | Ga0500583_0074743 | 3300053092 | Bacteria | 1626 |
| 1071 | Ga0500566_0000012 | 3300053094 | Bacteria | 117873 |
| 1072 | Ga0500640_003280 | 3300053095 | Bacteria | 5610 |
| 1073 | Ga0500562_014828 | 3300053108 | Bacteria | 1997 |
| 1074 | Ga0500572_001242 | 3300053111 | Bacteria | 7199 |
| 1075 | Ga0500595_000859 | 3300053119 | Bacteria | 17361 |
| 1076 | Ga0500595_070702 | 3300053119 | Bacteria | 1036 |
| 1077 | Ga0500614_001494 | 3300053123 | Bacteria | 5575 |
| 1078 | Ga0500559_0005620 | 3300053136 | Bacteria | 5745 |
| 1079 | Ga0500568_0052787 | 3300053139 | Bacteria | 1595 |
| 1080 | Ga0500603_000575 | 3300053150 | Bacteria | 9226 |
| 1081 | Ga0500603_000585 | 3300053150 | Bacteria | 9138 |
| 1082 | Ga0500616_0005716 | 3300053153 | Bacteria | 8371 |
| 1083 | Ga0500630_001334 | 3300053159 | Bacteria | 11605 |
| 1084 | Ga0500634_0051253 | 3300053161 | Bacteria | 2221 |
| 1085 | Ga0500638_054741 | 3300053162 | Bacteria | 1924 |
| 1086 | Ga0500639_000095 | 3300053163 | Bacteria | 41536 |
| 1087 | Ga0500639_098922 | 3300053163 | Bacteria | 1440 |
| 1088 | Ga0500636_0133044 | 3300053177 | Bacteria | 1383 |
| 1089 | Ga0500637_0115947 | 3300053178 | Bacteria | 1553 |
| 1090 | Ga0500609_004628 | 3300053731 | Bacteria | 1896 |
| 1091 | Ga0500596_000600 | 3300053735 | Bacteria | 6928 |
| 1092 | Ga0500596_008690 | 3300053735 | Bacteria | 1613 |
| 1093 | Ga0501084_0031511 | 3300054114 | Bacteria | 4433 |
| 1094 | Ga0501084_0061580 | 3300054114 | Bacteria | 3142 |
| 1095 | Ga0501084_0480948 | 3300054114 | Bacteria | 1050 |
| 1096 | Ga0590077_006676 | 3300059426 | Bacteria | 2363 |
| 1097 | Ga0501082_0000264 | 3300060353 | Bacteria | 46205 |
| 1098 | Ga0501082_0106658 | 3300060353 | Bacteria | 2424 |
| 1099 | Ga0501082_0270207 | 3300060353 | Bacteria | 1480 |
| 1100 | Ga0530510_0076444 | 3300061734 | Bacteria | 2433 |
| 1101 | Ga0530510_0132768 | 3300061734 | Bacteria | 1832 |
| 1102 | 2513693094 | 2513237101 | Bacteria | 7952346 |
| 1103 | 2793080737 | |||
| 1104 | 2854899012 | 2854896431 | Bacteria | 5869725 |
| 1105 | 2876816068 | 2876808645 | Bacteria | 8824342 |
| 1106 | 2879110842 | 2879110137 | Bacteria | 8907982 |
| 1107 | 2883580517 | 2883577096 | Bacteria | 4709178 |
| 1108 | 2889037590 | 2889033259 | Bacteria | 9099371 |
| 1109 | 8006985075 | 8006984368 | Bacteria | 9651211 |
| 1110 | 8056677585 | 8056673599 | Bacteria | 7871253 |
| 1111 | Ga0081455_10011732 | |||
| 1112 | JGI24750J21931_1000889 | |||
| 1113 | JGI24744J21845_10000391 | |||
| 1114 | JGI24742J22300_10025552 | |||
| 1115 | JGI25406J46586_10004281 | |||
| 1116 | JGI25406J46586_10005104 | |||
| 1117 | JGI25153J46596_10002190 | |||
| 1118 | JGI25404J52841_10002634 | |||
| 1119 | JGI25404J52841_10015190 | |||
| 1120 | Ga0070676_10174554 | |||
| 1121 | Ga0070683_100591791 | |||
| 1122 | Ga0070670_100017319 | |||
| 1123 | Ga0070670_100226205 | |||
| 1124 | Ga0070677_10155014 | |||
| 1125 | Ga0068869_100024381 | |||
| 1126 | Ga0068869_100210379 | |||
| 1127 | Ga0070666_10050373 | |||
| 1128 | Ga0070680_100130833 | |||
| 1129 | Ga0070680_100208752 | |||
| 1130 | Ga0070682_100115362 | |||
| 1131 | Ga0068868_100033796 | |||
| 1132 | Ga0068868_100055724 | |||
| 1133 | Ga0068868_100056637 | |||
| 1134 | Ga0070660_100131451 | |||
| 1135 | Ga0070689_100010283 | |||
| 1136 | Ga0070689_100019103 | |||
| 1137 | Ga0070689_100067415 | |||
| 1138 | Ga0070689_100124664 | |||
| 1139 | Ga0070689_100192611 | |||
| 1140 | Ga0070689_100296181 | |||
| 1141 | Ga0070691_10028162 | |||
| 1142 | Ga0070687_100024371 | |||
| 1143 | Ga0070687_100070446 | |||
| 1144 | Ga0070687_100190436 | |||
| 1145 | Ga0070661_100090767 | |||
| 1146 | Ga0070692_10030726 | |||
| 1147 | Ga0070692_10036227 | |||
| 1148 | Ga0070692_10130013 | |||
| 1149 | Ga0070668_100046375 | |||
| 1150 | Ga0070668_100049732 | |||
| 1151 | Ga0070669_100006968 | |||
| 1152 | Ga0070669_100058552 | |||
| 1153 | Ga0070669_100164406 | |||
| 1154 | Ga0070669_100292720 | |||
| 1155 | Ga0070675_100010672 | |||
| 1156 | Ga0070675_100061551 | |||
| 1157 | Ga0070675_100092950 | |||
| 1158 | Ga0070675_100118964 | |||
| 1159 | Ga0070671_100003829 | |||
| 1160 | Ga0070671_100028496 | |||
| 1161 | Ga0070671_100064321 | |||
| 1162 | Ga0070671_100083958 | |||
| 1163 | Ga0070671_100098269 | |||
| 1164 | Ga0070671_100426887 | |||
| 1165 | Ga0070674_100006772 | |||
| 1166 | Ga0070674_100010698 | |||
| 1167 | Ga0070674_100024307 | |||
| 1168 | Ga0070674_100033803 | |||
| 1169 | Ga0070674_100084156 | |||
| 1170 | Ga0070674_100142174 | |||
| 1171 | Ga0070674_100161819 | |||
| 1172 | Ga0070674_100198831 | |||
| 1173 | Ga0070673_100021834 | |||
| 1174 | Ga0070673_100046783 | |||
| 1175 | Ga0070673_100066975 | |||
| 1176 | Ga0070688_100056381 | |||
| 1177 | Ga0070688_100104682 | |||
| 1178 | Ga0070688_100195804 | |||
| 1179 | Ga0070659_100031532 | |||
| 1180 | Ga0070659_100142622 | |||
| 1181 | Ga0070659_100257732 | |||
| 1182 | Ga0070659_100406829 | |||
| 1183 | Ga0070667_100015027 | |||
| 1184 | Ga0070667_100027938 | |||
| 1185 | Ga0070667_100083681 | |||
| 1186 | Ga0070709_10005461 | |||
| 1187 | Ga0070709_10220297 | |||
| 1188 | Ga0070714_100031250 | |||
| 1189 | Ga0070714_100061470 | |||
| 1190 | Ga0070714_100337216 | |||
| 1191 | Ga0070713_100014160 | |||
| 1192 | Ga0070713_100145400 | |||
| 1193 | Ga0070713_100150250 | |||
| 1194 | Ga0070713_100199301 | |||
| 1195 | Ga0070713_100241346 | |||
| 1196 | Ga0070710_10010533 | |||
| 1197 | Ga0070710_10012586 | |||
| 1198 | Ga0070710_10042502 | |||
| 1199 | Ga0070710_10058428 | |||
| 1200 | Ga0070701_10004472 | |||
| 1201 | Ga0070701_10145532 | |||
| 1202 | Ga0070711_100041381 | |||
| 1203 | Ga0070711_100080723 | |||
| 1204 | Ga0070711_100102224 | |||
| 1205 | Ga0070711_100185592 | |||
| 1206 | Ga0070711_100257011 | |||
| 1207 | Ga0070705_100061390 | |||
| 1208 | Ga0070705_100078880 | |||
| 1209 | Ga0070700_100056600 | |||
| 1210 | Ga0070700_100072768 | |||
| 1211 | Ga0070700_100100530 | |||
| 1212 | Ga0070700_100112083 | |||
| 1213 | Ga0070700_100119797 | |||
| 1214 | Ga0070694_100019929 | |||
| 1215 | Ga0070708_100069806 | |||
| 1216 | Ga0070708_100189853 | |||
| 1217 | Ga0070663_100003523 | |||
| 1218 | Ga0070663_100057583 | |||
| 1219 | Ga0070663_100088698 | |||
| 1220 | Ga0070663_100344084 | |||
| 1221 | Ga0070678_100047943 | |||
| 1222 | Ga0070678_100074012 | |||
| 1223 | Ga0070678_100118789 | |||
| 1224 | Ga0070678_100122452 | |||
| 1225 | Ga0070678_100148650 | |||
| 1226 | Ga0070662_100073619 | |||
| 1227 | Ga0070662_100099204 | |||
| 1228 | Ga0070662_100129384 | |||
| 1229 | Ga0070662_100147207 | |||
| 1230 | Ga0070681_10132681 | |||
| 1231 | Ga0070681_10204374 | |||
| 1232 | Ga0068867_100009135 | |||
| 1233 | Ga0070685_10003711 | |||
| 1234 | Ga0070685_10024316 | |||
| 1235 | Ga0070685_10040183 | |||
| 1236 | Ga0070685_10226995 | |||
| 1237 | Ga0070706_100037571 | |||
| 1238 | Ga0070698_100389246 | |||
| 1239 | Ga0070699_100044495 | |||
| 1240 | Ga0070699_100369125 | |||
| 1241 | Ga0070684_100050829 | |||
| 1242 | Ga0070684_100090261 | |||
| 1243 | Ga0070697_100039116 | |||
| 1244 | Ga0070697_100120632 | |||
| 1245 | Ga0070697_100133465 | |||
| 1246 | Ga0068853_100071702 | |||
| 1247 | Ga0068853_100113939 | |||
| 1248 | Ga0068853_100141681 | |||
| 1249 | Ga0068853_100161258 | |||
| 1250 | Ga0070672_100037653 | |||
| 1251 | Ga0070672_100061976 | |||
| 1252 | Ga0070672_100188998 | |||
| 1253 | Ga0070672_100493386 | |||
| 1254 | Ga0070686_100002493 | |||
| 1255 | Ga0070686_100204398 | |||
| 1256 | Ga0070695_100002513 | |||
| 1257 | Ga0070695_100004291 | |||
| 1258 | Ga0070696_100105837 | |||
| 1259 | Ga0070696_100315380 | |||
| 1260 | Ga0070693_100050186 | |||
| 1261 | Ga0070693_100171287 | |||
| 1262 | Ga0070665_100026385 | |||
| 1263 | Ga0070665_100120172 | |||
| 1264 | Ga0070704_100446560 | |||
| 1265 | Ga0068855_100210694 | |||
| 1266 | Ga0070664_100091097 | |||
| 1267 | Ga0070664_100126126 | |||
| 1268 | Ga0068857_100104663 | |||
| 1269 | Ga0068854_100338084 | |||
| 1270 | Ga0068854_100377911 | |||
| 1271 | Ga0068854_100389033 | |||
| 1272 | Ga0068856_100074656 | |||
| 1273 | Ga0068856_100134560 | |||
| 1274 | Ga0068856_100234108 | |||
| 1275 | Ga0070702_100012167 | |||
| 1276 | Ga0070702_100015685 | |||
| 1277 | Ga0068852_100079355 | |||
| 1278 | Ga0068852_100088389 | |||
| 1279 | Ga0068859_100104992 | |||
| 1280 | Ga0068859_100121689 | |||
| 1281 | Ga0068859_100122305 | |||
| 1282 | Ga0068859_100167891 | |||
| 1283 | Ga0068859_100307471 | |||
| 1284 | Ga0068859_100382420 | |||
| 1285 | Ga0068864_100011177 | |||
| 1286 | Ga0068864_100036792 | |||
| 1287 | Ga0068864_100047643 | |||
| 1288 | Ga0068864_100066167 | |||
| 1289 | Ga0068866_10017075 | |||
| 1290 | Ga0068866_10023911 | |||
| 1291 | Ga0068866_10110868 | |||
| 1292 | Ga0068866_10135016 | |||
| 1293 | Ga0068861_100078096 | |||
| 1294 | Ga0068861_100124851 | |||
| 1295 | Ga0068861_100394379 | |||
| 1296 | Ga0068851_10083567 | |||
| 1297 | Ga0068870_10001278 | |||
| 1298 | Ga0068870_10040514 | |||
| 1299 | Ga0068870_10164593 | |||
| 1300 | Ga0068863_100077713 | |||
| 1301 | Ga0068863_100473032 | |||
| 1302 | Ga0068863_100511551 | |||
| 1303 | Ga0068863_100518417 | |||
| 1304 | Ga0068858_100003359 | |||
| 1305 | Ga0068858_100038474 | |||
| 1306 | Ga0068858_100350278 | |||
| 1307 | Ga0068860_100047356 | |||
| 1308 | Ga0068860_100054250 | |||
| 1309 | Ga0068860_100245889 | |||
| 1310 | Ga0068860_100632286 | |||
| 1311 | Ga0068862_100010721 | |||
| 1312 | Ga0068862_100011858 | |||
| 1313 | Ga0068862_100068511 | |||
| 1314 | Ga0068862_100098142 | |||
| 1315 | Ga0068862_100147137 | |||
| 1316 | Ga0081455_10006073 | |||
| 1317 | Ga0081455_10006153 | |||
| 1318 | Ga0081455_10007998 | |||
| 1319 | Ga0081455_10024867 | |||
| 1320 | Ga0081455_10058745 | |||
| 1321 | Ga0081455_10167377 | |||
| 1322 | Ga0081538_10009001 | |||
| 1323 | Ga0081538_10024689 | |||
| 1324 | Ga0081538_10036784 | |||
| 1325 | Ga0081540_1000338 | |||
| 1326 | Ga0081540_1001883 | |||
| 1327 | Ga0081540_1005306 | |||
| 1328 | Ga0081540_1005989 | |||
| 1329 | Ga0081540_1014606 | |||
| 1330 | Ga0081540_1017298 | |||
| 1331 | Ga0081540_1035157 | |||
| 1332 | Ga0081540_1050305 | |||
| 1333 | Ga0081540_1077100 | |||
| 1334 | Ga0081539_10001094 | |||
| 1335 | Ga0081539_10002062 | |||
| 1336 | Ga0081539_10052260 | |||
| 1337 | Ga0070717_10003746 | |||
| 1338 | Ga0070717_10119097 | |||
| 1339 | Ga0070717_10139481 | |||
| 1340 | Ga0070717_10379216 | |||
| 1341 | Ga0070717_10388707 | |||
| 1342 | Ga0075365_10000347 | |||
| 1343 | Ga0075365_10005992 | |||
| 1344 | Ga0075365_10007347 | |||
| 1345 | Ga0075365_10018670 | |||
| 1346 | Ga0075365_10019141 | |||
| 1347 | Ga0075365_10042158 | |||
| 1348 | Ga0075365_10112619 | |||
| 1349 | Ga0075365_10139950 | |||
| 1350 | Ga0075368_10003192 | |||
| 1351 | Ga0075368_10010918 | |||
| 1352 | Ga0075368_10014306 | |||
| 1353 | Ga0075368_10024541 | |||
| 1354 | Ga0075368_10073427 | |||
| 1355 | Ga0075363_100011774 | |||
| 1356 | Ga0075363_100029709 | |||
| 1357 | Ga0075364_10014842 | |||
| 1358 | Ga0075364_10095053 | |||
| 1359 | Ga0075364_10113145 | |||
| 1360 | Ga0070715_10004466 | |||
| 1361 | Ga0070715_10031473 | |||
| 1362 | Ga0070716_100136132 | |||
| 1363 | Ga0070712_100053086 | |||
| 1364 | Ga0070712_100323446 | |||
| 1365 | Ga0075362_10054948 | |||
| 1366 | Ga0075362_10085255 | |||
| 1367 | Ga0075367_10009833 | |||
| 1368 | Ga0075367_10035076 | |||
| 1369 | Ga0075367_10036670 | |||
| 1370 | Ga0075367_10059545 | |||
| 1371 | Ga0075367_10064015 | |||
| 1372 | Ga0075367_10067304 | |||
| 1373 | Ga0075367_10071557 | |||
| 1374 | Ga0075367_10125567 | |||
| 1375 | Ga0075369_10040923 | |||
| 1376 | Ga0075366_10031572 | |||
| 1377 | Ga0075366_10054064 | |||
| 1378 | Ga0097621_100021567 | |||
| 1379 | Ga0097621_100071368 | |||
| 1380 | Ga0097621_100097497 | |||
| 1381 | Ga0097621_100159309 | |||
| 1382 | Ga0097621_100267820 | |||
| 1383 | Ga0075370_10018836 | |||
| 1384 | Ga0075370_10082039 | |||
| 1385 | Ga0068871_100088999 | |||
| 1386 | Ga0075428_100004072 | |||
| 1387 | Ga0075428_100070572 | |||
| 1388 | Ga0075428_100124305 | |||
| 1389 | Ga0075428_100194510 | |||
| 1390 | Ga0075428_100236159 | |||
| 1391 | Ga0075428_100285113 | |||
| 1392 | Ga0075428_100503652 | |||
| 1393 | Ga0075428_100557468 | |||
| 1394 | Ga0075430_100010962 | |||
| 1395 | Ga0075430_100043636 | |||
| 1396 | Ga0075430_100058315 | |||
| 1397 | Ga0075430_100109479 | |||
| 1398 | Ga0075431_100000021 | |||
| 1399 | Ga0075431_100040334 | |||
| 1400 | Ga0075431_100095125 | |||
| 1401 | Ga0075431_100300640 | |||
| 1402 | Ga0075433_10104205 | |||
| 1403 | Ga0075433_10419190 | |||
| 1404 | Ga0075434_100003972 | |||
| 1405 | Ga0075434_100046006 | |||
| 1406 | Ga0075429_100022600 | |||
| 1407 | Ga0075429_100045168 | |||
| 1408 | Ga0075429_100142580 | |||
| 1409 | Ga0068865_100013556 | |||
| 1410 | Ga0068865_100025863 | |||
| 1411 | Ga0075436_100037211 | |||
| 1412 | Ga0075436_100070687 | |||
| 1413 | Ga0097620_100104990 | |||
| 1414 | Ga0097620_100121693 | |||
| 1415 | Ga0097620_100122310 | |||
| 1416 | Ga0097620_100167895 | |||
| 1417 | Ga0097620_100307489 | |||
| 1418 | Ga0097620_100382384 | |||
| 1419 | Ga0075435_100003318 | |||
| 1420 | Ga0075435_100053822 | |||
| 1421 | Ga0075435_100103814 | |||
| 1422 | Ga0099794_10001204 | |||
| 1423 | Ga0099795_10036431 | |||
| 1424 | Ga0105250_10041945 | |||
| 1425 | Ga0105240_10540807 | |||
| 1426 | Ga0111539_10001676 | |||
| 1427 | Ga0111539_10019188 | |||
| 1428 | Ga0111539_10181331 | |||
| 1429 | Ga0111539_10289874 | |||
| 1430 | Ga0111539_10355627 | |||
| 1431 | Ga0105245_10008525 | |||
| 1432 | Ga0105245_10044105 | |||
| 1433 | Ga0105245_10212793 | |||
| 1434 | Ga0105245_10226751 | |||
| 1435 | Ga0105245_10361400 | |||
| 1436 | Ga0105247_10006686 | |||
| 1437 | Ga0105247_10007853 | |||
| 1438 | Ga0105247_10036593 | |||
| 1439 | Ga0105247_10078275 | |||
| 1440 | Ga0105247_10235050 | |||
| 1441 | Ga0114129_10000068 | |||
| 1442 | Ga0114129_10062125 | |||
| 1443 | Ga0114129_10069665 | |||
| 1444 | Ga0114129_10094433 | |||
| 1445 | Ga0114129_10129902 | |||
| 1446 | Ga0114129_10130192 | |||
| 1447 | Ga0114129_10136370 | |||
| 1448 | Ga0114129_10170504 | |||
| 1449 | Ga0114129_10243588 | |||
| 1450 | Ga0114129_10302240 | |||
| 1451 | Ga0114129_10415796 | |||
| 1452 | Ga0105243_10007460 | |||
| 1453 | Ga0105243_10022206 | |||
| 1454 | Ga0105243_10050293 | |||
| 1455 | Ga0105243_10155426 | |||
| 1456 | Ga0105241_10097564 | |||
| 1457 | Ga0105241_10217511 | |||
| 1458 | Ga0105241_10223567 | |||
| 1459 | Ga0105242_10044861 | |||
| 1460 | Ga0105242_10172149 | |||
| 1461 | Ga0105242_10192718 | |||
| 1462 | Ga0105248_10183607 | |||
| 1463 | Ga0105237_10113091 | |||
| 1464 | Ga0105237_10297757 | |||
| 1465 | Ga0105238_10029419 | |||
| 1466 | Ga0105238_10124467 | |||
| 1467 | Ga0105249_10003555 | |||
| 1468 | Ga0105249_10011297 | |||
| 1469 | Ga0105249_10106250 | |||
| 1470 | Ga0105249_10319880 | |||
| 1471 | Ga0099796_10034004 | |||
| 1472 | Ga0105239_10109631 | |||
| 1473 | Ga0105239_10329180 | |||
| 1474 | Ga0105246_10035693 | |||
| 1475 | Ga0105246_10099988 | |||
| 1476 | Ga0105246_10109613 | |||
| 1477 | Ga0105246_10262861 | |||
| 1478 | Ga0105246_10331868 | |||
| 1479 | Ga0157373_10081779 | |||
| 1480 | Ga0157371_10135289 | |||
| 1481 | Ga0157374_10010555 | |||
| 1482 | Ga0157374_10012705 | |||
| 1483 | Ga0157374_10128778 | |||
| 1484 | Ga0157374_10327507 | |||
| 1485 | Ga0157374_10368308 | |||
| 1486 | Ga0163162_10078540 | |||
| 1487 | Ga0163162_10089608 | |||
| 1488 | Ga0163162_10219275 | |||
| 1489 | Ga0163162_10219863 | |||
| 1490 | Ga0163162_10290924 | |||
| 1491 | Ga0157372_10190342 | |||
| 1492 | Ga0157372_10355098 | |||
| 1493 | Ga0157375_10040338 | |||
| 1494 | Ga0157375_10076779 | |||
| 1495 | Ga0157375_10114778 | |||
| 1496 | Ga0157375_10228834 | |||
| 1497 | Ga0157375_10343704 | |||
| 1498 | Ga0163163_10043454 | |||
| 1499 | Ga0163163_10050766 | |||
| 1500 | Ga0163163_10096848 | |||
| 1501 | Ga0157380_10030033 | |||
| 1502 | Ga0157380_10118134 | |||
| 1503 | Ga0157380_10136107 | |||
| 1504 | Ga0157380_10191036 | |||
| 1505 | Ga0157380_10263980 | |||
| 1506 | Ga0157379_10011977 | |||
| 1507 | Ga0157376_10018166 | |||
| 1508 | Ga0163161_10055522 | |||
| 1509 | Ga0163161_10218078 | |||
| 1510 | Ga0213872_10068820 | |||
| 1511 | Ga0213876_10104940 | |||
| 1512 | Ga0209758_1000613 | |||
| 1513 | Ga0209758_1002704 | |||
| 1514 | Ga0209758_1068034 | |||
| 1515 | Ga0207426_1046380 | |||
| 1516 | Ga0207697_10027198 | |||
| 1517 | Ga0207682_10003199 | |||
| 1518 | Ga0207682_10014389 | |||
| 1519 | Ga0207682_10072015 | |||
| 1520 | Ga0207692_10003985 | |||
| 1521 | Ga0207692_10010794 | |||
| 1522 | Ga0207692_10021013 | |||
| 1523 | Ga0207692_10085035 | |||
| 1524 | Ga0207692_10242300 | |||
| 1525 | Ga0207642_10012038 | |||
| 1526 | Ga0207642_10014784 | |||
| 1527 | Ga0207642_10028738 | |||
| 1528 | Ga0207642_10145727 | |||
| 1529 | Ga0207710_10034621 | |||
| 1530 | Ga0207710_10084977 | |||
| 1531 | Ga0207688_10002540 | |||
| 1532 | Ga0207688_10011975 | |||
| 1533 | Ga0207688_10016159 | |||
| 1534 | Ga0207688_10028038 | |||
| 1535 | Ga0207688_10057972 | |||
| 1536 | Ga0207647_10013439 | |||
| 1537 | Ga0207685_10077549 | |||
| 1538 | Ga0207699_10014440 | |||
| 1539 | Ga0207699_10019700 | |||
| 1540 | Ga0207645_10061779 | |||
| 1541 | Ga0207645_10184888 | |||
| 1542 | Ga0207643_10000967 | |||
| 1543 | Ga0207643_10033684 | |||
| 1544 | Ga0207643_10042084 | |||
| 1545 | Ga0207684_10003027 | |||
| 1546 | Ga0207684_10140872 | |||
| 1547 | Ga0207707_10193705 | |||
| 1548 | Ga0207671_10339045 | |||
| 1549 | Ga0207693_10004220 | |||
| 1550 | Ga0207693_10012252 | |||
| 1551 | Ga0207693_10097589 | |||
| 1552 | Ga0207693_10122885 | |||
| 1553 | Ga0207693_10172088 | |||
| 1554 | Ga0207663_10046299 | |||
| 1555 | Ga0207663_10057001 | |||
| 1556 | Ga0207663_10070614 | |||
| 1557 | Ga0207663_10093574 | |||
| 1558 | Ga0207663_10259595 | |||
| 1559 | Ga0207660_10099352 | |||
| 1560 | Ga0207660_10161018 | |||
| 1561 | Ga0207662_10011477 | |||
| 1562 | Ga0207662_10084162 | |||
| 1563 | Ga0207652_10260840 | |||
| 1564 | Ga0207646_10039144 | |||
| 1565 | Ga0207646_10269202 | |||
| 1566 | Ga0207681_10009139 | |||
| 1567 | Ga0207694_10257318 | |||
| 1568 | Ga0207694_10283753 | |||
| 1569 | Ga0207650_10053772 | |||
| 1570 | Ga0207650_10067708 | |||
| 1571 | Ga0207650_10142180 | |||
| 1572 | Ga0207659_10019858 | |||
| 1573 | Ga0207659_10058280 | |||
| 1574 | Ga0207659_10069639 | |||
| 1575 | Ga0207659_10124369 | |||
| 1576 | Ga0207659_10204227 | |||
| 1577 | Ga0207687_10026708 | |||
| 1578 | Ga0207687_10033406 | |||
| 1579 | Ga0207687_10132680 | |||
| 1580 | Ga0207700_10014481 | |||
| 1581 | Ga0207700_10052461 | |||
| 1582 | Ga0207700_10275010 | |||
| 1583 | Ga0207664_10021410 | |||
| 1584 | Ga0207664_10076975 | |||
| 1585 | Ga0207644_10025738 | |||
| 1586 | Ga0207706_10007796 | |||
| 1587 | Ga0207706_10011027 | |||
| 1588 | Ga0207706_10014313 | |||
| 1589 | Ga0207706_10033052 | |||
| 1590 | Ga0207706_10033732 | |||
| 1591 | Ga0207706_10043930 | |||
| 1592 | Ga0207686_10007031 | |||
| 1593 | Ga0207686_10079263 | |||
| 1594 | Ga0207709_10008517 | |||
| 1595 | Ga0207709_10009791 | |||
| 1596 | Ga0207709_10027652 | |||
| 1597 | Ga0207709_10035136 | |||
| 1598 | Ga0207709_10193804 | |||
| 1599 | Ga0207670_10019846 | |||
| 1600 | Ga0207670_10068147 | |||
| 1601 | Ga0207670_10192720 | |||
| 1602 | Ga0207669_10012290 | |||
| 1603 | Ga0207669_10013751 | |||
| 1604 | Ga0207669_10035536 | |||
| 1605 | Ga0207669_10074471 | |||
| 1606 | Ga0207704_10010940 | |||
| 1607 | Ga0207704_10022313 | |||
| 1608 | Ga0207665_10001994 | |||
| 1609 | Ga0207665_10054389 | |||
| 1610 | Ga0207665_10168927 | |||
| 1611 | Ga0207665_10263166 | |||
| 1612 | Ga0207691_10024270 | |||
| 1613 | Ga0207691_10050650 | |||
| 1614 | Ga0207691_10080508 | |||
| 1615 | Ga0207691_10125092 | |||
| 1616 | Ga0207691_10201093 | |||
| 1617 | Ga0207711_10008863 | |||
| 1618 | Ga0207711_10048377 | |||
| 1619 | Ga0207711_10153792 | |||
| 1620 | Ga0207711_10228374 | |||
| 1621 | Ga0207689_10012734 | |||
| 1622 | Ga0207689_10062666 | |||
| 1623 | Ga0207689_10227112 | |||
| 1624 | Ga0207689_10274304 | |||
| 1625 | Ga0207679_10019653 | |||
| 1626 | Ga0207679_10493858 | |||
| 1627 | Ga0207667_10093335 | |||
| 1628 | Ga0207667_10180699 | |||
| 1629 | Ga0207651_10019208 | |||
| 1630 | Ga0207651_10114348 | |||
| 1631 | Ga0207651_10144470 | |||
| 1632 | Ga0207651_10394920 | |||
| 1633 | Ga0207712_10015690 | |||
| 1634 | Ga0207712_10022315 | |||
| 1635 | Ga0207712_10026871 | |||
| 1636 | Ga0207712_10099491 | |||
| 1637 | Ga0207712_10275096 | |||
| 1638 | Ga0207668_10003464 | |||
| 1639 | Ga0207668_10069010 | |||
| 1640 | Ga0207640_10151858 | |||
| 1641 | Ga0207640_10235682 | |||
| 1642 | Ga0207677_10083341 | |||
| 1643 | Ga0207677_10184476 | |||
| 1644 | Ga0207703_10098000 | |||
| 1645 | Ga0207639_10054958 | |||
| 1646 | Ga0207639_10213818 | |||
| 1647 | Ga0207678_10010626 | |||
| 1648 | Ga0207678_10015172 | |||
| 1649 | Ga0207678_10038156 | |||
| 1650 | Ga0207678_10041400 | |||
| 1651 | Ga0207678_10093743 | |||
| 1652 | Ga0207678_10211721 | |||
| 1653 | Ga0207708_10001893 | |||
| 1654 | Ga0207708_10001982 | |||
| 1655 | Ga0207708_10021646 | |||
| 1656 | Ga0207708_10031086 | |||
| 1657 | Ga0207708_10034508 | |||
| 1658 | Ga0207708_10098027 | |||
| 1659 | Ga0207708_10105517 | |||
| 1660 | Ga0207702_10045702 | |||
| 1661 | Ga0207702_10260214 | |||
| 1662 | Ga0207702_10301905 | |||
| 1663 | Ga0207641_10008033 | |||
| 1664 | Ga0207641_10462747 | |||
| 1665 | Ga0207648_10000930 | |||
| 1666 | Ga0207648_10001640 | |||
| 1667 | Ga0207648_10005439 | |||
| 1668 | Ga0207648_10008314 | |||
| 1669 | Ga0207648_10053736 | |||
| 1670 | Ga0207648_10156449 | |||
| 1671 | Ga0207648_10191343 | |||
| 1672 | Ga0207676_10037062 | |||
| 1673 | Ga0207676_10094244 | |||
| 1674 | Ga0207676_10097222 | |||
| 1675 | Ga0207674_10077499 | |||
| 1676 | Ga0207674_10147936 | |||
| 1677 | Ga0207675_100003662 | |||
| 1678 | Ga0207675_100007548 | |||
| 1679 | Ga0207675_100023222 | |||
| 1680 | Ga0207675_100031749 | |||
| 1681 | Ga0207675_100159483 | |||
| 1682 | Ga0207675_100237983 | |||
| 1683 | Ga0207683_10006631 | |||
| 1684 | Ga0207683_10015287 | |||
| 1685 | Ga0207683_10024348 | |||
| 1686 | Ga0207683_10043509 | |||
| 1687 | Ga0207683_10044403 | |||
| 1688 | Ga0207683_10104176 | |||
| 1689 | Ga0207683_10236169 | |||
| 1690 | Ga0207683_10297025 | |||
| 1691 | Ga0207683_10303956 | |||
| 1692 | Ga0207698_10037686 | |||
| 1693 | Ga0207698_10060552 | |||
| 1694 | Ga0209179_1004682 | |||
| 1695 | Ga0209813_10000171 | |||
| 1696 | Ga0209813_10015289 | |||
| 1697 | Ga0209813_10029792 | |||
| 1698 | Ga0207428_10008060 | |||
| 1699 | Ga0207428_10018287 | |||
| 1700 | Ga0207428_10075460 | |||
| 1701 | Ga0207428_10120998 | |||
| 1702 | Ga0207428_10290521 | |||
| 1703 | Ga0268266_10001685 | |||
| 1704 | Ga0268266_10018266 | |||
| 1705 | Ga0268266_10045547 | |||
| 1706 | Ga0268266_10046622 | |||
| 1707 | Ga0268266_10046802 | |||
| 1708 | Ga0268265_10013298 | |||
| 1709 | Ga0268265_10014407 | |||
| 1710 | Ga0268265_10070907 | |||
| 1711 | Ga0268265_10089156 | |||
| 1712 | Ga0268265_10121974 | |||
| 1713 | Ga0268265_10139426 | |||
| 1714 | Ga0268264_10184569 | |||
| 1715 | Ga0268264_10197026 | |||
| 1716 | Ga0268264_10331799 | |||
| 1717 | Ga0268264_10419225 | |||
| 1718 | Ga0268264_10608294 | |||
| 1719 | Ga0265338_10120807 | |||
| 1720 | Ga0265330_10013169 | |||
| 1721 | Ga0265325_10000004 | |||
| 1722 | Ga0265325_10028878 | |||
| 1723 | Ga0265325_10075214 | |||
| 1724 | Ga0265329_10009404 | |||
| 1725 | Ga0265329_10046160 | |||
| 1726 | Ga0265340_10025003 | |||
| 1727 | Ga0265340_10050316 | |||
| 1728 | Ga0265340_10127286 | |||
| 1729 | Ga0265339_10173581 | |||
| 1730 | Ga0265331_10095816 | |||
| 1731 | Ga0265316_10021306 | |||
| 1732 | Ga0307509_10174846 | |||
| 1733 | Ga0265313_10020510 | |||
| 1734 | Ga0265313_10026917 | |||
| 1735 | Ga0265313_10110096 | |||
| 1736 | Ga0307508_10000557 | |||
| 1737 | Ga0265342_10067459 | |||
| 1738 | Ga0307516_10007912 | |||
| 1739 | Ga0307516_10182259 | |||
| 1740 | Ga0307507_10022361 | |||
| 1741 | Ga0307510_10006581 | |||
| 1742 | Ga0307510_10051168 | |||
| 1743 | Ga0373940_0005232 | |||
| 1744 | Ga0373944_0015814 | |||
| 1745 | Ga0373944_0024740 | |||
| 1746 | Ga0373932_0025073 | |||
| 1747 | Ga0373936_0059667 | |||
| 1748 | Ga0373936_0089062 | |||
| 1749 | Ga0373939_0031876 | |||
| 1750 | Ga0373945_0008749 | |||
| 1751 | Ga0373945_0078181 | |||
| 1752 | Ga0373953_0043926 | |||
| 1753 | Ga0373954_0007914 | |||
| 1754 | Ga0373954_0014684 | |||
| 1755 | Ga0373956_0015153 | |||
| 1756 | Ga0373943_0000789 | |||
| 1757 | Ga0373943_0023389 | |||
| 1758 | Ga0373943_0036254 | |||
| 1759 | Ga0373943_0170701 | |||
| 1760 | Ga0373946_0006277 | |||
| 1761 | Ga0373955_0002543 | |||
| 1762 | Ga0373955_0004726 | |||
| 1763 | Ga0373955_0009435 | |||
| 1764 | Ga0373955_0028671 | |||
| 1765 | Ga0373942_0008505 | |||
| 1766 | Ga0373942_0010104 | |||
| 1767 | Ga0373962_0028297 | |||
| 1768 | Ga0373924_0020264 | |||
| 1769 | Ga0373931_0000929 | |||
| 1770 | Ga0373931_0005106 | |||
| 1771 | Ga0373931_0051355 | |||
| 1772 | Ga0373935_0000272 | |||
| 1773 | Ga0373935_0023128 | |||
| 1774 | Ga0373935_0025862 | |||
| 1775 | Ga0373935_0034682 | |||
| 1776 | Ga0373935_0087425 | |||
| 1777 | Ga0373927_0000980 | |||
| 1778 | Ga0373927_0146535 | |||
| 1779 | Ga0373933_0000342 | |||
| 1780 | Ga0373933_0004825 | |||
| 1781 | Ga0373947_0000563 | |||
| 1782 | Ga0373947_0029410 | |||
| 1783 | Ga0373947_0090170 | |||
| 1784 | Ga0373947_0099913 | |||
| 1785 | Ga0373947_0166421 | |||
| 1786 | Ga0373937_0014119 | |||
| 1787 | Ga0373937_0015092 | |||
| 1788 | Ga0373937_0016767 | |||
| 1789 | Ga0373937_0017936 | |||
| 1790 | Ga0373937_0122423 | |||
| 1791 | Ga0373937_0192866 | |||
| 1792 | Ga0373925_0001601 | |||
| 1793 | Ga0373925_0030638 | |||
| 1794 | Ga0373925_0041679 | |||
| 1795 | Ga0373925_0062852 | |||
| 1796 | Ga0395898_0237820 | |||
| 1797 | Ga0395905_0249861 | |||
| 1798 | Ga0436365_0424004 | |||
| 1799 | Ga0436365_1317488 | |||
| 1800 | Ga0436361_0707516 | |||
| 1801 | Ga0439453_0001434 | |||
| 1802 | Ga0451853_3534647 | |||
| 1803 | Ga0439446_0019995 | |||
| 1804 | Ga0495617_042446 | |||
| 1805 | Ga0495617_065707 | |||
| 1806 | Ga0495592_0001183 | |||
| 1807 | Ga0495592_0147310 | |||
| 1808 | Ga0495603_0000766 | |||
| 1809 | Ga0495603_0013119 | |||
| 1810 | Ga0495603_0044959 | |||
| 1811 | Ga0495603_0053860 | |||
| 1812 | Ga0495603_0169289 | |||
| 1813 | Ga0495629_0000499 | |||
| 1814 | Ga0495629_0100280 | |||
| 1815 | Ga0495638_0030282 | |||
| 1816 | Ga0495641_0009138 | |||
| 1817 | Ga0495641_0016576 | |||
| 1818 | Ga0495641_0072960 | |||
| 1819 | Ga0495651_0012555 | |||
| 1820 | Ga0495651_0067206 | |||
| 1821 | Ga0495653_0009651 | |||
| 1822 | Ga0495653_0026510 | |||
| 1823 | Ga0495580_0001242 | |||
| 1824 | Ga0495582_0001185 | |||
| 1825 | Ga0495582_0169315 | |||
| 1826 | Ga0495639_0000003 | |||
| 1827 | Ga0495639_0075874 | |||
| 1828 | Ga0495662_0000185 | |||
| 1829 | Ga0495662_0026927 | |||
| 1830 | Ga0495662_0090295 | |||
| 1831 | Ga0495664_0001147 | |||
| 1832 | Ga0495664_0201651 | |||
| 1833 | Ga0495584_0033275 | |||
| 1834 | Ga0495584_0122167 | |||
| 1835 | Ga0495584_0190274 | |||
| 1836 | Ga0495585_0061619 | |||
| 1837 | Ga0495585_0098639 | |||
| 1838 | Ga0495585_0176257 | |||
| 1839 | Ga0495594_0001056 | |||
| 1840 | Ga0495594_0039434 | |||
| 1841 | Ga0495594_0106088 | |||
| 1842 | Ga0495596_0038744 | |||
| 1843 | Ga0495608_0005264 | |||
| 1844 | Ga0495616_0154308 | |||
| 1845 | Ga0495618_0013776 | |||
| 1846 | Ga0495618_0297408 | |||
| 1847 | Ga0495628_0001064 | |||
| 1848 | Ga0495628_0009740 | |||
| 1849 | Ga0495628_0074799 | |||
| 1850 | Ga0495628_0278393 | |||
| 1851 | Ga0495630_0000566 | |||
| 1852 | Ga0495630_0046821 | |||
| 1853 | Ga0495644_0038917 | |||
| 1854 | Ga0495644_0047264 | |||
| 1855 | Ga0495666_0143752 | |||
| 1856 | Ga0495652_0001634 | |||
| 1857 | Ga0495652_0014266 | |||
| 1858 | Ga0495652_0075353 | |||
| 1859 | Ga0495652_0124160 | |||
| 1860 | Ga0495654_0031846 | |||
| 1861 | Ga0495665_0000138 | |||
| 1862 | Ga0495640_0000274 | |||
| 1863 | Ga0495640_0009232 | |||
| 1864 | Ga0495640_0054421 | |||
| 1865 | Ga0495640_0092072 | |||
| 1866 | Ga0495640_0111493 | |||
| 1867 | Ga0495587_0030465 | |||
| 1868 | Ga0495587_0031234 | |||
| 1869 | Ga0495598_0023365 | |||
| 1870 | Ga0495598_0024329 | |||
| 1871 | Ga0495598_0032303 | |||
| 1872 | Ga0495598_0077165 | |||
| 1873 | Ga0495621_0019492 | |||
| 1874 | Ga0495597_0112379 | |||
| 1875 | Ga0495645_0000368 | |||
| 1876 | Ga0495645_0044172 | |||
| 1877 | Ga0495622_0005994 | |||
| 1878 | Ga0495622_0015157 | |||
| 1879 | Ga0495622_0084514 | |||
| 1880 | Ga0495633_0071844 | |||
| 1881 | Ga0495633_0102146 | |||
| 1882 | Ga0495667_0001463 | |||
| 1883 | Ga0495667_0005593 | |||
| 1884 | Ga0495667_0270296 | |||
| 1885 | Ga0495656_0008186 | |||
| 1886 | Ga0495656_0032309 | |||
| 1887 | Ga0495656_0075708 | |||
| 1888 | Ga0495656_0089444 | |||
| 1889 | Ga0495668_0021357 | |||
| 1890 | Ga0495668_0134706 | |||
| 1891 | Ga0495668_0177322 | |||
| 1892 | Ga0495634_0000360 | |||
| 1893 | Ga0495611_0120049 | |||
| 1894 | Ga0495625_0060466 | |||
| 1895 | Ga0495635_0005840 | |||
| 1896 | Ga0495635_0098331 | |||
| 1897 | Ga0495588_0003118 | |||
| 1898 | Ga0495588_0003814 | |||
| 1899 | Ga0495588_0041292 | |||
| 1900 | Ga0495588_0046322 | |||
| 1901 | Ga0495657_0004684 | |||
| 1902 | Ga0495657_0029673 | |||
| 1903 | Ga0495599_0003753 | |||
| 1904 | Ga0495599_0137722 | |||
| 1905 | Ga0495623_0001952 | |||
| 1906 | Ga0495623_0012684 | |||
| 1907 | Ga0495646_0025109 | |||
| 1908 | Ga0495646_0073236 | |||
| 1909 | Ga0495647_0032336 | |||
| 1910 | Ga0495658_0000136 | |||
| 1911 | Ga0495669_0030515 | |||
| 1912 | Ga0495669_0134625 | |||
| 1913 | Ga0495613_0056803 | |||
| 1914 | Ga0495613_0077761 | |||
| 1915 | Ga0495624_0047913 | |||
| 1916 | Ga0495624_0050434 | |||
| 1917 | Ga0495670_0065432 | |||
| 1918 | Ga0495670_0068531 | |||
| 1919 | Ga0495671_0107799 | |||
| 1920 | Ga0495649_0055083 | |||
| 1921 | Ga0495649_0101955 | |||
| 1922 | Ga0495589_0108656 | |||
| 1923 | Ga0495600_0003190 | |||
| 1924 | Ga0495600_0005894 | |||
| 1925 | Ga0495600_0039933 | |||
| 1926 | Ga0495600_0353871 | |||
| 1927 | Ga0495581_0000614 | |||
| 1928 | Ga0495604_0001623 | |||
| 1929 | Ga0495604_0003305 | |||
| 1930 | Ga0495604_0183999 | |||
| 1931 | Ga0495636_0035467 | |||
| 1932 | Ga0495674_0001053 | |||
| 1933 | Ga0495674_0266420 | |||
| 1934 | Ga0495676_0042243 | |||
| 1935 | Ga0495676_0148389 | |||
| 1936 | Ga0495676_0218563 | |||
| 1937 | Ga0495680_0001148 | |||
| 1938 | Ga0495680_0013379 | |||
| 1939 | Ga0495675_0055623 | |||
| 1940 | Ga0495675_0056778 | |||
| 1941 | Ga0495675_0252367 | |||
| 1942 | Ga0495677_0069961 | |||
| 1943 | Ga0495677_0138958 | |||
| 1944 | Ga0495679_047269 | |||
| 1945 | Ga0495684_0066616 | |||
| 1946 | Ga0495686_0054902 | |||
| 1947 | Ga0495686_0211866 | |||
| 1948 | Ga0495593_0000819 | |||
| 1949 | Ga0495602_0000791 | |||
| 1950 | Ga0495602_0007047 | |||
| 1951 | Ga0495614_0029765 | |||
| 1952 | Ga0496100_0019077 | |||
| 1953 | Ga0496100_0024781 | |||
| 1954 | Ga0496100_0138034 | |||
| 1955 | Ga0496100_0187172 | |||
| 1956 | Ga0496101_0002847 | |||
| 1957 | Ga0496101_0008762 | |||
| 1958 | Ga0496101_0118958 | |||
| 1959 | Ga0496101_0285406 | |||
| 1960 | Ga0496102_0007982 | |||
| 1961 | Ga0496102_0010414 | |||
| 1962 | Ga0496102_0130126 | |||
| 1963 | Ga0496102_0354937 | |||
| 1964 | Ga0496102_0415056 | |||
| 1965 | Ga0496103_0012799 | |||
| 1966 | Ga0496103_0034715 | |||
| 1967 | Ga0496103_0211699 | |||
| 1968 | Ga0496104_0000280 | |||
| 1969 | Ga0496104_0000524 | |||
| 1970 | Ga0496104_0011213 | |||
| 1971 | Ga0496104_0016202 | |||
| 1972 | Ga0496104_0033659 | |||
| 1973 | Ga0496104_0043242 | |||
| 1974 | Ga0496104_0112459 | |||
| 1975 | Ga0496104_0136405 | |||
| 1976 | Ga0496104_0213421 | |||
| 1977 | Ga0496105_0000835 | |||
| 1978 | Ga0496105_0004323 | |||
| 1979 | Ga0496105_0039502 | |||
| 1980 | Ga0496105_0048175 | |||
| 1981 | Ga0496105_0052634 | |||
| 1982 | Ga0496106_0008620 | |||
| 1983 | Ga0496106_0030643 | |||
| 1984 | Ga0496106_0060992 | |||
| 1985 | Ga0496106_0119844 | |||
| 1986 | Ga0496106_0142501 | |||
| 1987 | Ga0496106_0197782 | |||
| 1988 | Ga0496107_0038168 | |||
| 1989 | Ga0496107_0051888 | |||
| 1990 | Ga0496107_0071006 | |||
| 1991 | Ga0496107_0088952 | |||
| 1992 | Ga0496107_0233876 | |||
| 1993 | Ga0496107_0234676 | |||
| 1994 | Ga0496108_0002485 | |||
| 1995 | Ga0496108_0007938 | |||
| 1996 | Ga0496108_0009402 | |||
| 1997 | Ga0496108_0143504 | |||
| 1998 | Ga0496108_0158095 | |||
| 1999 | Ga0496108_0160355 | |||
| 2000 | Ga0496108_0185823 | |||
| 2001 | Ga0496109_0001072 | |||
| 2002 | Ga0496109_0004069 | |||
| 2003 | Ga0496109_0023447 | |||
| 2004 | Ga0496109_0230823 | |||
| 2005 | Ga0496109_0314536 | |||
| 2006 | Ga0496109_0349405 | |||
| 2007 | Ga0496110_0000570 | |||
| 2008 | Ga0496110_0015271 | |||
| 2009 | Ga0496110_0032674 | |||
| 2010 | Ga0496110_0233555 | |||
| 2011 | Ga0496110_0282296 | |||
| 2012 | Ga0496111_0001744 | |||
| 2013 | Ga0496111_0030148 | |||
| 2014 | Ga0496111_0042471 | |||
| 2015 | Ga0496111_0066849 | |||
| 2016 | Ga0496111_0068204 | |||
| 2017 | Ga0496111_0106349 | |||
| 2018 | Ga0496112_0005539 | |||
| 2019 | Ga0496112_0005780 | |||
| 2020 | Ga0496112_0057633 | |||
| 2021 | Ga0496112_0079356 | |||
| 2022 | Ga0496112_0086196 | |||
| 2023 | Ga0496112_0216385 | |||
| 2024 | Ga0496112_0226696 | |||
| 2025 | Ga0496113_0021882 | |||
| 2026 | Ga0496113_0024976 | |||
| 2027 | Ga0496113_0025168 | |||
| 2028 | Ga0496113_0049941 | |||
| 2029 | Ga0496113_0106077 | |||
| 2030 | Ga0496113_0194707 | |||
| 2031 | Ga0496113_0242570 | |||
| 2032 | Ga0496113_0291594 | |||
| 2033 | Ga0496114_0014562 | |||
| 2034 | Ga0496114_0025784 | |||
| 2035 | Ga0496114_0030671 | |||
| 2036 | Ga0496114_0101752 | |||
| 2037 | Ga0496114_0106374 | |||
| 2038 | Ga0496114_0195337 | |||
| 2039 | Ga0496114_0497721 | |||
| 2040 | Ga0496115_0009034 | |||
| 2041 | Ga0496115_0034492 | |||
| 2042 | Ga0496115_0060227 | |||
| 2043 | Ga0496115_0062323 | |||
| 2044 | Ga0496115_0090382 | |||
| 2045 | Ga0496115_0105997 | |||
| 2046 | Ga0496115_0182700 | |||
| 2047 | Ga0496116_0141584 | |||
| 2048 | Ga0496117_0099206 | |||
| 2049 | Ga0496118_0005620 | |||
| 2050 | Ga0496121_0003623 | |||
| 2051 | Ga0496124_0002607 | |||
| 2052 | Ga0496125_0058423 | |||
| 2053 | Ga0496126_0004495 | |||
| 2054 | Ga0496126_0024524 | |||
| 2055 | Ga0501031_0060675 | |||
| 2056 | Ga0501038_0030200 | |||
| 2057 | Ga0501038_0411238 | |||
| 2058 | Ga0501039_0030686 | |||
| 2059 | Ga0501040_0116731 | |||
| 2060 | Ga0501043_0271010 | |||
| 2061 | Ga0501048_0349747 | |||
| 2062 | Ga0501068_0057486 | |||
| 2063 | Ga0501068_0096020 | |||
| 2064 | Ga0501069_0048387 | |||
| 2065 | Ga0501070_0172743 | |||
| 2066 | Ga0501071_0088048 | |||
| 2067 | Ga0501072_0005974 | |||
| 2068 | Ga0501072_0045450 | |||
| 2069 | Ga0501074_0364669 | |||
| 2070 | Ga0501075_0150910 | |||
| 2071 | Ga0501075_0328081 | |||
| 2072 | Ga0501076_0026966 | |||
| 2073 | Ga0501076_0117799 | |||
| 2074 | Ga0501076_0156766 | |||
| 2075 | Ga0501080_0029336 | |||
| 2076 | Ga0501080_0292529 | |||
| 2077 | Ga0501081_0133096 | |||
| 2078 | Ga0501035_0037084 | |||
| 2079 | Ga0501044_0010126 | |||
| 2080 | Ga0501045_0257373 | |||
| 2081 | nmdc:mga03683_1400_c1 | |||
| 2082 | nmdc:mga03683_48740_c1 | |||
| 2083 | nmdc:mga03n38_107706_c1 | |||
| 2084 | nmdc:mga03n38_3003_c1 | |||
| 2085 | nmdc:mga00v17_237648_c1 | |||
| 2086 | nmdc:mga00v17_68044_c1 | |||
| 2087 | nmdc:mga0yw44_119190_c1 | |||
| 2088 | nmdc:mga0yw44_157697_c1 | |||
| 2089 | nmdc:mga0yw44_172202_c1 | |||
| 2090 | nmdc:mga0yw44_281628_c1 | |||
| 2091 | nmdc:mga0yw44_34681_c1 | |||
| 2092 | nmdc:mga0yw44_35615_c1 | |||
| 2093 | nmdc:mga0yw44_48639_c1 | |||
| 2094 | nmdc:mga0yw44_6629_c1 | |||
| 2095 | nmdc:mga0yw44_8711_c1 | |||
| 2096 | nmdc:mga0yw44_9174_c1 | |||
| 2097 | nmdc:mga0k408_28510_c1 | |||
| 2098 | nmdc:mga0k408_69721_c1 | |||
| 2099 | nmdc:mga06z11_17762_c1 | |||
| 2100 | nmdc:mga06z11_187542_c1 | |||
| 2101 | nmdc:mga06z11_30638_c1 | |||
| 2102 | nmdc:mga06z11_35179_c1 | |||
| 2103 | nmdc:mga06z11_42150_c1 | |||
| 2104 | nmdc:mga06z11_46444_c1 | |||
| 2105 | nmdc:mga06z11_484_c1 | |||
| 2106 | nmdc:mga06z11_51745_c1 | |||
| 2107 | nmdc:mga06z11_79408_c1 | |||
| 2108 | nmdc:mga04h51_2413_c1 | |||
| 2109 | nmdc:mga04h51_28088_c1 | |||
| 2110 | nmdc:mga04h51_3408_c1 | |||
| 2111 | nmdc:mga07m45_117980_c1 | |||
| 2112 | nmdc:mga07m45_32693_c1 | |||
| 2113 | nmdc:mga05p37_151234_c1 | |||
| 2114 | nmdc:mga05p37_268074_c1 | |||
| 2115 | nmdc:mga05p37_299254_c1 | |||
| 2116 | nmdc:mga05p37_498971_c1 | |||
| 2117 | nmdc:mga05p37_52_c1 | |||
| 2118 | nmdc:mga05p37_57225_c1 | |||
| 2119 | nmdc:mga05p37_60269_c1 | |||
| 2120 | nmdc:mga05p37_655533_c1 | |||
| 2121 | nmdc:mga05p37_94209_c1 | |||
| 2122 | nmdc:mga05p37_98281_c1 | |||
| 2123 | nmdc:mga09592_126_c2 | |||
| 2124 | nmdc:mga09592_159889_c1 | |||
| 2125 | nmdc:mga09592_230200_c1 | |||
| 2126 | nmdc:mga09592_255929_c1 | |||
| 2127 | nmdc:mga09592_5425_c1 | |||
| 2128 | nmdc:mga09592_73456_c1 | |||
| 2129 | nmdc:mga0qj67_19482_c1 | |||
| 2130 | nmdc:mga0qj67_19920_c1 | |||
| 2131 | nmdc:mga0qj67_21393_c1 | |||
| 2132 | nmdc:mga0qj67_297718_c1 | |||
| 2133 | nmdc:mga0qj67_332365_c1 | |||
| 2134 | nmdc:mga0qj67_47_c1 | |||
| 2135 | nmdc:mga06r32_274569_c1 | |||
| 2136 | nmdc:mga06r32_299694_c1 | |||
| 2137 | nmdc:mga06r32_299709_c1 | |||
| 2138 | nmdc:mga06r32_299934_c1 | |||
| 2139 | nmdc:mga06r32_35443_c2 | |||
| 2140 | nmdc:mga06r32_387919_c1 | |||
| 2141 | nmdc:mga06r32_4_c1 | |||
| 2142 | nmdc:mga06r32_507974_c1 | |||
| 2143 | nmdc:mga06r32_57624_c1 | |||
| 2144 | nmdc:mga06r32_62018_c1 | |||
| 2145 | nmdc:mga08y16_140765_c1 | |||
| 2146 | nmdc:mga08y16_17963_c1 | |||
| 2147 | nmdc:mga08y16_2104_c1 | |||
| 2148 | nmdc:mga0n895_121556_c1 | |||
| 2149 | nmdc:mga0n895_13734_c1 | |||
| 2150 | nmdc:mga0n895_142005_c1 | |||
| 2151 | nmdc:mga0n895_151376_c1 | |||
| 2152 | nmdc:mga0n895_229499_c1 | |||
| 2153 | nmdc:mga0rr50_13041_c1 | |||
| 2154 | nmdc:mga0rr50_200654_c1 | |||
| 2155 | nmdc:mga0rr50_3169_c1 | |||
| 2156 | nmdc:mga08x19_161341_c1 | |||
| 2157 | nmdc:mga08x19_30895_c1 | |||
| 2158 | nmdc:mga0a205_210960_c1 | |||
| 2159 | nmdc:mga0a205_360096_c1 | |||
| 2160 | nmdc:mga0sz30_7423_c1 | |||
| 2161 | Ga0495601_0000152 | |||
| 2162 | Ga0495601_0011509 | |||
| 2163 | Ga0495601_0049432 | |||
| 2164 | Ga0495601_0273049 | |||
| 2165 | Ga0495601_0290689 | |||
| 2166 | Ga0495612_0000244 | |||
| 2167 | Ga0495612_0010585 | |||
| 2168 | Ga0500635_0009055 | |||
| 2169 | Ga0495655_0062184 | |||
| 2170 | Ga0495595_0000630 | |||
| 2171 | Ga0495595_0000791 | |||
| 2172 | Ga0495595_0002676 | |||
| 2173 | Ga0495595_0009750 | |||
| 2174 | Ga0495619_0000115 | |||
| 2175 | Ga0495619_0002237 | |||
| 2176 | Ga0495619_0008613 | |||
| 2177 | Ga0495619_0027135 | |||
| 2178 | Ga0495619_0085216 | |||
| 2179 | Ga0500644_0018798 | |||
| 2180 | Ga0500583_0074743 | |||
| 2181 | Ga0500566_0000012 | |||
| 2182 | Ga0500640_003280 | |||
| 2183 | Ga0500562_014828 | |||
| 2184 | Ga0500572_001242 | |||
| 2185 | Ga0500595_000859 | |||
| 2186 | Ga0500595_070702 | |||
| 2187 | Ga0500614_001494 | |||
| 2188 | Ga0500559_0005620 | |||
| 2189 | Ga0500568_0052787 | |||
| 2190 | Ga0500603_000575 | |||
| 2191 | Ga0500603_000585 | |||
| 2192 | Ga0500616_0005716 | |||
| 2193 | Ga0500630_001334 | |||
| 2194 | Ga0500634_0051253 | |||
| 2195 | Ga0500638_054741 | |||
| 2196 | Ga0500639_000095 | |||
| 2197 | Ga0500639_098922 | |||
| 2198 | Ga0500636_0133044 | |||
| 2199 | Ga0500637_0115947 | |||
| 2200 | Ga0500609_004628 | |||
| 2201 | Ga0500596_000600 | |||
| 2202 | Ga0500596_008690 | |||
| 2203 | Ga0501084_0031511 | |||
| 2204 | Ga0501084_0061580 | |||
| 2205 | Ga0501084_0480948 | |||
| 2206 | Ga0590077_006676 | |||
| 2207 | Ga0501082_0000264 | |||
| 2208 | Ga0501082_0106658 | |||
| 2209 | Ga0501082_0270207 | |||
| 2210 | Ga0530510_0076444 | |||
| 2211 | Ga0530510_0132768 | |||
| 2212 | 2513693094 | |||
| 2213 | 2793080737 | |||
| 2214 | 2854899012 | |||
| 2215 | 2876816068 | |||
| 2216 | 2879110842 | |||
| 2217 | 2883580517 | |||
| 2218 | 2889037590 | |||
| 2219 | 8006985075 | |||
| 2220 | 8056677585 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6hke-assembly1.cif.gz_A | matc (rpa3494) from rhodopseudomonas palustris with bound malate | 0.9654 | 29 | 320 |
| 2f5x-assembly3.cif.gz_C | structure of periplasmic binding protein bugd | 0.9639 | 29 | 325 |
| 2dvz-assembly1.cif.gz_A | structure of a periplasmic transporter | 0.9577 | 29 | 328 |
| 8hkb-assembly1.cif.gz_A | tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d | 0.9558 | 32 | 325 |
| 6hke-assembly1.cif.gz_A | matc (rpa3494) from rhodopseudomonas palustris with bound malate | 0.9558 | 29 | 320 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6hkeC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9674 | 128 | 250 | 3.40.190.10 |
| 6hkeC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9523 | 128 | 250 | 3.40.190.10 |
| 4x9tA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9406 | 128 | 250 | 3.40.190.10 |
| 2f5xC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9376 | 130 | 250 | 3.40.190.10 |
| 4x9tA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9333 | 128 | 250 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A327KHH5-F1-model_v4 | ABC transporter substrate-binding protein | 0.9676 | 19 | 328 |
|
| AF-A0A1F4CWQ1-F1-model_v4 | LacI family transcriptional regulator | 0.9664 | 22 | 324 |
|
| AF-A0A7C2YWG0-F1-model_v4 | Tripartite tricarboxylate transporter substrate binding protein | 0.9661 | 19 | 325 |
|
| AF-A0A1J5PQ67-F1-model_v4 | Tripartite tricarboxylate transporter family receptor | 0.9659 | 72 | 319 |
|
| AF-A0A1H8YFB1-F1-model_v4 | Tripartite-type tricarboxylate transporter, receptor component TctC | 0.9633 | 19 | 324 |
|