F490218
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1110 | 532 | 2220 | 211 |
Family's Representative Sequence
| Representative Sequence | 3300037471|Ga0395905_0181414|Ga0395905_0181414_159_854 |
| Length | 231 |
| Sequence | MTSDHELDAGLETAAPVWAAFADLMSGLLGAFVLILVCVIGMQLELAQKLEQEVHQREAAEQRQHALEQALAGPLAAGRVTLRDGRIGISGSVLFSFASADLQPEGRQLLRSLAAPLAAYLRTRDEALMVSGFTDDRQVRGGSQKFADNWELSAQRALTVTRALVEEGLPADAVFAAAFGAQQPVASNADAEGRARNRRVEMAPMPRVARTTGAASAPATSPAMATAASAP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 6 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 7 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 8 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 9 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 10 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 11 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 12 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 13 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 16 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 23 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 24 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 26 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 27 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 28 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 30 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 31 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 32 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 33 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 34 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 35 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 45 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 60 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 61 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 62 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 63 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 64 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 65 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 66 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 67 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 70 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 71 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 83 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 91 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 92 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 93 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 94 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 95 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 96 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 99 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 108 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 111 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 112 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 114 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 116 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 118 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 156 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 160 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 161 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 162 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 163 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 164 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 165 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 166 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 167 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 168 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 169 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 170 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 171 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 172 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 173 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 174 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 175 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 176 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 177 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 178 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 179 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 180 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 181 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 182 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 183 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 184 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 185 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 186 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 187 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 188 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 189 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 190 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 191 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 192 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 193 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 194 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 195 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 196 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 197 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 198 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 199 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 200 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 201 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 202 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 203 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 204 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 205 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 206 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 207 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 208 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 209 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 210 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 211 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 212 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 213 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 214 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 215 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 216 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 217 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 218 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 219 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 220 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 221 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 222 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 223 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 224 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 225 | 3300044650 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E | Metagenome | Unclassified |
| 226 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 227 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 228 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 229 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 230 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 231 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 232 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 233 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 234 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 235 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 236 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 237 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 238 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 239 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 240 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 241 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 242 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 243 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 331 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 332 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 333 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 334 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 335 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 336 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 337 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 338 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 340 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 341 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 342 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 343 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 344 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 345 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 346 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 347 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 348 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 349 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 350 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 351 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 352 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 353 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 354 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 355 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 356 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 357 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 361 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 362 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 364 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 365 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 366 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 367 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 368 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 369 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 370 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 371 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 372 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 373 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 374 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 375 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 376 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 377 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 378 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 379 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 380 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 381 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 382 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 383 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 384 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 385 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 386 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 387 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 388 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 389 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 390 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 391 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 392 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 393 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 394 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 395 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 396 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 397 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 398 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 399 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 400 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 401 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 402 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 403 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 404 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 405 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 406 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 407 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 408 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 409 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 410 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 411 | 2526164512 | Azovibrio restrictus DSM 23866 | Isolate | Unclassified |
| 412 | 2547132130 | Stenotrophomonas maltophilia RR-10 | Isolate | Unclassified |
| 413 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 414 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 415 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 416 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 417 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 418 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 419 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 420 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 421 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 422 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 423 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 424 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 425 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 426 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 427 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 428 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 429 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 430 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 431 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 432 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 433 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 434 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 435 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 436 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 437 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 438 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 439 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 440 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 441 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 442 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 443 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 444 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 445 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 446 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 447 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 448 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 449 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 450 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 451 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 452 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 453 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 454 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 455 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 456 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 457 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 458 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 459 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 460 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 461 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 462 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 463 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 464 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 465 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 466 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 467 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 468 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 469 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 470 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 471 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 472 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 473 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 474 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 475 | 2901300506 | Cupriavidus sp. UYMSc13B | Isolate | Unclassified |
| 476 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 477 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 478 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 479 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 480 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 481 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 482 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 483 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 484 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 485 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 486 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 487 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 488 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 489 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 490 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 491 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 492 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 493 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 494 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 495 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 496 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 497 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 498 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 499 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 500 | 2931380184 | Stenotrophomonas sp. DR822 | Isolate | Rhizosphere |
| 501 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 502 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 503 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 504 | 2941479691 | |||
| 505 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 506 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 507 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 508 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 509 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 510 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 511 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 512 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 513 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 514 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 515 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 516 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 517 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 518 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 519 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 520 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 521 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 522 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 523 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 524 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 525 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 526 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 527 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 528 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 529 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 530 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 531 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 532 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.12 |
| Metatranscriptomes | 0.27 |
| Isolates | 12.61 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.09 |
| Bulb | 0 |
| Endosphere | 19.01 |
| Nodule | 2.16 |
| Rhizoplane | 3.96 |
| Rhizosphere | 57.93 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0395905_0181414 | 3300037471 | Bacteria | 1976 |
| 2 | JGI24740J21852_10000188 | 3300001979 | Bacteria | 25268 |
| 3 | JGI24740J21852_10031126 | 3300001979 | Bacteria | 1726 |
| 4 | JGI24739J22299_10006875 | 3300001989 | Bacteria | 4285 |
| 5 | JGI24739J22299_10027695 | 3300001989 | Bacteria | 1979 |
| 6 | JGI24735J21928_10000295 | 3300002067 | Bacteria | 17380 |
| 7 | JGI24735J21928_10002557 | 3300002067 | Bacteria | 6295 |
| 8 | JGI24735J21928_10025903 | 3300002067 | Bacteria | 1768 |
| 9 | JGI24735J21928_10041993 | 3300002067 | Bacteria | 1332 |
| 10 | JGI24735J21928_10062451 | 3300002067 | Bacteria | 1070 |
| 11 | JGI24738J21930_10001725 | 3300002075 | Bacteria | 5979 |
| 12 | JGI25154J39366_1001255 | 3300002738 | Bacteria | 9529 |
| 13 | JGI25152J39213_1024242 | 3300002773 | Bacteria | 1021 |
| 14 | JGI25151J46595_10000304 | 3300003187 | Bacteria | 53759 |
| 15 | JGI25151J46595_10002852 | 3300003187 | Bacteria | 9943 |
| 16 | JGI25165J46597_1001102 | 3300003214 | Bacteria | 17203 |
| 17 | rootH2_10000556 | 3300003320 | Bacteria | 17866 |
| 18 | JGI25160J50197_1000037 | 3300003354 | Bacteria | 162757 |
| 19 | Ga0006562J51391_1170292 | 3300003578 | Bacteria | 3082 |
| 20 | Ga0055538_1001884 | 3300003751 | Bacteria | 3512 |
| 21 | Ga0055538_1002979 | 3300003751 | Bacteria | 2276 |
| 22 | Ga0055539_1000086 | 3300003752 | Bacteria | 117621 |
| 23 | Ga0055533_1000184 | 3300003756 | Bacteria | 52247 |
| 24 | Ga0055533_1002302 | 3300003756 | Bacteria | 4415 |
| 25 | Ga0055533_1003066 | 3300003756 | Bacteria | 3533 |
| 26 | Ga0055533_1003087 | 3300003756 | Bacteria | 3512 |
| 27 | Ga0055532_1000007 | 3300003758 | Bacteria | 429810 |
| 28 | Ga0055532_1000041 | 3300003758 | Bacteria | 195749 |
| 29 | Ga0055532_1000963 | 3300003758 | Bacteria | 9221 |
| 30 | Ga0055525_1000469 | 3300003759 | Bacteria | 22391 |
| 31 | Ga0055527_1000007 | 3300003760 | Bacteria | 429810 |
| 32 | Ga0055527_1000191 | 3300003760 | Bacteria | 40814 |
| 33 | Ga0055527_1000672 | 3300003760 | Bacteria | 10241 |
| 34 | Ga0055535_1000005 | 3300003761 | Bacteria | 429810 |
| 35 | Ga0055535_1000030 | 3300003761 | Bacteria | 195749 |
| 36 | Ga0055535_1000399 | 3300003761 | Bacteria | 40814 |
| 37 | Ga0055535_1002045 | 3300003761 | Bacteria | 8157 |
| 38 | Ga0055542_1000008 | 3300003762 | Bacteria | 429810 |
| 39 | Ga0055542_1001050 | 3300003762 | Bacteria | 17159 |
| 40 | Ga0055542_1001927 | 3300003762 | Bacteria | 8157 |
| 41 | Ga0055542_1004466 | 3300003762 | Bacteria | 3392 |
| 42 | Ga0055529_1000005 | 3300003763 | Bacteria | 429810 |
| 43 | Ga0055529_1000058 | 3300003763 | Bacteria | 195735 |
| 44 | Ga0055529_1001344 | 3300003763 | Bacteria | 8157 |
| 45 | Ga0055529_1011975 | 3300003763 | Bacteria | 1113 |
| 46 | Ga0055526_1000973 | 3300003771 | Bacteria | 21094 |
| 47 | Ga0055526_1007037 | 3300003771 | Bacteria | 5950 |
| 48 | Ga0055526_1020666 | 3300003771 | Bacteria | 2328 |
| 49 | Ga0055537_1000168 | 3300003773 | Bacteria | 48729 |
| 50 | Ga0055537_1000700 | 3300003773 | Bacteria | 17458 |
| 51 | Ga0055524_1006063 | 3300003775 | Bacteria | 5297 |
| 52 | Ga0055524_1025073 | 3300003775 | Bacteria | 1874 |
| 53 | Ga0055536_1000124 | 3300003781 | Bacteria | 66148 |
| 54 | Ga0055536_1000359 | 3300003781 | Bacteria | 33868 |
| 55 | Ga0055536_1001816 | 3300003781 | Bacteria | 12517 |
| 56 | Ga0055534_1000024 | 3300003784 | Bacteria | 131674 |
| 57 | Ga0055534_1000115 | 3300003784 | Bacteria | 59000 |
| 58 | Ga0055534_1000953 | 3300003784 | Bacteria | 12859 |
| 59 | Ga0055534_1032382 | 3300003784 | Bacteria | 800 |
| 60 | Ga0055528_1000348 | 3300003790 | Bacteria | 38126 |
| 61 | Ga0055528_1000446 | 3300003790 | Bacteria | 33063 |
| 62 | Ga0055530_10000021 | 3300003791 | Bacteria | 139383 |
| 63 | Ga0055530_10000323 | 3300003791 | Bacteria | 43172 |
| 64 | Ga0055530_10023750 | 3300003791 | Bacteria | 1754 |
| 65 | Ga0055540_1000408 | 3300003792 | Bacteria | 34822 |
| 66 | Ga0055540_1000433 | 3300003792 | Bacteria | 33202 |
| 67 | Ga0055540_1056699 | 3300003792 | Bacteria | 793 |
| 68 | Ga0055531_10013971 | 3300003794 | Bacteria | 3657 |
| 69 | Ga0055531_10041144 | 3300003794 | Bacteria | 1343 |
| 70 | Ga0055541_1007307 | 3300003841 | Bacteria | 1826 |
| 71 | Ga0058692_1000009 | 3300003856 | Bacteria | 349545 |
| 72 | Ga0058692_1002370 | 3300003856 | Bacteria | 6335 |
| 73 | Ga0058692_1041772 | 3300003856 | Bacteria | 801 |
| 74 | Ga0065165_1000629 | 3300005262 | Bacteria | 51217 |
| 75 | Ga0065165_1048682 | 3300005262 | Bacteria | 1216 |
| 76 | Ga0065714_10002862 | 3300005288 | Bacteria | 13067 |
| 77 | Ga0070658_10003973 | 3300005327 | Bacteria | 12118 |
| 78 | Ga0070658_10031180 | 3300005327 | Bacteria | 4281 |
| 79 | Ga0070658_10091806 | 3300005327 | Bacteria | 2503 |
| 80 | Ga0070658_10106600 | 3300005327 | Bacteria | 2319 |
| 81 | Ga0070676_10243199 | 3300005328 | Bacteria | 1198 |
| 82 | Ga0070670_100591915 | 3300005331 | Bacteria | 992 |
| 83 | Ga0070666_10200256 | 3300005335 | Bacteria | 1405 |
| 84 | Ga0070682_100165642 | 3300005337 | Bacteria | 1531 |
| 85 | Ga0070660_100000833 | 3300005339 | Bacteria | 20503 |
| 86 | Ga0070660_100006982 | 3300005339 | Bacteria | 7835 |
| 87 | Ga0070661_100000267 | 3300005344 | Bacteria | 42321 |
| 88 | Ga0070661_100340545 | 3300005344 | Bacteria | 1175 |
| 89 | Ga0070669_100029840 | 3300005353 | Bacteria | 3934 |
| 90 | Ga0070675_100416940 | 3300005354 | Bacteria | 1200 |
| 91 | Ga0070675_100848805 | 3300005354 | Bacteria | 836 |
| 92 | Ga0070688_100699863 | 3300005365 | Bacteria | 785 |
| 93 | Ga0070659_100000858 | 3300005366 | Bacteria | 22204 |
| 94 | Ga0070659_100001606 | 3300005366 | Bacteria | 16262 |
| 95 | Ga0070659_100318973 | 3300005366 | Bacteria | 1299 |
| 96 | Ga0070667_100572864 | 3300005367 | Bacteria | 1039 |
| 97 | Ga0070663_100000082 | 3300005455 | Bacteria | 42321 |
| 98 | Ga0070663_100001523 | 3300005455 | Bacteria | 12744 |
| 99 | Ga0070663_100272935 | 3300005455 | Bacteria | 1345 |
| 100 | Ga0070678_100198690 | 3300005456 | Bacteria | 1654 |
| 101 | Ga0070678_100671587 | 3300005456 | Bacteria | 931 |
| 102 | Ga0070684_100509692 | 3300005535 | Bacteria | 1115 |
| 103 | Ga0070672_100159122 | 3300005543 | Bacteria | 1872 |
| 104 | Ga0070665_100006462 | 3300005548 | Bacteria | 11931 |
| 105 | Ga0070665_100039729 | 3300005548 | Bacteria | 4730 |
| 106 | Ga0068855_100013980 | 3300005563 | Bacteria | 9677 |
| 107 | Ga0068855_100026993 | 3300005563 | Bacteria | 6871 |
| 108 | Ga0070664_100000274 | 3300005564 | Bacteria | 37138 |
| 109 | Ga0070664_100001095 | 3300005564 | Bacteria | 21389 |
| 110 | Ga0068854_100000341 | 3300005578 | Bacteria | 30099 |
| 111 | Ga0068856_100000527 | 3300005614 | Bacteria | 42321 |
| 112 | Ga0068856_100326522 | 3300005614 | Bacteria | 1552 |
| 113 | Ga0068856_100336448 | 3300005614 | Bacteria | 1528 |
| 114 | Ga0068852_100028158 | 3300005616 | Bacteria | 4594 |
| 115 | Ga0068852_100145810 | 3300005616 | Bacteria | 2196 |
| 116 | Ga0068852_100747715 | 3300005616 | Bacteria | 990 |
| 117 | Ga0068863_100575787 | 3300005841 | Bacteria | 1113 |
| 118 | Ga0068858_100492169 | 3300005842 | Bacteria | 1184 |
| 119 | Ga0075365_10022502 | 3300006038 | Bacteria | 3950 |
| 120 | Ga0075368_10184634 | 3300006042 | Bacteria | 880 |
| 121 | Ga0075363_100032856 | 3300006048 | Bacteria | 2698 |
| 122 | Ga0075363_100038398 | 3300006048 | Bacteria | 2518 |
| 123 | Ga0075363_100356827 | 3300006048 | Bacteria | 854 |
| 124 | Ga0075364_10022213 | 3300006051 | Bacteria | 4004 |
| 125 | Ga0075364_10059507 | 3300006051 | Bacteria | 2504 |
| 126 | Ga0075364_10080560 | 3300006051 | Bacteria | 2152 |
| 127 | Ga0075432_10006369 | 3300006058 | Bacteria | 4015 |
| 128 | Ga0075362_10003585 | 3300006177 | Bacteria | 5454 |
| 129 | Ga0075362_10109344 | 3300006177 | Bacteria | 1300 |
| 130 | Ga0075367_10052865 | 3300006178 | Bacteria | 2406 |
| 131 | Ga0075367_10054619 | 3300006178 | Bacteria | 2369 |
| 132 | Ga0075367_10077115 | 3300006178 | Bacteria | 2012 |
| 133 | Ga0075367_10231183 | 3300006178 | Bacteria | 1158 |
| 134 | Ga0075369_10040530 | 3300006186 | Bacteria | 1991 |
| 135 | Ga0075366_10004632 | 3300006195 | Bacteria | 7392 |
| 136 | Ga0075366_10016205 | 3300006195 | Bacteria | 4282 |
| 137 | Ga0097621_100630353 | 3300006237 | Bacteria | 982 |
| 138 | Ga0075370_10000045 | 3300006353 | Bacteria | 37777 |
| 139 | Ga0075370_10016917 | 3300006353 | Bacteria | 3932 |
| 140 | Ga0075370_10101048 | 3300006353 | Bacteria | 1669 |
| 141 | Ga0099826_10000132 | 3300006948 | Bacteria | 31946 |
| 142 | Ga0099826_10066190 | 3300006948 | Bacteria | 2319 |
| 143 | Ga0105251_10000085 | 3300009011 | Bacteria | 89249 |
| 144 | Ga0105251_10000195 | 3300009011 | Bacteria | 61183 |
| 145 | Ga0105251_10013696 | 3300009011 | Bacteria | 4523 |
| 146 | Ga0105251_10075319 | 3300009011 | Bacteria | 1567 |
| 147 | Ga0105244_10047560 | 3300009036 | Bacteria | 2199 |
| 148 | Ga0105250_10102813 | 3300009092 | Bacteria | 1167 |
| 149 | Ga0105240_10001007 | 3300009093 | Bacteria | 50237 |
| 150 | Ga0105240_10002439 | 3300009093 | Bacteria | 29909 |
| 151 | Ga0105240_10018449 | 3300009093 | Bacteria | 9368 |
| 152 | Ga0105240_10094053 | 3300009093 | Bacteria | 3657 |
| 153 | Ga0105240_10121379 | 3300009093 | Bacteria | 3146 |
| 154 | Ga0105240_10467877 | 3300009093 | Bacteria | 1407 |
| 155 | Ga0105243_10008382 | 3300009148 | Bacteria | 7932 |
| 156 | Ga0105243_10010744 | 3300009148 | Bacteria | 6936 |
| 157 | Ga0105243_10211677 | 3300009148 | Bacteria | 1707 |
| 158 | Ga0105243_10333283 | 3300009148 | Bacteria | 1387 |
| 159 | Ga0105241_10226142 | 3300009174 | Bacteria | 1575 |
| 160 | Ga0105241_10421667 | 3300009174 | Bacteria | 1175 |
| 161 | Ga0105237_10013644 | 3300009545 | Bacteria | 8509 |
| 162 | Ga0105237_10028203 | 3300009545 | Bacteria | 5721 |
| 163 | Ga0105237_10097247 | 3300009545 | Bacteria | 2934 |
| 164 | Ga0105238_10024279 | 3300009551 | Bacteria | 6179 |
| 165 | Ga0105238_10070687 | 3300009551 | Bacteria | 3489 |
| 166 | Ga0105238_10112683 | 3300009551 | Bacteria | 2700 |
| 167 | Ga0105249_10882111 | 3300009553 | Bacteria | 961 |
| 168 | Ga0105239_10002601 | 3300010375 | Bacteria | 22839 |
| 169 | Ga0105239_10048975 | 3300010375 | Bacteria | 4633 |
| 170 | Ga0105239_10617946 | 3300010375 | Bacteria | 1236 |
| 171 | Ga0105246_10195551 | 3300011119 | Bacteria | 1568 |
| 172 | Ga0157327_1020166 | 3300012512 | Bacteria | 744 |
| 173 | Ga0157373_10035498 | 3300013100 | Bacteria | 3579 |
| 174 | Ga0157373_10036300 | 3300013100 | Bacteria | 3538 |
| 175 | Ga0157373_10051805 | 3300013100 | Bacteria | 2922 |
| 176 | Ga0157373_10194991 | 3300013100 | Bacteria | 1427 |
| 177 | Ga0157371_10000022 | 3300013102 | Bacteria | 295029 |
| 178 | Ga0157371_10000613 | 3300013102 | Bacteria | 42448 |
| 179 | Ga0157371_10020173 | 3300013102 | Bacteria | 4905 |
| 180 | Ga0157370_10000004 | 3300013104 | Bacteria | 366426 |
| 181 | Ga0157370_10002960 | 3300013104 | Bacteria | 20211 |
| 182 | Ga0157370_10009604 | 3300013104 | Bacteria | 10297 |
| 183 | Ga0157370_10012552 | 3300013104 | Bacteria | 8783 |
| 184 | Ga0157369_10005113 | 3300013105 | Bacteria | 15359 |
| 185 | Ga0157369_10011117 | 3300013105 | Bacteria | 10236 |
| 186 | Ga0157369_10022890 | 3300013105 | Bacteria | 6968 |
| 187 | Ga0157369_10023753 | 3300013105 | Bacteria | 6825 |
| 188 | Ga0157369_10081071 | 3300013105 | Bacteria | 3473 |
| 189 | Ga0157369_10117995 | 3300013105 | Bacteria | 2816 |
| 190 | Ga0157369_10815426 | 3300013105 | Bacteria | 958 |
| 191 | Ga0157374_10000219 | 3300013296 | Bacteria | 52748 |
| 192 | Ga0157374_10478371 | 3300013296 | Bacteria | 1248 |
| 193 | Ga0157372_10002559 | 3300013307 | Bacteria | 19718 |
| 194 | Ga0157372_10007566 | 3300013307 | Bacteria | 11551 |
| 195 | Ga0157375_10246850 | 3300013308 | Bacteria | 1946 |
| 196 | Ga0157375_10906999 | 3300013308 | Bacteria | 1025 |
| 197 | Ga0182008_10000070 | 3300014497 | Bacteria | 81986 |
| 198 | Ga0182008_10005687 | 3300014497 | Bacteria | 7062 |
| 199 | Ga0182008_10011571 | 3300014497 | Bacteria | 4686 |
| 200 | Ga0182008_10016590 | 3300014497 | Bacteria | 3827 |
| 201 | Ga0182008_10034228 | 3300014497 | Bacteria | 2547 |
| 202 | Ga0182008_10117743 | 3300014497 | Bacteria | 1319 |
| 203 | Ga0182008_10187476 | 3300014497 | Bacteria | 1049 |
| 204 | Ga0182008_10189423 | 3300014497 | Bacteria | 1043 |
| 205 | Ga0182006_1000709 | 3300015261 | Bacteria | 23072 |
| 206 | Ga0182006_1026368 | 3300015261 | Bacteria | 2379 |
| 207 | Ga0182006_1035522 | 3300015261 | Bacteria | 1986 |
| 208 | Ga0182006_1046290 | 3300015261 | Bacteria | 1690 |
| 209 | Ga0182006_1056141 | 3300015261 | Bacteria | 1501 |
| 210 | Ga0182007_10000004 | 3300015262 | Bacteria | 485875 |
| 211 | Ga0182007_10000576 | 3300015262 | Bacteria | 21613 |
| 212 | Ga0182007_10030700 | 3300015262 | Bacteria | 1835 |
| 213 | Ga0182007_10033144 | 3300015262 | Bacteria | 1751 |
| 214 | Ga0182007_10044219 | 3300015262 | Bacteria | 1478 |
| 215 | Ga0182005_1020255 | 3300015265 | Bacteria | 1831 |
| 216 | Ga0182005_1062316 | 3300015265 | Bacteria | 1019 |
| 217 | Ga0182005_1065907 | 3300015265 | Bacteria | 991 |
| 218 | Ga0183362_10002 | 3300015683 | Bacteria | 1432711 |
| 219 | Ga0183361_10004 | 3300016635 | Bacteria | 484183 |
| 220 | Ga0163161_10000139 | 3300017792 | Bacteria | 67878 |
| 221 | Ga0163161_10005865 | 3300017792 | Bacteria | 8517 |
| 222 | Ga0163161_10265029 | 3300017792 | Bacteria | 1343 |
| 223 | Ga0163161_10311246 | 3300017792 | Bacteria | 1243 |
| 224 | Ga0163161_10490307 | 3300017792 | Bacteria | 999 |
| 225 | Ga0206351_10088385 | 3300020077 | Bacteria | 1190 |
| 226 | Ga0154015_1439323 | 3300020610 | Bacteria | 8605 |
| 227 | Ga0209784_100029 | 3300025224 | Bacteria | 347315 |
| 228 | Ga0209784_101356 | 3300025224 | Bacteria | 3397 |
| 229 | Ga0209566_100030 | 3300025225 | Bacteria | 347329 |
| 230 | Ga0209566_100807 | 3300025225 | Bacteria | 16304 |
| 231 | Ga0209566_101195 | 3300025225 | Bacteria | 9231 |
| 232 | Ga0209566_103041 | 3300025225 | Bacteria | 2753 |
| 233 | Ga0209674_100020 | 3300025226 | Bacteria | 672397 |
| 234 | Ga0209674_100029 | 3300025226 | Bacteria | 466683 |
| 235 | Ga0209674_100075 | 3300025226 | Bacteria | 216004 |
| 236 | Ga0209674_100160 | 3300025226 | Bacteria | 88210 |
| 237 | Ga0209674_102918 | 3300025226 | Bacteria | 3377 |
| 238 | Ga0209672_100012 | 3300025228 | Bacteria | 795742 |
| 239 | Ga0209672_100013 | 3300025228 | Bacteria | 740693 |
| 240 | Ga0209672_100093 | 3300025228 | Bacteria | 115446 |
| 241 | Ga0209672_100175 | 3300025228 | Bacteria | 53342 |
| 242 | Ga0209672_102442 | 3300025228 | Bacteria | 4559 |
| 243 | Ga0209147_100007 | 3300025229 | Bacteria | 795684 |
| 244 | Ga0209147_100008 | 3300025229 | Bacteria | 777096 |
| 245 | Ga0209147_100013 | 3300025229 | Bacteria | 660057 |
| 246 | Ga0209147_100074 | 3300025229 | Bacteria | 208743 |
| 247 | Ga0209147_100134 | 3300025229 | Bacteria | 118581 |
| 248 | Ga0209563_100091 | 3300025230 | Bacteria | 168320 |
| 249 | Ga0209563_100092 | 3300025230 | Bacteria | 167669 |
| 250 | Ga0209563_100484 | 3300025230 | Bacteria | 13474 |
| 251 | Ga0209563_104619 | 3300025230 | Bacteria | 2609 |
| 252 | Ga0207427_101111 | 3300025231 | Bacteria | 10765 |
| 253 | Ga0209258_100013 | 3300025242 | Bacteria | 777096 |
| 254 | Ga0209258_100014 | 3300025242 | Bacteria | 720132 |
| 255 | Ga0209258_100016 | 3300025242 | Bacteria | 668622 |
| 256 | Ga0209258_100209 | 3300025242 | Bacteria | 118581 |
| 257 | Ga0209646_1000019 | 3300025246 | Bacteria | 475248 |
| 258 | Ga0209677_100030 | 3300025253 | Bacteria | 347314 |
| 259 | Ga0209677_101579 | 3300025253 | Bacteria | 9667 |
| 260 | Ga0209677_118632 | 3300025253 | Bacteria | 843 |
| 261 | Ga0209148_1000020 | 3300025254 | Bacteria | 740693 |
| 262 | Ga0209148_1000118 | 3300025254 | Bacteria | 188330 |
| 263 | Ga0209148_1000184 | 3300025254 | Bacteria | 118581 |
| 264 | Ga0209148_1001921 | 3300025254 | Bacteria | 8496 |
| 265 | Ga0209148_1002607 | 3300025254 | Bacteria | 5897 |
| 266 | Ga0209759_1000008 | 3300025256 | Bacteria | 461395 |
| 267 | Ga0209759_1000022 | 3300025256 | Bacteria | 329136 |
| 268 | Ga0209759_1002763 | 3300025256 | Bacteria | 7438 |
| 269 | Ga0209759_1003296 | 3300025256 | Bacteria | 6500 |
| 270 | Ga0209759_1005327 | 3300025256 | Bacteria | 4537 |
| 271 | Ga0209759_1014515 | 3300025256 | Bacteria | 2078 |
| 272 | Ga0209759_1029014 | 3300025256 | Bacteria | 1116 |
| 273 | Ga0209129_1000873 | 3300025258 | Bacteria | 18565 |
| 274 | Ga0209233_1000055 | 3300025261 | Bacteria | 439422 |
| 275 | Ga0209565_1000024 | 3300025263 | Bacteria | 379907 |
| 276 | Ga0209565_1000040 | 3300025263 | Bacteria | 266543 |
| 277 | Ga0209565_1011161 | 3300025263 | Bacteria | 2197 |
| 278 | Ga0209455_1000017 | 3300025272 | Bacteria | 740693 |
| 279 | Ga0209455_1000106 | 3300025272 | Bacteria | 195801 |
| 280 | Ga0209455_1000160 | 3300025272 | Bacteria | 118581 |
| 281 | Ga0209455_1001972 | 3300025272 | Bacteria | 8441 |
| 282 | Ga0209673_1000046 | 3300025273 | Bacteria | 289907 |
| 283 | Ga0209673_1000109 | 3300025273 | Bacteria | 183000 |
| 284 | Ga0209673_1000413 | 3300025273 | Bacteria | 75089 |
| 285 | Ga0209673_1002008 | 3300025273 | Bacteria | 15702 |
| 286 | Ga0209130_1009220 | 3300025284 | Bacteria | 2835 |
| 287 | Ga0209130_1016600 | 3300025284 | Bacteria | 1777 |
| 288 | Ga0209675_1000024 | 3300025291 | Bacteria | 312615 |
| 289 | Ga0209675_1000039 | 3300025291 | Bacteria | 247966 |
| 290 | Ga0209675_1000129 | 3300025291 | Bacteria | 102806 |
| 291 | Ga0209675_1001803 | 3300025291 | Bacteria | 11694 |
| 292 | Ga0209675_1020366 | 3300025291 | Bacteria | 1800 |
| 293 | Ga0209675_1046902 | 3300025291 | Bacteria | 911 |
| 294 | Ga0209676_1000011 | 3300025292 | Bacteria | 860463 |
| 295 | Ga0209676_1000014 | 3300025292 | Bacteria | 793514 |
| 296 | Ga0209676_1000071 | 3300025292 | Bacteria | 309464 |
| 297 | Ga0209676_1000075 | 3300025292 | Bacteria | 303609 |
| 298 | Ga0209025_1000232 | 3300025294 | Bacteria | 130663 |
| 299 | Ga0209025_1000382 | 3300025294 | Bacteria | 91921 |
| 300 | Ga0209025_1000446 | 3300025294 | Bacteria | 80985 |
| 301 | Ga0209025_1001095 | 3300025294 | Bacteria | 39073 |
| 302 | Ga0209025_1021309 | 3300025294 | Bacteria | 3496 |
| 303 | Ga0209025_1025421 | 3300025294 | Bacteria | 3015 |
| 304 | Ga0209025_1030698 | 3300025294 | Bacteria | 2565 |
| 305 | Ga0209564_1000309 | 3300025295 | Bacteria | 96154 |
| 306 | Ga0209564_1000411 | 3300025295 | Bacteria | 75939 |
| 307 | Ga0209564_1001305 | 3300025295 | Bacteria | 26857 |
| 308 | Ga0209564_1003422 | 3300025295 | Bacteria | 10880 |
| 309 | Ga0209050_1000032 | 3300025298 | Bacteria | 456335 |
| 310 | Ga0209050_1000069 | 3300025298 | Bacteria | 297615 |
| 311 | Ga0209050_1000720 | 3300025298 | Bacteria | 48448 |
| 312 | Ga0209050_1003935 | 3300025298 | Bacteria | 10504 |
| 313 | Ga0209050_1068900 | 3300025298 | Bacteria | 799 |
| 314 | Ga0209256_1000134 | 3300025299 | Bacteria | 160229 |
| 315 | Ga0209256_1012635 | 3300025299 | Bacteria | 3204 |
| 316 | Ga0209256_1020757 | 3300025299 | Bacteria | 2039 |
| 317 | Ga0207426_1000004 | 3300025302 | Bacteria | 1047900 |
| 318 | Ga0209051_1000092 | 3300025303 | Bacteria | 170056 |
| 319 | Ga0209051_1000169 | 3300025303 | Bacteria | 119220 |
| 320 | Ga0209051_1002066 | 3300025303 | Bacteria | 15223 |
| 321 | Ga0209051_1013463 | 3300025303 | Bacteria | 3892 |
| 322 | Ga0209257_1000014 | 3300025304 | Bacteria | 946850 |
| 323 | Ga0209257_1000571 | 3300025304 | Bacteria | 61995 |
| 324 | Ga0209257_1000722 | 3300025304 | Bacteria | 50449 |
| 325 | Ga0209257_1009463 | 3300025304 | Bacteria | 5205 |
| 326 | Ga0207655_1048697 | 3300025728 | Bacteria | 1737 |
| 327 | Ga0207713_1001373 | 3300025735 | Bacteria | 19794 |
| 328 | Ga0207713_1003740 | 3300025735 | Bacteria | 10216 |
| 329 | Ga0207713_1043532 | 3300025735 | Bacteria | 1854 |
| 330 | Ga0207713_1095743 | 3300025735 | Bacteria | 1034 |
| 331 | Ga0207680_10201499 | 3300025903 | Bacteria | 1356 |
| 332 | Ga0207647_10002375 | 3300025904 | Bacteria | 14283 |
| 333 | Ga0207647_10012862 | 3300025904 | Bacteria | 5814 |
| 334 | Ga0207647_10019436 | 3300025904 | Bacteria | 4569 |
| 335 | Ga0207647_10022845 | 3300025904 | Bacteria | 4149 |
| 336 | Ga0207647_10052462 | 3300025904 | Bacteria | 2517 |
| 337 | Ga0207647_10077029 | 3300025904 | Bacteria | 2005 |
| 338 | Ga0207705_10000420 | 3300025909 | Bacteria | 37140 |
| 339 | Ga0207695_10000171 | 3300025913 | Bacteria | 191448 |
| 340 | Ga0207695_10002092 | 3300025913 | Bacteria | 30376 |
| 341 | Ga0207695_10028576 | 3300025913 | Bacteria | 6179 |
| 342 | Ga0207695_10127948 | 3300025913 | Bacteria | 2500 |
| 343 | Ga0207695_10340023 | 3300025913 | Bacteria | 1389 |
| 344 | Ga0207695_10372770 | 3300025913 | Bacteria | 1314 |
| 345 | Ga0207695_10888510 | 3300025913 | Bacteria | 771 |
| 346 | Ga0207671_10022820 | 3300025914 | Bacteria | 4727 |
| 347 | Ga0207671_10062975 | 3300025914 | Bacteria | 2755 |
| 348 | Ga0207671_10072418 | 3300025914 | Bacteria | 2572 |
| 349 | Ga0207657_10000002 | 3300025919 | Bacteria | 444378 |
| 350 | Ga0207657_10010805 | 3300025919 | Bacteria | 9084 |
| 351 | Ga0207649_10000335 | 3300025920 | Bacteria | 35710 |
| 352 | Ga0207649_10000468 | 3300025920 | Bacteria | 28930 |
| 353 | Ga0207681_10010845 | 3300025923 | Bacteria | 5598 |
| 354 | Ga0207694_10071654 | 3300025924 | Bacteria | 2708 |
| 355 | Ga0207694_10721457 | 3300025924 | Bacteria | 841 |
| 356 | Ga0207659_10276821 | 3300025926 | Bacteria | 1371 |
| 357 | Ga0207690_10000011 | 3300025932 | Bacteria | 295252 |
| 358 | Ga0207690_10000176 | 3300025932 | Bacteria | 49560 |
| 359 | Ga0207690_10292520 | 3300025932 | Bacteria | 1272 |
| 360 | Ga0207686_10454097 | 3300025934 | Bacteria | 986 |
| 361 | Ga0207709_10000038 | 3300025935 | Bacteria | 266638 |
| 362 | Ga0207709_10004913 | 3300025935 | Bacteria | 7655 |
| 363 | Ga0207709_10019495 | 3300025935 | Bacteria | 3815 |
| 364 | Ga0207691_10203543 | 3300025940 | Bacteria | 1722 |
| 365 | Ga0207679_10000168 | 3300025945 | Bacteria | 54187 |
| 366 | Ga0207679_10000229 | 3300025945 | Bacteria | 43614 |
| 367 | Ga0207667_10026258 | 3300025949 | Bacteria | 6364 |
| 368 | Ga0207667_10035219 | 3300025949 | Bacteria | 5370 |
| 369 | Ga0207667_10043871 | 3300025949 | Bacteria | 4743 |
| 370 | Ga0207667_10619107 | 3300025949 | Bacteria | 1090 |
| 371 | Ga0207640_10000289 | 3300025981 | Bacteria | 33658 |
| 372 | Ga0207640_10159791 | 3300025981 | Bacteria | 1666 |
| 373 | Ga0207658_10023311 | 3300025986 | Bacteria | 4320 |
| 374 | Ga0207677_10433889 | 3300026023 | Bacteria | 1122 |
| 375 | Ga0207703_10400911 | 3300026035 | Bacteria | 1273 |
| 376 | Ga0207678_10000334 | 3300026067 | Bacteria | 42400 |
| 377 | Ga0207678_10000677 | 3300026067 | Bacteria | 31159 |
| 378 | Ga0207678_10292425 | 3300026067 | Bacteria | 1399 |
| 379 | Ga0207702_10000537 | 3300026078 | Bacteria | 42458 |
| 380 | Ga0207702_10840403 | 3300026078 | Bacteria | 908 |
| 381 | Ga0207641_10340622 | 3300026088 | Bacteria | 1427 |
| 382 | Ga0207674_10009467 | 3300026116 | Bacteria | 11129 |
| 383 | Ga0207683_10072739 | 3300026121 | Bacteria | 3041 |
| 384 | Ga0207683_10327772 | 3300026121 | Bacteria | 1403 |
| 385 | Ga0207698_10117038 | 3300026142 | Bacteria | 2247 |
| 386 | Ga0207698_10346292 | 3300026142 | Bacteria | 1402 |
| 387 | Ga0207698_10993853 | 3300026142 | Bacteria | 849 |
| 388 | Ga0209371_1000023 | 3300027312 | Bacteria | 519553 |
| 389 | Ga0209371_1001595 | 3300027312 | Bacteria | 14761 |
| 390 | Ga0209371_1006823 | 3300027312 | Bacteria | 4131 |
| 391 | Ga0209282_1000032 | 3300027666 | Bacteria | 149218 |
| 392 | Ga0209282_1000127 | 3300027666 | Bacteria | 48767 |
| 393 | Ga0209813_10178787 | 3300027866 | Bacteria | 775 |
| 394 | Ga0268266_10007180 | 3300028379 | Bacteria | 10093 |
| 395 | Ga0268266_10098400 | 3300028379 | Bacteria | 2574 |
| 396 | Ga0268266_10745300 | 3300028379 | Bacteria | 945 |
| 397 | Ga0268265_10005086 | 3300028380 | Bacteria | 9018 |
| 398 | Ga0307517_10280209 | 3300028786 | Bacteria | 951 |
| 399 | Ga0307515_10000618 | 3300028794 | Bacteria | 83065 |
| 400 | Ga0307515_10001346 | 3300028794 | Bacteria | 55608 |
| 401 | Ga0307515_10001873 | 3300028794 | Bacteria | 46808 |
| 402 | Ga0307515_10014468 | 3300028794 | Bacteria | 14623 |
| 403 | Ga0265338_10000270 | 3300028800 | Bacteria | 94907 |
| 404 | Ga0268256_1000023 | 3300030500 | Bacteria | 519631 |
| 405 | Ga0268256_1001380 | 3300030500 | Bacteria | 14764 |
| 406 | Ga0268256_1006937 | 3300030500 | Bacteria | 4131 |
| 407 | Ga0307512_10034925 | 3300030522 | Bacteria | 4294 |
| 408 | Ga0316177_1007272 | 3300030731 | Bacteria | 1466 |
| 409 | Ga0316177_1155703 | 3300030731 | Bacteria | 5327 |
| 410 | Ga0316176_1109634 | 3300030732 | Bacteria | 9012 |
| 411 | Ga0314311_1020500 | 3300030733 | Bacteria | 7667 |
| 412 | Ga0316179_1048542 | 3300030734 | Bacteria | 4858 |
| 413 | Ga0316178_1040985 | 3300030735 | Bacteria | 8016 |
| 414 | Ga0316180_1037427 | 3300030736 | Bacteria | 4529 |
| 415 | Ga0316183_1157955 | 3300030742 | Bacteria | 3491 |
| 416 | Ga0316181_1023192 | 3300030744 | Bacteria | 5261 |
| 417 | Ga0316182_1156455 | 3300030745 | Bacteria | 4029 |
| 418 | Ga0316182_1211692 | 3300030745 | Bacteria | 2866 |
| 419 | Ga0265332_10045646 | 3300031238 | Bacteria | 1888 |
| 420 | Ga0265340_10084569 | 3300031247 | Bacteria | 1489 |
| 421 | Ga0265327_10017002 | 3300031251 | Bacteria | 4586 |
| 422 | Ga0265316_10009820 | 3300031344 | Bacteria | 8784 |
| 423 | Ga0265316_10096979 | 3300031344 | Bacteria | 2245 |
| 424 | Ga0307513_10086758 | 3300031456 | Bacteria | 3207 |
| 425 | Ga0307513_10483237 | 3300031456 | Bacteria | 958 |
| 426 | Ga0307509_10013250 | 3300031507 | Bacteria | 9780 |
| 427 | Ga0307408_100003959 | 3300031548 | Bacteria | 10087 |
| 428 | Ga0307408_100128688 | 3300031548 | Bacteria | 1972 |
| 429 | Ga0307408_100194290 | 3300031548 | Bacteria | 1637 |
| 430 | Ga0307408_100565879 | 3300031548 | Bacteria | 1005 |
| 431 | Ga0307508_10000053 | 3300031616 | Bacteria | 128020 |
| 432 | Ga0307514_10035015 | 3300031649 | Bacteria | 3999 |
| 433 | Ga0316576_10071642 | 3300031727 | Bacteria | 2556 |
| 434 | Ga0316576_10158704 | 3300031727 | Bacteria | 1705 |
| 435 | Ga0316578_10059541 | 3300031728 | Bacteria | 2247 |
| 436 | Ga0307516_10001663 | 3300031730 | Bacteria | 30602 |
| 437 | Ga0307516_10249984 | 3300031730 | Bacteria | 1468 |
| 438 | Ga0307405_10004656 | 3300031731 | Bacteria | 6515 |
| 439 | Ga0307405_10017276 | 3300031731 | Bacteria | 3955 |
| 440 | Ga0307405_10194828 | 3300031731 | Bacteria | 1466 |
| 441 | Ga0316577_10066463 | 3300031733 | Bacteria | 2013 |
| 442 | Ga0307413_10416287 | 3300031824 | Bacteria | 1057 |
| 443 | Ga0307410_10358594 | 3300031852 | Bacteria | 1167 |
| 444 | Ga0307410_10468455 | 3300031852 | Bacteria | 1031 |
| 445 | Ga0307406_10001449 | 3300031901 | Bacteria | 13116 |
| 446 | Ga0307406_10029459 | 3300031901 | Bacteria | 3324 |
| 447 | Ga0307406_10180811 | 3300031901 | Bacteria | 1535 |
| 448 | Ga0307406_10261138 | 3300031901 | Bacteria | 1310 |
| 449 | Ga0307407_10417630 | 3300031903 | Bacteria | 966 |
| 450 | Ga0307412_10000099 | 3300031911 | Bacteria | 71212 |
| 451 | Ga0307412_10000307 | 3300031911 | Bacteria | 30940 |
| 452 | Ga0307412_10000384 | 3300031911 | Bacteria | 27422 |
| 453 | Ga0307412_10010187 | 3300031911 | Bacteria | 5409 |
| 454 | Ga0307412_10016243 | 3300031911 | Bacteria | 4430 |
| 455 | Ga0307412_10253650 | 3300031911 | Bacteria | 1367 |
| 456 | Ga0307412_10321553 | 3300031911 | Bacteria | 1231 |
| 457 | Ga0307409_100834117 | 3300031995 | Bacteria | 932 |
| 458 | Ga0307416_100025774 | 3300032002 | Bacteria | 4319 |
| 459 | Ga0307416_100057543 | 3300032002 | Bacteria | 3146 |
| 460 | Ga0307414_10173269 | 3300032004 | Bacteria | 1727 |
| 461 | Ga0307414_10551212 | 3300032004 | Bacteria | 1027 |
| 462 | Ga0307411_10218905 | 3300032005 | Bacteria | 1476 |
| 463 | Ga0316580_10110045 | 3300032139 | Bacteria | 843 |
| 464 | Ga0307507_10059857 | 3300033179 | Bacteria | 3562 |
| 465 | Ga0373931_0002570 | 3300035691 | Bacteria | 8084 |
| 466 | Ga0395899_0000005 | 3300037312 | Bacteria | 772966 |
| 467 | Ga0395899_0015842 | 3300037312 | Bacteria | 5748 |
| 468 | Ga0395899_0015933 | 3300037312 | Bacteria | 5733 |
| 469 | Ga0395900_0000003 | 3300037418 | Bacteria | 587648 |
| 470 | Ga0395900_0000053 | 3300037418 | Bacteria | 221135 |
| 471 | Ga0395900_0010925 | 3300037418 | Bacteria | 9285 |
| 472 | Ga0395900_0052368 | 3300037418 | Bacteria | 4202 |
| 473 | Ga0395900_0064319 | 3300037418 | Bacteria | 3770 |
| 474 | Ga0395900_0082021 | 3300037418 | Bacteria | 3313 |
| 475 | Ga0395900_0150122 | 3300037418 | Bacteria | 2381 |
| 476 | Ga0395898_0000003 | 3300037466 | Bacteria | 772986 |
| 477 | Ga0395898_0000421 | 3300037466 | Bacteria | 90307 |
| 478 | Ga0395898_0009549 | 3300037466 | Bacteria | 10189 |
| 479 | Ga0395898_0036527 | 3300037466 | Bacteria | 4878 |
| 480 | Ga0395898_0216760 | 3300037466 | Bacteria | 1825 |
| 481 | Ga0395905_0000082 | 3300037471 | Bacteria | 158963 |
| 482 | Ga0395905_0127089 | 3300037471 | Bacteria | 2397 |
| 483 | Ga0395905_0303158 | 3300037471 | Bacteria | 1485 |
| 484 | Ga0395905_0323179 | 3300037471 | Bacteria | 1433 |
| 485 | Ga0395901_0000026 | 3300038443 | Bacteria | 249248 |
| 486 | Ga0395901_0000042 | 3300038443 | Bacteria | 201819 |
| 487 | Ga0395901_0002709 | 3300038443 | Bacteria | 17846 |
| 488 | Ga0395901_0006320 | 3300038443 | Bacteria | 11997 |
| 489 | Ga0395901_0214207 | 3300038443 | Bacteria | 2015 |
| 490 | Ga0436365_0462895 | 3300039437 | Bacteria | 1818 |
| 491 | Ga0439436_0047734 | 3300041404 | Bacteria | 1215 |
| 492 | Ga0439466_0007379 | 3300041411 | Bacteria | 4164 |
| 493 | Ga0439466_0029151 | 3300041411 | Bacteria | 1901 |
| 494 | Ga0451797_0775968 | 3300041453 | Bacteria | 1119 |
| 495 | Ga0451795_1600842 | 3300041456 | Bacteria | 1581 |
| 496 | Ga0451802_0924306 | 3300041460 | Bacteria | 1690 |
| 497 | Ga0451839_1417277 | 3300041496 | Bacteria | 1595 |
| 498 | Ga0439431_0107604 | 3300041997 | Bacteria | 770 |
| 499 | Ga0439433_0004268 | 3300041999 | Bacteria | 3073 |
| 500 | Ga0439442_000570 | 3300042002 | Bacteria | 8034 |
| 501 | Ga0439445_0044091 | 3300042004 | Bacteria | 1191 |
| 502 | Ga0439445_0052789 | 3300042004 | Bacteria | 1100 |
| 503 | Ga0439448_0008912 | 3300042005 | Bacteria | 2945 |
| 504 | Ga0439432_005383 | 3300042006 | Bacteria | 4611 |
| 505 | Ga0450911_000205 | 3300042115 | Bacteria | 23269 |
| 506 | Ga0450923_030597 | 3300042125 | Bacteria | 1096 |
| 507 | Ga0450894_010278 | 3300042131 | Bacteria | 1214 |
| 508 | Ga0450906_001618 | 3300042145 | Bacteria | 4941 |
| 509 | Ga0450910_001159 | 3300042147 | Bacteria | 3264 |
| 510 | Ga0439458_0020739 | 3300042157 | Bacteria | 1518 |
| 511 | Ga0450908_000955 | 3300042184 | Bacteria | 5569 |
| 512 | Ga0439434_0001564 | 3300042435 | Bacteria | 6603 |
| 513 | Ga0451577_0002963 | 3300042876 | Bacteria | 19426 |
| 514 | Ga0466986_0011918 | 3300044650 | Bacteria | 5409 |
| 515 | Ga0466969_0009726 | 3300044656 | Bacteria | 5096 |
| 516 | Ga0466969_0013326 | 3300044656 | Bacteria | 4329 |
| 517 | Ga0466972_0005561 | 3300044658 | Bacteria | 6310 |
| 518 | Ga0466972_0006396 | 3300044658 | Bacteria | 5914 |
| 519 | Ga0466972_0079312 | 3300044658 | Bacteria | 1563 |
| 520 | Ga0466982_0023348 | 3300044672 | Bacteria | 3570 |
| 521 | Ga0466965_0000647 | 3300044683 | Bacteria | 12749 |
| 522 | Ga0466965_0032830 | 3300044683 | Bacteria | 2535 |
| 523 | Ga0466966_0000035 | 3300044684 | Bacteria | 98928 |
| 524 | Ga0466966_0068457 | 3300044684 | Bacteria | 2228 |
| 525 | Ga0466966_0093843 | 3300044684 | Bacteria | 1860 |
| 526 | Ga0466966_0149199 | 3300044684 | Bacteria | 1427 |
| 527 | Ga0466961_0000053 | 3300044693 | Bacteria | 69359 |
| 528 | Ga0466961_0000336 | 3300044693 | Bacteria | 30807 |
| 529 | Ga0466961_0013896 | 3300044693 | Bacteria | 5158 |
| 530 | Ga0466961_0022748 | 3300044693 | Bacteria | 4031 |
| 531 | Ga0466961_0047699 | 3300044693 | Bacteria | 2739 |
| 532 | Ga0466961_0143486 | 3300044693 | Bacteria | 1494 |
| 533 | Ga0466961_0165343 | 3300044693 | Bacteria | 1377 |
| 534 | Ga0466961_0241355 | 3300044693 | Bacteria | 1110 |
| 535 | Ga0466963_0010944 | 3300044694 | Bacteria | 5512 |
| 536 | Ga0466964_0009554 | 3300044706 | Bacteria | 3655 |
| 537 | Ga0453684_0337396 | 3300044712 | Bacteria | 1703 |
| 538 | Ga0466971_0058409 | 3300044719 | Bacteria | 1741 |
| 539 | Ga0466971_0178257 | 3300044719 | Bacteria | 998 |
| 540 | Ga0466968_0008978 | 3300044735 | Bacteria | 3842 |
| 541 | Ga0466968_0050712 | 3300044735 | Bacteria | 1771 |
| 542 | Ga0466970_0000691 | 3300044765 | Bacteria | 16510 |
| 543 | Ga0466970_0081594 | 3300044765 | Bacteria | 1749 |
| 544 | Ga0466970_0095450 | 3300044765 | Bacteria | 1616 |
| 545 | Ga0466970_0207290 | 3300044765 | Bacteria | 1091 |
| 546 | Ga0466957_0090477 | 3300044842 | Bacteria | 1917 |
| 547 | Ga0466957_0151919 | 3300044842 | Bacteria | 1498 |
| 548 | Ga0466957_0289252 | 3300044842 | Bacteria | 1098 |
| 549 | Ga0466957_0727094 | 3300044842 | Bacteria | 702 |
| 550 | Ga0466959_0000536 | 3300045049 | Bacteria | 22029 |
| 551 | Ga0466959_0020141 | 3300045049 | Bacteria | 4911 |
| 552 | Ga0466959_0038648 | 3300045049 | Bacteria | 3526 |
| 553 | Ga0466959_0138489 | 3300045049 | Bacteria | 1721 |
| 554 | Ga0466959_0148957 | 3300045049 | Bacteria | 1650 |
| 555 | Ga0451576_0793505 | 3300045051 | Bacteria | 994 |
| 556 | Ga0466958_0003134 | 3300045836 | Bacteria | 8507 |
| 557 | Ga0466958_0008375 | 3300045836 | Bacteria | 5731 |
| 558 | Ga0466958_0037591 | 3300045836 | Bacteria | 2900 |
| 559 | Ga0466967_0002309 | 3300045976 | Bacteria | 11781 |
| 560 | Ga0466967_0017394 | 3300045976 | Bacteria | 5706 |
| 561 | Ga0466967_0452265 | 3300045976 | Bacteria | 1255 |
| 562 | Ga0495627_013120 | 3300046453 | Bacteria | 2922 |
| 563 | Ga0495592_0004473 | 3300046454 | Bacteria | 10226 |
| 564 | Ga0495592_0011711 | 3300046454 | Bacteria | 6643 |
| 565 | Ga0495592_0034294 | 3300046454 | Bacteria | 3826 |
| 566 | Ga0495592_0256043 | 3300046454 | Bacteria | 1155 |
| 567 | Ga0495603_0000314 | 3300046455 | Bacteria | 25941 |
| 568 | Ga0495603_0000829 | 3300046455 | Bacteria | 17765 |
| 569 | Ga0495603_0001095 | 3300046455 | Bacteria | 15727 |
| 570 | Ga0495590_0000532 | 3300046457 | Bacteria | 18347 |
| 571 | Ga0495590_0011310 | 3300046457 | Bacteria | 3339 |
| 572 | Ga0495590_0028532 | 3300046457 | Bacteria | 1957 |
| 573 | Ga0495590_0032454 | 3300046457 | Bacteria | 1826 |
| 574 | Ga0495591_001445 | 3300046458 | Bacteria | 14729 |
| 575 | Ga0495591_020044 | 3300046458 | Bacteria | 2221 |
| 576 | Ga0495629_0001045 | 3300046459 | Bacteria | 22168 |
| 577 | Ga0495629_0001355 | 3300046459 | Bacteria | 19292 |
| 578 | Ga0495629_0009735 | 3300046459 | Bacteria | 7015 |
| 579 | Ga0495629_0025773 | 3300046459 | Bacteria | 4178 |
| 580 | Ga0495638_0008288 | 3300046460 | Bacteria | 7380 |
| 581 | Ga0495638_0030479 | 3300046460 | Bacteria | 3472 |
| 582 | Ga0495638_0339899 | 3300046460 | Bacteria | 796 |
| 583 | Ga0495641_0005366 | 3300046461 | Bacteria | 8687 |
| 584 | Ga0495651_0004504 | 3300046462 | Bacteria | 10665 |
| 585 | Ga0495651_0010112 | 3300046462 | Bacteria | 7247 |
| 586 | Ga0495653_0001129 | 3300046463 | Bacteria | 20533 |
| 587 | Ga0495653_0037733 | 3300046463 | Bacteria | 3794 |
| 588 | Ga0495653_0081863 | 3300046463 | Bacteria | 2384 |
| 589 | Ga0495653_0113137 | 3300046463 | Bacteria | 1947 |
| 590 | Ga0495653_0254242 | 3300046463 | Bacteria | 1165 |
| 591 | Ga0495650_0000785 | 3300046471 | Bacteria | 38956 |
| 592 | Ga0495650_0044736 | 3300046471 | Bacteria | 1868 |
| 593 | Ga0495650_0130688 | 3300046471 | Bacteria | 916 |
| 594 | Ga0495580_0000009 | 3300046472 | Bacteria | 101827 |
| 595 | Ga0495580_0000090 | 3300046472 | Bacteria | 59451 |
| 596 | Ga0495580_0002321 | 3300046472 | Bacteria | 16595 |
| 597 | Ga0495580_0008992 | 3300046472 | Bacteria | 7888 |
| 598 | Ga0495580_0017639 | 3300046472 | Bacteria | 5332 |
| 599 | Ga0495580_0029284 | 3300046472 | Bacteria | 3997 |
| 600 | Ga0495580_0037251 | 3300046472 | Bacteria | 3492 |
| 601 | Ga0495582_0000149 | 3300046473 | Bacteria | 37867 |
| 602 | Ga0495582_0147028 | 3300046473 | Bacteria | 1337 |
| 603 | Ga0495605_0006972 | 3300046474 | Bacteria | 6452 |
| 604 | Ga0495605_0022475 | 3300046474 | Bacteria | 3331 |
| 605 | Ga0495605_0172387 | 3300046474 | Bacteria | 955 |
| 606 | Ga0495639_0033005 | 3300046475 | Bacteria | 2310 |
| 607 | Ga0495662_0062602 | 3300046476 | Bacteria | 1797 |
| 608 | Ga0495662_0064927 | 3300046476 | Bacteria | 1764 |
| 609 | Ga0495662_0130127 | 3300046476 | Bacteria | 1237 |
| 610 | Ga0495664_0000841 | 3300046477 | Bacteria | 15743 |
| 611 | Ga0495664_0178640 | 3300046477 | Bacteria | 1287 |
| 612 | Ga0495664_0305854 | 3300046477 | Bacteria | 959 |
| 613 | Ga0495584_0091524 | 3300046491 | Bacteria | 1534 |
| 614 | Ga0495585_0053061 | 3300046492 | Bacteria | 2244 |
| 615 | Ga0495596_0001240 | 3300046500 | Bacteria | 14840 |
| 616 | Ga0495596_0001953 | 3300046500 | Bacteria | 11381 |
| 617 | Ga0495596_0042453 | 3300046500 | Bacteria | 1792 |
| 618 | Ga0495596_0068397 | 3300046500 | Bacteria | 1380 |
| 619 | Ga0495607_0004706 | 3300046501 | Bacteria | 9987 |
| 620 | Ga0495606_0044207 | 3300046507 | Bacteria | 2964 |
| 621 | Ga0495606_0115161 | 3300046507 | Bacteria | 1616 |
| 622 | Ga0495606_0136314 | 3300046507 | Bacteria | 1453 |
| 623 | Ga0495606_0253939 | 3300046507 | Bacteria | 974 |
| 624 | Ga0495608_0116226 | 3300046511 | Bacteria | 1717 |
| 625 | Ga0495608_0151551 | 3300046511 | Bacteria | 1477 |
| 626 | Ga0495608_0287737 | 3300046511 | Bacteria | 1019 |
| 627 | Ga0495610_0000801 | 3300046512 | Bacteria | 29499 |
| 628 | Ga0495610_0001684 | 3300046512 | Bacteria | 19421 |
| 629 | Ga0495610_0007797 | 3300046512 | Bacteria | 7057 |
| 630 | Ga0495610_0057560 | 3300046512 | Bacteria | 1863 |
| 631 | Ga0495610_0212895 | 3300046512 | Bacteria | 785 |
| 632 | Ga0495616_0004225 | 3300046513 | Bacteria | 9089 |
| 633 | Ga0495616_0006997 | 3300046513 | Bacteria | 6790 |
| 634 | Ga0495618_0002845 | 3300046514 | Bacteria | 10957 |
| 635 | Ga0495618_0005116 | 3300046514 | Bacteria | 8009 |
| 636 | Ga0495618_0007341 | 3300046514 | Bacteria | 6670 |
| 637 | Ga0495620_0088171 | 3300046515 | Bacteria | 1247 |
| 638 | Ga0495620_0195273 | 3300046515 | Bacteria | 779 |
| 639 | Ga0495628_0000686 | 3300046516 | Bacteria | 31223 |
| 640 | Ga0495628_0087838 | 3300046516 | Bacteria | 2410 |
| 641 | Ga0495628_0423713 | 3300046516 | Bacteria | 969 |
| 642 | Ga0495630_0002882 | 3300046517 | Bacteria | 11950 |
| 643 | Ga0495630_0065202 | 3300046517 | Bacteria | 2736 |
| 644 | Ga0495631_0000277 | 3300046518 | Bacteria | 35860 |
| 645 | Ga0495631_0000415 | 3300046518 | Bacteria | 29398 |
| 646 | Ga0495632_0083848 | 3300046519 | Bacteria | 1517 |
| 647 | Ga0495637_0023139 | 3300046520 | Bacteria | 2828 |
| 648 | Ga0495643_0000612 | 3300046522 | Bacteria | 42656 |
| 649 | Ga0495643_0012668 | 3300046522 | Bacteria | 5079 |
| 650 | Ga0495643_0089381 | 3300046522 | Bacteria | 1591 |
| 651 | Ga0495643_0164780 | 3300046522 | Bacteria | 1088 |
| 652 | Ga0495648_0001922 | 3300046524 | Bacteria | 19797 |
| 653 | Ga0495648_0037685 | 3300046524 | Bacteria | 3103 |
| 654 | Ga0495648_0065967 | 3300046524 | Bacteria | 2124 |
| 655 | Ga0495648_0071448 | 3300046524 | Bacteria | 2011 |
| 656 | Ga0495666_0000262 | 3300046526 | Bacteria | 22801 |
| 657 | Ga0495666_0001367 | 3300046526 | Bacteria | 11823 |
| 658 | Ga0495666_0012949 | 3300046526 | Bacteria | 4156 |
| 659 | Ga0495666_0041449 | 3300046526 | Bacteria | 2229 |
| 660 | Ga0495642_0043689 | 3300046528 | Bacteria | 1828 |
| 661 | Ga0495642_0251145 | 3300046528 | Bacteria | 773 |
| 662 | Ga0495652_0003339 | 3300046529 | Bacteria | 15922 |
| 663 | Ga0495652_0039211 | 3300046529 | Bacteria | 4096 |
| 664 | Ga0495652_0170978 | 3300046529 | Bacteria | 1677 |
| 665 | Ga0495665_0000891 | 3300046531 | Bacteria | 15666 |
| 666 | Ga0495665_0032568 | 3300046531 | Bacteria | 2788 |
| 667 | Ga0495665_0041706 | 3300046531 | Bacteria | 2443 |
| 668 | Ga0495665_0207024 | 3300046531 | Bacteria | 1016 |
| 669 | Ga0495640_0003423 | 3300046533 | Bacteria | 12776 |
| 670 | Ga0495640_0015454 | 3300046533 | Bacteria | 5744 |
| 671 | Ga0495640_0396468 | 3300046533 | Bacteria | 848 |
| 672 | Ga0495586_0000464 | 3300046535 | Bacteria | 24313 |
| 673 | Ga0495586_0133949 | 3300046535 | Bacteria | 1388 |
| 674 | Ga0495587_0001565 | 3300046536 | Bacteria | 15225 |
| 675 | Ga0495587_0054328 | 3300046536 | Bacteria | 2360 |
| 676 | Ga0495609_0002726 | 3300046538 | Bacteria | 10657 |
| 677 | Ga0495609_0211215 | 3300046538 | Bacteria | 808 |
| 678 | Ga0495621_0004284 | 3300046539 | Bacteria | 3997 |
| 679 | Ga0495621_0069330 | 3300046539 | Bacteria | 1295 |
| 680 | Ga0495621_0142640 | 3300046539 | Bacteria | 938 |
| 681 | Ga0495645_0000208 | 3300046543 | Bacteria | 42020 |
| 682 | Ga0495645_0000626 | 3300046543 | Bacteria | 24355 |
| 683 | Ga0495645_0005988 | 3300046543 | Bacteria | 8409 |
| 684 | Ga0495622_0000183 | 3300046557 | Bacteria | 50803 |
| 685 | Ga0495622_0000581 | 3300046557 | Bacteria | 21677 |
| 686 | Ga0495667_0151034 | 3300046559 | Bacteria | 1496 |
| 687 | Ga0495656_0000060 | 3300046615 | Bacteria | 52471 |
| 688 | Ga0495668_0115505 | 3300046616 | Bacteria | 1468 |
| 689 | Ga0495668_0153348 | 3300046616 | Bacteria | 1262 |
| 690 | Ga0495634_0000984 | 3300046642 | Bacteria | 26848 |
| 691 | Ga0495634_0086558 | 3300046642 | Bacteria | 2040 |
| 692 | Ga0495611_0039632 | 3300046648 | Bacteria | 2098 |
| 693 | Ga0495611_0106089 | 3300046648 | Bacteria | 1306 |
| 694 | Ga0495625_0000624 | 3300046660 | Bacteria | 51214 |
| 695 | Ga0495625_0012940 | 3300046660 | Bacteria | 6734 |
| 696 | Ga0495625_0013348 | 3300046660 | Bacteria | 6602 |
| 697 | Ga0495625_0022482 | 3300046660 | Bacteria | 4835 |
| 698 | Ga0495625_0058918 | 3300046660 | Bacteria | 2726 |
| 699 | Ga0495625_0400787 | 3300046660 | Bacteria | 857 |
| 700 | Ga0495635_0000661 | 3300046663 | Bacteria | 22131 |
| 701 | Ga0495635_0139930 | 3300046663 | Bacteria | 1649 |
| 702 | Ga0495635_0152801 | 3300046663 | Bacteria | 1571 |
| 703 | Ga0495635_0238786 | 3300046663 | Bacteria | 1226 |
| 704 | Ga0495661_0001181 | 3300046665 | Bacteria | 22678 |
| 705 | Ga0495661_0002898 | 3300046665 | Bacteria | 12979 |
| 706 | Ga0495661_0016358 | 3300046665 | Bacteria | 4919 |
| 707 | Ga0495661_0190636 | 3300046665 | Bacteria | 1080 |
| 708 | Ga0495588_0013862 | 3300046674 | Bacteria | 3848 |
| 709 | Ga0495588_0055626 | 3300046674 | Bacteria | 2042 |
| 710 | Ga0495588_0123273 | 3300046674 | Bacteria | 1366 |
| 711 | Ga0495657_0033214 | 3300046675 | Bacteria | 3594 |
| 712 | Ga0495599_0001014 | 3300046678 | Bacteria | 15781 |
| 713 | Ga0495599_0050641 | 3300046678 | Bacteria | 2602 |
| 714 | Ga0495623_0007386 | 3300046679 | Bacteria | 7134 |
| 715 | Ga0495623_0017823 | 3300046679 | Bacteria | 4586 |
| 716 | Ga0495623_0215273 | 3300046679 | Bacteria | 1097 |
| 717 | Ga0495646_0001547 | 3300046680 | Bacteria | 13695 |
| 718 | Ga0495646_0025675 | 3300046680 | Bacteria | 3704 |
| 719 | Ga0495646_0292285 | 3300046680 | Bacteria | 863 |
| 720 | Ga0495669_0096340 | 3300046684 | Bacteria | 1371 |
| 721 | Ga0495613_0063081 | 3300046689 | Bacteria | 2711 |
| 722 | Ga0495624_0002433 | 3300046690 | Bacteria | 14121 |
| 723 | Ga0495624_0003097 | 3300046690 | Bacteria | 12444 |
| 724 | Ga0495624_0140967 | 3300046690 | Bacteria | 1476 |
| 725 | Ga0495670_0031670 | 3300046691 | Bacteria | 2629 |
| 726 | Ga0495670_0066695 | 3300046691 | Bacteria | 1816 |
| 727 | Ga0495671_0002249 | 3300046692 | Bacteria | 12273 |
| 728 | Ga0495671_0002256 | 3300046692 | Bacteria | 12249 |
| 729 | Ga0495649_0000785 | 3300046694 | Bacteria | 25518 |
| 730 | Ga0495649_0009077 | 3300046694 | Bacteria | 5934 |
| 731 | Ga0495649_0012885 | 3300046694 | Bacteria | 4844 |
| 732 | Ga0495649_0031289 | 3300046694 | Bacteria | 2935 |
| 733 | Ga0495649_0046087 | 3300046694 | Bacteria | 2375 |
| 734 | Ga0495649_0047216 | 3300046694 | Bacteria | 2342 |
| 735 | Ga0495649_0052822 | 3300046694 | Bacteria | 2201 |
| 736 | Ga0495649_0074684 | 3300046694 | Bacteria | 1816 |
| 737 | Ga0495649_0182347 | 3300046694 | Bacteria | 1095 |
| 738 | Ga0495589_0026311 | 3300046794 | Bacteria | 2948 |
| 739 | Ga0495589_0073458 | 3300046794 | Bacteria | 1669 |
| 740 | Ga0495600_0006002 | 3300046809 | Bacteria | 7352 |
| 741 | Ga0495600_0032475 | 3300046809 | Bacteria | 3387 |
| 742 | Ga0495600_0099985 | 3300046809 | Bacteria | 1890 |
| 743 | Ga0495660_0121080 | 3300046810 | Bacteria | 1324 |
| 744 | Ga0495581_0000321 | 3300047315 | Bacteria | 23631 |
| 745 | Ga0495581_0025612 | 3300047315 | Bacteria | 3420 |
| 746 | Ga0495604_0000541 | 3300047317 | Bacteria | 33313 |
| 747 | Ga0495604_0084998 | 3300047317 | Bacteria | 2361 |
| 748 | Ga0495604_0095943 | 3300047317 | Bacteria | 2189 |
| 749 | Ga0495674_0004302 | 3300047319 | Bacteria | 13698 |
| 750 | Ga0495674_0007009 | 3300047319 | Bacteria | 10783 |
| 751 | Ga0495674_0048224 | 3300047319 | Bacteria | 3771 |
| 752 | Ga0495674_0065636 | 3300047319 | Bacteria | 3151 |
| 753 | Ga0495674_0450263 | 3300047319 | Bacteria | 1034 |
| 754 | Ga0495672_0000006 | 3300047320 | Bacteria | 589807 |
| 755 | Ga0495672_0012615 | 3300047320 | Bacteria | 5884 |
| 756 | Ga0495672_0017394 | 3300047320 | Bacteria | 4810 |
| 757 | Ga0495672_0247775 | 3300047320 | Bacteria | 866 |
| 758 | Ga0495676_0003067 | 3300047321 | Bacteria | 15109 |
| 759 | Ga0495676_0057258 | 3300047321 | Bacteria | 3076 |
| 760 | Ga0495676_0065688 | 3300047321 | Bacteria | 2814 |
| 761 | Ga0495680_0003534 | 3300047322 | Bacteria | 15320 |
| 762 | Ga0495680_0141419 | 3300047322 | Bacteria | 1760 |
| 763 | Ga0495680_0144781 | 3300047322 | Bacteria | 1736 |
| 764 | Ga0495683_0000741 | 3300047323 | Bacteria | 23578 |
| 765 | Ga0495683_0002235 | 3300047323 | Bacteria | 11836 |
| 766 | Ga0495683_0030529 | 3300047323 | Bacteria | 2749 |
| 767 | Ga0495683_0072002 | 3300047323 | Bacteria | 1695 |
| 768 | Ga0495687_000018 | 3300047443 | Bacteria | 342973 |
| 769 | Ga0495687_010258 | 3300047443 | Bacteria | 5149 |
| 770 | Ga0495687_042270 | 3300047443 | Bacteria | 1993 |
| 771 | Ga0495687_073381 | 3300047443 | Bacteria | 1364 |
| 772 | Ga0495675_0012248 | 3300047444 | Bacteria | 5398 |
| 773 | Ga0495675_0029005 | 3300047444 | Bacteria | 3527 |
| 774 | Ga0495679_000287 | 3300047446 | Bacteria | 41484 |
| 775 | Ga0495679_003284 | 3300047446 | Bacteria | 7837 |
| 776 | Ga0495679_042574 | 3300047446 | Bacteria | 1400 |
| 777 | Ga0495685_006425 | 3300047447 | Bacteria | 3847 |
| 778 | Ga0495673_0031906 | 3300047469 | Bacteria | 2463 |
| 779 | Ga0495673_0067048 | 3300047469 | Bacteria | 1520 |
| 780 | Ga0495673_0198005 | 3300047469 | Bacteria | 753 |
| 781 | Ga0495681_0018795 | 3300047470 | Bacteria | 3793 |
| 782 | Ga0495684_0030859 | 3300047471 | Bacteria | 4114 |
| 783 | Ga0495686_0007586 | 3300047472 | Bacteria | 8107 |
| 784 | Ga0495593_0000274 | 3300047673 | Bacteria | 28031 |
| 785 | Ga0495593_0004998 | 3300047673 | Bacteria | 7850 |
| 786 | Ga0495593_0005252 | 3300047673 | Bacteria | 7656 |
| 787 | Ga0495602_0004133 | 3300048088 | Bacteria | 15124 |
| 788 | Ga0495602_0026645 | 3300048088 | Bacteria | 5571 |
| 789 | Ga0495602_0027358 | 3300048088 | Bacteria | 5479 |
| 790 | Ga0495602_0271070 | 3300048088 | Bacteria | 1254 |
| 791 | Ga0495614_0000736 | 3300048089 | Bacteria | 13868 |
| 792 | Ga0495614_0004205 | 3300048089 | Bacteria | 6487 |
| 793 | Ga0495614_0011872 | 3300048089 | Bacteria | 3829 |
| 794 | Ga0495614_0096912 | 3300048089 | Bacteria | 1286 |
| 795 | Ga0495615_0071734 | 3300048090 | Bacteria | 934 |
| 796 | Ga0495626_0062747 | 3300048091 | Bacteria | 1687 |
| 797 | Ga0496100_0000137 | 3300048903 | Bacteria | 40757 |
| 798 | Ga0496100_0001939 | 3300048903 | Bacteria | 10343 |
| 799 | Ga0496101_0000044 | 3300048904 | Bacteria | 161295 |
| 800 | Ga0496101_0005632 | 3300048904 | Bacteria | 7989 |
| 801 | Ga0496101_0006414 | 3300048904 | Bacteria | 7567 |
| 802 | Ga0496101_0020807 | 3300048904 | Bacteria | 4500 |
| 803 | Ga0496102_0000379 | 3300048905 | Bacteria | 53037 |
| 804 | Ga0496102_0005508 | 3300048905 | Bacteria | 10749 |
| 805 | Ga0496102_0125153 | 3300048905 | Bacteria | 2402 |
| 806 | Ga0496102_0316952 | 3300048905 | Bacteria | 1469 |
| 807 | Ga0496102_0675973 | 3300048905 | Bacteria | 955 |
| 808 | Ga0496103_0000469 | 3300048906 | Bacteria | 34035 |
| 809 | Ga0496103_0001373 | 3300048906 | Bacteria | 16422 |
| 810 | Ga0496103_0005736 | 3300048906 | Bacteria | 7416 |
| 811 | Ga0496104_0002691 | 3300048907 | Bacteria | 15306 |
| 812 | Ga0496104_0053443 | 3300048907 | Bacteria | 3816 |
| 813 | Ga0496104_0133108 | 3300048907 | Bacteria | 2388 |
| 814 | Ga0496105_0005462 | 3300048908 | Bacteria | 9647 |
| 815 | Ga0496105_0122211 | 3300048908 | Bacteria | 2146 |
| 816 | Ga0496105_0253794 | 3300048908 | Bacteria | 1424 |
| 817 | Ga0496106_0007891 | 3300048909 | Bacteria | 7867 |
| 818 | Ga0496106_0213559 | 3300048909 | Bacteria | 1537 |
| 819 | Ga0496107_0052860 | 3300048910 | Bacteria | 2930 |
| 820 | Ga0496107_0067625 | 3300048910 | Bacteria | 2593 |
| 821 | Ga0496108_0071610 | 3300048911 | Bacteria | 2925 |
| 822 | Ga0496109_0147934 | 3300048912 | Bacteria | 2198 |
| 823 | Ga0496110_0019287 | 3300048913 | Bacteria | 5735 |
| 824 | Ga0496111_0006059 | 3300048914 | Bacteria | 7814 |
| 825 | Ga0496112_0024471 | 3300048915 | Bacteria | 5782 |
| 826 | Ga0496112_0051572 | 3300048915 | Bacteria | 4036 |
| 827 | Ga0496113_0009083 | 3300048916 | Bacteria | 6514 |
| 828 | Ga0496113_0027592 | 3300048916 | Bacteria | 4072 |
| 829 | Ga0496114_0002580 | 3300048917 | Bacteria | 13842 |
| 830 | Ga0496115_0000096 | 3300048918 | Bacteria | 82735 |
| 831 | Ga0496116_0000403 | 3300048919 | Bacteria | 62168 |
| 832 | Ga0496116_0002276 | 3300048919 | Bacteria | 20367 |
| 833 | Ga0496116_0006912 | 3300048919 | Bacteria | 10179 |
| 834 | Ga0496116_0013389 | 3300048919 | Bacteria | 6618 |
| 835 | Ga0496116_0021912 | 3300048919 | Bacteria | 4805 |
| 836 | Ga0496116_0024040 | 3300048919 | Bacteria | 4517 |
| 837 | Ga0496117_0000098 | 3300048920 | Bacteria | 196331 |
| 838 | Ga0496117_0006629 | 3300048920 | Bacteria | 11619 |
| 839 | Ga0496117_0015082 | 3300048920 | Bacteria | 6617 |
| 840 | Ga0496117_0027118 | 3300048920 | Bacteria | 4469 |
| 841 | Ga0496117_0070768 | 3300048920 | Bacteria | 2341 |
| 842 | Ga0496117_0113768 | 3300048920 | Bacteria | 1679 |
| 843 | Ga0496117_0172529 | 3300048920 | Bacteria | 1253 |
| 844 | Ga0496117_0387126 | 3300048920 | Bacteria | 710 |
| 845 | Ga0496118_0000400 | 3300048921 | Bacteria | 73227 |
| 846 | Ga0496118_0000533 | 3300048921 | Bacteria | 62461 |
| 847 | Ga0496118_0000644 | 3300048921 | Bacteria | 57224 |
| 848 | Ga0496118_0003771 | 3300048921 | Bacteria | 18726 |
| 849 | Ga0496118_0006135 | 3300048921 | Bacteria | 13342 |
| 850 | Ga0496118_0007071 | 3300048921 | Bacteria | 12055 |
| 851 | Ga0496118_0009625 | 3300048921 | Bacteria | 9724 |
| 852 | Ga0496118_0013952 | 3300048921 | Bacteria | 7556 |
| 853 | Ga0496118_0016091 | 3300048921 | Bacteria | 6881 |
| 854 | Ga0496118_0131205 | 3300048921 | Bacteria | 1609 |
| 855 | Ga0496118_0218997 | 3300048921 | Bacteria | 1110 |
| 856 | Ga0496119_0014786 | 3300048922 | Bacteria | 6074 |
| 857 | Ga0496119_0171283 | 3300048922 | Bacteria | 1146 |
| 858 | Ga0496120_0025672 | 3300048923 | Bacteria | 3653 |
| 859 | Ga0496121_0000294 | 3300048924 | Bacteria | 103244 |
| 860 | Ga0496121_0000822 | 3300048924 | Bacteria | 56626 |
| 861 | Ga0496121_0001909 | 3300048924 | Bacteria | 33363 |
| 862 | Ga0496121_0003473 | 3300048924 | Bacteria | 22448 |
| 863 | Ga0496121_0004825 | 3300048924 | Bacteria | 17756 |
| 864 | Ga0496121_0015210 | 3300048924 | Bacteria | 8086 |
| 865 | Ga0496121_0023258 | 3300048924 | Bacteria | 5975 |
| 866 | Ga0496121_0030733 | 3300048924 | Bacteria | 4927 |
| 867 | Ga0496121_0059162 | 3300048924 | Bacteria | 3161 |
| 868 | Ga0496121_0104713 | 3300048924 | Bacteria | 2173 |
| 869 | Ga0496121_0106385 | 3300048924 | Bacteria | 2150 |
| 870 | Ga0496122_0000021 | 3300048925 | Bacteria | 391363 |
| 871 | Ga0496122_0006795 | 3300048925 | Bacteria | 12994 |
| 872 | Ga0496122_0008449 | 3300048925 | Bacteria | 11104 |
| 873 | Ga0496122_0008978 | 3300048925 | Bacteria | 10627 |
| 874 | Ga0496122_0133825 | 3300048925 | Bacteria | 1568 |
| 875 | Ga0496122_0218100 | 3300048925 | Bacteria | 1097 |
| 876 | Ga0496122_0254233 | 3300048925 | Bacteria | 980 |
| 877 | Ga0496122_0373662 | 3300048925 | Bacteria | 734 |
| 878 | Ga0496123_0000050 | 3300048926 | Bacteria | 238021 |
| 879 | Ga0496123_0000176 | 3300048926 | Bacteria | 130010 |
| 880 | Ga0496123_0004101 | 3300048926 | Bacteria | 15630 |
| 881 | Ga0496123_0009377 | 3300048926 | Bacteria | 8824 |
| 882 | Ga0496123_0013089 | 3300048926 | Bacteria | 7000 |
| 883 | Ga0496123_0017617 | 3300048926 | Bacteria | 5735 |
| 884 | Ga0496123_0077868 | 3300048926 | Bacteria | 2034 |
| 885 | Ga0496123_0150532 | 3300048926 | Bacteria | 1256 |
| 886 | Ga0496123_0153252 | 3300048926 | Bacteria | 1240 |
| 887 | Ga0496123_0291450 | 3300048926 | Bacteria | 783 |
| 888 | Ga0496124_0000006 | 3300048927 | Bacteria | 904259 |
| 889 | Ga0496124_0020422 | 3300048927 | Bacteria | 6119 |
| 890 | Ga0496124_0060707 | 3300048927 | Bacteria | 3171 |
| 891 | Ga0496124_0088643 | 3300048927 | Bacteria | 2528 |
| 892 | Ga0496124_0115861 | 3300048927 | Bacteria | 2149 |
| 893 | Ga0496124_0123310 | 3300048927 | Bacteria | 2067 |
| 894 | Ga0496124_0137890 | 3300048927 | Bacteria | 1929 |
| 895 | Ga0496124_0144744 | 3300048927 | Bacteria | 1871 |
| 896 | Ga0496124_0171432 | 3300048927 | Bacteria | 1680 |
| 897 | Ga0496124_0223694 | 3300048927 | Bacteria | 1413 |
| 898 | Ga0496125_0000005 | 3300048928 | Bacteria | 827598 |
| 899 | Ga0496125_0001680 | 3300048928 | Bacteria | 30949 |
| 900 | Ga0496125_0006458 | 3300048928 | Bacteria | 12671 |
| 901 | Ga0496125_0015569 | 3300048928 | Bacteria | 7344 |
| 902 | Ga0496125_0016460 | 3300048928 | Bacteria | 7097 |
| 903 | Ga0496125_0029704 | 3300048928 | Bacteria | 4906 |
| 904 | Ga0496125_0035954 | 3300048928 | Bacteria | 4333 |
| 905 | Ga0496125_0037911 | 3300048928 | Bacteria | 4183 |
| 906 | Ga0496125_0050626 | 3300048928 | Bacteria | 3437 |
| 907 | Ga0496125_0067250 | 3300048928 | Bacteria | 2825 |
| 908 | Ga0496125_0128454 | 3300048928 | Bacteria | 1790 |
| 909 | Ga0496126_0000331 | 3300048929 | Bacteria | 100914 |
| 910 | Ga0496126_0001126 | 3300048929 | Bacteria | 44695 |
| 911 | Ga0496126_0005355 | 3300048929 | Bacteria | 14667 |
| 912 | Ga0496126_0014902 | 3300048929 | Bacteria | 7841 |
| 913 | Ga0496126_0016298 | 3300048929 | Bacteria | 7436 |
| 914 | Ga0496126_0039126 | 3300048929 | Bacteria | 4404 |
| 915 | Ga0496126_0133401 | 3300048929 | Bacteria | 2144 |
| 916 | Ga0496126_0145636 | 3300048929 | Bacteria | 2034 |
| 917 | Ga0496126_0383859 | 3300048929 | Bacteria | 1143 |
| 918 | Ga0495678_027991 | 3300049459 | Bacteria | 2384 |
| 919 | Ga0495678_069790 | 3300049459 | Bacteria | 1292 |
| 920 | Ga0495682_0063955 | 3300049460 | Bacteria | 1326 |
| 921 | Ga0501037_0037371 | 3300049573 | Bacteria | 3580 |
| 922 | Ga0501198_000072 | 3300049649 | Bacteria | 26487 |
| 923 | Ga0501222_000024 | 3300049662 | Bacteria | 65412 |
| 924 | Ga0501044_0211188 | 3300049823 | Bacteria | 1895 |
| 925 | nmdc:mga03n38_17778_c1 | 3300050490 | Bacteria | 2791 |
| 926 | nmdc:mga00v17_12227_c1 | 3300050491 | Bacteria | 4735 |
| 927 | nmdc:mga00v17_60088_c1 | 3300050491 | Bacteria | 2334 |
| 928 | nmdc:mga00v17_682496_c1 | 3300050491 | Bacteria | 659 |
| 929 | nmdc:mga0k408_131132_c1 | 3300050493 | Bacteria | 1488 |
| 930 | nmdc:mga0k408_484143_c1 | 3300050493 | Bacteria | 734 |
| 931 | nmdc:mga06z11_340964_c1 | 3300050494 | Bacteria | 896 |
| 932 | nmdc:mga07m45_1317_c1 | 3300050496 | Bacteria | 11304 |
| 933 | nmdc:mga07m45_16450_c1 | 3300050496 | Bacteria | 3960 |
| 934 | nmdc:mga07m45_905_c1 | 3300050496 | Bacteria | 12956 |
| 935 | Ga0500610_0003239 | 3300053079 | Bacteria | 6203 |
| 936 | Ga0500610_0015684 | 3300053079 | Bacteria | 3594 |
| 937 | Ga0500610_0104981 | 3300053079 | Bacteria | 1458 |
| 938 | Ga0500578_0000342 | 3300053086 | Bacteria | 56948 |
| 939 | Ga0500643_003837 | 3300053087 | Bacteria | 7002 |
| 940 | Ga0500651_0000028 | 3300053093 | Bacteria | 114592 |
| 941 | Ga0500566_0166851 | 3300053094 | Bacteria | 1142 |
| 942 | Ga0500641_0062005 | 3300053096 | Bacteria | 1559 |
| 943 | Ga0500571_000016 | 3300053110 | Bacteria | 64989 |
| 944 | Ga0500593_000167 | 3300053117 | Bacteria | 26501 |
| 945 | Ga0500607_001510 | 3300053121 | Bacteria | 20789 |
| 946 | Ga0500607_029863 | 3300053121 | Bacteria | 3009 |
| 947 | Ga0500608_065226 | 3300053122 | Bacteria | 1737 |
| 948 | Ga0500618_022250 | 3300053125 | Bacteria | 1541 |
| 949 | Ga0500626_022823 | 3300053128 | Bacteria | 2800 |
| 950 | Ga0500658_0000864 | 3300053134 | Bacteria | 12433 |
| 951 | Ga0500658_0002893 | 3300053134 | Bacteria | 6588 |
| 952 | Ga0500559_0003152 | 3300053136 | Bacteria | 8189 |
| 953 | Ga0500559_0004597 | 3300053136 | Bacteria | 6522 |
| 954 | Ga0500564_049498 | 3300053138 | Bacteria | 1924 |
| 955 | Ga0500568_0020741 | 3300053139 | Bacteria | 2838 |
| 956 | Ga0500574_028747 | 3300053141 | Bacteria | 1476 |
| 957 | Ga0500574_032796 | 3300053141 | Bacteria | 1408 |
| 958 | Ga0500616_0028263 | 3300053153 | Bacteria | 3091 |
| 959 | Ga0500627_0000710 | 3300053158 | Bacteria | 8856 |
| 960 | Ga0500633_0191528 | 3300053160 | Bacteria | 766 |
| 961 | Ga0500634_0000177 | 3300053161 | Bacteria | 21112 |
| 962 | Ga0500634_0014502 | 3300053161 | Bacteria | 4159 |
| 963 | Ga0500636_0310620 | 3300053177 | Bacteria | 771 |
| 964 | Ga0500645_000787 | 3300053730 | Bacteria | 19169 |
| 965 | Ga0500587_000482 | 3300053739 | Bacteria | 4784 |
| 966 | Ga0466962_0000180 | 3300061719 | Bacteria | 26200 |
| 967 | Ga0466962_0001916 | 3300061719 | Bacteria | 9798 |
| 968 | Ga0466962_0019617 | 3300061719 | Bacteria | 3250 |
| 969 | Ga0466962_0026332 | 3300061719 | Bacteria | 2792 |
| 970 | Ga0466962_0052815 | 3300061719 | Bacteria | 1942 |
| 971 | 2501075203 | 2501025501 | Bacteria | 7768574 |
| 972 | 2501083203 | 2501025502 | Bacteria | 9641094 |
| 973 | 2501412491 | 2501025504 | Bacteria | 8008976 |
| 974 | 2510248779 | 2510065045 | Bacteria | 7761063 |
| 975 | 2511088121 | 2510917013 | Bacteria | 9951648 |
| 976 | 2511101377 | 2510917014 | Bacteria | 8296963 |
| 977 | 2511108020 | 2510917015 | Bacteria | 7950052 |
| 978 | 2512349090 | 2512047030 | Bacteria | 9031815 |
| 979 | 2513231123 | 2513020051 | Bacteria | 6053213 |
| 980 | 2513552571 | 2513237082 | Bacteria | 8640282 |
| 981 | 2513560689 | 2513237083 | Bacteria | 8410967 |
| 982 | 2513953574 | 2513237150 | Bacteria | 6553639 |
| 983 | 2513958457 | 2513237151 | Bacteria | 6309801 |
| 984 | 2514044267 | 2513237165 | Bacteria | 6771773 |
| 985 | 2514047305 | 2513237166 | Bacteria | 10373764 |
| 986 | 2515680311 | 2515154122 | Bacteria | 8609520 |
| 987 | 2516021748 | 2515154189 | Bacteria | 9629850 |
| 988 | 2519461064 | 2519103095 | Bacteria | 6629912 |
| 989 | 2526212243 | 2526164512 | Bacteria | 4025691 |
| 990 | 2547501875 | 2547132130 | Bacteria | 4660562 |
| 991 | 2563059726 | 2562617112 | Bacteria | 10918404 |
| 992 | 2585289960 | 2582581311 | Bacteria | 6763856 |
| 993 | 2587755677 | 2585428062 | Bacteria | 6842168 |
| 994 | 2597028321 | 2596583598 | Bacteria | 5251611 |
| 995 | 2599445111 | 2599185178 | Bacteria | 5365746 |
| 996 | 2599735702 | 2599185239 | Bacteria | 8686614 |
| 997 | 2599743625 | 2599185240 | Bacteria | 7968121 |
| 998 | 2599903646 | 2599185292 | Bacteria | 6290804 |
| 999 | 2600209174 | 2599185355 | Bacteria | 7968906 |
| 1000 | 2600815027 | 2600255067 | Bacteria | 6795583 |
| 1001 | 2643860127 | 2643221569 | Bacteria | 6064337 |
| 1002 | 2643967050 | 2643221592 | Bacteria | 6608788 |
| 1003 | 2643979247 | 2643221594 | Bacteria | 5811388 |
| 1004 | 2644120165 | 2643221621 | Bacteria | 6212786 |
| 1005 | 2644139916 | 2643221625 | Bacteria | 6512927 |
| 1006 | 2644162991 | 2643221628 | Bacteria | 5745828 |
| 1007 | 2644271156 | 2643221648 | Bacteria | 6521465 |
| 1008 | 2644325346 | 2643221658 | Bacteria | 6064537 |
| 1009 | 2644399080 | 2643221672 | Bacteria | 6322190 |
| 1010 | 2644467813 | 2643221683 | Bacteria | 5749203 |
| 1011 | 2676742588 | 2675903129 | Bacteria | 7964495 |
| 1012 | 2713480566 | 2711768613 | Bacteria | 11048459 |
| 1013 | 2719642795 | 2718217991 | Bacteria | 7829542 |
| 1014 | 2723876111 | 2721755763 | Bacteria | 4464185 |
| 1015 | 2738723500 | 2738541277 | Bacteria | 7458140 |
| 1016 | 2738819179 | 2738541296 | Bacteria | 7285013 |
| 1017 | 2738831658 | 2738541298 | Bacteria | 7286732 |
| 1018 | 2738873186 | 2738541306 | Bacteria | 7284992 |
| 1019 | 2738882199 | 2738541307 | Bacteria | 8606193 |
| 1020 | 2739184816 | 2738543002 | Bacteria | 7284546 |
| 1021 | 2739219785 | 2738543008 | Bacteria | 7282815 |
| 1022 | 2739249246 | 2738543013 | Bacteria | 5618633 |
| 1023 | 2739284231 | 2738543019 | Bacteria | 7459457 |
| 1024 | 2747948539 | 2747842428 | Bacteria | 4689383 |
| 1025 | 2753570995 | 2751185846 | Bacteria | 7242164 |
| 1026 | 2765579317 | 2765235840 | Bacteria | 4663337 |
| 1027 | 2792835403 | 2791355137 | Bacteria | 9654227 |
| 1028 | 2809035881 | 2808606395 | Bacteria | 6020352 |
| 1029 | 2816517428 | 2816332141 | Bacteria | 4436036 |
| 1030 | 2817259093 | 2816332253 | Bacteria | 6764532 |
| 1031 | 2817280489 | 2816332256 | Bacteria | 6891714 |
| 1032 | 2817452320 | 2816332286 | Bacteria | 6853759 |
| 1033 | 2819619154 | 2818991450 | Bacteria | 6962147 |
| 1034 | 2819630260 | 2818991452 | Bacteria | 8442785 |
| 1035 | 2842327133 | 2842324504 | Bacteria | 9364110 |
| 1036 | 2842350738 | 2842348783 | Bacteria | 9002918 |
| 1037 | 2842391561 | 2842391507 | Bacteria | 4486072 |
| 1038 | 2842456526 | 2842454564 | Bacteria | 8730687 |
| 1039 | 2842680111 | 2842677519 | Bacteria | 5615038 |
| 1040 | 2842734725 | 2842733646 | Bacteria | 5716726 |
| 1041 | 2842748513 | 2842747753 | Bacteria | 5578255 |
| 1042 | 2856288722 | 2856287931 | Bacteria | 7223934 |
| 1043 | 2857362105 | 2857357740 | Bacteria | 9937880 |
| 1044 | 2857538866 | 2857537821 | Bacteria | 5248181 |
| 1045 | 2858953652 | 2858950400 | Bacteria | 6783797 |
| 1046 | 2863423536 | 2863421361 | Bacteria | 7300805 |
| 1047 | 2870074683 | 2870068957 | Bacteria | 8925310 |
| 1048 | 2874222004 | 2874220319 | Bacteria | 4594709 |
| 1049 | 2883090261 | 2883087390 | Bacteria | 9532701 |
| 1050 | 2885196575 | 2885192300 | Bacteria | 5882526 |
| 1051 | 2885278067 | 2885270888 | Bacteria | 9831543 |
| 1052 | 2900580511 | 2900577576 | Bacteria | 5438534 |
| 1053 | 2901306535 | 2901300506 | Bacteria | 8463898 |
| 1054 | 2902687943 | 2902682994 | Bacteria | 8951596 |
| 1055 | 2904454647 | 2904449895 | Bacteria | 6927402 |
| 1056 | 2904460430 | 2904456579 | Bacteria | 6819253 |
| 1057 | 2904547779 | 2904541872 | Bacteria | 8915136 |
| 1058 | 2904569604 | 2904564687 | Bacteria | 7609577 |
| 1059 | 2904576915 | 2904571731 | Bacteria | 7608790 |
| 1060 | 2904620084 | 2904615490 | Bacteria | 10047340 |
| 1061 | 2919089353 | 2919089067 | Bacteria | 4560942 |
| 1062 | 2919135711 | 2919134579 | Bacteria | 4480386 |
| 1063 | 2919464231 | 2919462493 | Bacteria | 5817112 |
| 1064 | 2919529605 | 2919527303 | Bacteria | 7718827 |
| 1065 | 2928060278 | 2928058823 | Bacteria | 5520022 |
| 1066 | 2928090157 | 2928084124 | Bacteria | 7159212 |
| 1067 | 2928114073 | 2928108538 | Bacteria | 7360024 |
| 1068 | 2928120338 | 2928115317 | Bacteria | 6477646 |
| 1069 | 2928141449 | 2928135762 | Bacteria | 7259641 |
| 1070 | 2928157855 | 2928157003 | Bacteria | 7522202 |
| 1071 | 2928165621 | 2928163908 | Bacteria | 7561269 |
| 1072 | 2928179041 | 2928170801 | Bacteria | 8785406 |
| 1073 | 2928497480 | 2928496128 | Bacteria | 4631123 |
| 1074 | 2928504560 | 2928503688 | Bacteria | 7268108 |
| 1075 | 2928536994 | 2928536128 | Bacteria | 7657547 |
| 1076 | 2929166980 | 2929160207 | Bacteria | 9075316 |
| 1077 | 2929524628 | 2929520902 | Bacteria | 6765052 |
| 1078 | 2931380406 | 2931380184 | Bacteria | 4455911 |
| 1079 | 2937612839 | 2937610967 | Bacteria | 4618818 |
| 1080 | 2939591752 | 2939589442 | Bacteria | 4214238 |
| 1081 | 2939626974 | 2939626828 | Bacteria | 4695272 |
| 1082 | 2941483425 | |||
| 1083 | 2945912167 | 2945909444 | Bacteria | 7065066 |
| 1084 | 2945940190 | 2945934425 | Bacteria | 7444609 |
| 1085 | 2945947051 | 2945945610 | Bacteria | 5951079 |
| 1086 | 2945976742 | 2945972063 | Bacteria | 6086495 |
| 1087 | 2945985545 | 2945984333 | Bacteria | 7358892 |
| 1088 | 2954771785 | 2954767861 | Bacteria | 5535784 |
| 1089 | 2961048771 | 2961047084 | Bacteria | 4594415 |
| 1090 | 2961067674 | 2961064222 | Bacteria | 4749990 |
| 1091 | 2974308717 | 2974307012 | Bacteria | 4172388 |
| 1092 | 2977249456 | 2977247770 | Bacteria | 4160543 |
| 1093 | 2981990869 | 2981990288 | Bacteria | 7590678 |
| 1094 | 2984516076 | 2984514374 | Bacteria | 4172479 |
| 1095 | 2990707321 | 2990703756 | Bacteria | 7715990 |
| 1096 | 642423762 | 641736151 | Bacteria | 7477263 |
| 1097 | 642419997 | 641736154 | Bacteria | 7689995 |
| 1098 | 642598101 | 642555112 | Bacteria | 8676562 |
| 1099 | 644750393 | 644736347 | Bacteria | 6476522 |
| 1100 | 8003958354 | 8003955200 | Bacteria | 8601927 |
| 1101 | 8018853100 | 8018845410 | Bacteria | 8933938 |
| 1102 | 8020812867 | 8020807995 | Bacteria | 6801506 |
| 1103 | 8020940705 | 8020938398 | Bacteria | 7472757 |
| 1104 | 8020949730 | 8020945358 | Bacteria | 8467355 |
| 1105 | 8020954286 | 8020953355 | Bacteria | 7439080 |
| 1106 | 8021121195 | 8021120328 | Bacteria | 8782274 |
| 1107 | 8039101886 | 8039098773 | Bacteria | 6602928 |
| 1108 | 8040173516 | 8040173305 | Bacteria | 6827067 |
| 1109 | 8055269313 | 8055266321 | Bacteria | 7999742 |
| 1110 | 8055303634 | 8055301274 | Bacteria | 8587385 |
| 1111 | Ga0395905_0181414 | |||
| 1112 | JGI24740J21852_10000188 | |||
| 1113 | JGI24740J21852_10031126 | |||
| 1114 | JGI24739J22299_10006875 | |||
| 1115 | JGI24739J22299_10027695 | |||
| 1116 | JGI24735J21928_10000295 | |||
| 1117 | JGI24735J21928_10002557 | |||
| 1118 | JGI24735J21928_10025903 | |||
| 1119 | JGI24735J21928_10041993 | |||
| 1120 | JGI24735J21928_10062451 | |||
| 1121 | JGI24738J21930_10001725 | |||
| 1122 | JGI25154J39366_1001255 | |||
| 1123 | JGI25152J39213_1024242 | |||
| 1124 | JGI25151J46595_10000304 | |||
| 1125 | JGI25151J46595_10002852 | |||
| 1126 | JGI25165J46597_1001102 | |||
| 1127 | rootH2_10000556 | |||
| 1128 | JGI25160J50197_1000037 | |||
| 1129 | Ga0006562J51391_1170292 | |||
| 1130 | Ga0055538_1001884 | |||
| 1131 | Ga0055538_1002979 | |||
| 1132 | Ga0055539_1000086 | |||
| 1133 | Ga0055533_1000184 | |||
| 1134 | Ga0055533_1002302 | |||
| 1135 | Ga0055533_1003066 | |||
| 1136 | Ga0055533_1003087 | |||
| 1137 | Ga0055532_1000007 | |||
| 1138 | Ga0055532_1000041 | |||
| 1139 | Ga0055532_1000963 | |||
| 1140 | Ga0055525_1000469 | |||
| 1141 | Ga0055527_1000007 | |||
| 1142 | Ga0055527_1000191 | |||
| 1143 | Ga0055527_1000672 | |||
| 1144 | Ga0055535_1000005 | |||
| 1145 | Ga0055535_1000030 | |||
| 1146 | Ga0055535_1000399 | |||
| 1147 | Ga0055535_1002045 | |||
| 1148 | Ga0055542_1000008 | |||
| 1149 | Ga0055542_1001050 | |||
| 1150 | Ga0055542_1001927 | |||
| 1151 | Ga0055542_1004466 | |||
| 1152 | Ga0055529_1000005 | |||
| 1153 | Ga0055529_1000058 | |||
| 1154 | Ga0055529_1001344 | |||
| 1155 | Ga0055529_1011975 | |||
| 1156 | Ga0055526_1000973 | |||
| 1157 | Ga0055526_1007037 | |||
| 1158 | Ga0055526_1020666 | |||
| 1159 | Ga0055537_1000168 | |||
| 1160 | Ga0055537_1000700 | |||
| 1161 | Ga0055524_1006063 | |||
| 1162 | Ga0055524_1025073 | |||
| 1163 | Ga0055536_1000124 | |||
| 1164 | Ga0055536_1000359 | |||
| 1165 | Ga0055536_1001816 | |||
| 1166 | Ga0055534_1000024 | |||
| 1167 | Ga0055534_1000115 | |||
| 1168 | Ga0055534_1000953 | |||
| 1169 | Ga0055534_1032382 | |||
| 1170 | Ga0055528_1000348 | |||
| 1171 | Ga0055528_1000446 | |||
| 1172 | Ga0055530_10000021 | |||
| 1173 | Ga0055530_10000323 | |||
| 1174 | Ga0055530_10023750 | |||
| 1175 | Ga0055540_1000408 | |||
| 1176 | Ga0055540_1000433 | |||
| 1177 | Ga0055540_1056699 | |||
| 1178 | Ga0055531_10013971 | |||
| 1179 | Ga0055531_10041144 | |||
| 1180 | Ga0055541_1007307 | |||
| 1181 | Ga0058692_1000009 | |||
| 1182 | Ga0058692_1002370 | |||
| 1183 | Ga0058692_1041772 | |||
| 1184 | Ga0065165_1000629 | |||
| 1185 | Ga0065165_1048682 | |||
| 1186 | Ga0065714_10002862 | |||
| 1187 | Ga0070658_10003973 | |||
| 1188 | Ga0070658_10031180 | |||
| 1189 | Ga0070658_10091806 | |||
| 1190 | Ga0070658_10106600 | |||
| 1191 | Ga0070676_10243199 | |||
| 1192 | Ga0070670_100591915 | |||
| 1193 | Ga0070666_10200256 | |||
| 1194 | Ga0070682_100165642 | |||
| 1195 | Ga0070660_100000833 | |||
| 1196 | Ga0070660_100006982 | |||
| 1197 | Ga0070661_100000267 | |||
| 1198 | Ga0070661_100340545 | |||
| 1199 | Ga0070669_100029840 | |||
| 1200 | Ga0070675_100416940 | |||
| 1201 | Ga0070675_100848805 | |||
| 1202 | Ga0070688_100699863 | |||
| 1203 | Ga0070659_100000858 | |||
| 1204 | Ga0070659_100001606 | |||
| 1205 | Ga0070659_100318973 | |||
| 1206 | Ga0070667_100572864 | |||
| 1207 | Ga0070663_100000082 | |||
| 1208 | Ga0070663_100001523 | |||
| 1209 | Ga0070663_100272935 | |||
| 1210 | Ga0070678_100198690 | |||
| 1211 | Ga0070678_100671587 | |||
| 1212 | Ga0070684_100509692 | |||
| 1213 | Ga0070672_100159122 | |||
| 1214 | Ga0070665_100006462 | |||
| 1215 | Ga0070665_100039729 | |||
| 1216 | Ga0068855_100013980 | |||
| 1217 | Ga0068855_100026993 | |||
| 1218 | Ga0070664_100000274 | |||
| 1219 | Ga0070664_100001095 | |||
| 1220 | Ga0068854_100000341 | |||
| 1221 | Ga0068856_100000527 | |||
| 1222 | Ga0068856_100326522 | |||
| 1223 | Ga0068856_100336448 | |||
| 1224 | Ga0068852_100028158 | |||
| 1225 | Ga0068852_100145810 | |||
| 1226 | Ga0068852_100747715 | |||
| 1227 | Ga0068863_100575787 | |||
| 1228 | Ga0068858_100492169 | |||
| 1229 | Ga0075365_10022502 | |||
| 1230 | Ga0075368_10184634 | |||
| 1231 | Ga0075363_100032856 | |||
| 1232 | Ga0075363_100038398 | |||
| 1233 | Ga0075363_100356827 | |||
| 1234 | Ga0075364_10022213 | |||
| 1235 | Ga0075364_10059507 | |||
| 1236 | Ga0075364_10080560 | |||
| 1237 | Ga0075432_10006369 | |||
| 1238 | Ga0075362_10003585 | |||
| 1239 | Ga0075362_10109344 | |||
| 1240 | Ga0075367_10052865 | |||
| 1241 | Ga0075367_10054619 | |||
| 1242 | Ga0075367_10077115 | |||
| 1243 | Ga0075367_10231183 | |||
| 1244 | Ga0075369_10040530 | |||
| 1245 | Ga0075366_10004632 | |||
| 1246 | Ga0075366_10016205 | |||
| 1247 | Ga0097621_100630353 | |||
| 1248 | Ga0075370_10000045 | |||
| 1249 | Ga0075370_10016917 | |||
| 1250 | Ga0075370_10101048 | |||
| 1251 | Ga0099826_10000132 | |||
| 1252 | Ga0099826_10066190 | |||
| 1253 | Ga0105251_10000085 | |||
| 1254 | Ga0105251_10000195 | |||
| 1255 | Ga0105251_10013696 | |||
| 1256 | Ga0105251_10075319 | |||
| 1257 | Ga0105244_10047560 | |||
| 1258 | Ga0105250_10102813 | |||
| 1259 | Ga0105240_10001007 | |||
| 1260 | Ga0105240_10002439 | |||
| 1261 | Ga0105240_10018449 | |||
| 1262 | Ga0105240_10094053 | |||
| 1263 | Ga0105240_10121379 | |||
| 1264 | Ga0105240_10467877 | |||
| 1265 | Ga0105243_10008382 | |||
| 1266 | Ga0105243_10010744 | |||
| 1267 | Ga0105243_10211677 | |||
| 1268 | Ga0105243_10333283 | |||
| 1269 | Ga0105241_10226142 | |||
| 1270 | Ga0105241_10421667 | |||
| 1271 | Ga0105237_10013644 | |||
| 1272 | Ga0105237_10028203 | |||
| 1273 | Ga0105237_10097247 | |||
| 1274 | Ga0105238_10024279 | |||
| 1275 | Ga0105238_10070687 | |||
| 1276 | Ga0105238_10112683 | |||
| 1277 | Ga0105249_10882111 | |||
| 1278 | Ga0105239_10002601 | |||
| 1279 | Ga0105239_10048975 | |||
| 1280 | Ga0105239_10617946 | |||
| 1281 | Ga0105246_10195551 | |||
| 1282 | Ga0157327_1020166 | |||
| 1283 | Ga0157373_10035498 | |||
| 1284 | Ga0157373_10036300 | |||
| 1285 | Ga0157373_10051805 | |||
| 1286 | Ga0157373_10194991 | |||
| 1287 | Ga0157371_10000022 | |||
| 1288 | Ga0157371_10000613 | |||
| 1289 | Ga0157371_10020173 | |||
| 1290 | Ga0157370_10000004 | |||
| 1291 | Ga0157370_10002960 | |||
| 1292 | Ga0157370_10009604 | |||
| 1293 | Ga0157370_10012552 | |||
| 1294 | Ga0157369_10005113 | |||
| 1295 | Ga0157369_10011117 | |||
| 1296 | Ga0157369_10022890 | |||
| 1297 | Ga0157369_10023753 | |||
| 1298 | Ga0157369_10081071 | |||
| 1299 | Ga0157369_10117995 | |||
| 1300 | Ga0157369_10815426 | |||
| 1301 | Ga0157374_10000219 | |||
| 1302 | Ga0157374_10478371 | |||
| 1303 | Ga0157372_10002559 | |||
| 1304 | Ga0157372_10007566 | |||
| 1305 | Ga0157375_10246850 | |||
| 1306 | Ga0157375_10906999 | |||
| 1307 | Ga0182008_10000070 | |||
| 1308 | Ga0182008_10005687 | |||
| 1309 | Ga0182008_10011571 | |||
| 1310 | Ga0182008_10016590 | |||
| 1311 | Ga0182008_10034228 | |||
| 1312 | Ga0182008_10117743 | |||
| 1313 | Ga0182008_10187476 | |||
| 1314 | Ga0182008_10189423 | |||
| 1315 | Ga0182006_1000709 | |||
| 1316 | Ga0182006_1026368 | |||
| 1317 | Ga0182006_1035522 | |||
| 1318 | Ga0182006_1046290 | |||
| 1319 | Ga0182006_1056141 | |||
| 1320 | Ga0182007_10000004 | |||
| 1321 | Ga0182007_10000576 | |||
| 1322 | Ga0182007_10030700 | |||
| 1323 | Ga0182007_10033144 | |||
| 1324 | Ga0182007_10044219 | |||
| 1325 | Ga0182005_1020255 | |||
| 1326 | Ga0182005_1062316 | |||
| 1327 | Ga0182005_1065907 | |||
| 1328 | Ga0183362_10002 | |||
| 1329 | Ga0183361_10004 | |||
| 1330 | Ga0163161_10000139 | |||
| 1331 | Ga0163161_10005865 | |||
| 1332 | Ga0163161_10265029 | |||
| 1333 | Ga0163161_10311246 | |||
| 1334 | Ga0163161_10490307 | |||
| 1335 | Ga0206351_10088385 | |||
| 1336 | Ga0154015_1439323 | |||
| 1337 | Ga0209784_100029 | |||
| 1338 | Ga0209784_101356 | |||
| 1339 | Ga0209566_100030 | |||
| 1340 | Ga0209566_100807 | |||
| 1341 | Ga0209566_101195 | |||
| 1342 | Ga0209566_103041 | |||
| 1343 | Ga0209674_100020 | |||
| 1344 | Ga0209674_100029 | |||
| 1345 | Ga0209674_100075 | |||
| 1346 | Ga0209674_100160 | |||
| 1347 | Ga0209674_102918 | |||
| 1348 | Ga0209672_100012 | |||
| 1349 | Ga0209672_100013 | |||
| 1350 | Ga0209672_100093 | |||
| 1351 | Ga0209672_100175 | |||
| 1352 | Ga0209672_102442 | |||
| 1353 | Ga0209147_100007 | |||
| 1354 | Ga0209147_100008 | |||
| 1355 | Ga0209147_100013 | |||
| 1356 | Ga0209147_100074 | |||
| 1357 | Ga0209147_100134 | |||
| 1358 | Ga0209563_100091 | |||
| 1359 | Ga0209563_100092 | |||
| 1360 | Ga0209563_100484 | |||
| 1361 | Ga0209563_104619 | |||
| 1362 | Ga0207427_101111 | |||
| 1363 | Ga0209258_100013 | |||
| 1364 | Ga0209258_100014 | |||
| 1365 | Ga0209258_100016 | |||
| 1366 | Ga0209258_100209 | |||
| 1367 | Ga0209646_1000019 | |||
| 1368 | Ga0209677_100030 | |||
| 1369 | Ga0209677_101579 | |||
| 1370 | Ga0209677_118632 | |||
| 1371 | Ga0209148_1000020 | |||
| 1372 | Ga0209148_1000118 | |||
| 1373 | Ga0209148_1000184 | |||
| 1374 | Ga0209148_1001921 | |||
| 1375 | Ga0209148_1002607 | |||
| 1376 | Ga0209759_1000008 | |||
| 1377 | Ga0209759_1000022 | |||
| 1378 | Ga0209759_1002763 | |||
| 1379 | Ga0209759_1003296 | |||
| 1380 | Ga0209759_1005327 | |||
| 1381 | Ga0209759_1014515 | |||
| 1382 | Ga0209759_1029014 | |||
| 1383 | Ga0209129_1000873 | |||
| 1384 | Ga0209233_1000055 | |||
| 1385 | Ga0209565_1000024 | |||
| 1386 | Ga0209565_1000040 | |||
| 1387 | Ga0209565_1011161 | |||
| 1388 | Ga0209455_1000017 | |||
| 1389 | Ga0209455_1000106 | |||
| 1390 | Ga0209455_1000160 | |||
| 1391 | Ga0209455_1001972 | |||
| 1392 | Ga0209673_1000046 | |||
| 1393 | Ga0209673_1000109 | |||
| 1394 | Ga0209673_1000413 | |||
| 1395 | Ga0209673_1002008 | |||
| 1396 | Ga0209130_1009220 | |||
| 1397 | Ga0209130_1016600 | |||
| 1398 | Ga0209675_1000024 | |||
| 1399 | Ga0209675_1000039 | |||
| 1400 | Ga0209675_1000129 | |||
| 1401 | Ga0209675_1001803 | |||
| 1402 | Ga0209675_1020366 | |||
| 1403 | Ga0209675_1046902 | |||
| 1404 | Ga0209676_1000011 | |||
| 1405 | Ga0209676_1000014 | |||
| 1406 | Ga0209676_1000071 | |||
| 1407 | Ga0209676_1000075 | |||
| 1408 | Ga0209025_1000232 | |||
| 1409 | Ga0209025_1000382 | |||
| 1410 | Ga0209025_1000446 | |||
| 1411 | Ga0209025_1001095 | |||
| 1412 | Ga0209025_1021309 | |||
| 1413 | Ga0209025_1025421 | |||
| 1414 | Ga0209025_1030698 | |||
| 1415 | Ga0209564_1000309 | |||
| 1416 | Ga0209564_1000411 | |||
| 1417 | Ga0209564_1001305 | |||
| 1418 | Ga0209564_1003422 | |||
| 1419 | Ga0209050_1000032 | |||
| 1420 | Ga0209050_1000069 | |||
| 1421 | Ga0209050_1000720 | |||
| 1422 | Ga0209050_1003935 | |||
| 1423 | Ga0209050_1068900 | |||
| 1424 | Ga0209256_1000134 | |||
| 1425 | Ga0209256_1012635 | |||
| 1426 | Ga0209256_1020757 | |||
| 1427 | Ga0207426_1000004 | |||
| 1428 | Ga0209051_1000092 | |||
| 1429 | Ga0209051_1000169 | |||
| 1430 | Ga0209051_1002066 | |||
| 1431 | Ga0209051_1013463 | |||
| 1432 | Ga0209257_1000014 | |||
| 1433 | Ga0209257_1000571 | |||
| 1434 | Ga0209257_1000722 | |||
| 1435 | Ga0209257_1009463 | |||
| 1436 | Ga0207655_1048697 | |||
| 1437 | Ga0207713_1001373 | |||
| 1438 | Ga0207713_1003740 | |||
| 1439 | Ga0207713_1043532 | |||
| 1440 | Ga0207713_1095743 | |||
| 1441 | Ga0207680_10201499 | |||
| 1442 | Ga0207647_10002375 | |||
| 1443 | Ga0207647_10012862 | |||
| 1444 | Ga0207647_10019436 | |||
| 1445 | Ga0207647_10022845 | |||
| 1446 | Ga0207647_10052462 | |||
| 1447 | Ga0207647_10077029 | |||
| 1448 | Ga0207705_10000420 | |||
| 1449 | Ga0207695_10000171 | |||
| 1450 | Ga0207695_10002092 | |||
| 1451 | Ga0207695_10028576 | |||
| 1452 | Ga0207695_10127948 | |||
| 1453 | Ga0207695_10340023 | |||
| 1454 | Ga0207695_10372770 | |||
| 1455 | Ga0207695_10888510 | |||
| 1456 | Ga0207671_10022820 | |||
| 1457 | Ga0207671_10062975 | |||
| 1458 | Ga0207671_10072418 | |||
| 1459 | Ga0207657_10000002 | |||
| 1460 | Ga0207657_10010805 | |||
| 1461 | Ga0207649_10000335 | |||
| 1462 | Ga0207649_10000468 | |||
| 1463 | Ga0207681_10010845 | |||
| 1464 | Ga0207694_10071654 | |||
| 1465 | Ga0207694_10721457 | |||
| 1466 | Ga0207659_10276821 | |||
| 1467 | Ga0207690_10000011 | |||
| 1468 | Ga0207690_10000176 | |||
| 1469 | Ga0207690_10292520 | |||
| 1470 | Ga0207686_10454097 | |||
| 1471 | Ga0207709_10000038 | |||
| 1472 | Ga0207709_10004913 | |||
| 1473 | Ga0207709_10019495 | |||
| 1474 | Ga0207691_10203543 | |||
| 1475 | Ga0207679_10000168 | |||
| 1476 | Ga0207679_10000229 | |||
| 1477 | Ga0207667_10026258 | |||
| 1478 | Ga0207667_10035219 | |||
| 1479 | Ga0207667_10043871 | |||
| 1480 | Ga0207667_10619107 | |||
| 1481 | Ga0207640_10000289 | |||
| 1482 | Ga0207640_10159791 | |||
| 1483 | Ga0207658_10023311 | |||
| 1484 | Ga0207677_10433889 | |||
| 1485 | Ga0207703_10400911 | |||
| 1486 | Ga0207678_10000334 | |||
| 1487 | Ga0207678_10000677 | |||
| 1488 | Ga0207678_10292425 | |||
| 1489 | Ga0207702_10000537 | |||
| 1490 | Ga0207702_10840403 | |||
| 1491 | Ga0207641_10340622 | |||
| 1492 | Ga0207674_10009467 | |||
| 1493 | Ga0207683_10072739 | |||
| 1494 | Ga0207683_10327772 | |||
| 1495 | Ga0207698_10117038 | |||
| 1496 | Ga0207698_10346292 | |||
| 1497 | Ga0207698_10993853 | |||
| 1498 | Ga0209371_1000023 | |||
| 1499 | Ga0209371_1001595 | |||
| 1500 | Ga0209371_1006823 | |||
| 1501 | Ga0209282_1000032 | |||
| 1502 | Ga0209282_1000127 | |||
| 1503 | Ga0209813_10178787 | |||
| 1504 | Ga0268266_10007180 | |||
| 1505 | Ga0268266_10098400 | |||
| 1506 | Ga0268266_10745300 | |||
| 1507 | Ga0268265_10005086 | |||
| 1508 | Ga0307517_10280209 | |||
| 1509 | Ga0307515_10000618 | |||
| 1510 | Ga0307515_10001346 | |||
| 1511 | Ga0307515_10001873 | |||
| 1512 | Ga0307515_10014468 | |||
| 1513 | Ga0265338_10000270 | |||
| 1514 | Ga0268256_1000023 | |||
| 1515 | Ga0268256_1001380 | |||
| 1516 | Ga0268256_1006937 | |||
| 1517 | Ga0307512_10034925 | |||
| 1518 | Ga0316177_1007272 | |||
| 1519 | Ga0316177_1155703 | |||
| 1520 | Ga0316176_1109634 | |||
| 1521 | Ga0314311_1020500 | |||
| 1522 | Ga0316179_1048542 | |||
| 1523 | Ga0316178_1040985 | |||
| 1524 | Ga0316180_1037427 | |||
| 1525 | Ga0316183_1157955 | |||
| 1526 | Ga0316181_1023192 | |||
| 1527 | Ga0316182_1156455 | |||
| 1528 | Ga0316182_1211692 | |||
| 1529 | Ga0265332_10045646 | |||
| 1530 | Ga0265340_10084569 | |||
| 1531 | Ga0265327_10017002 | |||
| 1532 | Ga0265316_10009820 | |||
| 1533 | Ga0265316_10096979 | |||
| 1534 | Ga0307513_10086758 | |||
| 1535 | Ga0307513_10483237 | |||
| 1536 | Ga0307509_10013250 | |||
| 1537 | Ga0307408_100003959 | |||
| 1538 | Ga0307408_100128688 | |||
| 1539 | Ga0307408_100194290 | |||
| 1540 | Ga0307408_100565879 | |||
| 1541 | Ga0307508_10000053 | |||
| 1542 | Ga0307514_10035015 | |||
| 1543 | Ga0316576_10071642 | |||
| 1544 | Ga0316576_10158704 | |||
| 1545 | Ga0316578_10059541 | |||
| 1546 | Ga0307516_10001663 | |||
| 1547 | Ga0307516_10249984 | |||
| 1548 | Ga0307405_10004656 | |||
| 1549 | Ga0307405_10017276 | |||
| 1550 | Ga0307405_10194828 | |||
| 1551 | Ga0316577_10066463 | |||
| 1552 | Ga0307413_10416287 | |||
| 1553 | Ga0307410_10358594 | |||
| 1554 | Ga0307410_10468455 | |||
| 1555 | Ga0307406_10001449 | |||
| 1556 | Ga0307406_10029459 | |||
| 1557 | Ga0307406_10180811 | |||
| 1558 | Ga0307406_10261138 | |||
| 1559 | Ga0307407_10417630 | |||
| 1560 | Ga0307412_10000099 | |||
| 1561 | Ga0307412_10000307 | |||
| 1562 | Ga0307412_10000384 | |||
| 1563 | Ga0307412_10010187 | |||
| 1564 | Ga0307412_10016243 | |||
| 1565 | Ga0307412_10253650 | |||
| 1566 | Ga0307412_10321553 | |||
| 1567 | Ga0307409_100834117 | |||
| 1568 | Ga0307416_100025774 | |||
| 1569 | Ga0307416_100057543 | |||
| 1570 | Ga0307414_10173269 | |||
| 1571 | Ga0307414_10551212 | |||
| 1572 | Ga0307411_10218905 | |||
| 1573 | Ga0316580_10110045 | |||
| 1574 | Ga0307507_10059857 | |||
| 1575 | Ga0373931_0002570 | |||
| 1576 | Ga0395899_0000005 | |||
| 1577 | Ga0395899_0015842 | |||
| 1578 | Ga0395899_0015933 | |||
| 1579 | Ga0395900_0000003 | |||
| 1580 | Ga0395900_0000053 | |||
| 1581 | Ga0395900_0010925 | |||
| 1582 | Ga0395900_0052368 | |||
| 1583 | Ga0395900_0064319 | |||
| 1584 | Ga0395900_0082021 | |||
| 1585 | Ga0395900_0150122 | |||
| 1586 | Ga0395898_0000003 | |||
| 1587 | Ga0395898_0000421 | |||
| 1588 | Ga0395898_0009549 | |||
| 1589 | Ga0395898_0036527 | |||
| 1590 | Ga0395898_0216760 | |||
| 1591 | Ga0395905_0000082 | |||
| 1592 | Ga0395905_0127089 | |||
| 1593 | Ga0395905_0303158 | |||
| 1594 | Ga0395905_0323179 | |||
| 1595 | Ga0395901_0000026 | |||
| 1596 | Ga0395901_0000042 | |||
| 1597 | Ga0395901_0002709 | |||
| 1598 | Ga0395901_0006320 | |||
| 1599 | Ga0395901_0214207 | |||
| 1600 | Ga0436365_0462895 | |||
| 1601 | Ga0439436_0047734 | |||
| 1602 | Ga0439466_0007379 | |||
| 1603 | Ga0439466_0029151 | |||
| 1604 | Ga0451797_0775968 | |||
| 1605 | Ga0451795_1600842 | |||
| 1606 | Ga0451802_0924306 | |||
| 1607 | Ga0451839_1417277 | |||
| 1608 | Ga0439431_0107604 | |||
| 1609 | Ga0439433_0004268 | |||
| 1610 | Ga0439442_000570 | |||
| 1611 | Ga0439445_0044091 | |||
| 1612 | Ga0439445_0052789 | |||
| 1613 | Ga0439448_0008912 | |||
| 1614 | Ga0439432_005383 | |||
| 1615 | Ga0450911_000205 | |||
| 1616 | Ga0450923_030597 | |||
| 1617 | Ga0450894_010278 | |||
| 1618 | Ga0450906_001618 | |||
| 1619 | Ga0450910_001159 | |||
| 1620 | Ga0439458_0020739 | |||
| 1621 | Ga0450908_000955 | |||
| 1622 | Ga0439434_0001564 | |||
| 1623 | Ga0451577_0002963 | |||
| 1624 | Ga0466986_0011918 | |||
| 1625 | Ga0466969_0009726 | |||
| 1626 | Ga0466969_0013326 | |||
| 1627 | Ga0466972_0005561 | |||
| 1628 | Ga0466972_0006396 | |||
| 1629 | Ga0466972_0079312 | |||
| 1630 | Ga0466982_0023348 | |||
| 1631 | Ga0466965_0000647 | |||
| 1632 | Ga0466965_0032830 | |||
| 1633 | Ga0466966_0000035 | |||
| 1634 | Ga0466966_0068457 | |||
| 1635 | Ga0466966_0093843 | |||
| 1636 | Ga0466966_0149199 | |||
| 1637 | Ga0466961_0000053 | |||
| 1638 | Ga0466961_0000336 | |||
| 1639 | Ga0466961_0013896 | |||
| 1640 | Ga0466961_0022748 | |||
| 1641 | Ga0466961_0047699 | |||
| 1642 | Ga0466961_0143486 | |||
| 1643 | Ga0466961_0165343 | |||
| 1644 | Ga0466961_0241355 | |||
| 1645 | Ga0466963_0010944 | |||
| 1646 | Ga0466964_0009554 | |||
| 1647 | Ga0453684_0337396 | |||
| 1648 | Ga0466971_0058409 | |||
| 1649 | Ga0466971_0178257 | |||
| 1650 | Ga0466968_0008978 | |||
| 1651 | Ga0466968_0050712 | |||
| 1652 | Ga0466970_0000691 | |||
| 1653 | Ga0466970_0081594 | |||
| 1654 | Ga0466970_0095450 | |||
| 1655 | Ga0466970_0207290 | |||
| 1656 | Ga0466957_0090477 | |||
| 1657 | Ga0466957_0151919 | |||
| 1658 | Ga0466957_0289252 | |||
| 1659 | Ga0466957_0727094 | |||
| 1660 | Ga0466959_0000536 | |||
| 1661 | Ga0466959_0020141 | |||
| 1662 | Ga0466959_0038648 | |||
| 1663 | Ga0466959_0138489 | |||
| 1664 | Ga0466959_0148957 | |||
| 1665 | Ga0451576_0793505 | |||
| 1666 | Ga0466958_0003134 | |||
| 1667 | Ga0466958_0008375 | |||
| 1668 | Ga0466958_0037591 | |||
| 1669 | Ga0466967_0002309 | |||
| 1670 | Ga0466967_0017394 | |||
| 1671 | Ga0466967_0452265 | |||
| 1672 | Ga0495627_013120 | |||
| 1673 | Ga0495592_0004473 | |||
| 1674 | Ga0495592_0011711 | |||
| 1675 | Ga0495592_0034294 | |||
| 1676 | Ga0495592_0256043 | |||
| 1677 | Ga0495603_0000314 | |||
| 1678 | Ga0495603_0000829 | |||
| 1679 | Ga0495603_0001095 | |||
| 1680 | Ga0495590_0000532 | |||
| 1681 | Ga0495590_0011310 | |||
| 1682 | Ga0495590_0028532 | |||
| 1683 | Ga0495590_0032454 | |||
| 1684 | Ga0495591_001445 | |||
| 1685 | Ga0495591_020044 | |||
| 1686 | Ga0495629_0001045 | |||
| 1687 | Ga0495629_0001355 | |||
| 1688 | Ga0495629_0009735 | |||
| 1689 | Ga0495629_0025773 | |||
| 1690 | Ga0495638_0008288 | |||
| 1691 | Ga0495638_0030479 | |||
| 1692 | Ga0495638_0339899 | |||
| 1693 | Ga0495641_0005366 | |||
| 1694 | Ga0495651_0004504 | |||
| 1695 | Ga0495651_0010112 | |||
| 1696 | Ga0495653_0001129 | |||
| 1697 | Ga0495653_0037733 | |||
| 1698 | Ga0495653_0081863 | |||
| 1699 | Ga0495653_0113137 | |||
| 1700 | Ga0495653_0254242 | |||
| 1701 | Ga0495650_0000785 | |||
| 1702 | Ga0495650_0044736 | |||
| 1703 | Ga0495650_0130688 | |||
| 1704 | Ga0495580_0000009 | |||
| 1705 | Ga0495580_0000090 | |||
| 1706 | Ga0495580_0002321 | |||
| 1707 | Ga0495580_0008992 | |||
| 1708 | Ga0495580_0017639 | |||
| 1709 | Ga0495580_0029284 | |||
| 1710 | Ga0495580_0037251 | |||
| 1711 | Ga0495582_0000149 | |||
| 1712 | Ga0495582_0147028 | |||
| 1713 | Ga0495605_0006972 | |||
| 1714 | Ga0495605_0022475 | |||
| 1715 | Ga0495605_0172387 | |||
| 1716 | Ga0495639_0033005 | |||
| 1717 | Ga0495662_0062602 | |||
| 1718 | Ga0495662_0064927 | |||
| 1719 | Ga0495662_0130127 | |||
| 1720 | Ga0495664_0000841 | |||
| 1721 | Ga0495664_0178640 | |||
| 1722 | Ga0495664_0305854 | |||
| 1723 | Ga0495584_0091524 | |||
| 1724 | Ga0495585_0053061 | |||
| 1725 | Ga0495596_0001240 | |||
| 1726 | Ga0495596_0001953 | |||
| 1727 | Ga0495596_0042453 | |||
| 1728 | Ga0495596_0068397 | |||
| 1729 | Ga0495607_0004706 | |||
| 1730 | Ga0495606_0044207 | |||
| 1731 | Ga0495606_0115161 | |||
| 1732 | Ga0495606_0136314 | |||
| 1733 | Ga0495606_0253939 | |||
| 1734 | Ga0495608_0116226 | |||
| 1735 | Ga0495608_0151551 | |||
| 1736 | Ga0495608_0287737 | |||
| 1737 | Ga0495610_0000801 | |||
| 1738 | Ga0495610_0001684 | |||
| 1739 | Ga0495610_0007797 | |||
| 1740 | Ga0495610_0057560 | |||
| 1741 | Ga0495610_0212895 | |||
| 1742 | Ga0495616_0004225 | |||
| 1743 | Ga0495616_0006997 | |||
| 1744 | Ga0495618_0002845 | |||
| 1745 | Ga0495618_0005116 | |||
| 1746 | Ga0495618_0007341 | |||
| 1747 | Ga0495620_0088171 | |||
| 1748 | Ga0495620_0195273 | |||
| 1749 | Ga0495628_0000686 | |||
| 1750 | Ga0495628_0087838 | |||
| 1751 | Ga0495628_0423713 | |||
| 1752 | Ga0495630_0002882 | |||
| 1753 | Ga0495630_0065202 | |||
| 1754 | Ga0495631_0000277 | |||
| 1755 | Ga0495631_0000415 | |||
| 1756 | Ga0495632_0083848 | |||
| 1757 | Ga0495637_0023139 | |||
| 1758 | Ga0495643_0000612 | |||
| 1759 | Ga0495643_0012668 | |||
| 1760 | Ga0495643_0089381 | |||
| 1761 | Ga0495643_0164780 | |||
| 1762 | Ga0495648_0001922 | |||
| 1763 | Ga0495648_0037685 | |||
| 1764 | Ga0495648_0065967 | |||
| 1765 | Ga0495648_0071448 | |||
| 1766 | Ga0495666_0000262 | |||
| 1767 | Ga0495666_0001367 | |||
| 1768 | Ga0495666_0012949 | |||
| 1769 | Ga0495666_0041449 | |||
| 1770 | Ga0495642_0043689 | |||
| 1771 | Ga0495642_0251145 | |||
| 1772 | Ga0495652_0003339 | |||
| 1773 | Ga0495652_0039211 | |||
| 1774 | Ga0495652_0170978 | |||
| 1775 | Ga0495665_0000891 | |||
| 1776 | Ga0495665_0032568 | |||
| 1777 | Ga0495665_0041706 | |||
| 1778 | Ga0495665_0207024 | |||
| 1779 | Ga0495640_0003423 | |||
| 1780 | Ga0495640_0015454 | |||
| 1781 | Ga0495640_0396468 | |||
| 1782 | Ga0495586_0000464 | |||
| 1783 | Ga0495586_0133949 | |||
| 1784 | Ga0495587_0001565 | |||
| 1785 | Ga0495587_0054328 | |||
| 1786 | Ga0495609_0002726 | |||
| 1787 | Ga0495609_0211215 | |||
| 1788 | Ga0495621_0004284 | |||
| 1789 | Ga0495621_0069330 | |||
| 1790 | Ga0495621_0142640 | |||
| 1791 | Ga0495645_0000208 | |||
| 1792 | Ga0495645_0000626 | |||
| 1793 | Ga0495645_0005988 | |||
| 1794 | Ga0495622_0000183 | |||
| 1795 | Ga0495622_0000581 | |||
| 1796 | Ga0495667_0151034 | |||
| 1797 | Ga0495656_0000060 | |||
| 1798 | Ga0495668_0115505 | |||
| 1799 | Ga0495668_0153348 | |||
| 1800 | Ga0495634_0000984 | |||
| 1801 | Ga0495634_0086558 | |||
| 1802 | Ga0495611_0039632 | |||
| 1803 | Ga0495611_0106089 | |||
| 1804 | Ga0495625_0000624 | |||
| 1805 | Ga0495625_0012940 | |||
| 1806 | Ga0495625_0013348 | |||
| 1807 | Ga0495625_0022482 | |||
| 1808 | Ga0495625_0058918 | |||
| 1809 | Ga0495625_0400787 | |||
| 1810 | Ga0495635_0000661 | |||
| 1811 | Ga0495635_0139930 | |||
| 1812 | Ga0495635_0152801 | |||
| 1813 | Ga0495635_0238786 | |||
| 1814 | Ga0495661_0001181 | |||
| 1815 | Ga0495661_0002898 | |||
| 1816 | Ga0495661_0016358 | |||
| 1817 | Ga0495661_0190636 | |||
| 1818 | Ga0495588_0013862 | |||
| 1819 | Ga0495588_0055626 | |||
| 1820 | Ga0495588_0123273 | |||
| 1821 | Ga0495657_0033214 | |||
| 1822 | Ga0495599_0001014 | |||
| 1823 | Ga0495599_0050641 | |||
| 1824 | Ga0495623_0007386 | |||
| 1825 | Ga0495623_0017823 | |||
| 1826 | Ga0495623_0215273 | |||
| 1827 | Ga0495646_0001547 | |||
| 1828 | Ga0495646_0025675 | |||
| 1829 | Ga0495646_0292285 | |||
| 1830 | Ga0495669_0096340 | |||
| 1831 | Ga0495613_0063081 | |||
| 1832 | Ga0495624_0002433 | |||
| 1833 | Ga0495624_0003097 | |||
| 1834 | Ga0495624_0140967 | |||
| 1835 | Ga0495670_0031670 | |||
| 1836 | Ga0495670_0066695 | |||
| 1837 | Ga0495671_0002249 | |||
| 1838 | Ga0495671_0002256 | |||
| 1839 | Ga0495649_0000785 | |||
| 1840 | Ga0495649_0009077 | |||
| 1841 | Ga0495649_0012885 | |||
| 1842 | Ga0495649_0031289 | |||
| 1843 | Ga0495649_0046087 | |||
| 1844 | Ga0495649_0047216 | |||
| 1845 | Ga0495649_0052822 | |||
| 1846 | Ga0495649_0074684 | |||
| 1847 | Ga0495649_0182347 | |||
| 1848 | Ga0495589_0026311 | |||
| 1849 | Ga0495589_0073458 | |||
| 1850 | Ga0495600_0006002 | |||
| 1851 | Ga0495600_0032475 | |||
| 1852 | Ga0495600_0099985 | |||
| 1853 | Ga0495660_0121080 | |||
| 1854 | Ga0495581_0000321 | |||
| 1855 | Ga0495581_0025612 | |||
| 1856 | Ga0495604_0000541 | |||
| 1857 | Ga0495604_0084998 | |||
| 1858 | Ga0495604_0095943 | |||
| 1859 | Ga0495674_0004302 | |||
| 1860 | Ga0495674_0007009 | |||
| 1861 | Ga0495674_0048224 | |||
| 1862 | Ga0495674_0065636 | |||
| 1863 | Ga0495674_0450263 | |||
| 1864 | Ga0495672_0000006 | |||
| 1865 | Ga0495672_0012615 | |||
| 1866 | Ga0495672_0017394 | |||
| 1867 | Ga0495672_0247775 | |||
| 1868 | Ga0495676_0003067 | |||
| 1869 | Ga0495676_0057258 | |||
| 1870 | Ga0495676_0065688 | |||
| 1871 | Ga0495680_0003534 | |||
| 1872 | Ga0495680_0141419 | |||
| 1873 | Ga0495680_0144781 | |||
| 1874 | Ga0495683_0000741 | |||
| 1875 | Ga0495683_0002235 | |||
| 1876 | Ga0495683_0030529 | |||
| 1877 | Ga0495683_0072002 | |||
| 1878 | Ga0495687_000018 | |||
| 1879 | Ga0495687_010258 | |||
| 1880 | Ga0495687_042270 | |||
| 1881 | Ga0495687_073381 | |||
| 1882 | Ga0495675_0012248 | |||
| 1883 | Ga0495675_0029005 | |||
| 1884 | Ga0495679_000287 | |||
| 1885 | Ga0495679_003284 | |||
| 1886 | Ga0495679_042574 | |||
| 1887 | Ga0495685_006425 | |||
| 1888 | Ga0495673_0031906 | |||
| 1889 | Ga0495673_0067048 | |||
| 1890 | Ga0495673_0198005 | |||
| 1891 | Ga0495681_0018795 | |||
| 1892 | Ga0495684_0030859 | |||
| 1893 | Ga0495686_0007586 | |||
| 1894 | Ga0495593_0000274 | |||
| 1895 | Ga0495593_0004998 | |||
| 1896 | Ga0495593_0005252 | |||
| 1897 | Ga0495602_0004133 | |||
| 1898 | Ga0495602_0026645 | |||
| 1899 | Ga0495602_0027358 | |||
| 1900 | Ga0495602_0271070 | |||
| 1901 | Ga0495614_0000736 | |||
| 1902 | Ga0495614_0004205 | |||
| 1903 | Ga0495614_0011872 | |||
| 1904 | Ga0495614_0096912 | |||
| 1905 | Ga0495615_0071734 | |||
| 1906 | Ga0495626_0062747 | |||
| 1907 | Ga0496100_0000137 | |||
| 1908 | Ga0496100_0001939 | |||
| 1909 | Ga0496101_0000044 | |||
| 1910 | Ga0496101_0005632 | |||
| 1911 | Ga0496101_0006414 | |||
| 1912 | Ga0496101_0020807 | |||
| 1913 | Ga0496102_0000379 | |||
| 1914 | Ga0496102_0005508 | |||
| 1915 | Ga0496102_0125153 | |||
| 1916 | Ga0496102_0316952 | |||
| 1917 | Ga0496102_0675973 | |||
| 1918 | Ga0496103_0000469 | |||
| 1919 | Ga0496103_0001373 | |||
| 1920 | Ga0496103_0005736 | |||
| 1921 | Ga0496104_0002691 | |||
| 1922 | Ga0496104_0053443 | |||
| 1923 | Ga0496104_0133108 | |||
| 1924 | Ga0496105_0005462 | |||
| 1925 | Ga0496105_0122211 | |||
| 1926 | Ga0496105_0253794 | |||
| 1927 | Ga0496106_0007891 | |||
| 1928 | Ga0496106_0213559 | |||
| 1929 | Ga0496107_0052860 | |||
| 1930 | Ga0496107_0067625 | |||
| 1931 | Ga0496108_0071610 | |||
| 1932 | Ga0496109_0147934 | |||
| 1933 | Ga0496110_0019287 | |||
| 1934 | Ga0496111_0006059 | |||
| 1935 | Ga0496112_0024471 | |||
| 1936 | Ga0496112_0051572 | |||
| 1937 | Ga0496113_0009083 | |||
| 1938 | Ga0496113_0027592 | |||
| 1939 | Ga0496114_0002580 | |||
| 1940 | Ga0496115_0000096 | |||
| 1941 | Ga0496116_0000403 | |||
| 1942 | Ga0496116_0002276 | |||
| 1943 | Ga0496116_0006912 | |||
| 1944 | Ga0496116_0013389 | |||
| 1945 | Ga0496116_0021912 | |||
| 1946 | Ga0496116_0024040 | |||
| 1947 | Ga0496117_0000098 | |||
| 1948 | Ga0496117_0006629 | |||
| 1949 | Ga0496117_0015082 | |||
| 1950 | Ga0496117_0027118 | |||
| 1951 | Ga0496117_0070768 | |||
| 1952 | Ga0496117_0113768 | |||
| 1953 | Ga0496117_0172529 | |||
| 1954 | Ga0496117_0387126 | |||
| 1955 | Ga0496118_0000400 | |||
| 1956 | Ga0496118_0000533 | |||
| 1957 | Ga0496118_0000644 | |||
| 1958 | Ga0496118_0003771 | |||
| 1959 | Ga0496118_0006135 | |||
| 1960 | Ga0496118_0007071 | |||
| 1961 | Ga0496118_0009625 | |||
| 1962 | Ga0496118_0013952 | |||
| 1963 | Ga0496118_0016091 | |||
| 1964 | Ga0496118_0131205 | |||
| 1965 | Ga0496118_0218997 | |||
| 1966 | Ga0496119_0014786 | |||
| 1967 | Ga0496119_0171283 | |||
| 1968 | Ga0496120_0025672 | |||
| 1969 | Ga0496121_0000294 | |||
| 1970 | Ga0496121_0000822 | |||
| 1971 | Ga0496121_0001909 | |||
| 1972 | Ga0496121_0003473 | |||
| 1973 | Ga0496121_0004825 | |||
| 1974 | Ga0496121_0015210 | |||
| 1975 | Ga0496121_0023258 | |||
| 1976 | Ga0496121_0030733 | |||
| 1977 | Ga0496121_0059162 | |||
| 1978 | Ga0496121_0104713 | |||
| 1979 | Ga0496121_0106385 | |||
| 1980 | Ga0496122_0000021 | |||
| 1981 | Ga0496122_0006795 | |||
| 1982 | Ga0496122_0008449 | |||
| 1983 | Ga0496122_0008978 | |||
| 1984 | Ga0496122_0133825 | |||
| 1985 | Ga0496122_0218100 | |||
| 1986 | Ga0496122_0254233 | |||
| 1987 | Ga0496122_0373662 | |||
| 1988 | Ga0496123_0000050 | |||
| 1989 | Ga0496123_0000176 | |||
| 1990 | Ga0496123_0004101 | |||
| 1991 | Ga0496123_0009377 | |||
| 1992 | Ga0496123_0013089 | |||
| 1993 | Ga0496123_0017617 | |||
| 1994 | Ga0496123_0077868 | |||
| 1995 | Ga0496123_0150532 | |||
| 1996 | Ga0496123_0153252 | |||
| 1997 | Ga0496123_0291450 | |||
| 1998 | Ga0496124_0000006 | |||
| 1999 | Ga0496124_0020422 | |||
| 2000 | Ga0496124_0060707 | |||
| 2001 | Ga0496124_0088643 | |||
| 2002 | Ga0496124_0115861 | |||
| 2003 | Ga0496124_0123310 | |||
| 2004 | Ga0496124_0137890 | |||
| 2005 | Ga0496124_0144744 | |||
| 2006 | Ga0496124_0171432 | |||
| 2007 | Ga0496124_0223694 | |||
| 2008 | Ga0496125_0000005 | |||
| 2009 | Ga0496125_0001680 | |||
| 2010 | Ga0496125_0006458 | |||
| 2011 | Ga0496125_0015569 | |||
| 2012 | Ga0496125_0016460 | |||
| 2013 | Ga0496125_0029704 | |||
| 2014 | Ga0496125_0035954 | |||
| 2015 | Ga0496125_0037911 | |||
| 2016 | Ga0496125_0050626 | |||
| 2017 | Ga0496125_0067250 | |||
| 2018 | Ga0496125_0128454 | |||
| 2019 | Ga0496126_0000331 | |||
| 2020 | Ga0496126_0001126 | |||
| 2021 | Ga0496126_0005355 | |||
| 2022 | Ga0496126_0014902 | |||
| 2023 | Ga0496126_0016298 | |||
| 2024 | Ga0496126_0039126 | |||
| 2025 | Ga0496126_0133401 | |||
| 2026 | Ga0496126_0145636 | |||
| 2027 | Ga0496126_0383859 | |||
| 2028 | Ga0495678_027991 | |||
| 2029 | Ga0495678_069790 | |||
| 2030 | Ga0495682_0063955 | |||
| 2031 | Ga0501037_0037371 | |||
| 2032 | Ga0501198_000072 | |||
| 2033 | Ga0501222_000024 | |||
| 2034 | Ga0501044_0211188 | |||
| 2035 | nmdc:mga03n38_17778_c1 | |||
| 2036 | nmdc:mga00v17_12227_c1 | |||
| 2037 | nmdc:mga00v17_60088_c1 | |||
| 2038 | nmdc:mga00v17_682496_c1 | |||
| 2039 | nmdc:mga0k408_131132_c1 | |||
| 2040 | nmdc:mga0k408_484143_c1 | |||
| 2041 | nmdc:mga06z11_340964_c1 | |||
| 2042 | nmdc:mga07m45_1317_c1 | |||
| 2043 | nmdc:mga07m45_16450_c1 | |||
| 2044 | nmdc:mga07m45_905_c1 | |||
| 2045 | Ga0500610_0003239 | |||
| 2046 | Ga0500610_0015684 | |||
| 2047 | Ga0500610_0104981 | |||
| 2048 | Ga0500578_0000342 | |||
| 2049 | Ga0500643_003837 | |||
| 2050 | Ga0500651_0000028 | |||
| 2051 | Ga0500566_0166851 | |||
| 2052 | Ga0500641_0062005 | |||
| 2053 | Ga0500571_000016 | |||
| 2054 | Ga0500593_000167 | |||
| 2055 | Ga0500607_001510 | |||
| 2056 | Ga0500607_029863 | |||
| 2057 | Ga0500608_065226 | |||
| 2058 | Ga0500618_022250 | |||
| 2059 | Ga0500626_022823 | |||
| 2060 | Ga0500658_0000864 | |||
| 2061 | Ga0500658_0002893 | |||
| 2062 | Ga0500559_0003152 | |||
| 2063 | Ga0500559_0004597 | |||
| 2064 | Ga0500564_049498 | |||
| 2065 | Ga0500568_0020741 | |||
| 2066 | Ga0500574_028747 | |||
| 2067 | Ga0500574_032796 | |||
| 2068 | Ga0500616_0028263 | |||
| 2069 | Ga0500627_0000710 | |||
| 2070 | Ga0500633_0191528 | |||
| 2071 | Ga0500634_0000177 | |||
| 2072 | Ga0500634_0014502 | |||
| 2073 | Ga0500636_0310620 | |||
| 2074 | Ga0500645_000787 | |||
| 2075 | Ga0500587_000482 | |||
| 2076 | Ga0466962_0000180 | |||
| 2077 | Ga0466962_0001916 | |||
| 2078 | Ga0466962_0019617 | |||
| 2079 | Ga0466962_0026332 | |||
| 2080 | Ga0466962_0052815 | |||
| 2081 | 2501075203 | |||
| 2082 | 2501083203 | |||
| 2083 | 2501412491 | |||
| 2084 | 2510248779 | |||
| 2085 | 2511088121 | |||
| 2086 | 2511101377 | |||
| 2087 | 2511108020 | |||
| 2088 | 2512349090 | |||
| 2089 | 2513231123 | |||
| 2090 | 2513552571 | |||
| 2091 | 2513560689 | |||
| 2092 | 2513953574 | |||
| 2093 | 2513958457 | |||
| 2094 | 2514044267 | |||
| 2095 | 2514047305 | |||
| 2096 | 2515680311 | |||
| 2097 | 2516021748 | |||
| 2098 | 2519461064 | |||
| 2099 | 2526212243 | |||
| 2100 | 2547501875 | |||
| 2101 | 2563059726 | |||
| 2102 | 2585289960 | |||
| 2103 | 2587755677 | |||
| 2104 | 2597028321 | |||
| 2105 | 2599445111 | |||
| 2106 | 2599735702 | |||
| 2107 | 2599743625 | |||
| 2108 | 2599903646 | |||
| 2109 | 2600209174 | |||
| 2110 | 2600815027 | |||
| 2111 | 2643860127 | |||
| 2112 | 2643967050 | |||
| 2113 | 2643979247 | |||
| 2114 | 2644120165 | |||
| 2115 | 2644139916 | |||
| 2116 | 2644162991 | |||
| 2117 | 2644271156 | |||
| 2118 | 2644325346 | |||
| 2119 | 2644399080 | |||
| 2120 | 2644467813 | |||
| 2121 | 2676742588 | |||
| 2122 | 2713480566 | |||
| 2123 | 2719642795 | |||
| 2124 | 2723876111 | |||
| 2125 | 2738723500 | |||
| 2126 | 2738819179 | |||
| 2127 | 2738831658 | |||
| 2128 | 2738873186 | |||
| 2129 | 2738882199 | |||
| 2130 | 2739184816 | |||
| 2131 | 2739219785 | |||
| 2132 | 2739249246 | |||
| 2133 | 2739284231 | |||
| 2134 | 2747948539 | |||
| 2135 | 2753570995 | |||
| 2136 | 2765579317 | |||
| 2137 | 2792835403 | |||
| 2138 | 2809035881 | |||
| 2139 | 2816517428 | |||
| 2140 | 2817259093 | |||
| 2141 | 2817280489 | |||
| 2142 | 2817452320 | |||
| 2143 | 2819619154 | |||
| 2144 | 2819630260 | |||
| 2145 | 2842327133 | |||
| 2146 | 2842350738 | |||
| 2147 | 2842391561 | |||
| 2148 | 2842456526 | |||
| 2149 | 2842680111 | |||
| 2150 | 2842734725 | |||
| 2151 | 2842748513 | |||
| 2152 | 2856288722 | |||
| 2153 | 2857362105 | |||
| 2154 | 2857538866 | |||
| 2155 | 2858953652 | |||
| 2156 | 2863423536 | |||
| 2157 | 2870074683 | |||
| 2158 | 2874222004 | |||
| 2159 | 2883090261 | |||
| 2160 | 2885196575 | |||
| 2161 | 2885278067 | |||
| 2162 | 2900580511 | |||
| 2163 | 2901306535 | |||
| 2164 | 2902687943 | |||
| 2165 | 2904454647 | |||
| 2166 | 2904460430 | |||
| 2167 | 2904547779 | |||
| 2168 | 2904569604 | |||
| 2169 | 2904576915 | |||
| 2170 | 2904620084 | |||
| 2171 | 2919089353 | |||
| 2172 | 2919135711 | |||
| 2173 | 2919464231 | |||
| 2174 | 2919529605 | |||
| 2175 | 2928060278 | |||
| 2176 | 2928090157 | |||
| 2177 | 2928114073 | |||
| 2178 | 2928120338 | |||
| 2179 | 2928141449 | |||
| 2180 | 2928157855 | |||
| 2181 | 2928165621 | |||
| 2182 | 2928179041 | |||
| 2183 | 2928497480 | |||
| 2184 | 2928504560 | |||
| 2185 | 2928536994 | |||
| 2186 | 2929166980 | |||
| 2187 | 2929524628 | |||
| 2188 | 2931380406 | |||
| 2189 | 2937612839 | |||
| 2190 | 2939591752 | |||
| 2191 | 2939626974 | |||
| 2192 | 2941483425 | |||
| 2193 | 2945912167 | |||
| 2194 | 2945940190 | |||
| 2195 | 2945947051 | |||
| 2196 | 2945976742 | |||
| 2197 | 2945985545 | |||
| 2198 | 2954771785 | |||
| 2199 | 2961048771 | |||
| 2200 | 2961067674 | |||
| 2201 | 2974308717 | |||
| 2202 | 2977249456 | |||
| 2203 | 2981990869 | |||
| 2204 | 2984516076 | |||
| 2205 | 2990707321 | |||
| 2206 | 642423762 | |||
| 2207 | 642419997 | |||
| 2208 | 642598101 | |||
| 2209 | 644750393 | |||
| 2210 | 8003958354 | |||
| 2211 | 8018853100 | |||
| 2212 | 8020812867 | |||
| 2213 | 8020940705 | |||
| 2214 | 8020949730 | |||
| 2215 | 8020954286 | |||
| 2216 | 8021121195 | |||
| 2217 | 8039101886 | |||
| 2218 | 8040173516 | |||
| 2219 | 8055269313 | |||
| 2220 | 8055303634 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3hgm-assembly1.cif.gz_B | universal stress protein tead from the trap transporter teaabc of halomonas elongata | 0.9451 | 148 | 178 |
| 6k6w-assembly1.cif.gz_A | structure of rnase j2 from staphylococcus epidermidis | 0.928 | 151 | 174 |
| 3imp-assembly5.cif.gz_I | new crystal form of the c-terminal domain of helicobacter pylori motb (residues 125-256) | 0.882 | 91 | 203 |
| 5wtl-assembly4.cif.gz_D | crystal structure of the periplasmic portion of outer membrane protein a (ompa) from capnocytophaga gingivalis | 0.8773 | 88 | 203 |
| 3cyp-assembly3.cif.gz_B | the crystal structure of the c-terminal domain of helicobacter pylori motb (residues 125-256). | 0.8672 | 91 | 203 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3zq4E01 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.925 | 151 | 174 | 3.60.15.10 |
| 5a0tB01 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.9058 | 151 | 175 | 3.60.15.10 |
| 3cypB00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain | 0.8672 | 91 | 203 | 3.30.1330.60 |
| 5y61D00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain | 0.8625 | 91 | 201 | 3.30.1330.60 |
| 5m38B00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain | 0.842 | 88 | 204 | 3.30.1330.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3QHI6-F1-model_v4 | deleted | 0.9842 | 118 | 204 |
|
| AF-A0A1V6ENM9-F1-model_v4 | Putative lipoprotein YiaD | 0.953 | 32 | 216 |
GO:0016020
|
| AF-A0A447U9N1-F1-model_v4 | Membrane protein | 0.95 | 84 | 200 |
GO:0016020
|
| AF-A0A1V6ENM9-F1-model_v4 | Putative lipoprotein YiaD | 0.9429 | 32 | 216 |
GO:0016020
|
| AF-A0A439KLY8-F1-model_v4 | Peptidoglycan-binding protein | 0.94 | 79 | 205 |
GO:0016020
|