F490218

General Info

Members Datasets Scaffolds Average Seq Length
1110 532 2220 211

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0181414|Ga0395905_0181414_159_854
Length 231
Sequence MTSDHELDAGLETAAPVWAAFADLMSGLLGAFVLILVCVIGMQLELAQKLEQEVHQREAAEQRQHALEQALAGPLAAGRVTLRDGRIGISGSVLFSFASADLQPEGRQLLRSLAAPLAAYLRTRDEALMVSGFTDDRQVRGGSQKFADNWELSAQRALTVTRALVEEGLPADAVFAAAFGAQQPVASNADAEGRARNRRVEMAPMPRVARTTGAASAPATSPAMATAASAP

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
13 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
14 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
15 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
16 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
17 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
18 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
19 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
20 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
21 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
22 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
23 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
24 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
25 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
26 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
27 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
28 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
29 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
30 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
31 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
32 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
33 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
34 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
35 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
36 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
37 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
38 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
39 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
44 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
71 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
72 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
73 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
91 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
92 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
93 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
94 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
95 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
106 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
108 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
111 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
112 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
113 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
117 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
120 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
124 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
156 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
160 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
161 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
162 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
163 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
164 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
165 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
166 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
167 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
168 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
169 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
170 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
171 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
172 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
173 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
174 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
175 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
176 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
177 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
178 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
179 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
180 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
181 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
182 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
183 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
184 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
185 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
186 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
187 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
188 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
189 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
190 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
191 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
192 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
193 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
194 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
195 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
196 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
197 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
198 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
199 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
200 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
201 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
202 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
203 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
204 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
205 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
206 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
207 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
208 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
209 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
210 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
211 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
212 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
213 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
214 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
215 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
216 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
217 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
218 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
219 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
220 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
221 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
222 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
223 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
224 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
225 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
226 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
227 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
228 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
229 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
230 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
231 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
232 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
233 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
234 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
235 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
236 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
237 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
238 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
239 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
240 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
241 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
242 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
243 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
244 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
245 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
246 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
247 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
248 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
249 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
250 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
251 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
252 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
253 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
254 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
255 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
256 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
257 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
258 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
259 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
260 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
261 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
262 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
263 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
264 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
265 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
266 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
267 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
268 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
269 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
270 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
271 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
272 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
273 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
274 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
275 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
276 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
277 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
278 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
279 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
280 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
281 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
282 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
283 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
284 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
285 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
286 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
287 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
288 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
289 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
290 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
291 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
292 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
293 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
294 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
295 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
296 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
297 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
298 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
299 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
300 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
301 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
302 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
303 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
304 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
305 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
306 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
307 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
308 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
309 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
310 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
311 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
312 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
313 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
314 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
315 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
316 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
317 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
318 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
319 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
320 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
321 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
322 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
323 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
324 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
325 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
326 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
327 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
328 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
329 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
330 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
331 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
332 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
333 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
334 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
335 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
336 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
337 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
338 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
339 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
340 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
341 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
342 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
343 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
344 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
345 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
346 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
347 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
348 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
349 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
350 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
351 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
352 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
353 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
354 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
355 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
356 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
357 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
358 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
359 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
361 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
362 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
363 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
364 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
365 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
366 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
367 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
368 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
369 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
370 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
371 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
372 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
373 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
374 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
375 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
376 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
377 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
378 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
379 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
380 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
381 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
382 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
383 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
384 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
385 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
386 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
387 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
388 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
389 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
390 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
391 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
392 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
393 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
394 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
395 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
396 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
397 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
398 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
399 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
400 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
401 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
402 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
403 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
404 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
405 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
406 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
407 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
408 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
409 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
410 2519103095 Burkholderia sp. KJ006 Isolate Nodule
411 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
412 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
413 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
414 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
415 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
416 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
417 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
418 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
419 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
420 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
421 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
422 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
423 2643221569 Achromobacter sp. Root565 Isolate Unclassified
424 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
425 2643221594 Achromobacter sp. Root170 Isolate Unclassified
426 2643221621 Achromobacter sp. Root83 Isolate Unclassified
427 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
428 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
429 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
430 2643221658 Variovorax sp. Root411 Isolate Unclassified
431 2643221672 Variovorax sp. Root434 Isolate Unclassified
432 2643221683 Variovorax sp. Root473 Isolate Unclassified
433 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
434 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
435 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
436 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
437 2738541277 Variovorax sp. GV051 Isolate Unclassified
438 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
439 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
440 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
441 2738541307 Variovorax sp. GV008 Isolate Unclassified
442 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
443 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
444 2738543013 Variovorax sp. BT01 Isolate Unclassified
445 2738543019 Variovorax sp. GV040 Isolate Unclassified
446 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
447 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
448 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
449 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
450 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
451 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
452 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
453 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
454 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
455 2818991450 Burkholderia sp. 604 Isolate Unclassified
456 2818991452 Burkholderia cepacia 561 Isolate Unclassified
457 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
458 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
459 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
460 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
461 2842677519 Variovorax sp. R-72495 Isolate Unclassified
462 2842733646 Variovorax sp. R-72446 Isolate Unclassified
463 2842747753 Variovorax sp. R-72060 Isolate Unclassified
464 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
465 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
466 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
467 2858950400 Achromobacter sp. K91 Isolate Unclassified
468 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
469 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
470 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
471 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
472 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
473 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
474 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
475 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
476 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
477 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
478 2904456579 Variovorax sp. 2002 Isolate Unclassified
479 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
480 2904564687 Burkholderia sp. 571 Isolate Unclassified
481 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
482 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
483 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
484 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
485 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
486 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
487 2928058823 Ralstonia sp. 1138 Isolate Unclassified
488 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
489 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
490 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
491 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
492 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
493 2928163908 Burkholderia sp. 567 Isolate Unclassified
494 2928170801 Burkholderia sp. 572 Isolate Unclassified
495 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
496 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
497 2928536128 Burkholderia sola 565 Isolate Unclassified
498 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
499 2929520902 Variovorax beijingensis 502 Isolate Unclassified
500 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
501 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
502 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
503 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
504 2941479691
505 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
506 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
507 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
508 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
509 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
510 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
511 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
512 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
513 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
514 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
515 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
516 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
517 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
518 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
519 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
520 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
521 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
522 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
523 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
524 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
525 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
526 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
527 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
528 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
529 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
530 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
531 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
532 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.12
Metatranscriptomes 0.27
Isolates 12.61

Biome Distribution

Category Percentage (%)
Aerial Root 0.09
Bulb 0
Endosphere 19.01
Nodule 2.16
Rhizoplane 3.96
Rhizosphere 57.93
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0181414 3300037471 Bacteria 1976
2 JGI24740J21852_10000188 3300001979 Bacteria 25268
3 JGI24740J21852_10031126 3300001979 Bacteria 1726
4 JGI24739J22299_10006875 3300001989 Bacteria 4285
5 JGI24739J22299_10027695 3300001989 Bacteria 1979
6 JGI24735J21928_10000295 3300002067 Bacteria 17380
7 JGI24735J21928_10002557 3300002067 Bacteria 6295
8 JGI24735J21928_10025903 3300002067 Bacteria 1768
9 JGI24735J21928_10041993 3300002067 Bacteria 1332
10 JGI24735J21928_10062451 3300002067 Bacteria 1070
11 JGI24738J21930_10001725 3300002075 Bacteria 5979
12 JGI25154J39366_1001255 3300002738 Bacteria 9529
13 JGI25152J39213_1024242 3300002773 Bacteria 1021
14 JGI25151J46595_10000304 3300003187 Bacteria 53759
15 JGI25151J46595_10002852 3300003187 Bacteria 9943
16 JGI25165J46597_1001102 3300003214 Bacteria 17203
17 rootH2_10000556 3300003320 Bacteria 17866
18 JGI25160J50197_1000037 3300003354 Bacteria 162757
19 Ga0006562J51391_1170292 3300003578 Bacteria 3082
20 Ga0055538_1001884 3300003751 Bacteria 3512
21 Ga0055538_1002979 3300003751 Bacteria 2276
22 Ga0055539_1000086 3300003752 Bacteria 117621
23 Ga0055533_1000184 3300003756 Bacteria 52247
24 Ga0055533_1002302 3300003756 Bacteria 4415
25 Ga0055533_1003066 3300003756 Bacteria 3533
26 Ga0055533_1003087 3300003756 Bacteria 3512
27 Ga0055532_1000007 3300003758 Bacteria 429810
28 Ga0055532_1000041 3300003758 Bacteria 195749
29 Ga0055532_1000963 3300003758 Bacteria 9221
30 Ga0055525_1000469 3300003759 Bacteria 22391
31 Ga0055527_1000007 3300003760 Bacteria 429810
32 Ga0055527_1000191 3300003760 Bacteria 40814
33 Ga0055527_1000672 3300003760 Bacteria 10241
34 Ga0055535_1000005 3300003761 Bacteria 429810
35 Ga0055535_1000030 3300003761 Bacteria 195749
36 Ga0055535_1000399 3300003761 Bacteria 40814
37 Ga0055535_1002045 3300003761 Bacteria 8157
38 Ga0055542_1000008 3300003762 Bacteria 429810
39 Ga0055542_1001050 3300003762 Bacteria 17159
40 Ga0055542_1001927 3300003762 Bacteria 8157
41 Ga0055542_1004466 3300003762 Bacteria 3392
42 Ga0055529_1000005 3300003763 Bacteria 429810
43 Ga0055529_1000058 3300003763 Bacteria 195735
44 Ga0055529_1001344 3300003763 Bacteria 8157
45 Ga0055529_1011975 3300003763 Bacteria 1113
46 Ga0055526_1000973 3300003771 Bacteria 21094
47 Ga0055526_1007037 3300003771 Bacteria 5950
48 Ga0055526_1020666 3300003771 Bacteria 2328
49 Ga0055537_1000168 3300003773 Bacteria 48729
50 Ga0055537_1000700 3300003773 Bacteria 17458
51 Ga0055524_1006063 3300003775 Bacteria 5297
52 Ga0055524_1025073 3300003775 Bacteria 1874
53 Ga0055536_1000124 3300003781 Bacteria 66148
54 Ga0055536_1000359 3300003781 Bacteria 33868
55 Ga0055536_1001816 3300003781 Bacteria 12517
56 Ga0055534_1000024 3300003784 Bacteria 131674
57 Ga0055534_1000115 3300003784 Bacteria 59000
58 Ga0055534_1000953 3300003784 Bacteria 12859
59 Ga0055534_1032382 3300003784 Bacteria 800
60 Ga0055528_1000348 3300003790 Bacteria 38126
61 Ga0055528_1000446 3300003790 Bacteria 33063
62 Ga0055530_10000021 3300003791 Bacteria 139383
63 Ga0055530_10000323 3300003791 Bacteria 43172
64 Ga0055530_10023750 3300003791 Bacteria 1754
65 Ga0055540_1000408 3300003792 Bacteria 34822
66 Ga0055540_1000433 3300003792 Bacteria 33202
67 Ga0055540_1056699 3300003792 Bacteria 793
68 Ga0055531_10013971 3300003794 Bacteria 3657
69 Ga0055531_10041144 3300003794 Bacteria 1343
70 Ga0055541_1007307 3300003841 Bacteria 1826
71 Ga0058692_1000009 3300003856 Bacteria 349545
72 Ga0058692_1002370 3300003856 Bacteria 6335
73 Ga0058692_1041772 3300003856 Bacteria 801
74 Ga0065165_1000629 3300005262 Bacteria 51217
75 Ga0065165_1048682 3300005262 Bacteria 1216
76 Ga0065714_10002862 3300005288 Bacteria 13067
77 Ga0070658_10003973 3300005327 Bacteria 12118
78 Ga0070658_10031180 3300005327 Bacteria 4281
79 Ga0070658_10091806 3300005327 Bacteria 2503
80 Ga0070658_10106600 3300005327 Bacteria 2319
81 Ga0070676_10243199 3300005328 Bacteria 1198
82 Ga0070670_100591915 3300005331 Bacteria 992
83 Ga0070666_10200256 3300005335 Bacteria 1405
84 Ga0070682_100165642 3300005337 Bacteria 1531
85 Ga0070660_100000833 3300005339 Bacteria 20503
86 Ga0070660_100006982 3300005339 Bacteria 7835
87 Ga0070661_100000267 3300005344 Bacteria 42321
88 Ga0070661_100340545 3300005344 Bacteria 1175
89 Ga0070669_100029840 3300005353 Bacteria 3934
90 Ga0070675_100416940 3300005354 Bacteria 1200
91 Ga0070675_100848805 3300005354 Bacteria 836
92 Ga0070688_100699863 3300005365 Bacteria 785
93 Ga0070659_100000858 3300005366 Bacteria 22204
94 Ga0070659_100001606 3300005366 Bacteria 16262
95 Ga0070659_100318973 3300005366 Bacteria 1299
96 Ga0070667_100572864 3300005367 Bacteria 1039
97 Ga0070663_100000082 3300005455 Bacteria 42321
98 Ga0070663_100001523 3300005455 Bacteria 12744
99 Ga0070663_100272935 3300005455 Bacteria 1345
100 Ga0070678_100198690 3300005456 Bacteria 1654
101 Ga0070678_100671587 3300005456 Bacteria 931
102 Ga0070684_100509692 3300005535 Bacteria 1115
103 Ga0070672_100159122 3300005543 Bacteria 1872
104 Ga0070665_100006462 3300005548 Bacteria 11931
105 Ga0070665_100039729 3300005548 Bacteria 4730
106 Ga0068855_100013980 3300005563 Bacteria 9677
107 Ga0068855_100026993 3300005563 Bacteria 6871
108 Ga0070664_100000274 3300005564 Bacteria 37138
109 Ga0070664_100001095 3300005564 Bacteria 21389
110 Ga0068854_100000341 3300005578 Bacteria 30099
111 Ga0068856_100000527 3300005614 Bacteria 42321
112 Ga0068856_100326522 3300005614 Bacteria 1552
113 Ga0068856_100336448 3300005614 Bacteria 1528
114 Ga0068852_100028158 3300005616 Bacteria 4594
115 Ga0068852_100145810 3300005616 Bacteria 2196
116 Ga0068852_100747715 3300005616 Bacteria 990
117 Ga0068863_100575787 3300005841 Bacteria 1113
118 Ga0068858_100492169 3300005842 Bacteria 1184
119 Ga0075365_10022502 3300006038 Bacteria 3950
120 Ga0075368_10184634 3300006042 Bacteria 880
121 Ga0075363_100032856 3300006048 Bacteria 2698
122 Ga0075363_100038398 3300006048 Bacteria 2518
123 Ga0075363_100356827 3300006048 Bacteria 854
124 Ga0075364_10022213 3300006051 Bacteria 4004
125 Ga0075364_10059507 3300006051 Bacteria 2504
126 Ga0075364_10080560 3300006051 Bacteria 2152
127 Ga0075432_10006369 3300006058 Bacteria 4015
128 Ga0075362_10003585 3300006177 Bacteria 5454
129 Ga0075362_10109344 3300006177 Bacteria 1300
130 Ga0075367_10052865 3300006178 Bacteria 2406
131 Ga0075367_10054619 3300006178 Bacteria 2369
132 Ga0075367_10077115 3300006178 Bacteria 2012
133 Ga0075367_10231183 3300006178 Bacteria 1158
134 Ga0075369_10040530 3300006186 Bacteria 1991
135 Ga0075366_10004632 3300006195 Bacteria 7392
136 Ga0075366_10016205 3300006195 Bacteria 4282
137 Ga0097621_100630353 3300006237 Bacteria 982
138 Ga0075370_10000045 3300006353 Bacteria 37777
139 Ga0075370_10016917 3300006353 Bacteria 3932
140 Ga0075370_10101048 3300006353 Bacteria 1669
141 Ga0099826_10000132 3300006948 Bacteria 31946
142 Ga0099826_10066190 3300006948 Bacteria 2319
143 Ga0105251_10000085 3300009011 Bacteria 89249
144 Ga0105251_10000195 3300009011 Bacteria 61183
145 Ga0105251_10013696 3300009011 Bacteria 4523
146 Ga0105251_10075319 3300009011 Bacteria 1567
147 Ga0105244_10047560 3300009036 Bacteria 2199
148 Ga0105250_10102813 3300009092 Bacteria 1167
149 Ga0105240_10001007 3300009093 Bacteria 50237
150 Ga0105240_10002439 3300009093 Bacteria 29909
151 Ga0105240_10018449 3300009093 Bacteria 9368
152 Ga0105240_10094053 3300009093 Bacteria 3657
153 Ga0105240_10121379 3300009093 Bacteria 3146
154 Ga0105240_10467877 3300009093 Bacteria 1407
155 Ga0105243_10008382 3300009148 Bacteria 7932
156 Ga0105243_10010744 3300009148 Bacteria 6936
157 Ga0105243_10211677 3300009148 Bacteria 1707
158 Ga0105243_10333283 3300009148 Bacteria 1387
159 Ga0105241_10226142 3300009174 Bacteria 1575
160 Ga0105241_10421667 3300009174 Bacteria 1175
161 Ga0105237_10013644 3300009545 Bacteria 8509
162 Ga0105237_10028203 3300009545 Bacteria 5721
163 Ga0105237_10097247 3300009545 Bacteria 2934
164 Ga0105238_10024279 3300009551 Bacteria 6179
165 Ga0105238_10070687 3300009551 Bacteria 3489
166 Ga0105238_10112683 3300009551 Bacteria 2700
167 Ga0105249_10882111 3300009553 Bacteria 961
168 Ga0105239_10002601 3300010375 Bacteria 22839
169 Ga0105239_10048975 3300010375 Bacteria 4633
170 Ga0105239_10617946 3300010375 Bacteria 1236
171 Ga0105246_10195551 3300011119 Bacteria 1568
172 Ga0157327_1020166 3300012512 Bacteria 744
173 Ga0157373_10035498 3300013100 Bacteria 3579
174 Ga0157373_10036300 3300013100 Bacteria 3538
175 Ga0157373_10051805 3300013100 Bacteria 2922
176 Ga0157373_10194991 3300013100 Bacteria 1427
177 Ga0157371_10000022 3300013102 Bacteria 295029
178 Ga0157371_10000613 3300013102 Bacteria 42448
179 Ga0157371_10020173 3300013102 Bacteria 4905
180 Ga0157370_10000004 3300013104 Bacteria 366426
181 Ga0157370_10002960 3300013104 Bacteria 20211
182 Ga0157370_10009604 3300013104 Bacteria 10297
183 Ga0157370_10012552 3300013104 Bacteria 8783
184 Ga0157369_10005113 3300013105 Bacteria 15359
185 Ga0157369_10011117 3300013105 Bacteria 10236
186 Ga0157369_10022890 3300013105 Bacteria 6968
187 Ga0157369_10023753 3300013105 Bacteria 6825
188 Ga0157369_10081071 3300013105 Bacteria 3473
189 Ga0157369_10117995 3300013105 Bacteria 2816
190 Ga0157369_10815426 3300013105 Bacteria 958
191 Ga0157374_10000219 3300013296 Bacteria 52748
192 Ga0157374_10478371 3300013296 Bacteria 1248
193 Ga0157372_10002559 3300013307 Bacteria 19718
194 Ga0157372_10007566 3300013307 Bacteria 11551
195 Ga0157375_10246850 3300013308 Bacteria 1946
196 Ga0157375_10906999 3300013308 Bacteria 1025
197 Ga0182008_10000070 3300014497 Bacteria 81986
198 Ga0182008_10005687 3300014497 Bacteria 7062
199 Ga0182008_10011571 3300014497 Bacteria 4686
200 Ga0182008_10016590 3300014497 Bacteria 3827
201 Ga0182008_10034228 3300014497 Bacteria 2547
202 Ga0182008_10117743 3300014497 Bacteria 1319
203 Ga0182008_10187476 3300014497 Bacteria 1049
204 Ga0182008_10189423 3300014497 Bacteria 1043
205 Ga0182006_1000709 3300015261 Bacteria 23072
206 Ga0182006_1026368 3300015261 Bacteria 2379
207 Ga0182006_1035522 3300015261 Bacteria 1986
208 Ga0182006_1046290 3300015261 Bacteria 1690
209 Ga0182006_1056141 3300015261 Bacteria 1501
210 Ga0182007_10000004 3300015262 Bacteria 485875
211 Ga0182007_10000576 3300015262 Bacteria 21613
212 Ga0182007_10030700 3300015262 Bacteria 1835
213 Ga0182007_10033144 3300015262 Bacteria 1751
214 Ga0182007_10044219 3300015262 Bacteria 1478
215 Ga0182005_1020255 3300015265 Bacteria 1831
216 Ga0182005_1062316 3300015265 Bacteria 1019
217 Ga0182005_1065907 3300015265 Bacteria 991
218 Ga0183362_10002 3300015683 Bacteria 1432711
219 Ga0183361_10004 3300016635 Bacteria 484183
220 Ga0163161_10000139 3300017792 Bacteria 67878
221 Ga0163161_10005865 3300017792 Bacteria 8517
222 Ga0163161_10265029 3300017792 Bacteria 1343
223 Ga0163161_10311246 3300017792 Bacteria 1243
224 Ga0163161_10490307 3300017792 Bacteria 999
225 Ga0206351_10088385 3300020077 Bacteria 1190
226 Ga0154015_1439323 3300020610 Bacteria 8605
227 Ga0209784_100029 3300025224 Bacteria 347315
228 Ga0209784_101356 3300025224 Bacteria 3397
229 Ga0209566_100030 3300025225 Bacteria 347329
230 Ga0209566_100807 3300025225 Bacteria 16304
231 Ga0209566_101195 3300025225 Bacteria 9231
232 Ga0209566_103041 3300025225 Bacteria 2753
233 Ga0209674_100020 3300025226 Bacteria 672397
234 Ga0209674_100029 3300025226 Bacteria 466683
235 Ga0209674_100075 3300025226 Bacteria 216004
236 Ga0209674_100160 3300025226 Bacteria 88210
237 Ga0209674_102918 3300025226 Bacteria 3377
238 Ga0209672_100012 3300025228 Bacteria 795742
239 Ga0209672_100013 3300025228 Bacteria 740693
240 Ga0209672_100093 3300025228 Bacteria 115446
241 Ga0209672_100175 3300025228 Bacteria 53342
242 Ga0209672_102442 3300025228 Bacteria 4559
243 Ga0209147_100007 3300025229 Bacteria 795684
244 Ga0209147_100008 3300025229 Bacteria 777096
245 Ga0209147_100013 3300025229 Bacteria 660057
246 Ga0209147_100074 3300025229 Bacteria 208743
247 Ga0209147_100134 3300025229 Bacteria 118581
248 Ga0209563_100091 3300025230 Bacteria 168320
249 Ga0209563_100092 3300025230 Bacteria 167669
250 Ga0209563_100484 3300025230 Bacteria 13474
251 Ga0209563_104619 3300025230 Bacteria 2609
252 Ga0207427_101111 3300025231 Bacteria 10765
253 Ga0209258_100013 3300025242 Bacteria 777096
254 Ga0209258_100014 3300025242 Bacteria 720132
255 Ga0209258_100016 3300025242 Bacteria 668622
256 Ga0209258_100209 3300025242 Bacteria 118581
257 Ga0209646_1000019 3300025246 Bacteria 475248
258 Ga0209677_100030 3300025253 Bacteria 347314
259 Ga0209677_101579 3300025253 Bacteria 9667
260 Ga0209677_118632 3300025253 Bacteria 843
261 Ga0209148_1000020 3300025254 Bacteria 740693
262 Ga0209148_1000118 3300025254 Bacteria 188330
263 Ga0209148_1000184 3300025254 Bacteria 118581
264 Ga0209148_1001921 3300025254 Bacteria 8496
265 Ga0209148_1002607 3300025254 Bacteria 5897
266 Ga0209759_1000008 3300025256 Bacteria 461395
267 Ga0209759_1000022 3300025256 Bacteria 329136
268 Ga0209759_1002763 3300025256 Bacteria 7438
269 Ga0209759_1003296 3300025256 Bacteria 6500
270 Ga0209759_1005327 3300025256 Bacteria 4537
271 Ga0209759_1014515 3300025256 Bacteria 2078
272 Ga0209759_1029014 3300025256 Bacteria 1116
273 Ga0209129_1000873 3300025258 Bacteria 18565
274 Ga0209233_1000055 3300025261 Bacteria 439422
275 Ga0209565_1000024 3300025263 Bacteria 379907
276 Ga0209565_1000040 3300025263 Bacteria 266543
277 Ga0209565_1011161 3300025263 Bacteria 2197
278 Ga0209455_1000017 3300025272 Bacteria 740693
279 Ga0209455_1000106 3300025272 Bacteria 195801
280 Ga0209455_1000160 3300025272 Bacteria 118581
281 Ga0209455_1001972 3300025272 Bacteria 8441
282 Ga0209673_1000046 3300025273 Bacteria 289907
283 Ga0209673_1000109 3300025273 Bacteria 183000
284 Ga0209673_1000413 3300025273 Bacteria 75089
285 Ga0209673_1002008 3300025273 Bacteria 15702
286 Ga0209130_1009220 3300025284 Bacteria 2835
287 Ga0209130_1016600 3300025284 Bacteria 1777
288 Ga0209675_1000024 3300025291 Bacteria 312615
289 Ga0209675_1000039 3300025291 Bacteria 247966
290 Ga0209675_1000129 3300025291 Bacteria 102806
291 Ga0209675_1001803 3300025291 Bacteria 11694
292 Ga0209675_1020366 3300025291 Bacteria 1800
293 Ga0209675_1046902 3300025291 Bacteria 911
294 Ga0209676_1000011 3300025292 Bacteria 860463
295 Ga0209676_1000014 3300025292 Bacteria 793514
296 Ga0209676_1000071 3300025292 Bacteria 309464
297 Ga0209676_1000075 3300025292 Bacteria 303609
298 Ga0209025_1000232 3300025294 Bacteria 130663
299 Ga0209025_1000382 3300025294 Bacteria 91921
300 Ga0209025_1000446 3300025294 Bacteria 80985
301 Ga0209025_1001095 3300025294 Bacteria 39073
302 Ga0209025_1021309 3300025294 Bacteria 3496
303 Ga0209025_1025421 3300025294 Bacteria 3015
304 Ga0209025_1030698 3300025294 Bacteria 2565
305 Ga0209564_1000309 3300025295 Bacteria 96154
306 Ga0209564_1000411 3300025295 Bacteria 75939
307 Ga0209564_1001305 3300025295 Bacteria 26857
308 Ga0209564_1003422 3300025295 Bacteria 10880
309 Ga0209050_1000032 3300025298 Bacteria 456335
310 Ga0209050_1000069 3300025298 Bacteria 297615
311 Ga0209050_1000720 3300025298 Bacteria 48448
312 Ga0209050_1003935 3300025298 Bacteria 10504
313 Ga0209050_1068900 3300025298 Bacteria 799
314 Ga0209256_1000134 3300025299 Bacteria 160229
315 Ga0209256_1012635 3300025299 Bacteria 3204
316 Ga0209256_1020757 3300025299 Bacteria 2039
317 Ga0207426_1000004 3300025302 Bacteria 1047900
318 Ga0209051_1000092 3300025303 Bacteria 170056
319 Ga0209051_1000169 3300025303 Bacteria 119220
320 Ga0209051_1002066 3300025303 Bacteria 15223
321 Ga0209051_1013463 3300025303 Bacteria 3892
322 Ga0209257_1000014 3300025304 Bacteria 946850
323 Ga0209257_1000571 3300025304 Bacteria 61995
324 Ga0209257_1000722 3300025304 Bacteria 50449
325 Ga0209257_1009463 3300025304 Bacteria 5205
326 Ga0207655_1048697 3300025728 Bacteria 1737
327 Ga0207713_1001373 3300025735 Bacteria 19794
328 Ga0207713_1003740 3300025735 Bacteria 10216
329 Ga0207713_1043532 3300025735 Bacteria 1854
330 Ga0207713_1095743 3300025735 Bacteria 1034
331 Ga0207680_10201499 3300025903 Bacteria 1356
332 Ga0207647_10002375 3300025904 Bacteria 14283
333 Ga0207647_10012862 3300025904 Bacteria 5814
334 Ga0207647_10019436 3300025904 Bacteria 4569
335 Ga0207647_10022845 3300025904 Bacteria 4149
336 Ga0207647_10052462 3300025904 Bacteria 2517
337 Ga0207647_10077029 3300025904 Bacteria 2005
338 Ga0207705_10000420 3300025909 Bacteria 37140
339 Ga0207695_10000171 3300025913 Bacteria 191448
340 Ga0207695_10002092 3300025913 Bacteria 30376
341 Ga0207695_10028576 3300025913 Bacteria 6179
342 Ga0207695_10127948 3300025913 Bacteria 2500
343 Ga0207695_10340023 3300025913 Bacteria 1389
344 Ga0207695_10372770 3300025913 Bacteria 1314
345 Ga0207695_10888510 3300025913 Bacteria 771
346 Ga0207671_10022820 3300025914 Bacteria 4727
347 Ga0207671_10062975 3300025914 Bacteria 2755
348 Ga0207671_10072418 3300025914 Bacteria 2572
349 Ga0207657_10000002 3300025919 Bacteria 444378
350 Ga0207657_10010805 3300025919 Bacteria 9084
351 Ga0207649_10000335 3300025920 Bacteria 35710
352 Ga0207649_10000468 3300025920 Bacteria 28930
353 Ga0207681_10010845 3300025923 Bacteria 5598
354 Ga0207694_10071654 3300025924 Bacteria 2708
355 Ga0207694_10721457 3300025924 Bacteria 841
356 Ga0207659_10276821 3300025926 Bacteria 1371
357 Ga0207690_10000011 3300025932 Bacteria 295252
358 Ga0207690_10000176 3300025932 Bacteria 49560
359 Ga0207690_10292520 3300025932 Bacteria 1272
360 Ga0207686_10454097 3300025934 Bacteria 986
361 Ga0207709_10000038 3300025935 Bacteria 266638
362 Ga0207709_10004913 3300025935 Bacteria 7655
363 Ga0207709_10019495 3300025935 Bacteria 3815
364 Ga0207691_10203543 3300025940 Bacteria 1722
365 Ga0207679_10000168 3300025945 Bacteria 54187
366 Ga0207679_10000229 3300025945 Bacteria 43614
367 Ga0207667_10026258 3300025949 Bacteria 6364
368 Ga0207667_10035219 3300025949 Bacteria 5370
369 Ga0207667_10043871 3300025949 Bacteria 4743
370 Ga0207667_10619107 3300025949 Bacteria 1090
371 Ga0207640_10000289 3300025981 Bacteria 33658
372 Ga0207640_10159791 3300025981 Bacteria 1666
373 Ga0207658_10023311 3300025986 Bacteria 4320
374 Ga0207677_10433889 3300026023 Bacteria 1122
375 Ga0207703_10400911 3300026035 Bacteria 1273
376 Ga0207678_10000334 3300026067 Bacteria 42400
377 Ga0207678_10000677 3300026067 Bacteria 31159
378 Ga0207678_10292425 3300026067 Bacteria 1399
379 Ga0207702_10000537 3300026078 Bacteria 42458
380 Ga0207702_10840403 3300026078 Bacteria 908
381 Ga0207641_10340622 3300026088 Bacteria 1427
382 Ga0207674_10009467 3300026116 Bacteria 11129
383 Ga0207683_10072739 3300026121 Bacteria 3041
384 Ga0207683_10327772 3300026121 Bacteria 1403
385 Ga0207698_10117038 3300026142 Bacteria 2247
386 Ga0207698_10346292 3300026142 Bacteria 1402
387 Ga0207698_10993853 3300026142 Bacteria 849
388 Ga0209371_1000023 3300027312 Bacteria 519553
389 Ga0209371_1001595 3300027312 Bacteria 14761
390 Ga0209371_1006823 3300027312 Bacteria 4131
391 Ga0209282_1000032 3300027666 Bacteria 149218
392 Ga0209282_1000127 3300027666 Bacteria 48767
393 Ga0209813_10178787 3300027866 Bacteria 775
394 Ga0268266_10007180 3300028379 Bacteria 10093
395 Ga0268266_10098400 3300028379 Bacteria 2574
396 Ga0268266_10745300 3300028379 Bacteria 945
397 Ga0268265_10005086 3300028380 Bacteria 9018
398 Ga0307517_10280209 3300028786 Bacteria 951
399 Ga0307515_10000618 3300028794 Bacteria 83065
400 Ga0307515_10001346 3300028794 Bacteria 55608
401 Ga0307515_10001873 3300028794 Bacteria 46808
402 Ga0307515_10014468 3300028794 Bacteria 14623
403 Ga0265338_10000270 3300028800 Bacteria 94907
404 Ga0268256_1000023 3300030500 Bacteria 519631
405 Ga0268256_1001380 3300030500 Bacteria 14764
406 Ga0268256_1006937 3300030500 Bacteria 4131
407 Ga0307512_10034925 3300030522 Bacteria 4294
408 Ga0316177_1007272 3300030731 Bacteria 1466
409 Ga0316177_1155703 3300030731 Bacteria 5327
410 Ga0316176_1109634 3300030732 Bacteria 9012
411 Ga0314311_1020500 3300030733 Bacteria 7667
412 Ga0316179_1048542 3300030734 Bacteria 4858
413 Ga0316178_1040985 3300030735 Bacteria 8016
414 Ga0316180_1037427 3300030736 Bacteria 4529
415 Ga0316183_1157955 3300030742 Bacteria 3491
416 Ga0316181_1023192 3300030744 Bacteria 5261
417 Ga0316182_1156455 3300030745 Bacteria 4029
418 Ga0316182_1211692 3300030745 Bacteria 2866
419 Ga0265332_10045646 3300031238 Bacteria 1888
420 Ga0265340_10084569 3300031247 Bacteria 1489
421 Ga0265327_10017002 3300031251 Bacteria 4586
422 Ga0265316_10009820 3300031344 Bacteria 8784
423 Ga0265316_10096979 3300031344 Bacteria 2245
424 Ga0307513_10086758 3300031456 Bacteria 3207
425 Ga0307513_10483237 3300031456 Bacteria 958
426 Ga0307509_10013250 3300031507 Bacteria 9780
427 Ga0307408_100003959 3300031548 Bacteria 10087
428 Ga0307408_100128688 3300031548 Bacteria 1972
429 Ga0307408_100194290 3300031548 Bacteria 1637
430 Ga0307408_100565879 3300031548 Bacteria 1005
431 Ga0307508_10000053 3300031616 Bacteria 128020
432 Ga0307514_10035015 3300031649 Bacteria 3999
433 Ga0316576_10071642 3300031727 Bacteria 2556
434 Ga0316576_10158704 3300031727 Bacteria 1705
435 Ga0316578_10059541 3300031728 Bacteria 2247
436 Ga0307516_10001663 3300031730 Bacteria 30602
437 Ga0307516_10249984 3300031730 Bacteria 1468
438 Ga0307405_10004656 3300031731 Bacteria 6515
439 Ga0307405_10017276 3300031731 Bacteria 3955
440 Ga0307405_10194828 3300031731 Bacteria 1466
441 Ga0316577_10066463 3300031733 Bacteria 2013
442 Ga0307413_10416287 3300031824 Bacteria 1057
443 Ga0307410_10358594 3300031852 Bacteria 1167
444 Ga0307410_10468455 3300031852 Bacteria 1031
445 Ga0307406_10001449 3300031901 Bacteria 13116
446 Ga0307406_10029459 3300031901 Bacteria 3324
447 Ga0307406_10180811 3300031901 Bacteria 1535
448 Ga0307406_10261138 3300031901 Bacteria 1310
449 Ga0307407_10417630 3300031903 Bacteria 966
450 Ga0307412_10000099 3300031911 Bacteria 71212
451 Ga0307412_10000307 3300031911 Bacteria 30940
452 Ga0307412_10000384 3300031911 Bacteria 27422
453 Ga0307412_10010187 3300031911 Bacteria 5409
454 Ga0307412_10016243 3300031911 Bacteria 4430
455 Ga0307412_10253650 3300031911 Bacteria 1367
456 Ga0307412_10321553 3300031911 Bacteria 1231
457 Ga0307409_100834117 3300031995 Bacteria 932
458 Ga0307416_100025774 3300032002 Bacteria 4319
459 Ga0307416_100057543 3300032002 Bacteria 3146
460 Ga0307414_10173269 3300032004 Bacteria 1727
461 Ga0307414_10551212 3300032004 Bacteria 1027
462 Ga0307411_10218905 3300032005 Bacteria 1476
463 Ga0316580_10110045 3300032139 Bacteria 843
464 Ga0307507_10059857 3300033179 Bacteria 3562
465 Ga0373931_0002570 3300035691 Bacteria 8084
466 Ga0395899_0000005 3300037312 Bacteria 772966
467 Ga0395899_0015842 3300037312 Bacteria 5748
468 Ga0395899_0015933 3300037312 Bacteria 5733
469 Ga0395900_0000003 3300037418 Bacteria 587648
470 Ga0395900_0000053 3300037418 Bacteria 221135
471 Ga0395900_0010925 3300037418 Bacteria 9285
472 Ga0395900_0052368 3300037418 Bacteria 4202
473 Ga0395900_0064319 3300037418 Bacteria 3770
474 Ga0395900_0082021 3300037418 Bacteria 3313
475 Ga0395900_0150122 3300037418 Bacteria 2381
476 Ga0395898_0000003 3300037466 Bacteria 772986
477 Ga0395898_0000421 3300037466 Bacteria 90307
478 Ga0395898_0009549 3300037466 Bacteria 10189
479 Ga0395898_0036527 3300037466 Bacteria 4878
480 Ga0395898_0216760 3300037466 Bacteria 1825
481 Ga0395905_0000082 3300037471 Bacteria 158963
482 Ga0395905_0127089 3300037471 Bacteria 2397
483 Ga0395905_0303158 3300037471 Bacteria 1485
484 Ga0395905_0323179 3300037471 Bacteria 1433
485 Ga0395901_0000026 3300038443 Bacteria 249248
486 Ga0395901_0000042 3300038443 Bacteria 201819
487 Ga0395901_0002709 3300038443 Bacteria 17846
488 Ga0395901_0006320 3300038443 Bacteria 11997
489 Ga0395901_0214207 3300038443 Bacteria 2015
490 Ga0436365_0462895 3300039437 Bacteria 1818
491 Ga0439436_0047734 3300041404 Bacteria 1215
492 Ga0439466_0007379 3300041411 Bacteria 4164
493 Ga0439466_0029151 3300041411 Bacteria 1901
494 Ga0451797_0775968 3300041453 Bacteria 1119
495 Ga0451795_1600842 3300041456 Bacteria 1581
496 Ga0451802_0924306 3300041460 Bacteria 1690
497 Ga0451839_1417277 3300041496 Bacteria 1595
498 Ga0439431_0107604 3300041997 Bacteria 770
499 Ga0439433_0004268 3300041999 Bacteria 3073
500 Ga0439442_000570 3300042002 Bacteria 8034
501 Ga0439445_0044091 3300042004 Bacteria 1191
502 Ga0439445_0052789 3300042004 Bacteria 1100
503 Ga0439448_0008912 3300042005 Bacteria 2945
504 Ga0439432_005383 3300042006 Bacteria 4611
505 Ga0450911_000205 3300042115 Bacteria 23269
506 Ga0450923_030597 3300042125 Bacteria 1096
507 Ga0450894_010278 3300042131 Bacteria 1214
508 Ga0450906_001618 3300042145 Bacteria 4941
509 Ga0450910_001159 3300042147 Bacteria 3264
510 Ga0439458_0020739 3300042157 Bacteria 1518
511 Ga0450908_000955 3300042184 Bacteria 5569
512 Ga0439434_0001564 3300042435 Bacteria 6603
513 Ga0451577_0002963 3300042876 Bacteria 19426
514 Ga0466986_0011918 3300044650 Bacteria 5409
515 Ga0466969_0009726 3300044656 Bacteria 5096
516 Ga0466969_0013326 3300044656 Bacteria 4329
517 Ga0466972_0005561 3300044658 Bacteria 6310
518 Ga0466972_0006396 3300044658 Bacteria 5914
519 Ga0466972_0079312 3300044658 Bacteria 1563
520 Ga0466982_0023348 3300044672 Bacteria 3570
521 Ga0466965_0000647 3300044683 Bacteria 12749
522 Ga0466965_0032830 3300044683 Bacteria 2535
523 Ga0466966_0000035 3300044684 Bacteria 98928
524 Ga0466966_0068457 3300044684 Bacteria 2228
525 Ga0466966_0093843 3300044684 Bacteria 1860
526 Ga0466966_0149199 3300044684 Bacteria 1427
527 Ga0466961_0000053 3300044693 Bacteria 69359
528 Ga0466961_0000336 3300044693 Bacteria 30807
529 Ga0466961_0013896 3300044693 Bacteria 5158
530 Ga0466961_0022748 3300044693 Bacteria 4031
531 Ga0466961_0047699 3300044693 Bacteria 2739
532 Ga0466961_0143486 3300044693 Bacteria 1494
533 Ga0466961_0165343 3300044693 Bacteria 1377
534 Ga0466961_0241355 3300044693 Bacteria 1110
535 Ga0466963_0010944 3300044694 Bacteria 5512
536 Ga0466964_0009554 3300044706 Bacteria 3655
537 Ga0453684_0337396 3300044712 Bacteria 1703
538 Ga0466971_0058409 3300044719 Bacteria 1741
539 Ga0466971_0178257 3300044719 Bacteria 998
540 Ga0466968_0008978 3300044735 Bacteria 3842
541 Ga0466968_0050712 3300044735 Bacteria 1771
542 Ga0466970_0000691 3300044765 Bacteria 16510
543 Ga0466970_0081594 3300044765 Bacteria 1749
544 Ga0466970_0095450 3300044765 Bacteria 1616
545 Ga0466970_0207290 3300044765 Bacteria 1091
546 Ga0466957_0090477 3300044842 Bacteria 1917
547 Ga0466957_0151919 3300044842 Bacteria 1498
548 Ga0466957_0289252 3300044842 Bacteria 1098
549 Ga0466957_0727094 3300044842 Bacteria 702
550 Ga0466959_0000536 3300045049 Bacteria 22029
551 Ga0466959_0020141 3300045049 Bacteria 4911
552 Ga0466959_0038648 3300045049 Bacteria 3526
553 Ga0466959_0138489 3300045049 Bacteria 1721
554 Ga0466959_0148957 3300045049 Bacteria 1650
555 Ga0451576_0793505 3300045051 Bacteria 994
556 Ga0466958_0003134 3300045836 Bacteria 8507
557 Ga0466958_0008375 3300045836 Bacteria 5731
558 Ga0466958_0037591 3300045836 Bacteria 2900
559 Ga0466967_0002309 3300045976 Bacteria 11781
560 Ga0466967_0017394 3300045976 Bacteria 5706
561 Ga0466967_0452265 3300045976 Bacteria 1255
562 Ga0495627_013120 3300046453 Bacteria 2922
563 Ga0495592_0004473 3300046454 Bacteria 10226
564 Ga0495592_0011711 3300046454 Bacteria 6643
565 Ga0495592_0034294 3300046454 Bacteria 3826
566 Ga0495592_0256043 3300046454 Bacteria 1155
567 Ga0495603_0000314 3300046455 Bacteria 25941
568 Ga0495603_0000829 3300046455 Bacteria 17765
569 Ga0495603_0001095 3300046455 Bacteria 15727
570 Ga0495590_0000532 3300046457 Bacteria 18347
571 Ga0495590_0011310 3300046457 Bacteria 3339
572 Ga0495590_0028532 3300046457 Bacteria 1957
573 Ga0495590_0032454 3300046457 Bacteria 1826
574 Ga0495591_001445 3300046458 Bacteria 14729
575 Ga0495591_020044 3300046458 Bacteria 2221
576 Ga0495629_0001045 3300046459 Bacteria 22168
577 Ga0495629_0001355 3300046459 Bacteria 19292
578 Ga0495629_0009735 3300046459 Bacteria 7015
579 Ga0495629_0025773 3300046459 Bacteria 4178
580 Ga0495638_0008288 3300046460 Bacteria 7380
581 Ga0495638_0030479 3300046460 Bacteria 3472
582 Ga0495638_0339899 3300046460 Bacteria 796
583 Ga0495641_0005366 3300046461 Bacteria 8687
584 Ga0495651_0004504 3300046462 Bacteria 10665
585 Ga0495651_0010112 3300046462 Bacteria 7247
586 Ga0495653_0001129 3300046463 Bacteria 20533
587 Ga0495653_0037733 3300046463 Bacteria 3794
588 Ga0495653_0081863 3300046463 Bacteria 2384
589 Ga0495653_0113137 3300046463 Bacteria 1947
590 Ga0495653_0254242 3300046463 Bacteria 1165
591 Ga0495650_0000785 3300046471 Bacteria 38956
592 Ga0495650_0044736 3300046471 Bacteria 1868
593 Ga0495650_0130688 3300046471 Bacteria 916
594 Ga0495580_0000009 3300046472 Bacteria 101827
595 Ga0495580_0000090 3300046472 Bacteria 59451
596 Ga0495580_0002321 3300046472 Bacteria 16595
597 Ga0495580_0008992 3300046472 Bacteria 7888
598 Ga0495580_0017639 3300046472 Bacteria 5332
599 Ga0495580_0029284 3300046472 Bacteria 3997
600 Ga0495580_0037251 3300046472 Bacteria 3492
601 Ga0495582_0000149 3300046473 Bacteria 37867
602 Ga0495582_0147028 3300046473 Bacteria 1337
603 Ga0495605_0006972 3300046474 Bacteria 6452
604 Ga0495605_0022475 3300046474 Bacteria 3331
605 Ga0495605_0172387 3300046474 Bacteria 955
606 Ga0495639_0033005 3300046475 Bacteria 2310
607 Ga0495662_0062602 3300046476 Bacteria 1797
608 Ga0495662_0064927 3300046476 Bacteria 1764
609 Ga0495662_0130127 3300046476 Bacteria 1237
610 Ga0495664_0000841 3300046477 Bacteria 15743
611 Ga0495664_0178640 3300046477 Bacteria 1287
612 Ga0495664_0305854 3300046477 Bacteria 959
613 Ga0495584_0091524 3300046491 Bacteria 1534
614 Ga0495585_0053061 3300046492 Bacteria 2244
615 Ga0495596_0001240 3300046500 Bacteria 14840
616 Ga0495596_0001953 3300046500 Bacteria 11381
617 Ga0495596_0042453 3300046500 Bacteria 1792
618 Ga0495596_0068397 3300046500 Bacteria 1380
619 Ga0495607_0004706 3300046501 Bacteria 9987
620 Ga0495606_0044207 3300046507 Bacteria 2964
621 Ga0495606_0115161 3300046507 Bacteria 1616
622 Ga0495606_0136314 3300046507 Bacteria 1453
623 Ga0495606_0253939 3300046507 Bacteria 974
624 Ga0495608_0116226 3300046511 Bacteria 1717
625 Ga0495608_0151551 3300046511 Bacteria 1477
626 Ga0495608_0287737 3300046511 Bacteria 1019
627 Ga0495610_0000801 3300046512 Bacteria 29499
628 Ga0495610_0001684 3300046512 Bacteria 19421
629 Ga0495610_0007797 3300046512 Bacteria 7057
630 Ga0495610_0057560 3300046512 Bacteria 1863
631 Ga0495610_0212895 3300046512 Bacteria 785
632 Ga0495616_0004225 3300046513 Bacteria 9089
633 Ga0495616_0006997 3300046513 Bacteria 6790
634 Ga0495618_0002845 3300046514 Bacteria 10957
635 Ga0495618_0005116 3300046514 Bacteria 8009
636 Ga0495618_0007341 3300046514 Bacteria 6670
637 Ga0495620_0088171 3300046515 Bacteria 1247
638 Ga0495620_0195273 3300046515 Bacteria 779
639 Ga0495628_0000686 3300046516 Bacteria 31223
640 Ga0495628_0087838 3300046516 Bacteria 2410
641 Ga0495628_0423713 3300046516 Bacteria 969
642 Ga0495630_0002882 3300046517 Bacteria 11950
643 Ga0495630_0065202 3300046517 Bacteria 2736
644 Ga0495631_0000277 3300046518 Bacteria 35860
645 Ga0495631_0000415 3300046518 Bacteria 29398
646 Ga0495632_0083848 3300046519 Bacteria 1517
647 Ga0495637_0023139 3300046520 Bacteria 2828
648 Ga0495643_0000612 3300046522 Bacteria 42656
649 Ga0495643_0012668 3300046522 Bacteria 5079
650 Ga0495643_0089381 3300046522 Bacteria 1591
651 Ga0495643_0164780 3300046522 Bacteria 1088
652 Ga0495648_0001922 3300046524 Bacteria 19797
653 Ga0495648_0037685 3300046524 Bacteria 3103
654 Ga0495648_0065967 3300046524 Bacteria 2124
655 Ga0495648_0071448 3300046524 Bacteria 2011
656 Ga0495666_0000262 3300046526 Bacteria 22801
657 Ga0495666_0001367 3300046526 Bacteria 11823
658 Ga0495666_0012949 3300046526 Bacteria 4156
659 Ga0495666_0041449 3300046526 Bacteria 2229
660 Ga0495642_0043689 3300046528 Bacteria 1828
661 Ga0495642_0251145 3300046528 Bacteria 773
662 Ga0495652_0003339 3300046529 Bacteria 15922
663 Ga0495652_0039211 3300046529 Bacteria 4096
664 Ga0495652_0170978 3300046529 Bacteria 1677
665 Ga0495665_0000891 3300046531 Bacteria 15666
666 Ga0495665_0032568 3300046531 Bacteria 2788
667 Ga0495665_0041706 3300046531 Bacteria 2443
668 Ga0495665_0207024 3300046531 Bacteria 1016
669 Ga0495640_0003423 3300046533 Bacteria 12776
670 Ga0495640_0015454 3300046533 Bacteria 5744
671 Ga0495640_0396468 3300046533 Bacteria 848
672 Ga0495586_0000464 3300046535 Bacteria 24313
673 Ga0495586_0133949 3300046535 Bacteria 1388
674 Ga0495587_0001565 3300046536 Bacteria 15225
675 Ga0495587_0054328 3300046536 Bacteria 2360
676 Ga0495609_0002726 3300046538 Bacteria 10657
677 Ga0495609_0211215 3300046538 Bacteria 808
678 Ga0495621_0004284 3300046539 Bacteria 3997
679 Ga0495621_0069330 3300046539 Bacteria 1295
680 Ga0495621_0142640 3300046539 Bacteria 938
681 Ga0495645_0000208 3300046543 Bacteria 42020
682 Ga0495645_0000626 3300046543 Bacteria 24355
683 Ga0495645_0005988 3300046543 Bacteria 8409
684 Ga0495622_0000183 3300046557 Bacteria 50803
685 Ga0495622_0000581 3300046557 Bacteria 21677
686 Ga0495667_0151034 3300046559 Bacteria 1496
687 Ga0495656_0000060 3300046615 Bacteria 52471
688 Ga0495668_0115505 3300046616 Bacteria 1468
689 Ga0495668_0153348 3300046616 Bacteria 1262
690 Ga0495634_0000984 3300046642 Bacteria 26848
691 Ga0495634_0086558 3300046642 Bacteria 2040
692 Ga0495611_0039632 3300046648 Bacteria 2098
693 Ga0495611_0106089 3300046648 Bacteria 1306
694 Ga0495625_0000624 3300046660 Bacteria 51214
695 Ga0495625_0012940 3300046660 Bacteria 6734
696 Ga0495625_0013348 3300046660 Bacteria 6602
697 Ga0495625_0022482 3300046660 Bacteria 4835
698 Ga0495625_0058918 3300046660 Bacteria 2726
699 Ga0495625_0400787 3300046660 Bacteria 857
700 Ga0495635_0000661 3300046663 Bacteria 22131
701 Ga0495635_0139930 3300046663 Bacteria 1649
702 Ga0495635_0152801 3300046663 Bacteria 1571
703 Ga0495635_0238786 3300046663 Bacteria 1226
704 Ga0495661_0001181 3300046665 Bacteria 22678
705 Ga0495661_0002898 3300046665 Bacteria 12979
706 Ga0495661_0016358 3300046665 Bacteria 4919
707 Ga0495661_0190636 3300046665 Bacteria 1080
708 Ga0495588_0013862 3300046674 Bacteria 3848
709 Ga0495588_0055626 3300046674 Bacteria 2042
710 Ga0495588_0123273 3300046674 Bacteria 1366
711 Ga0495657_0033214 3300046675 Bacteria 3594
712 Ga0495599_0001014 3300046678 Bacteria 15781
713 Ga0495599_0050641 3300046678 Bacteria 2602
714 Ga0495623_0007386 3300046679 Bacteria 7134
715 Ga0495623_0017823 3300046679 Bacteria 4586
716 Ga0495623_0215273 3300046679 Bacteria 1097
717 Ga0495646_0001547 3300046680 Bacteria 13695
718 Ga0495646_0025675 3300046680 Bacteria 3704
719 Ga0495646_0292285 3300046680 Bacteria 863
720 Ga0495669_0096340 3300046684 Bacteria 1371
721 Ga0495613_0063081 3300046689 Bacteria 2711
722 Ga0495624_0002433 3300046690 Bacteria 14121
723 Ga0495624_0003097 3300046690 Bacteria 12444
724 Ga0495624_0140967 3300046690 Bacteria 1476
725 Ga0495670_0031670 3300046691 Bacteria 2629
726 Ga0495670_0066695 3300046691 Bacteria 1816
727 Ga0495671_0002249 3300046692 Bacteria 12273
728 Ga0495671_0002256 3300046692 Bacteria 12249
729 Ga0495649_0000785 3300046694 Bacteria 25518
730 Ga0495649_0009077 3300046694 Bacteria 5934
731 Ga0495649_0012885 3300046694 Bacteria 4844
732 Ga0495649_0031289 3300046694 Bacteria 2935
733 Ga0495649_0046087 3300046694 Bacteria 2375
734 Ga0495649_0047216 3300046694 Bacteria 2342
735 Ga0495649_0052822 3300046694 Bacteria 2201
736 Ga0495649_0074684 3300046694 Bacteria 1816
737 Ga0495649_0182347 3300046694 Bacteria 1095
738 Ga0495589_0026311 3300046794 Bacteria 2948
739 Ga0495589_0073458 3300046794 Bacteria 1669
740 Ga0495600_0006002 3300046809 Bacteria 7352
741 Ga0495600_0032475 3300046809 Bacteria 3387
742 Ga0495600_0099985 3300046809 Bacteria 1890
743 Ga0495660_0121080 3300046810 Bacteria 1324
744 Ga0495581_0000321 3300047315 Bacteria 23631
745 Ga0495581_0025612 3300047315 Bacteria 3420
746 Ga0495604_0000541 3300047317 Bacteria 33313
747 Ga0495604_0084998 3300047317 Bacteria 2361
748 Ga0495604_0095943 3300047317 Bacteria 2189
749 Ga0495674_0004302 3300047319 Bacteria 13698
750 Ga0495674_0007009 3300047319 Bacteria 10783
751 Ga0495674_0048224 3300047319 Bacteria 3771
752 Ga0495674_0065636 3300047319 Bacteria 3151
753 Ga0495674_0450263 3300047319 Bacteria 1034
754 Ga0495672_0000006 3300047320 Bacteria 589807
755 Ga0495672_0012615 3300047320 Bacteria 5884
756 Ga0495672_0017394 3300047320 Bacteria 4810
757 Ga0495672_0247775 3300047320 Bacteria 866
758 Ga0495676_0003067 3300047321 Bacteria 15109
759 Ga0495676_0057258 3300047321 Bacteria 3076
760 Ga0495676_0065688 3300047321 Bacteria 2814
761 Ga0495680_0003534 3300047322 Bacteria 15320
762 Ga0495680_0141419 3300047322 Bacteria 1760
763 Ga0495680_0144781 3300047322 Bacteria 1736
764 Ga0495683_0000741 3300047323 Bacteria 23578
765 Ga0495683_0002235 3300047323 Bacteria 11836
766 Ga0495683_0030529 3300047323 Bacteria 2749
767 Ga0495683_0072002 3300047323 Bacteria 1695
768 Ga0495687_000018 3300047443 Bacteria 342973
769 Ga0495687_010258 3300047443 Bacteria 5149
770 Ga0495687_042270 3300047443 Bacteria 1993
771 Ga0495687_073381 3300047443 Bacteria 1364
772 Ga0495675_0012248 3300047444 Bacteria 5398
773 Ga0495675_0029005 3300047444 Bacteria 3527
774 Ga0495679_000287 3300047446 Bacteria 41484
775 Ga0495679_003284 3300047446 Bacteria 7837
776 Ga0495679_042574 3300047446 Bacteria 1400
777 Ga0495685_006425 3300047447 Bacteria 3847
778 Ga0495673_0031906 3300047469 Bacteria 2463
779 Ga0495673_0067048 3300047469 Bacteria 1520
780 Ga0495673_0198005 3300047469 Bacteria 753
781 Ga0495681_0018795 3300047470 Bacteria 3793
782 Ga0495684_0030859 3300047471 Bacteria 4114
783 Ga0495686_0007586 3300047472 Bacteria 8107
784 Ga0495593_0000274 3300047673 Bacteria 28031
785 Ga0495593_0004998 3300047673 Bacteria 7850
786 Ga0495593_0005252 3300047673 Bacteria 7656
787 Ga0495602_0004133 3300048088 Bacteria 15124
788 Ga0495602_0026645 3300048088 Bacteria 5571
789 Ga0495602_0027358 3300048088 Bacteria 5479
790 Ga0495602_0271070 3300048088 Bacteria 1254
791 Ga0495614_0000736 3300048089 Bacteria 13868
792 Ga0495614_0004205 3300048089 Bacteria 6487
793 Ga0495614_0011872 3300048089 Bacteria 3829
794 Ga0495614_0096912 3300048089 Bacteria 1286
795 Ga0495615_0071734 3300048090 Bacteria 934
796 Ga0495626_0062747 3300048091 Bacteria 1687
797 Ga0496100_0000137 3300048903 Bacteria 40757
798 Ga0496100_0001939 3300048903 Bacteria 10343
799 Ga0496101_0000044 3300048904 Bacteria 161295
800 Ga0496101_0005632 3300048904 Bacteria 7989
801 Ga0496101_0006414 3300048904 Bacteria 7567
802 Ga0496101_0020807 3300048904 Bacteria 4500
803 Ga0496102_0000379 3300048905 Bacteria 53037
804 Ga0496102_0005508 3300048905 Bacteria 10749
805 Ga0496102_0125153 3300048905 Bacteria 2402
806 Ga0496102_0316952 3300048905 Bacteria 1469
807 Ga0496102_0675973 3300048905 Bacteria 955
808 Ga0496103_0000469 3300048906 Bacteria 34035
809 Ga0496103_0001373 3300048906 Bacteria 16422
810 Ga0496103_0005736 3300048906 Bacteria 7416
811 Ga0496104_0002691 3300048907 Bacteria 15306
812 Ga0496104_0053443 3300048907 Bacteria 3816
813 Ga0496104_0133108 3300048907 Bacteria 2388
814 Ga0496105_0005462 3300048908 Bacteria 9647
815 Ga0496105_0122211 3300048908 Bacteria 2146
816 Ga0496105_0253794 3300048908 Bacteria 1424
817 Ga0496106_0007891 3300048909 Bacteria 7867
818 Ga0496106_0213559 3300048909 Bacteria 1537
819 Ga0496107_0052860 3300048910 Bacteria 2930
820 Ga0496107_0067625 3300048910 Bacteria 2593
821 Ga0496108_0071610 3300048911 Bacteria 2925
822 Ga0496109_0147934 3300048912 Bacteria 2198
823 Ga0496110_0019287 3300048913 Bacteria 5735
824 Ga0496111_0006059 3300048914 Bacteria 7814
825 Ga0496112_0024471 3300048915 Bacteria 5782
826 Ga0496112_0051572 3300048915 Bacteria 4036
827 Ga0496113_0009083 3300048916 Bacteria 6514
828 Ga0496113_0027592 3300048916 Bacteria 4072
829 Ga0496114_0002580 3300048917 Bacteria 13842
830 Ga0496115_0000096 3300048918 Bacteria 82735
831 Ga0496116_0000403 3300048919 Bacteria 62168
832 Ga0496116_0002276 3300048919 Bacteria 20367
833 Ga0496116_0006912 3300048919 Bacteria 10179
834 Ga0496116_0013389 3300048919 Bacteria 6618
835 Ga0496116_0021912 3300048919 Bacteria 4805
836 Ga0496116_0024040 3300048919 Bacteria 4517
837 Ga0496117_0000098 3300048920 Bacteria 196331
838 Ga0496117_0006629 3300048920 Bacteria 11619
839 Ga0496117_0015082 3300048920 Bacteria 6617
840 Ga0496117_0027118 3300048920 Bacteria 4469
841 Ga0496117_0070768 3300048920 Bacteria 2341
842 Ga0496117_0113768 3300048920 Bacteria 1679
843 Ga0496117_0172529 3300048920 Bacteria 1253
844 Ga0496117_0387126 3300048920 Bacteria 710
845 Ga0496118_0000400 3300048921 Bacteria 73227
846 Ga0496118_0000533 3300048921 Bacteria 62461
847 Ga0496118_0000644 3300048921 Bacteria 57224
848 Ga0496118_0003771 3300048921 Bacteria 18726
849 Ga0496118_0006135 3300048921 Bacteria 13342
850 Ga0496118_0007071 3300048921 Bacteria 12055
851 Ga0496118_0009625 3300048921 Bacteria 9724
852 Ga0496118_0013952 3300048921 Bacteria 7556
853 Ga0496118_0016091 3300048921 Bacteria 6881
854 Ga0496118_0131205 3300048921 Bacteria 1609
855 Ga0496118_0218997 3300048921 Bacteria 1110
856 Ga0496119_0014786 3300048922 Bacteria 6074
857 Ga0496119_0171283 3300048922 Bacteria 1146
858 Ga0496120_0025672 3300048923 Bacteria 3653
859 Ga0496121_0000294 3300048924 Bacteria 103244
860 Ga0496121_0000822 3300048924 Bacteria 56626
861 Ga0496121_0001909 3300048924 Bacteria 33363
862 Ga0496121_0003473 3300048924 Bacteria 22448
863 Ga0496121_0004825 3300048924 Bacteria 17756
864 Ga0496121_0015210 3300048924 Bacteria 8086
865 Ga0496121_0023258 3300048924 Bacteria 5975
866 Ga0496121_0030733 3300048924 Bacteria 4927
867 Ga0496121_0059162 3300048924 Bacteria 3161
868 Ga0496121_0104713 3300048924 Bacteria 2173
869 Ga0496121_0106385 3300048924 Bacteria 2150
870 Ga0496122_0000021 3300048925 Bacteria 391363
871 Ga0496122_0006795 3300048925 Bacteria 12994
872 Ga0496122_0008449 3300048925 Bacteria 11104
873 Ga0496122_0008978 3300048925 Bacteria 10627
874 Ga0496122_0133825 3300048925 Bacteria 1568
875 Ga0496122_0218100 3300048925 Bacteria 1097
876 Ga0496122_0254233 3300048925 Bacteria 980
877 Ga0496122_0373662 3300048925 Bacteria 734
878 Ga0496123_0000050 3300048926 Bacteria 238021
879 Ga0496123_0000176 3300048926 Bacteria 130010
880 Ga0496123_0004101 3300048926 Bacteria 15630
881 Ga0496123_0009377 3300048926 Bacteria 8824
882 Ga0496123_0013089 3300048926 Bacteria 7000
883 Ga0496123_0017617 3300048926 Bacteria 5735
884 Ga0496123_0077868 3300048926 Bacteria 2034
885 Ga0496123_0150532 3300048926 Bacteria 1256
886 Ga0496123_0153252 3300048926 Bacteria 1240
887 Ga0496123_0291450 3300048926 Bacteria 783
888 Ga0496124_0000006 3300048927 Bacteria 904259
889 Ga0496124_0020422 3300048927 Bacteria 6119
890 Ga0496124_0060707 3300048927 Bacteria 3171
891 Ga0496124_0088643 3300048927 Bacteria 2528
892 Ga0496124_0115861 3300048927 Bacteria 2149
893 Ga0496124_0123310 3300048927 Bacteria 2067
894 Ga0496124_0137890 3300048927 Bacteria 1929
895 Ga0496124_0144744 3300048927 Bacteria 1871
896 Ga0496124_0171432 3300048927 Bacteria 1680
897 Ga0496124_0223694 3300048927 Bacteria 1413
898 Ga0496125_0000005 3300048928 Bacteria 827598
899 Ga0496125_0001680 3300048928 Bacteria 30949
900 Ga0496125_0006458 3300048928 Bacteria 12671
901 Ga0496125_0015569 3300048928 Bacteria 7344
902 Ga0496125_0016460 3300048928 Bacteria 7097
903 Ga0496125_0029704 3300048928 Bacteria 4906
904 Ga0496125_0035954 3300048928 Bacteria 4333
905 Ga0496125_0037911 3300048928 Bacteria 4183
906 Ga0496125_0050626 3300048928 Bacteria 3437
907 Ga0496125_0067250 3300048928 Bacteria 2825
908 Ga0496125_0128454 3300048928 Bacteria 1790
909 Ga0496126_0000331 3300048929 Bacteria 100914
910 Ga0496126_0001126 3300048929 Bacteria 44695
911 Ga0496126_0005355 3300048929 Bacteria 14667
912 Ga0496126_0014902 3300048929 Bacteria 7841
913 Ga0496126_0016298 3300048929 Bacteria 7436
914 Ga0496126_0039126 3300048929 Bacteria 4404
915 Ga0496126_0133401 3300048929 Bacteria 2144
916 Ga0496126_0145636 3300048929 Bacteria 2034
917 Ga0496126_0383859 3300048929 Bacteria 1143
918 Ga0495678_027991 3300049459 Bacteria 2384
919 Ga0495678_069790 3300049459 Bacteria 1292
920 Ga0495682_0063955 3300049460 Bacteria 1326
921 Ga0501037_0037371 3300049573 Bacteria 3580
922 Ga0501198_000072 3300049649 Bacteria 26487
923 Ga0501222_000024 3300049662 Bacteria 65412
924 Ga0501044_0211188 3300049823 Bacteria 1895
925 nmdc:mga03n38_17778_c1 3300050490 Bacteria 2791
926 nmdc:mga00v17_12227_c1 3300050491 Bacteria 4735
927 nmdc:mga00v17_60088_c1 3300050491 Bacteria 2334
928 nmdc:mga00v17_682496_c1 3300050491 Bacteria 659
929 nmdc:mga0k408_131132_c1 3300050493 Bacteria 1488
930 nmdc:mga0k408_484143_c1 3300050493 Bacteria 734
931 nmdc:mga06z11_340964_c1 3300050494 Bacteria 896
932 nmdc:mga07m45_1317_c1 3300050496 Bacteria 11304
933 nmdc:mga07m45_16450_c1 3300050496 Bacteria 3960
934 nmdc:mga07m45_905_c1 3300050496 Bacteria 12956
935 Ga0500610_0003239 3300053079 Bacteria 6203
936 Ga0500610_0015684 3300053079 Bacteria 3594
937 Ga0500610_0104981 3300053079 Bacteria 1458
938 Ga0500578_0000342 3300053086 Bacteria 56948
939 Ga0500643_003837 3300053087 Bacteria 7002
940 Ga0500651_0000028 3300053093 Bacteria 114592
941 Ga0500566_0166851 3300053094 Bacteria 1142
942 Ga0500641_0062005 3300053096 Bacteria 1559
943 Ga0500571_000016 3300053110 Bacteria 64989
944 Ga0500593_000167 3300053117 Bacteria 26501
945 Ga0500607_001510 3300053121 Bacteria 20789
946 Ga0500607_029863 3300053121 Bacteria 3009
947 Ga0500608_065226 3300053122 Bacteria 1737
948 Ga0500618_022250 3300053125 Bacteria 1541
949 Ga0500626_022823 3300053128 Bacteria 2800
950 Ga0500658_0000864 3300053134 Bacteria 12433
951 Ga0500658_0002893 3300053134 Bacteria 6588
952 Ga0500559_0003152 3300053136 Bacteria 8189
953 Ga0500559_0004597 3300053136 Bacteria 6522
954 Ga0500564_049498 3300053138 Bacteria 1924
955 Ga0500568_0020741 3300053139 Bacteria 2838
956 Ga0500574_028747 3300053141 Bacteria 1476
957 Ga0500574_032796 3300053141 Bacteria 1408
958 Ga0500616_0028263 3300053153 Bacteria 3091
959 Ga0500627_0000710 3300053158 Bacteria 8856
960 Ga0500633_0191528 3300053160 Bacteria 766
961 Ga0500634_0000177 3300053161 Bacteria 21112
962 Ga0500634_0014502 3300053161 Bacteria 4159
963 Ga0500636_0310620 3300053177 Bacteria 771
964 Ga0500645_000787 3300053730 Bacteria 19169
965 Ga0500587_000482 3300053739 Bacteria 4784
966 Ga0466962_0000180 3300061719 Bacteria 26200
967 Ga0466962_0001916 3300061719 Bacteria 9798
968 Ga0466962_0019617 3300061719 Bacteria 3250
969 Ga0466962_0026332 3300061719 Bacteria 2792
970 Ga0466962_0052815 3300061719 Bacteria 1942
971 2501075203 2501025501 Bacteria 7768574
972 2501083203 2501025502 Bacteria 9641094
973 2501412491 2501025504 Bacteria 8008976
974 2510248779 2510065045 Bacteria 7761063
975 2511088121 2510917013 Bacteria 9951648
976 2511101377 2510917014 Bacteria 8296963
977 2511108020 2510917015 Bacteria 7950052
978 2512349090 2512047030 Bacteria 9031815
979 2513231123 2513020051 Bacteria 6053213
980 2513552571 2513237082 Bacteria 8640282
981 2513560689 2513237083 Bacteria 8410967
982 2513953574 2513237150 Bacteria 6553639
983 2513958457 2513237151 Bacteria 6309801
984 2514044267 2513237165 Bacteria 6771773
985 2514047305 2513237166 Bacteria 10373764
986 2515680311 2515154122 Bacteria 8609520
987 2516021748 2515154189 Bacteria 9629850
988 2519461064 2519103095 Bacteria 6629912
989 2526212243 2526164512 Bacteria 4025691
990 2547501875 2547132130 Bacteria 4660562
991 2563059726 2562617112 Bacteria 10918404
992 2585289960 2582581311 Bacteria 6763856
993 2587755677 2585428062 Bacteria 6842168
994 2597028321 2596583598 Bacteria 5251611
995 2599445111 2599185178 Bacteria 5365746
996 2599735702 2599185239 Bacteria 8686614
997 2599743625 2599185240 Bacteria 7968121
998 2599903646 2599185292 Bacteria 6290804
999 2600209174 2599185355 Bacteria 7968906
1000 2600815027 2600255067 Bacteria 6795583
1001 2643860127 2643221569 Bacteria 6064337
1002 2643967050 2643221592 Bacteria 6608788
1003 2643979247 2643221594 Bacteria 5811388
1004 2644120165 2643221621 Bacteria 6212786
1005 2644139916 2643221625 Bacteria 6512927
1006 2644162991 2643221628 Bacteria 5745828
1007 2644271156 2643221648 Bacteria 6521465
1008 2644325346 2643221658 Bacteria 6064537
1009 2644399080 2643221672 Bacteria 6322190
1010 2644467813 2643221683 Bacteria 5749203
1011 2676742588 2675903129 Bacteria 7964495
1012 2713480566 2711768613 Bacteria 11048459
1013 2719642795 2718217991 Bacteria 7829542
1014 2723876111 2721755763 Bacteria 4464185
1015 2738723500 2738541277 Bacteria 7458140
1016 2738819179 2738541296 Bacteria 7285013
1017 2738831658 2738541298 Bacteria 7286732
1018 2738873186 2738541306 Bacteria 7284992
1019 2738882199 2738541307 Bacteria 8606193
1020 2739184816 2738543002 Bacteria 7284546
1021 2739219785 2738543008 Bacteria 7282815
1022 2739249246 2738543013 Bacteria 5618633
1023 2739284231 2738543019 Bacteria 7459457
1024 2747948539 2747842428 Bacteria 4689383
1025 2753570995 2751185846 Bacteria 7242164
1026 2765579317 2765235840 Bacteria 4663337
1027 2792835403 2791355137 Bacteria 9654227
1028 2809035881 2808606395 Bacteria 6020352
1029 2816517428 2816332141 Bacteria 4436036
1030 2817259093 2816332253 Bacteria 6764532
1031 2817280489 2816332256 Bacteria 6891714
1032 2817452320 2816332286 Bacteria 6853759
1033 2819619154 2818991450 Bacteria 6962147
1034 2819630260 2818991452 Bacteria 8442785
1035 2842327133 2842324504 Bacteria 9364110
1036 2842350738 2842348783 Bacteria 9002918
1037 2842391561 2842391507 Bacteria 4486072
1038 2842456526 2842454564 Bacteria 8730687
1039 2842680111 2842677519 Bacteria 5615038
1040 2842734725 2842733646 Bacteria 5716726
1041 2842748513 2842747753 Bacteria 5578255
1042 2856288722 2856287931 Bacteria 7223934
1043 2857362105 2857357740 Bacteria 9937880
1044 2857538866 2857537821 Bacteria 5248181
1045 2858953652 2858950400 Bacteria 6783797
1046 2863423536 2863421361 Bacteria 7300805
1047 2870074683 2870068957 Bacteria 8925310
1048 2874222004 2874220319 Bacteria 4594709
1049 2883090261 2883087390 Bacteria 9532701
1050 2885196575 2885192300 Bacteria 5882526
1051 2885278067 2885270888 Bacteria 9831543
1052 2900580511 2900577576 Bacteria 5438534
1053 2901306535 2901300506 Bacteria 8463898
1054 2902687943 2902682994 Bacteria 8951596
1055 2904454647 2904449895 Bacteria 6927402
1056 2904460430 2904456579 Bacteria 6819253
1057 2904547779 2904541872 Bacteria 8915136
1058 2904569604 2904564687 Bacteria 7609577
1059 2904576915 2904571731 Bacteria 7608790
1060 2904620084 2904615490 Bacteria 10047340
1061 2919089353 2919089067 Bacteria 4560942
1062 2919135711 2919134579 Bacteria 4480386
1063 2919464231 2919462493 Bacteria 5817112
1064 2919529605 2919527303 Bacteria 7718827
1065 2928060278 2928058823 Bacteria 5520022
1066 2928090157 2928084124 Bacteria 7159212
1067 2928114073 2928108538 Bacteria 7360024
1068 2928120338 2928115317 Bacteria 6477646
1069 2928141449 2928135762 Bacteria 7259641
1070 2928157855 2928157003 Bacteria 7522202
1071 2928165621 2928163908 Bacteria 7561269
1072 2928179041 2928170801 Bacteria 8785406
1073 2928497480 2928496128 Bacteria 4631123
1074 2928504560 2928503688 Bacteria 7268108
1075 2928536994 2928536128 Bacteria 7657547
1076 2929166980 2929160207 Bacteria 9075316
1077 2929524628 2929520902 Bacteria 6765052
1078 2931380406 2931380184 Bacteria 4455911
1079 2937612839 2937610967 Bacteria 4618818
1080 2939591752 2939589442 Bacteria 4214238
1081 2939626974 2939626828 Bacteria 4695272
1082 2941483425
1083 2945912167 2945909444 Bacteria 7065066
1084 2945940190 2945934425 Bacteria 7444609
1085 2945947051 2945945610 Bacteria 5951079
1086 2945976742 2945972063 Bacteria 6086495
1087 2945985545 2945984333 Bacteria 7358892
1088 2954771785 2954767861 Bacteria 5535784
1089 2961048771 2961047084 Bacteria 4594415
1090 2961067674 2961064222 Bacteria 4749990
1091 2974308717 2974307012 Bacteria 4172388
1092 2977249456 2977247770 Bacteria 4160543
1093 2981990869 2981990288 Bacteria 7590678
1094 2984516076 2984514374 Bacteria 4172479
1095 2990707321 2990703756 Bacteria 7715990
1096 642423762 641736151 Bacteria 7477263
1097 642419997 641736154 Bacteria 7689995
1098 642598101 642555112 Bacteria 8676562
1099 644750393 644736347 Bacteria 6476522
1100 8003958354 8003955200 Bacteria 8601927
1101 8018853100 8018845410 Bacteria 8933938
1102 8020812867 8020807995 Bacteria 6801506
1103 8020940705 8020938398 Bacteria 7472757
1104 8020949730 8020945358 Bacteria 8467355
1105 8020954286 8020953355 Bacteria 7439080
1106 8021121195 8021120328 Bacteria 8782274
1107 8039101886 8039098773 Bacteria 6602928
1108 8040173516 8040173305 Bacteria 6827067
1109 8055269313 8055266321 Bacteria 7999742
1110 8055303634 8055301274 Bacteria 8587385
1111 Ga0395905_0181414
1112 JGI24740J21852_10000188
1113 JGI24740J21852_10031126
1114 JGI24739J22299_10006875
1115 JGI24739J22299_10027695
1116 JGI24735J21928_10000295
1117 JGI24735J21928_10002557
1118 JGI24735J21928_10025903
1119 JGI24735J21928_10041993
1120 JGI24735J21928_10062451
1121 JGI24738J21930_10001725
1122 JGI25154J39366_1001255
1123 JGI25152J39213_1024242
1124 JGI25151J46595_10000304
1125 JGI25151J46595_10002852
1126 JGI25165J46597_1001102
1127 rootH2_10000556
1128 JGI25160J50197_1000037
1129 Ga0006562J51391_1170292
1130 Ga0055538_1001884
1131 Ga0055538_1002979
1132 Ga0055539_1000086
1133 Ga0055533_1000184
1134 Ga0055533_1002302
1135 Ga0055533_1003066
1136 Ga0055533_1003087
1137 Ga0055532_1000007
1138 Ga0055532_1000041
1139 Ga0055532_1000963
1140 Ga0055525_1000469
1141 Ga0055527_1000007
1142 Ga0055527_1000191
1143 Ga0055527_1000672
1144 Ga0055535_1000005
1145 Ga0055535_1000030
1146 Ga0055535_1000399
1147 Ga0055535_1002045
1148 Ga0055542_1000008
1149 Ga0055542_1001050
1150 Ga0055542_1001927
1151 Ga0055542_1004466
1152 Ga0055529_1000005
1153 Ga0055529_1000058
1154 Ga0055529_1001344
1155 Ga0055529_1011975
1156 Ga0055526_1000973
1157 Ga0055526_1007037
1158 Ga0055526_1020666
1159 Ga0055537_1000168
1160 Ga0055537_1000700
1161 Ga0055524_1006063
1162 Ga0055524_1025073
1163 Ga0055536_1000124
1164 Ga0055536_1000359
1165 Ga0055536_1001816
1166 Ga0055534_1000024
1167 Ga0055534_1000115
1168 Ga0055534_1000953
1169 Ga0055534_1032382
1170 Ga0055528_1000348
1171 Ga0055528_1000446
1172 Ga0055530_10000021
1173 Ga0055530_10000323
1174 Ga0055530_10023750
1175 Ga0055540_1000408
1176 Ga0055540_1000433
1177 Ga0055540_1056699
1178 Ga0055531_10013971
1179 Ga0055531_10041144
1180 Ga0055541_1007307
1181 Ga0058692_1000009
1182 Ga0058692_1002370
1183 Ga0058692_1041772
1184 Ga0065165_1000629
1185 Ga0065165_1048682
1186 Ga0065714_10002862
1187 Ga0070658_10003973
1188 Ga0070658_10031180
1189 Ga0070658_10091806
1190 Ga0070658_10106600
1191 Ga0070676_10243199
1192 Ga0070670_100591915
1193 Ga0070666_10200256
1194 Ga0070682_100165642
1195 Ga0070660_100000833
1196 Ga0070660_100006982
1197 Ga0070661_100000267
1198 Ga0070661_100340545
1199 Ga0070669_100029840
1200 Ga0070675_100416940
1201 Ga0070675_100848805
1202 Ga0070688_100699863
1203 Ga0070659_100000858
1204 Ga0070659_100001606
1205 Ga0070659_100318973
1206 Ga0070667_100572864
1207 Ga0070663_100000082
1208 Ga0070663_100001523
1209 Ga0070663_100272935
1210 Ga0070678_100198690
1211 Ga0070678_100671587
1212 Ga0070684_100509692
1213 Ga0070672_100159122
1214 Ga0070665_100006462
1215 Ga0070665_100039729
1216 Ga0068855_100013980
1217 Ga0068855_100026993
1218 Ga0070664_100000274
1219 Ga0070664_100001095
1220 Ga0068854_100000341
1221 Ga0068856_100000527
1222 Ga0068856_100326522
1223 Ga0068856_100336448
1224 Ga0068852_100028158
1225 Ga0068852_100145810
1226 Ga0068852_100747715
1227 Ga0068863_100575787
1228 Ga0068858_100492169
1229 Ga0075365_10022502
1230 Ga0075368_10184634
1231 Ga0075363_100032856
1232 Ga0075363_100038398
1233 Ga0075363_100356827
1234 Ga0075364_10022213
1235 Ga0075364_10059507
1236 Ga0075364_10080560
1237 Ga0075432_10006369
1238 Ga0075362_10003585
1239 Ga0075362_10109344
1240 Ga0075367_10052865
1241 Ga0075367_10054619
1242 Ga0075367_10077115
1243 Ga0075367_10231183
1244 Ga0075369_10040530
1245 Ga0075366_10004632
1246 Ga0075366_10016205
1247 Ga0097621_100630353
1248 Ga0075370_10000045
1249 Ga0075370_10016917
1250 Ga0075370_10101048
1251 Ga0099826_10000132
1252 Ga0099826_10066190
1253 Ga0105251_10000085
1254 Ga0105251_10000195
1255 Ga0105251_10013696
1256 Ga0105251_10075319
1257 Ga0105244_10047560
1258 Ga0105250_10102813
1259 Ga0105240_10001007
1260 Ga0105240_10002439
1261 Ga0105240_10018449
1262 Ga0105240_10094053
1263 Ga0105240_10121379
1264 Ga0105240_10467877
1265 Ga0105243_10008382
1266 Ga0105243_10010744
1267 Ga0105243_10211677
1268 Ga0105243_10333283
1269 Ga0105241_10226142
1270 Ga0105241_10421667
1271 Ga0105237_10013644
1272 Ga0105237_10028203
1273 Ga0105237_10097247
1274 Ga0105238_10024279
1275 Ga0105238_10070687
1276 Ga0105238_10112683
1277 Ga0105249_10882111
1278 Ga0105239_10002601
1279 Ga0105239_10048975
1280 Ga0105239_10617946
1281 Ga0105246_10195551
1282 Ga0157327_1020166
1283 Ga0157373_10035498
1284 Ga0157373_10036300
1285 Ga0157373_10051805
1286 Ga0157373_10194991
1287 Ga0157371_10000022
1288 Ga0157371_10000613
1289 Ga0157371_10020173
1290 Ga0157370_10000004
1291 Ga0157370_10002960
1292 Ga0157370_10009604
1293 Ga0157370_10012552
1294 Ga0157369_10005113
1295 Ga0157369_10011117
1296 Ga0157369_10022890
1297 Ga0157369_10023753
1298 Ga0157369_10081071
1299 Ga0157369_10117995
1300 Ga0157369_10815426
1301 Ga0157374_10000219
1302 Ga0157374_10478371
1303 Ga0157372_10002559
1304 Ga0157372_10007566
1305 Ga0157375_10246850
1306 Ga0157375_10906999
1307 Ga0182008_10000070
1308 Ga0182008_10005687
1309 Ga0182008_10011571
1310 Ga0182008_10016590
1311 Ga0182008_10034228
1312 Ga0182008_10117743
1313 Ga0182008_10187476
1314 Ga0182008_10189423
1315 Ga0182006_1000709
1316 Ga0182006_1026368
1317 Ga0182006_1035522
1318 Ga0182006_1046290
1319 Ga0182006_1056141
1320 Ga0182007_10000004
1321 Ga0182007_10000576
1322 Ga0182007_10030700
1323 Ga0182007_10033144
1324 Ga0182007_10044219
1325 Ga0182005_1020255
1326 Ga0182005_1062316
1327 Ga0182005_1065907
1328 Ga0183362_10002
1329 Ga0183361_10004
1330 Ga0163161_10000139
1331 Ga0163161_10005865
1332 Ga0163161_10265029
1333 Ga0163161_10311246
1334 Ga0163161_10490307
1335 Ga0206351_10088385
1336 Ga0154015_1439323
1337 Ga0209784_100029
1338 Ga0209784_101356
1339 Ga0209566_100030
1340 Ga0209566_100807
1341 Ga0209566_101195
1342 Ga0209566_103041
1343 Ga0209674_100020
1344 Ga0209674_100029
1345 Ga0209674_100075
1346 Ga0209674_100160
1347 Ga0209674_102918
1348 Ga0209672_100012
1349 Ga0209672_100013
1350 Ga0209672_100093
1351 Ga0209672_100175
1352 Ga0209672_102442
1353 Ga0209147_100007
1354 Ga0209147_100008
1355 Ga0209147_100013
1356 Ga0209147_100074
1357 Ga0209147_100134
1358 Ga0209563_100091
1359 Ga0209563_100092
1360 Ga0209563_100484
1361 Ga0209563_104619
1362 Ga0207427_101111
1363 Ga0209258_100013
1364 Ga0209258_100014
1365 Ga0209258_100016
1366 Ga0209258_100209
1367 Ga0209646_1000019
1368 Ga0209677_100030
1369 Ga0209677_101579
1370 Ga0209677_118632
1371 Ga0209148_1000020
1372 Ga0209148_1000118
1373 Ga0209148_1000184
1374 Ga0209148_1001921
1375 Ga0209148_1002607
1376 Ga0209759_1000008
1377 Ga0209759_1000022
1378 Ga0209759_1002763
1379 Ga0209759_1003296
1380 Ga0209759_1005327
1381 Ga0209759_1014515
1382 Ga0209759_1029014
1383 Ga0209129_1000873
1384 Ga0209233_1000055
1385 Ga0209565_1000024
1386 Ga0209565_1000040
1387 Ga0209565_1011161
1388 Ga0209455_1000017
1389 Ga0209455_1000106
1390 Ga0209455_1000160
1391 Ga0209455_1001972
1392 Ga0209673_1000046
1393 Ga0209673_1000109
1394 Ga0209673_1000413
1395 Ga0209673_1002008
1396 Ga0209130_1009220
1397 Ga0209130_1016600
1398 Ga0209675_1000024
1399 Ga0209675_1000039
1400 Ga0209675_1000129
1401 Ga0209675_1001803
1402 Ga0209675_1020366
1403 Ga0209675_1046902
1404 Ga0209676_1000011
1405 Ga0209676_1000014
1406 Ga0209676_1000071
1407 Ga0209676_1000075
1408 Ga0209025_1000232
1409 Ga0209025_1000382
1410 Ga0209025_1000446
1411 Ga0209025_1001095
1412 Ga0209025_1021309
1413 Ga0209025_1025421
1414 Ga0209025_1030698
1415 Ga0209564_1000309
1416 Ga0209564_1000411
1417 Ga0209564_1001305
1418 Ga0209564_1003422
1419 Ga0209050_1000032
1420 Ga0209050_1000069
1421 Ga0209050_1000720
1422 Ga0209050_1003935
1423 Ga0209050_1068900
1424 Ga0209256_1000134
1425 Ga0209256_1012635
1426 Ga0209256_1020757
1427 Ga0207426_1000004
1428 Ga0209051_1000092
1429 Ga0209051_1000169
1430 Ga0209051_1002066
1431 Ga0209051_1013463
1432 Ga0209257_1000014
1433 Ga0209257_1000571
1434 Ga0209257_1000722
1435 Ga0209257_1009463
1436 Ga0207655_1048697
1437 Ga0207713_1001373
1438 Ga0207713_1003740
1439 Ga0207713_1043532
1440 Ga0207713_1095743
1441 Ga0207680_10201499
1442 Ga0207647_10002375
1443 Ga0207647_10012862
1444 Ga0207647_10019436
1445 Ga0207647_10022845
1446 Ga0207647_10052462
1447 Ga0207647_10077029
1448 Ga0207705_10000420
1449 Ga0207695_10000171
1450 Ga0207695_10002092
1451 Ga0207695_10028576
1452 Ga0207695_10127948
1453 Ga0207695_10340023
1454 Ga0207695_10372770
1455 Ga0207695_10888510
1456 Ga0207671_10022820
1457 Ga0207671_10062975
1458 Ga0207671_10072418
1459 Ga0207657_10000002
1460 Ga0207657_10010805
1461 Ga0207649_10000335
1462 Ga0207649_10000468
1463 Ga0207681_10010845
1464 Ga0207694_10071654
1465 Ga0207694_10721457
1466 Ga0207659_10276821
1467 Ga0207690_10000011
1468 Ga0207690_10000176
1469 Ga0207690_10292520
1470 Ga0207686_10454097
1471 Ga0207709_10000038
1472 Ga0207709_10004913
1473 Ga0207709_10019495
1474 Ga0207691_10203543
1475 Ga0207679_10000168
1476 Ga0207679_10000229
1477 Ga0207667_10026258
1478 Ga0207667_10035219
1479 Ga0207667_10043871
1480 Ga0207667_10619107
1481 Ga0207640_10000289
1482 Ga0207640_10159791
1483 Ga0207658_10023311
1484 Ga0207677_10433889
1485 Ga0207703_10400911
1486 Ga0207678_10000334
1487 Ga0207678_10000677
1488 Ga0207678_10292425
1489 Ga0207702_10000537
1490 Ga0207702_10840403
1491 Ga0207641_10340622
1492 Ga0207674_10009467
1493 Ga0207683_10072739
1494 Ga0207683_10327772
1495 Ga0207698_10117038
1496 Ga0207698_10346292
1497 Ga0207698_10993853
1498 Ga0209371_1000023
1499 Ga0209371_1001595
1500 Ga0209371_1006823
1501 Ga0209282_1000032
1502 Ga0209282_1000127
1503 Ga0209813_10178787
1504 Ga0268266_10007180
1505 Ga0268266_10098400
1506 Ga0268266_10745300
1507 Ga0268265_10005086
1508 Ga0307517_10280209
1509 Ga0307515_10000618
1510 Ga0307515_10001346
1511 Ga0307515_10001873
1512 Ga0307515_10014468
1513 Ga0265338_10000270
1514 Ga0268256_1000023
1515 Ga0268256_1001380
1516 Ga0268256_1006937
1517 Ga0307512_10034925
1518 Ga0316177_1007272
1519 Ga0316177_1155703
1520 Ga0316176_1109634
1521 Ga0314311_1020500
1522 Ga0316179_1048542
1523 Ga0316178_1040985
1524 Ga0316180_1037427
1525 Ga0316183_1157955
1526 Ga0316181_1023192
1527 Ga0316182_1156455
1528 Ga0316182_1211692
1529 Ga0265332_10045646
1530 Ga0265340_10084569
1531 Ga0265327_10017002
1532 Ga0265316_10009820
1533 Ga0265316_10096979
1534 Ga0307513_10086758
1535 Ga0307513_10483237
1536 Ga0307509_10013250
1537 Ga0307408_100003959
1538 Ga0307408_100128688
1539 Ga0307408_100194290
1540 Ga0307408_100565879
1541 Ga0307508_10000053
1542 Ga0307514_10035015
1543 Ga0316576_10071642
1544 Ga0316576_10158704
1545 Ga0316578_10059541
1546 Ga0307516_10001663
1547 Ga0307516_10249984
1548 Ga0307405_10004656
1549 Ga0307405_10017276
1550 Ga0307405_10194828
1551 Ga0316577_10066463
1552 Ga0307413_10416287
1553 Ga0307410_10358594
1554 Ga0307410_10468455
1555 Ga0307406_10001449
1556 Ga0307406_10029459
1557 Ga0307406_10180811
1558 Ga0307406_10261138
1559 Ga0307407_10417630
1560 Ga0307412_10000099
1561 Ga0307412_10000307
1562 Ga0307412_10000384
1563 Ga0307412_10010187
1564 Ga0307412_10016243
1565 Ga0307412_10253650
1566 Ga0307412_10321553
1567 Ga0307409_100834117
1568 Ga0307416_100025774
1569 Ga0307416_100057543
1570 Ga0307414_10173269
1571 Ga0307414_10551212
1572 Ga0307411_10218905
1573 Ga0316580_10110045
1574 Ga0307507_10059857
1575 Ga0373931_0002570
1576 Ga0395899_0000005
1577 Ga0395899_0015842
1578 Ga0395899_0015933
1579 Ga0395900_0000003
1580 Ga0395900_0000053
1581 Ga0395900_0010925
1582 Ga0395900_0052368
1583 Ga0395900_0064319
1584 Ga0395900_0082021
1585 Ga0395900_0150122
1586 Ga0395898_0000003
1587 Ga0395898_0000421
1588 Ga0395898_0009549
1589 Ga0395898_0036527
1590 Ga0395898_0216760
1591 Ga0395905_0000082
1592 Ga0395905_0127089
1593 Ga0395905_0303158
1594 Ga0395905_0323179
1595 Ga0395901_0000026
1596 Ga0395901_0000042
1597 Ga0395901_0002709
1598 Ga0395901_0006320
1599 Ga0395901_0214207
1600 Ga0436365_0462895
1601 Ga0439436_0047734
1602 Ga0439466_0007379
1603 Ga0439466_0029151
1604 Ga0451797_0775968
1605 Ga0451795_1600842
1606 Ga0451802_0924306
1607 Ga0451839_1417277
1608 Ga0439431_0107604
1609 Ga0439433_0004268
1610 Ga0439442_000570
1611 Ga0439445_0044091
1612 Ga0439445_0052789
1613 Ga0439448_0008912
1614 Ga0439432_005383
1615 Ga0450911_000205
1616 Ga0450923_030597
1617 Ga0450894_010278
1618 Ga0450906_001618
1619 Ga0450910_001159
1620 Ga0439458_0020739
1621 Ga0450908_000955
1622 Ga0439434_0001564
1623 Ga0451577_0002963
1624 Ga0466986_0011918
1625 Ga0466969_0009726
1626 Ga0466969_0013326
1627 Ga0466972_0005561
1628 Ga0466972_0006396
1629 Ga0466972_0079312
1630 Ga0466982_0023348
1631 Ga0466965_0000647
1632 Ga0466965_0032830
1633 Ga0466966_0000035
1634 Ga0466966_0068457
1635 Ga0466966_0093843
1636 Ga0466966_0149199
1637 Ga0466961_0000053
1638 Ga0466961_0000336
1639 Ga0466961_0013896
1640 Ga0466961_0022748
1641 Ga0466961_0047699
1642 Ga0466961_0143486
1643 Ga0466961_0165343
1644 Ga0466961_0241355
1645 Ga0466963_0010944
1646 Ga0466964_0009554
1647 Ga0453684_0337396
1648 Ga0466971_0058409
1649 Ga0466971_0178257
1650 Ga0466968_0008978
1651 Ga0466968_0050712
1652 Ga0466970_0000691
1653 Ga0466970_0081594
1654 Ga0466970_0095450
1655 Ga0466970_0207290
1656 Ga0466957_0090477
1657 Ga0466957_0151919
1658 Ga0466957_0289252
1659 Ga0466957_0727094
1660 Ga0466959_0000536
1661 Ga0466959_0020141
1662 Ga0466959_0038648
1663 Ga0466959_0138489
1664 Ga0466959_0148957
1665 Ga0451576_0793505
1666 Ga0466958_0003134
1667 Ga0466958_0008375
1668 Ga0466958_0037591
1669 Ga0466967_0002309
1670 Ga0466967_0017394
1671 Ga0466967_0452265
1672 Ga0495627_013120
1673 Ga0495592_0004473
1674 Ga0495592_0011711
1675 Ga0495592_0034294
1676 Ga0495592_0256043
1677 Ga0495603_0000314
1678 Ga0495603_0000829
1679 Ga0495603_0001095
1680 Ga0495590_0000532
1681 Ga0495590_0011310
1682 Ga0495590_0028532
1683 Ga0495590_0032454
1684 Ga0495591_001445
1685 Ga0495591_020044
1686 Ga0495629_0001045
1687 Ga0495629_0001355
1688 Ga0495629_0009735
1689 Ga0495629_0025773
1690 Ga0495638_0008288
1691 Ga0495638_0030479
1692 Ga0495638_0339899
1693 Ga0495641_0005366
1694 Ga0495651_0004504
1695 Ga0495651_0010112
1696 Ga0495653_0001129
1697 Ga0495653_0037733
1698 Ga0495653_0081863
1699 Ga0495653_0113137
1700 Ga0495653_0254242
1701 Ga0495650_0000785
1702 Ga0495650_0044736
1703 Ga0495650_0130688
1704 Ga0495580_0000009
1705 Ga0495580_0000090
1706 Ga0495580_0002321
1707 Ga0495580_0008992
1708 Ga0495580_0017639
1709 Ga0495580_0029284
1710 Ga0495580_0037251
1711 Ga0495582_0000149
1712 Ga0495582_0147028
1713 Ga0495605_0006972
1714 Ga0495605_0022475
1715 Ga0495605_0172387
1716 Ga0495639_0033005
1717 Ga0495662_0062602
1718 Ga0495662_0064927
1719 Ga0495662_0130127
1720 Ga0495664_0000841
1721 Ga0495664_0178640
1722 Ga0495664_0305854
1723 Ga0495584_0091524
1724 Ga0495585_0053061
1725 Ga0495596_0001240
1726 Ga0495596_0001953
1727 Ga0495596_0042453
1728 Ga0495596_0068397
1729 Ga0495607_0004706
1730 Ga0495606_0044207
1731 Ga0495606_0115161
1732 Ga0495606_0136314
1733 Ga0495606_0253939
1734 Ga0495608_0116226
1735 Ga0495608_0151551
1736 Ga0495608_0287737
1737 Ga0495610_0000801
1738 Ga0495610_0001684
1739 Ga0495610_0007797
1740 Ga0495610_0057560
1741 Ga0495610_0212895
1742 Ga0495616_0004225
1743 Ga0495616_0006997
1744 Ga0495618_0002845
1745 Ga0495618_0005116
1746 Ga0495618_0007341
1747 Ga0495620_0088171
1748 Ga0495620_0195273
1749 Ga0495628_0000686
1750 Ga0495628_0087838
1751 Ga0495628_0423713
1752 Ga0495630_0002882
1753 Ga0495630_0065202
1754 Ga0495631_0000277
1755 Ga0495631_0000415
1756 Ga0495632_0083848
1757 Ga0495637_0023139
1758 Ga0495643_0000612
1759 Ga0495643_0012668
1760 Ga0495643_0089381
1761 Ga0495643_0164780
1762 Ga0495648_0001922
1763 Ga0495648_0037685
1764 Ga0495648_0065967
1765 Ga0495648_0071448
1766 Ga0495666_0000262
1767 Ga0495666_0001367
1768 Ga0495666_0012949
1769 Ga0495666_0041449
1770 Ga0495642_0043689
1771 Ga0495642_0251145
1772 Ga0495652_0003339
1773 Ga0495652_0039211
1774 Ga0495652_0170978
1775 Ga0495665_0000891
1776 Ga0495665_0032568
1777 Ga0495665_0041706
1778 Ga0495665_0207024
1779 Ga0495640_0003423
1780 Ga0495640_0015454
1781 Ga0495640_0396468
1782 Ga0495586_0000464
1783 Ga0495586_0133949
1784 Ga0495587_0001565
1785 Ga0495587_0054328
1786 Ga0495609_0002726
1787 Ga0495609_0211215
1788 Ga0495621_0004284
1789 Ga0495621_0069330
1790 Ga0495621_0142640
1791 Ga0495645_0000208
1792 Ga0495645_0000626
1793 Ga0495645_0005988
1794 Ga0495622_0000183
1795 Ga0495622_0000581
1796 Ga0495667_0151034
1797 Ga0495656_0000060
1798 Ga0495668_0115505
1799 Ga0495668_0153348
1800 Ga0495634_0000984
1801 Ga0495634_0086558
1802 Ga0495611_0039632
1803 Ga0495611_0106089
1804 Ga0495625_0000624
1805 Ga0495625_0012940
1806 Ga0495625_0013348
1807 Ga0495625_0022482
1808 Ga0495625_0058918
1809 Ga0495625_0400787
1810 Ga0495635_0000661
1811 Ga0495635_0139930
1812 Ga0495635_0152801
1813 Ga0495635_0238786
1814 Ga0495661_0001181
1815 Ga0495661_0002898
1816 Ga0495661_0016358
1817 Ga0495661_0190636
1818 Ga0495588_0013862
1819 Ga0495588_0055626
1820 Ga0495588_0123273
1821 Ga0495657_0033214
1822 Ga0495599_0001014
1823 Ga0495599_0050641
1824 Ga0495623_0007386
1825 Ga0495623_0017823
1826 Ga0495623_0215273
1827 Ga0495646_0001547
1828 Ga0495646_0025675
1829 Ga0495646_0292285
1830 Ga0495669_0096340
1831 Ga0495613_0063081
1832 Ga0495624_0002433
1833 Ga0495624_0003097
1834 Ga0495624_0140967
1835 Ga0495670_0031670
1836 Ga0495670_0066695
1837 Ga0495671_0002249
1838 Ga0495671_0002256
1839 Ga0495649_0000785
1840 Ga0495649_0009077
1841 Ga0495649_0012885
1842 Ga0495649_0031289
1843 Ga0495649_0046087
1844 Ga0495649_0047216
1845 Ga0495649_0052822
1846 Ga0495649_0074684
1847 Ga0495649_0182347
1848 Ga0495589_0026311
1849 Ga0495589_0073458
1850 Ga0495600_0006002
1851 Ga0495600_0032475
1852 Ga0495600_0099985
1853 Ga0495660_0121080
1854 Ga0495581_0000321
1855 Ga0495581_0025612
1856 Ga0495604_0000541
1857 Ga0495604_0084998
1858 Ga0495604_0095943
1859 Ga0495674_0004302
1860 Ga0495674_0007009
1861 Ga0495674_0048224
1862 Ga0495674_0065636
1863 Ga0495674_0450263
1864 Ga0495672_0000006
1865 Ga0495672_0012615
1866 Ga0495672_0017394
1867 Ga0495672_0247775
1868 Ga0495676_0003067
1869 Ga0495676_0057258
1870 Ga0495676_0065688
1871 Ga0495680_0003534
1872 Ga0495680_0141419
1873 Ga0495680_0144781
1874 Ga0495683_0000741
1875 Ga0495683_0002235
1876 Ga0495683_0030529
1877 Ga0495683_0072002
1878 Ga0495687_000018
1879 Ga0495687_010258
1880 Ga0495687_042270
1881 Ga0495687_073381
1882 Ga0495675_0012248
1883 Ga0495675_0029005
1884 Ga0495679_000287
1885 Ga0495679_003284
1886 Ga0495679_042574
1887 Ga0495685_006425
1888 Ga0495673_0031906
1889 Ga0495673_0067048
1890 Ga0495673_0198005
1891 Ga0495681_0018795
1892 Ga0495684_0030859
1893 Ga0495686_0007586
1894 Ga0495593_0000274
1895 Ga0495593_0004998
1896 Ga0495593_0005252
1897 Ga0495602_0004133
1898 Ga0495602_0026645
1899 Ga0495602_0027358
1900 Ga0495602_0271070
1901 Ga0495614_0000736
1902 Ga0495614_0004205
1903 Ga0495614_0011872
1904 Ga0495614_0096912
1905 Ga0495615_0071734
1906 Ga0495626_0062747
1907 Ga0496100_0000137
1908 Ga0496100_0001939
1909 Ga0496101_0000044
1910 Ga0496101_0005632
1911 Ga0496101_0006414
1912 Ga0496101_0020807
1913 Ga0496102_0000379
1914 Ga0496102_0005508
1915 Ga0496102_0125153
1916 Ga0496102_0316952
1917 Ga0496102_0675973
1918 Ga0496103_0000469
1919 Ga0496103_0001373
1920 Ga0496103_0005736
1921 Ga0496104_0002691
1922 Ga0496104_0053443
1923 Ga0496104_0133108
1924 Ga0496105_0005462
1925 Ga0496105_0122211
1926 Ga0496105_0253794
1927 Ga0496106_0007891
1928 Ga0496106_0213559
1929 Ga0496107_0052860
1930 Ga0496107_0067625
1931 Ga0496108_0071610
1932 Ga0496109_0147934
1933 Ga0496110_0019287
1934 Ga0496111_0006059
1935 Ga0496112_0024471
1936 Ga0496112_0051572
1937 Ga0496113_0009083
1938 Ga0496113_0027592
1939 Ga0496114_0002580
1940 Ga0496115_0000096
1941 Ga0496116_0000403
1942 Ga0496116_0002276
1943 Ga0496116_0006912
1944 Ga0496116_0013389
1945 Ga0496116_0021912
1946 Ga0496116_0024040
1947 Ga0496117_0000098
1948 Ga0496117_0006629
1949 Ga0496117_0015082
1950 Ga0496117_0027118
1951 Ga0496117_0070768
1952 Ga0496117_0113768
1953 Ga0496117_0172529
1954 Ga0496117_0387126
1955 Ga0496118_0000400
1956 Ga0496118_0000533
1957 Ga0496118_0000644
1958 Ga0496118_0003771
1959 Ga0496118_0006135
1960 Ga0496118_0007071
1961 Ga0496118_0009625
1962 Ga0496118_0013952
1963 Ga0496118_0016091
1964 Ga0496118_0131205
1965 Ga0496118_0218997
1966 Ga0496119_0014786
1967 Ga0496119_0171283
1968 Ga0496120_0025672
1969 Ga0496121_0000294
1970 Ga0496121_0000822
1971 Ga0496121_0001909
1972 Ga0496121_0003473
1973 Ga0496121_0004825
1974 Ga0496121_0015210
1975 Ga0496121_0023258
1976 Ga0496121_0030733
1977 Ga0496121_0059162
1978 Ga0496121_0104713
1979 Ga0496121_0106385
1980 Ga0496122_0000021
1981 Ga0496122_0006795
1982 Ga0496122_0008449
1983 Ga0496122_0008978
1984 Ga0496122_0133825
1985 Ga0496122_0218100
1986 Ga0496122_0254233
1987 Ga0496122_0373662
1988 Ga0496123_0000050
1989 Ga0496123_0000176
1990 Ga0496123_0004101
1991 Ga0496123_0009377
1992 Ga0496123_0013089
1993 Ga0496123_0017617
1994 Ga0496123_0077868
1995 Ga0496123_0150532
1996 Ga0496123_0153252
1997 Ga0496123_0291450
1998 Ga0496124_0000006
1999 Ga0496124_0020422
2000 Ga0496124_0060707
2001 Ga0496124_0088643
2002 Ga0496124_0115861
2003 Ga0496124_0123310
2004 Ga0496124_0137890
2005 Ga0496124_0144744
2006 Ga0496124_0171432
2007 Ga0496124_0223694
2008 Ga0496125_0000005
2009 Ga0496125_0001680
2010 Ga0496125_0006458
2011 Ga0496125_0015569
2012 Ga0496125_0016460
2013 Ga0496125_0029704
2014 Ga0496125_0035954
2015 Ga0496125_0037911
2016 Ga0496125_0050626
2017 Ga0496125_0067250
2018 Ga0496125_0128454
2019 Ga0496126_0000331
2020 Ga0496126_0001126
2021 Ga0496126_0005355
2022 Ga0496126_0014902
2023 Ga0496126_0016298
2024 Ga0496126_0039126
2025 Ga0496126_0133401
2026 Ga0496126_0145636
2027 Ga0496126_0383859
2028 Ga0495678_027991
2029 Ga0495678_069790
2030 Ga0495682_0063955
2031 Ga0501037_0037371
2032 Ga0501198_000072
2033 Ga0501222_000024
2034 Ga0501044_0211188
2035 nmdc:mga03n38_17778_c1
2036 nmdc:mga00v17_12227_c1
2037 nmdc:mga00v17_60088_c1
2038 nmdc:mga00v17_682496_c1
2039 nmdc:mga0k408_131132_c1
2040 nmdc:mga0k408_484143_c1
2041 nmdc:mga06z11_340964_c1
2042 nmdc:mga07m45_1317_c1
2043 nmdc:mga07m45_16450_c1
2044 nmdc:mga07m45_905_c1
2045 Ga0500610_0003239
2046 Ga0500610_0015684
2047 Ga0500610_0104981
2048 Ga0500578_0000342
2049 Ga0500643_003837
2050 Ga0500651_0000028
2051 Ga0500566_0166851
2052 Ga0500641_0062005
2053 Ga0500571_000016
2054 Ga0500593_000167
2055 Ga0500607_001510
2056 Ga0500607_029863
2057 Ga0500608_065226
2058 Ga0500618_022250
2059 Ga0500626_022823
2060 Ga0500658_0000864
2061 Ga0500658_0002893
2062 Ga0500559_0003152
2063 Ga0500559_0004597
2064 Ga0500564_049498
2065 Ga0500568_0020741
2066 Ga0500574_028747
2067 Ga0500574_032796
2068 Ga0500616_0028263
2069 Ga0500627_0000710
2070 Ga0500633_0191528
2071 Ga0500634_0000177
2072 Ga0500634_0014502
2073 Ga0500636_0310620
2074 Ga0500645_000787
2075 Ga0500587_000482
2076 Ga0466962_0000180
2077 Ga0466962_0001916
2078 Ga0466962_0019617
2079 Ga0466962_0026332
2080 Ga0466962_0052815
2081 2501075203
2082 2501083203
2083 2501412491
2084 2510248779
2085 2511088121
2086 2511101377
2087 2511108020
2088 2512349090
2089 2513231123
2090 2513552571
2091 2513560689
2092 2513953574
2093 2513958457
2094 2514044267
2095 2514047305
2096 2515680311
2097 2516021748
2098 2519461064
2099 2526212243
2100 2547501875
2101 2563059726
2102 2585289960
2103 2587755677
2104 2597028321
2105 2599445111
2106 2599735702
2107 2599743625
2108 2599903646
2109 2600209174
2110 2600815027
2111 2643860127
2112 2643967050
2113 2643979247
2114 2644120165
2115 2644139916
2116 2644162991
2117 2644271156
2118 2644325346
2119 2644399080
2120 2644467813
2121 2676742588
2122 2713480566
2123 2719642795
2124 2723876111
2125 2738723500
2126 2738819179
2127 2738831658
2128 2738873186
2129 2738882199
2130 2739184816
2131 2739219785
2132 2739249246
2133 2739284231
2134 2747948539
2135 2753570995
2136 2765579317
2137 2792835403
2138 2809035881
2139 2816517428
2140 2817259093
2141 2817280489
2142 2817452320
2143 2819619154
2144 2819630260
2145 2842327133
2146 2842350738
2147 2842391561
2148 2842456526
2149 2842680111
2150 2842734725
2151 2842748513
2152 2856288722
2153 2857362105
2154 2857538866
2155 2858953652
2156 2863423536
2157 2870074683
2158 2874222004
2159 2883090261
2160 2885196575
2161 2885278067
2162 2900580511
2163 2901306535
2164 2902687943
2165 2904454647
2166 2904460430
2167 2904547779
2168 2904569604
2169 2904576915
2170 2904620084
2171 2919089353
2172 2919135711
2173 2919464231
2174 2919529605
2175 2928060278
2176 2928090157
2177 2928114073
2178 2928120338
2179 2928141449
2180 2928157855
2181 2928165621
2182 2928179041
2183 2928497480
2184 2928504560
2185 2928536994
2186 2929166980
2187 2929524628
2188 2931380406
2189 2937612839
2190 2939591752
2191 2939626974
2192 2941483425
2193 2945912167
2194 2945940190
2195 2945947051
2196 2945976742
2197 2945985545
2198 2954771785
2199 2961048771
2200 2961067674
2201 2974308717
2202 2977249456
2203 2981990869
2204 2984516076
2205 2990707321
2206 642423762
2207 642419997
2208 642598101
2209 644750393
2210 8003958354
2211 8018853100
2212 8020812867
2213 8020940705
2214 8020949730
2215 8020954286
2216 8021121195
2217 8039101886
2218 8040173516
2219 8055269313
2220 8055303634

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00691

OmpA

OmpA family

94

198

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hgm-assembly1.cif.gz_B universal stress protein tead from the trap transporter teaabc of halomonas elongata 0.9451 148 178
6k6w-assembly1.cif.gz_A structure of rnase j2 from staphylococcus epidermidis 0.928 151 174
3imp-assembly5.cif.gz_I new crystal form of the c-terminal domain of helicobacter pylori motb (residues 125-256) 0.882 91 203
5wtl-assembly4.cif.gz_D crystal structure of the periplasmic portion of outer membrane protein a (ompa) from capnocytophaga gingivalis 0.8773 88 203
3cyp-assembly3.cif.gz_B the crystal structure of the c-terminal domain of helicobacter pylori motb (residues 125-256). 0.8672 91 203
ID Description Score Start End Superfamily
3zq4E01 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.925 151 174 3.60.15.10
5a0tB01 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9058 151 175 3.60.15.10
3cypB00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain 0.8672 91 203 3.30.1330.60
5y61D00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain 0.8625 91 201 3.30.1330.60
5m38B00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain 0.842 88 204 3.30.1330.60
ID Description Score Start End GO Terms
AF-A0A4Q3QHI6-F1-model_v4 deleted 0.9842 118 204
AF-A0A1V6ENM9-F1-model_v4 Putative lipoprotein YiaD 0.953 32 216 GO:0016020
AF-A0A447U9N1-F1-model_v4 Membrane protein 0.95 84 200 GO:0016020
AF-A0A1V6ENM9-F1-model_v4 Putative lipoprotein YiaD 0.9429 32 216 GO:0016020
AF-A0A439KLY8-F1-model_v4 Peptidoglycan-binding protein 0.94 79 205 GO:0016020

Map