F490221
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1110 | 436 | 2220 | 317 |
Family's Representative Sequence
| Representative Sequence | 3300046474|Ga0495605_0027860|Ga0495605_0027860_1887_2879 |
| Length | 330 |
| Sequence | MRAIPLVPLLLGGWLVLPVHADDAQDQLKRLAQAEQQQSFQGTFVYERNGSFSTHRIWHRVADGKVSEHLLQLDGSAQEVLRVDGVTQCVSGTLEAGVSNLPDSPAHAFDAAKLSAWYDMKVAGSSRVAGRPATVVTLTPRDQHRYGIELHLDNQTGLPLKSLLLSDKGQLLERFQFTELNSADPLTDQMLQPSADCKTVTVAKTKPEPQKQQVAWHSDWLPPGFELSNAAARKDPDSKTLVTSLMYDDGLARFSVFIEPVSGAAVTDIRTQLGPTVAVSRRLTTPKGDAMVTVVGEIPIGTAERIALSMRNDPATSSAGSKASGATSKN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 7 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 9 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 10 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 11 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 18 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 22 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 23 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 24 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 25 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 26 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 27 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 28 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 34 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 42 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 43 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 44 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 45 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 47 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 48 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 49 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 50 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 51 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 52 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 53 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 54 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 65 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 66 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 69 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 70 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 72 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 73 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 74 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 75 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 76 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 77 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 78 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 79 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 80 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 81 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 82 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 83 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 84 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 85 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 86 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 87 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 88 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 89 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 90 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 91 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 92 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 93 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 94 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 95 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 96 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 97 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 98 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 99 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 100 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 101 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 102 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 103 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 104 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 105 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 106 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 107 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 108 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 109 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 110 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 111 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 112 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 113 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 114 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 115 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 116 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 117 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 118 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 119 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 120 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 121 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 122 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 202 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 203 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 204 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 205 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 206 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 207 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 208 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 209 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 210 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 211 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 212 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 213 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 214 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 215 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 216 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 217 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 218 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 219 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 220 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 221 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 224 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 225 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 226 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 229 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 230 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 231 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 232 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 233 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 234 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 235 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 236 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 237 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 238 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 239 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 240 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 241 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 242 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 243 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 244 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 245 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 246 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 247 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 248 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 249 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 250 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 251 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 252 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 253 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 254 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 255 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 256 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 257 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 258 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 259 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 260 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 261 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 262 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 263 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 264 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 265 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 266 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 267 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 268 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 269 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 270 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 271 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 272 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 273 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 274 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 275 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 276 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 277 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 278 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 279 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 280 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 281 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 282 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 283 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 284 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 285 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 286 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 287 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 288 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 289 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 290 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 291 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 292 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 293 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 294 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 295 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 296 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 297 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 298 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 299 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 300 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 301 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 302 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 303 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 304 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 305 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 306 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 307 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 308 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 309 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 310 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 311 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 312 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 313 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 314 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 315 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 316 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 317 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 318 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 319 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 320 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 321 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 322 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 323 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 324 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 325 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 326 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 327 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 328 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 329 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 330 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 331 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 332 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 333 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 334 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 335 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 336 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 337 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 338 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 339 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 340 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 341 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 342 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 343 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 344 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 345 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 346 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 347 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 348 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 349 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 350 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 351 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 352 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 353 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 354 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 355 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 356 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 357 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 358 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 359 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 360 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 361 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 362 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 363 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 364 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 365 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 366 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 367 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 368 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 369 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 370 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 371 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 372 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 373 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 374 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 375 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 376 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 377 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 378 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 379 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 380 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 381 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 382 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 383 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 384 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 385 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 386 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 387 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 388 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 389 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 390 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 391 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 392 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 393 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 394 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 395 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 396 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 397 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 398 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 399 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 400 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 401 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 402 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 403 | 2990196909 | Pseudomonas mangrovi TC-11 | Isolate | Unclassified |
| 404 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 405 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 406 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 407 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 408 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 409 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 410 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 411 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 412 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 413 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 414 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 415 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 416 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 417 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 418 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 419 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 420 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 421 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 422 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 423 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 424 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 425 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 426 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 427 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 428 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 429 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 430 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 431 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 432 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 433 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 434 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 435 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 436 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 81.35 |
| Metatranscriptomes | 0.54 |
| Isolates | 18.11 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.77 |
| Nodule | 2.61 |
| Rhizoplane | 6.58 |
| Rhizosphere | 74.77 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495605_0027860 | 3300046474 | Bacteria | 2922 |
| 2 | MRS2a_Contig_27 | 2124908027 | Bacteria | 53155 |
| 3 | MRS2a_Contig_6276 | 2124908027 | Bacteria | 2644 |
| 4 | SwRhRL2b_contig_722602 | 2162886007 | Bacteria | 2196 |
| 5 | MRS1b_contig_3814 | 2162886011 | Bacteria | 1952 |
| 6 | JGI25162J39368_1000132 | 3300002737 | Bacteria | 80803 |
| 7 | JGI25163J39215_1001003 | 3300002771 | Bacteria | 6221 |
| 8 | JGI25163J39215_1001640 | 3300002771 | Bacteria | 3322 |
| 9 | JGI25164J39214_1000029 | 3300002772 | Bacteria | 147779 |
| 10 | JGI25164J39214_1000106 | 3300002772 | Bacteria | 80803 |
| 11 | JGI25165J46597_1000111 | 3300003214 | Bacteria | 147779 |
| 12 | JGI25165J46597_1000217 | 3300003214 | Bacteria | 80803 |
| 13 | rootH1_10289084 | 3300003323 | Bacteria | 1442 |
| 14 | Ga0006562J51391_1005324 | 3300003578 | Bacteria | 4100 |
| 15 | Ga0055536_1000043 | 3300003781 | Bacteria | 124663 |
| 16 | Ga0055536_1004002 | 3300003781 | Bacteria | 7698 |
| 17 | Ga0055536_1004073 | 3300003781 | Bacteria | 7606 |
| 18 | Ga0055536_1036712 | 3300003781 | Bacteria | 1208 |
| 19 | Ga0055530_10000031 | 3300003791 | Bacteria | 122117 |
| 20 | Ga0055530_10004130 | 3300003791 | Bacteria | 7698 |
| 21 | Ga0055530_10004172 | 3300003791 | Bacteria | 7630 |
| 22 | Ga0055540_1000415 | 3300003792 | Bacteria | 34269 |
| 23 | Ga0055540_1003406 | 3300003792 | Bacteria | 7698 |
| 24 | Ga0055540_1003457 | 3300003792 | Bacteria | 7630 |
| 25 | Ga0055540_1018326 | 3300003792 | Bacteria | 1921 |
| 26 | Ga0055531_10000283 | 3300003794 | Bacteria | 51426 |
| 27 | Ga0065714_10000009 | 3300005288 | Bacteria | 21525 |
| 28 | Ga0065714_10003519 | 3300005288 | Bacteria | 6867 |
| 29 | Ga0065714_10004035 | 3300005288 | Bacteria | 6830 |
| 30 | Ga0065714_10019813 | 3300005288 | Bacteria | 1931 |
| 31 | Ga0065714_10065522 | 3300005288 | Bacteria | 9626 |
| 32 | Ga0065714_10068042 | 3300005288 | Bacteria | 5010 |
| 33 | Ga0065714_10068362 | 3300005288 | Bacteria | 4768 |
| 34 | Ga0065714_10071009 | 3300005288 | Bacteria | 3703 |
| 35 | Ga0065714_10078627 | 3300005288 | Bacteria | 2582 |
| 36 | Ga0065714_10082576 | 3300005288 | Bacteria | 2295 |
| 37 | Ga0065704_10001998 | 3300005289 | Bacteria | 6708 |
| 38 | Ga0065704_10006243 | 3300005289 | Bacteria | 3375 |
| 39 | Ga0065704_10006864 | 3300005289 | Bacteria | 2617 |
| 40 | Ga0065704_10086866 | 3300005289 | Bacteria | 3065 |
| 41 | Ga0065712_10000649 | 3300005290 | Bacteria | 9303 |
| 42 | Ga0065712_10067895 | 3300005290 | Bacteria | 22221 |
| 43 | Ga0065715_10008316 | 3300005293 | Bacteria | 5960 |
| 44 | Ga0070669_100306876 | 3300005353 | Bacteria | 1278 |
| 45 | Ga0070662_100019401 | 3300005457 | Bacteria | 4616 |
| 46 | Ga0075364_10089589 | 3300006051 | Bacteria | 2040 |
| 47 | Ga0075364_10163874 | 3300006051 | Bacteria | 1501 |
| 48 | Ga0075364_10325072 | 3300006051 | Bacteria | 1047 |
| 49 | Ga0075432_10004652 | 3300006058 | Bacteria | 4672 |
| 50 | Ga0075432_10007662 | 3300006058 | Bacteria | 3683 |
| 51 | Ga0075432_10037467 | 3300006058 | Bacteria | 1688 |
| 52 | Ga0075432_10054030 | 3300006058 | Bacteria | 1421 |
| 53 | Ga0075362_10113548 | 3300006177 | Bacteria | 1277 |
| 54 | Ga0099823_1016692 | 3300006944 | Bacteria | 7191 |
| 55 | Ga0079104_1000090 | 3300006946 | Bacteria | 132824 |
| 56 | Ga0079104_1000134 | 3300006946 | Bacteria | 103774 |
| 57 | Ga0099826_10003760 | 3300006948 | Bacteria | 10433 |
| 58 | Ga0105251_10000004 | 3300009011 | Bacteria | 285212 |
| 59 | Ga0105251_10000149 | 3300009011 | Bacteria | 71244 |
| 60 | Ga0105251_10001609 | 3300009011 | Bacteria | 19193 |
| 61 | Ga0105251_10006481 | 3300009011 | Bacteria | 7443 |
| 62 | Ga0105251_10020224 | 3300009011 | Bacteria | 3501 |
| 63 | Ga0105251_10020962 | 3300009011 | Bacteria | 3422 |
| 64 | Ga0105251_10077823 | 3300009011 | Bacteria | 1537 |
| 65 | Ga0105244_10000922 | 3300009036 | Bacteria | 24861 |
| 66 | Ga0105244_10012941 | 3300009036 | Bacteria | 4908 |
| 67 | Ga0105244_10013329 | 3300009036 | Bacteria | 4812 |
| 68 | Ga0105244_10020751 | 3300009036 | Bacteria | 3644 |
| 69 | Ga0105244_10022164 | 3300009036 | Bacteria | 3498 |
| 70 | Ga0105244_10024012 | 3300009036 | Bacteria | 3333 |
| 71 | Ga0105244_10025221 | 3300009036 | Bacteria | 3235 |
| 72 | Ga0105244_10031172 | 3300009036 | Bacteria | 2830 |
| 73 | Ga0105244_10036374 | 3300009036 | Bacteria | 2580 |
| 74 | Ga0105244_10037258 | 3300009036 | Bacteria | 2543 |
| 75 | Ga0105244_10059997 | 3300009036 | Bacteria | 1917 |
| 76 | Ga0105244_10066409 | 3300009036 | Bacteria | 1806 |
| 77 | Ga0105244_10070997 | 3300009036 | Bacteria | 1736 |
| 78 | Ga0105244_10071768 | 3300009036 | Bacteria | 1726 |
| 79 | Ga0105244_10074577 | 3300009036 | Bacteria | 1687 |
| 80 | Ga0105244_10081183 | 3300009036 | Bacteria | 1605 |
| 81 | Ga0105244_10114729 | 3300009036 | Bacteria | 1308 |
| 82 | Ga0105250_10000235 | 3300009092 | Bacteria | 46317 |
| 83 | Ga0105250_10005280 | 3300009092 | Bacteria | 5803 |
| 84 | Ga0105250_10012229 | 3300009092 | Bacteria | 3546 |
| 85 | Ga0105250_10018577 | 3300009092 | Bacteria | 2815 |
| 86 | Ga0105250_10045489 | 3300009092 | Bacteria | 1760 |
| 87 | Ga0105250_10092306 | 3300009092 | Bacteria | 1232 |
| 88 | Ga0105243_10000144 | 3300009148 | Bacteria | 81484 |
| 89 | Ga0105243_10000218 | 3300009148 | Bacteria | 67019 |
| 90 | Ga0105243_10051760 | 3300009148 | Bacteria | 3249 |
| 91 | Ga0105243_10080446 | 3300009148 | Bacteria | 2658 |
| 92 | Ga0105243_10130389 | 3300009148 | Bacteria | 2132 |
| 93 | Ga0105243_10200699 | 3300009148 | Bacteria | 1749 |
| 94 | Ga0105242_10123597 | 3300009176 | Bacteria | 2225 |
| 95 | Ga0105246_10000228 | 3300011119 | Bacteria | 28707 |
| 96 | Ga0105246_10295921 | 3300011119 | Bacteria | 1304 |
| 97 | Ga0105246_10336244 | 3300011119 | Bacteria | 1232 |
| 98 | Ga0157345_1000028 | 3300012498 | Bacteria | 37231 |
| 99 | Ga0157373_10008179 | 3300013100 | Bacteria | 7780 |
| 100 | Ga0157373_10008952 | 3300013100 | Bacteria | 7405 |
| 101 | Ga0157373_10009220 | 3300013100 | Bacteria | 7297 |
| 102 | Ga0157373_10009462 | 3300013100 | Bacteria | 7199 |
| 103 | Ga0157373_10013114 | 3300013100 | Bacteria | 6084 |
| 104 | Ga0157373_10070497 | 3300013100 | Bacteria | 2470 |
| 105 | Ga0157373_10164417 | 3300013100 | Bacteria | 1562 |
| 106 | Ga0157373_10312381 | 3300013100 | Bacteria | 1117 |
| 107 | Ga0157371_10000230 | 3300013102 | Bacteria | 80303 |
| 108 | Ga0157371_10000460 | 3300013102 | Bacteria | 49750 |
| 109 | Ga0157371_10008723 | 3300013102 | Bacteria | 8047 |
| 110 | Ga0157371_10015482 | 3300013102 | Bacteria | 5720 |
| 111 | Ga0157370_10036735 | 3300013104 | Bacteria | 4753 |
| 112 | Ga0157370_10102041 | 3300013104 | Bacteria | 2687 |
| 113 | Ga0157370_10217470 | 3300013104 | Bacteria | 1770 |
| 114 | Ga0157370_10374505 | 3300013104 | Bacteria | 1312 |
| 115 | Ga0157369_10019705 | 3300013105 | Bacteria | 7550 |
| 116 | Ga0157369_10260890 | 3300013105 | Bacteria | 1807 |
| 117 | Ga0157369_10356841 | 3300013105 | Bacteria | 1518 |
| 118 | Ga0157369_10356882 | 3300013105 | Bacteria | 1518 |
| 119 | Ga0163162_10098170 | 3300013306 | Bacteria | 3018 |
| 120 | Ga0163162_10108221 | 3300013306 | Bacteria | 2876 |
| 121 | Ga0157372_10000815 | 3300013307 | Bacteria | 33774 |
| 122 | Ga0157372_10120467 | 3300013307 | Bacteria | 3013 |
| 123 | Ga0157375_10518220 | 3300013308 | Bacteria | 1356 |
| 124 | Ga0157375_10611678 | 3300013308 | Bacteria | 1248 |
| 125 | Ga0157375_10646505 | 3300013308 | Bacteria | 1214 |
| 126 | Ga0182008_10000783 | 3300014497 | Bacteria | 22244 |
| 127 | Ga0182008_10011690 | 3300014497 | Bacteria | 4658 |
| 128 | Ga0182008_10014603 | 3300014497 | Bacteria | 4107 |
| 129 | Ga0182008_10036226 | 3300014497 | Bacteria | 2469 |
| 130 | Ga0182008_10038445 | 3300014497 | Bacteria | 2393 |
| 131 | Ga0182008_10057774 | 3300014497 | Bacteria | 1916 |
| 132 | Ga0182008_10065702 | 3300014497 | Bacteria | 1784 |
| 133 | Ga0182008_10124341 | 3300014497 | Bacteria | 1283 |
| 134 | Ga0182008_10156246 | 3300014497 | Bacteria | 1146 |
| 135 | Ga0182006_1001311 | 3300015261 | Bacteria | 15281 |
| 136 | Ga0182006_1003963 | 3300015261 | Bacteria | 7405 |
| 137 | Ga0182006_1004043 | 3300015261 | Bacteria | 7314 |
| 138 | Ga0182006_1006595 | 3300015261 | Bacteria | 5378 |
| 139 | Ga0182006_1011169 | 3300015261 | Bacteria | 3964 |
| 140 | Ga0182006_1014072 | 3300015261 | Bacteria | 3454 |
| 141 | Ga0182006_1018198 | 3300015261 | Bacteria | 2973 |
| 142 | Ga0182006_1049750 | 3300015261 | Bacteria | 1617 |
| 143 | Ga0182006_1066701 | 3300015261 | Bacteria | 1344 |
| 144 | Ga0182007_10003527 | 3300015262 | Bacteria | 7366 |
| 145 | Ga0182005_1001973 | 3300015265 | Bacteria | 7707 |
| 146 | Ga0182005_1015473 | 3300015265 | Bacteria | 2127 |
| 147 | Ga0182005_1018865 | 3300015265 | Bacteria | 1905 |
| 148 | Ga0182005_1050588 | 3300015265 | Bacteria | 1130 |
| 149 | Ga0182005_1050589 | 3300015265 | Bacteria | 1130 |
| 150 | Ga0163161_10010705 | 3300017792 | Bacteria | 6352 |
| 151 | Ga0163161_10018309 | 3300017792 | Bacteria | 4908 |
| 152 | Ga0163161_10071149 | 3300017792 | Bacteria | 2545 |
| 153 | Ga0163161_10085613 | 3300017792 | Bacteria | 2325 |
| 154 | Ga0163161_10151862 | 3300017792 | Bacteria | 1761 |
| 155 | Ga0163161_10489344 | 3300017792 | Bacteria | 1000 |
| 156 | Ga0206356_11555357 | 3300020070 | Bacteria | 1266 |
| 157 | Ga0209760_100015 | 3300025207 | Bacteria | 176281 |
| 158 | Ga0209760_100047 | 3300025207 | Bacteria | 107520 |
| 159 | Ga0209563_100515 | 3300025230 | Bacteria | 13129 |
| 160 | Ga0207427_100001 | 3300025231 | Bacteria | 1410763 |
| 161 | Ga0207427_100029 | 3300025231 | Bacteria | 376678 |
| 162 | Ga0209437_100003 | 3300025233 | Bacteria | 1517827 |
| 163 | Ga0209437_100009 | 3300025233 | Bacteria | 915954 |
| 164 | Ga0209759_1019525 | 3300025256 | Bacteria | 1604 |
| 165 | Ga0209233_1000007 | 3300025261 | Bacteria | 1411234 |
| 166 | Ga0209233_1000032 | 3300025261 | Bacteria | 623596 |
| 167 | Ga0209675_1004059 | 3300025291 | Bacteria | 6668 |
| 168 | Ga0209676_1000016 | 3300025292 | Bacteria | 655561 |
| 169 | Ga0209676_1000033 | 3300025292 | Bacteria | 463236 |
| 170 | Ga0209676_1000080 | 3300025292 | Bacteria | 287400 |
| 171 | Ga0209676_1000721 | 3300025292 | Bacteria | 45474 |
| 172 | Ga0209676_1001858 | 3300025292 | Bacteria | 17373 |
| 173 | Ga0209676_1003397 | 3300025292 | Bacteria | 9864 |
| 174 | Ga0209050_1000009 | 3300025298 | Bacteria | 1047265 |
| 175 | Ga0209050_1000036 | 3300025298 | Bacteria | 423070 |
| 176 | Ga0209050_1000117 | 3300025298 | Bacteria | 202979 |
| 177 | Ga0209050_1001816 | 3300025298 | Bacteria | 20822 |
| 178 | Ga0209051_1000053 | 3300025303 | Bacteria | 281564 |
| 179 | Ga0209051_1000077 | 3300025303 | Bacteria | 202959 |
| 180 | Ga0209051_1000094 | 3300025303 | Bacteria | 168538 |
| 181 | Ga0209051_1014768 | 3300025303 | Bacteria | 3627 |
| 182 | Ga0209257_1000173 | 3300025304 | Bacteria | 166678 |
| 183 | Ga0209257_1026276 | 3300025304 | Bacteria | 1966 |
| 184 | Ga0207696_1000022 | 3300025711 | Bacteria | 427529 |
| 185 | Ga0207696_1000044 | 3300025711 | Bacteria | 300953 |
| 186 | Ga0207696_1000083 | 3300025711 | Bacteria | 197352 |
| 187 | Ga0207696_1002326 | 3300025711 | Bacteria | 9424 |
| 188 | Ga0207696_1003920 | 3300025711 | Bacteria | 6561 |
| 189 | Ga0207696_1004851 | 3300025711 | Bacteria | 5701 |
| 190 | Ga0207696_1006039 | 3300025711 | Bacteria | 4939 |
| 191 | Ga0207696_1029848 | 3300025711 | Bacteria | 1662 |
| 192 | Ga0207655_1000005 | 3300025728 | Bacteria | 917277 |
| 193 | Ga0207655_1000015 | 3300025728 | Bacteria | 600662 |
| 194 | Ga0207655_1000193 | 3300025728 | Bacteria | 107789 |
| 195 | Ga0207655_1000240 | 3300025728 | Bacteria | 90267 |
| 196 | Ga0207655_1000516 | 3300025728 | Bacteria | 49122 |
| 197 | Ga0207655_1001511 | 3300025728 | Bacteria | 21214 |
| 198 | Ga0207655_1002564 | 3300025728 | Bacteria | 14532 |
| 199 | Ga0207655_1005303 | 3300025728 | Bacteria | 8825 |
| 200 | Ga0207655_1012339 | 3300025728 | Bacteria | 5001 |
| 201 | Ga0207655_1019915 | 3300025728 | Bacteria | 3478 |
| 202 | Ga0207655_1025696 | 3300025728 | Bacteria | 2852 |
| 203 | Ga0207655_1026474 | 3300025728 | Bacteria | 2785 |
| 204 | Ga0207655_1043244 | 3300025728 | Bacteria | 1908 |
| 205 | Ga0207655_1045470 | 3300025728 | Bacteria | 1833 |
| 206 | Ga0207655_1074279 | 3300025728 | Bacteria | 1251 |
| 207 | Ga0207713_1000013 | 3300025735 | Bacteria | 475751 |
| 208 | Ga0207713_1000104 | 3300025735 | Bacteria | 138310 |
| 209 | Ga0207713_1000933 | 3300025735 | Bacteria | 26222 |
| 210 | Ga0207713_1000977 | 3300025735 | Bacteria | 25286 |
| 211 | Ga0207713_1003887 | 3300025735 | Bacteria | 9953 |
| 212 | Ga0207713_1007436 | 3300025735 | Bacteria | 6465 |
| 213 | Ga0207713_1007908 | 3300025735 | Bacteria | 6195 |
| 214 | Ga0207713_1010208 | 3300025735 | Bacteria | 5215 |
| 215 | Ga0207713_1010346 | 3300025735 | Bacteria | 5171 |
| 216 | Ga0207713_1010443 | 3300025735 | Bacteria | 5135 |
| 217 | Ga0207713_1020768 | 3300025735 | Bacteria | 3170 |
| 218 | Ga0207713_1020816 | 3300025735 | Bacteria | 3164 |
| 219 | Ga0207713_1024766 | 3300025735 | Bacteria | 2788 |
| 220 | Ga0207713_1060892 | 3300025735 | Bacteria | 1439 |
| 221 | Ga0207681_10337243 | 3300025923 | Bacteria | 1203 |
| 222 | Ga0207706_10031700 | 3300025933 | Bacteria | 4707 |
| 223 | Ga0207709_10000036 | 3300025935 | Bacteria | 292568 |
| 224 | Ga0207709_10000250 | 3300025935 | Bacteria | 65488 |
| 225 | Ga0207709_10011638 | 3300025935 | Bacteria | 4851 |
| 226 | Ga0207709_10080242 | 3300025935 | Bacteria | 2100 |
| 227 | Ga0209281_1000013 | 3300027111 | Bacteria | 653449 |
| 228 | Ga0209281_1000172 | 3300027111 | Bacteria | 151766 |
| 229 | Ga0209281_1008449 | 3300027111 | Bacteria | 2499 |
| 230 | Ga0209281_1014360 | 3300027111 | Bacteria | 1679 |
| 231 | Ga0209389_1000002 | 3300027296 | Bacteria | 333932 |
| 232 | Ga0209371_1000414 | 3300027312 | Bacteria | 44059 |
| 233 | Ga0209999_1005350 | 3300027543 | Bacteria | 2311 |
| 234 | Ga0209282_1042241 | 3300027666 | Bacteria | 2692 |
| 235 | Ga0207428_10029703 | 3300027907 | Bacteria | 4527 |
| 236 | Ga0207428_10126181 | 3300027907 | Bacteria | 1960 |
| 237 | Ga0207428_10233821 | 3300027907 | Bacteria | 1375 |
| 238 | Ga0207428_10352501 | 3300027907 | Bacteria | 1083 |
| 239 | Ga0268266_10156206 | 3300028379 | Bacteria | 2060 |
| 240 | Ga0307517_10168130 | 3300028786 | Bacteria | 1450 |
| 241 | Ga0307517_10239473 | 3300028786 | Bacteria | 1078 |
| 242 | Ga0268256_1000355 | 3300030500 | Bacteria | 44059 |
| 243 | Ga0314311_1203986 | 3300030733 | Bacteria | 4286 |
| 244 | Ga0316178_1048493 | 3300030735 | Bacteria | 14555 |
| 245 | Ga0316183_1025019 | 3300030742 | Bacteria | 2522 |
| 246 | Ga0316183_1065202 | 3300030742 | Bacteria | 2363 |
| 247 | Ga0316181_1070701 | 3300030744 | Bacteria | 1436 |
| 248 | Ga0307408_100000081 | 3300031548 | Bacteria | 106920 |
| 249 | Ga0307408_100003809 | 3300031548 | Bacteria | 10270 |
| 250 | Ga0307408_100019038 | 3300031548 | Bacteria | 4618 |
| 251 | Ga0307408_100062293 | 3300031548 | Bacteria | 2725 |
| 252 | Ga0307408_100304399 | 3300031548 | Bacteria | 1336 |
| 253 | Ga0307405_10008655 | 3300031731 | Bacteria | 5173 |
| 254 | Ga0307412_10014719 | 3300031911 | Bacteria | 4623 |
| 255 | Ga0307412_10015341 | 3300031911 | Bacteria | 4540 |
| 256 | Ga0307412_10160042 | 3300031911 | Bacteria | 1671 |
| 257 | Ga0307412_10203664 | 3300031911 | Bacteria | 1504 |
| 258 | Ga0307412_10347440 | 3300031911 | Bacteria | 1189 |
| 259 | Ga0307409_100238037 | 3300031995 | Bacteria | 1655 |
| 260 | Ga0307414_10015196 | 3300032004 | Bacteria | 4641 |
| 261 | Ga0307414_10060093 | 3300032004 | Bacteria | 2686 |
| 262 | Ga0307414_10085384 | 3300032004 | Bacteria | 2325 |
| 263 | Ga0307414_10122593 | 3300032004 | Bacteria | 2001 |
| 264 | Ga0307411_10092953 | 3300032005 | Bacteria | 2110 |
| 265 | Ga0307510_10020770 | 3300033180 | Bacteria | 7666 |
| 266 | Ga0307510_10156577 | 3300033180 | Bacteria | 1884 |
| 267 | Ga0237819_00586 | 3300038705 | Bacteria | 12170 |
| 268 | Ga0439436_0006624 | 3300041404 | Bacteria | 3556 |
| 269 | Ga0439438_000992 | 3300041405 | Bacteria | 12681 |
| 270 | Ga0439438_001224 | 3300041405 | Bacteria | 11394 |
| 271 | Ga0439438_002780 | 3300041405 | Bacteria | 7325 |
| 272 | Ga0439438_004117 | 3300041405 | Bacteria | 5678 |
| 273 | Ga0439438_005242 | 3300041405 | Bacteria | 4807 |
| 274 | Ga0439438_005988 | 3300041405 | Bacteria | 4381 |
| 275 | Ga0439438_006395 | 3300041405 | Bacteria | 4165 |
| 276 | Ga0439438_009648 | 3300041405 | Bacteria | 3111 |
| 277 | Ga0439438_015423 | 3300041405 | Bacteria | 2248 |
| 278 | Ga0439438_020237 | 3300041405 | Bacteria | 1870 |
| 279 | Ga0439438_024721 | 3300041405 | Bacteria | 1642 |
| 280 | Ga0439447_000502 | 3300041407 | Bacteria | 14543 |
| 281 | Ga0439447_001881 | 3300041407 | Bacteria | 7679 |
| 282 | Ga0439447_003703 | 3300041407 | Bacteria | 5386 |
| 283 | Ga0439447_007850 | 3300041407 | Bacteria | 3347 |
| 284 | Ga0439447_008366 | 3300041407 | Bacteria | 3208 |
| 285 | Ga0439447_008833 | 3300041407 | Bacteria | 3095 |
| 286 | Ga0439447_010942 | 3300041407 | Bacteria | 2671 |
| 287 | Ga0439466_0000342 | 3300041411 | Bacteria | 17912 |
| 288 | Ga0439466_0001434 | 3300041411 | Bacteria | 9311 |
| 289 | Ga0439466_0001459 | 3300041411 | Bacteria | 9229 |
| 290 | Ga0439466_0002230 | 3300041411 | Bacteria | 7590 |
| 291 | Ga0439466_0003988 | 3300041411 | Bacteria | 5695 |
| 292 | Ga0439466_0005828 | 3300041411 | Bacteria | 4693 |
| 293 | Ga0439466_0007938 | 3300041411 | Bacteria | 4002 |
| 294 | Ga0439466_0012473 | 3300041411 | Bacteria | 3129 |
| 295 | Ga0439466_0015533 | 3300041411 | Bacteria | 2765 |
| 296 | Ga0439466_0018697 | 3300041411 | Bacteria | 2484 |
| 297 | Ga0439466_0021069 | 3300041411 | Bacteria | 2315 |
| 298 | Ga0439466_0054853 | 3300041411 | Bacteria | 1297 |
| 299 | Ga0439465_0003166 | 3300041413 | Bacteria | 5368 |
| 300 | Ga0439465_0027031 | 3300041413 | Bacteria | 1816 |
| 301 | Ga0439431_0002910 | 3300041997 | Bacteria | 3762 |
| 302 | Ga0439431_0005964 | 3300041997 | Bacteria | 2688 |
| 303 | Ga0439431_0007018 | 3300041997 | Bacteria | 2506 |
| 304 | Ga0439445_0033542 | 3300042004 | Bacteria | 1342 |
| 305 | Ga0439445_0050313 | 3300042004 | Bacteria | 1124 |
| 306 | Ga0439432_002305 | 3300042006 | Bacteria | 7190 |
| 307 | Ga0439432_003429 | 3300042006 | Bacteria | 5884 |
| 308 | Ga0439432_005514 | 3300042006 | Bacteria | 4550 |
| 309 | Ga0439432_008520 | 3300042006 | Bacteria | 3598 |
| 310 | Ga0439432_019693 | 3300042006 | Bacteria | 2246 |
| 311 | Ga0439432_023356 | 3300042006 | Bacteria | 2037 |
| 312 | Ga0439432_027182 | 3300042006 | Bacteria | 1869 |
| 313 | Ga0439451_001946 | 3300042009 | Bacteria | 4129 |
| 314 | Ga0439452_000500 | 3300042010 | Bacteria | 21349 |
| 315 | Ga0439452_001277 | 3300042010 | Bacteria | 10694 |
| 316 | Ga0439452_001890 | 3300042010 | Bacteria | 8061 |
| 317 | Ga0439452_001939 | 3300042010 | Bacteria | 7918 |
| 318 | Ga0439452_003673 | 3300042010 | Bacteria | 5318 |
| 319 | Ga0439452_003981 | 3300042010 | Bacteria | 5048 |
| 320 | Ga0439452_009442 | 3300042010 | Bacteria | 2872 |
| 321 | Ga0439452_011351 | 3300042010 | Bacteria | 2563 |
| 322 | Ga0439452_011895 | 3300042010 | Bacteria | 2490 |
| 323 | Ga0439455_0005047 | 3300042012 | Bacteria | 2659 |
| 324 | Ga0439456_000039 | 3300042013 | Bacteria | 48127 |
| 325 | Ga0439456_000851 | 3300042013 | Bacteria | 6167 |
| 326 | Ga0439456_004460 | 3300042013 | Bacteria | 2829 |
| 327 | Ga0439456_005650 | 3300042013 | Bacteria | 2542 |
| 328 | Ga0439456_007987 | 3300042013 | Bacteria | 2181 |
| 329 | Ga0439456_012300 | 3300042013 | Bacteria | 1774 |
| 330 | Ga0439456_017389 | 3300042013 | Bacteria | 1508 |
| 331 | Ga0439463_001515 | 3300042016 | Bacteria | 6127 |
| 332 | Ga0439463_005478 | 3300042016 | Bacteria | 3152 |
| 333 | Ga0439463_017111 | 3300042016 | Bacteria | 1795 |
| 334 | Ga0439463_035096 | 3300042016 | Bacteria | 1269 |
| 335 | Ga0450911_000037 | 3300042115 | Bacteria | 60341 |
| 336 | Ga0450911_000292 | 3300042115 | Bacteria | 18338 |
| 337 | Ga0450911_004861 | 3300042115 | Bacteria | 2149 |
| 338 | Ga0450919_003445 | 3300042121 | Bacteria | 1979 |
| 339 | Ga0450922_001710 | 3300042124 | Bacteria | 2133 |
| 340 | Ga0450922_002063 | 3300042124 | Bacteria | 1912 |
| 341 | Ga0450890_000422 | 3300042127 | Bacteria | 6182 |
| 342 | Ga0450891_002006 | 3300042129 | Bacteria | 2084 |
| 343 | Ga0450900_000809 | 3300042136 | Bacteria | 2732 |
| 344 | Ga0450902_000567 | 3300042137 | Bacteria | 4678 |
| 345 | Ga0450902_020770 | 3300042137 | Bacteria | 1083 |
| 346 | Ga0450903_000781 | 3300042138 | Bacteria | 6196 |
| 347 | Ga0450904_000012 | 3300042139 | Bacteria | 42482 |
| 348 | Ga0450904_001656 | 3300042139 | Bacteria | 2991 |
| 349 | Ga0450905_000074 | 3300042142 | Bacteria | 9342 |
| 350 | Ga0450905_001959 | 3300042142 | Bacteria | 2623 |
| 351 | Ga0450905_004581 | 3300042142 | Bacteria | 1837 |
| 352 | Ga0450905_011138 | 3300042142 | Bacteria | 1254 |
| 353 | Ga0450906_000157 | 3300042145 | Bacteria | 12663 |
| 354 | Ga0450907_000591 | 3300042146 | Bacteria | 9694 |
| 355 | Ga0450907_001368 | 3300042146 | Bacteria | 5368 |
| 356 | Ga0450910_005405 | 3300042147 | Bacteria | 1742 |
| 357 | Ga0450910_008145 | 3300042147 | Bacteria | 1470 |
| 358 | Ga0439446_0001558 | 3300042156 | Bacteria | 5265 |
| 359 | Ga0439446_0002615 | 3300042156 | Bacteria | 4346 |
| 360 | Ga0439446_0004462 | 3300042156 | Bacteria | 3548 |
| 361 | Ga0439446_0005697 | 3300042156 | Bacteria | 3215 |
| 362 | Ga0450909_003876 | 3300042185 | Bacteria | 2128 |
| 363 | Ga0450909_004616 | 3300042185 | Bacteria | 1969 |
| 364 | Ga0450909_006490 | 3300042185 | Bacteria | 1686 |
| 365 | Ga0439434_0000189 | 3300042435 | Bacteria | 16824 |
| 366 | Ga0439434_0002776 | 3300042435 | Bacteria | 5104 |
| 367 | Ga0439434_0019941 | 3300042435 | Bacteria | 2012 |
| 368 | Ga0439459_0001248 | 3300042438 | Bacteria | 3719 |
| 369 | Ga0439464_0001261 | 3300042439 | Bacteria | 5884 |
| 370 | Ga0439460_0000237 | 3300042461 | Bacteria | 11180 |
| 371 | Ga0450916_000955 | 3300042530 | Bacteria | 2779 |
| 372 | Ga0450916_005396 | 3300042530 | Bacteria | 1477 |
| 373 | Ga0450918_005125 | 3300042531 | Bacteria | 2360 |
| 374 | Ga0450893_0003354 | 3300042532 | Bacteria | 2523 |
| 375 | Ga0450893_0004277 | 3300042532 | Bacteria | 2275 |
| 376 | Ga0450901_000655 | 3300042533 | Bacteria | 4073 |
| 377 | Ga0439440_0008818 | 3300042993 | Bacteria | 2076 |
| 378 | Ga0439440_0016140 | 3300042993 | Bacteria | 1630 |
| 379 | Ga0495617_001816 | 3300046452 | Bacteria | 9091 |
| 380 | Ga0495617_012260 | 3300046452 | Bacteria | 2920 |
| 381 | Ga0495617_023649 | 3300046452 | Bacteria | 2075 |
| 382 | Ga0495617_031553 | 3300046452 | Bacteria | 1779 |
| 383 | Ga0495617_033987 | 3300046452 | Bacteria | 1711 |
| 384 | Ga0495617_061220 | 3300046452 | Bacteria | 1244 |
| 385 | Ga0495617_072426 | 3300046452 | Bacteria | 1133 |
| 386 | Ga0495627_000021 | 3300046453 | Bacteria | 282454 |
| 387 | Ga0495627_000279 | 3300046453 | Bacteria | 51531 |
| 388 | Ga0495627_002666 | 3300046453 | Bacteria | 8372 |
| 389 | Ga0495627_002922 | 3300046453 | Bacteria | 7853 |
| 390 | Ga0495627_012582 | 3300046453 | Bacteria | 2997 |
| 391 | Ga0495627_033788 | 3300046453 | Bacteria | 1601 |
| 392 | Ga0495603_0015991 | 3300046455 | Bacteria | 4536 |
| 393 | Ga0495590_0000920 | 3300046457 | Bacteria | 13074 |
| 394 | Ga0495590_0002374 | 3300046457 | Bacteria | 7801 |
| 395 | Ga0495590_0026903 | 3300046457 | Bacteria | 2019 |
| 396 | Ga0495590_0040384 | 3300046457 | Bacteria | 1627 |
| 397 | Ga0495590_0042127 | 3300046457 | Bacteria | 1591 |
| 398 | Ga0495591_000015 | 3300046458 | Bacteria | 252107 |
| 399 | Ga0495591_001627 | 3300046458 | Bacteria | 13592 |
| 400 | Ga0495591_003627 | 3300046458 | Bacteria | 7858 |
| 401 | Ga0495591_003905 | 3300046458 | Bacteria | 7511 |
| 402 | Ga0495591_005627 | 3300046458 | Bacteria | 5746 |
| 403 | Ga0495591_006409 | 3300046458 | Bacteria | 5206 |
| 404 | Ga0495591_006828 | 3300046458 | Bacteria | 4962 |
| 405 | Ga0495591_007829 | 3300046458 | Bacteria | 4465 |
| 406 | Ga0495591_008115 | 3300046458 | Bacteria | 4339 |
| 407 | Ga0495591_008517 | 3300046458 | Bacteria | 4193 |
| 408 | Ga0495591_027684 | 3300046458 | Bacteria | 1744 |
| 409 | Ga0495591_041331 | 3300046458 | Bacteria | 1309 |
| 410 | Ga0495629_0009993 | 3300046459 | Bacteria | 6924 |
| 411 | Ga0495638_0007630 | 3300046460 | Bacteria | 7733 |
| 412 | Ga0495638_0008249 | 3300046460 | Bacteria | 7401 |
| 413 | Ga0495638_0015483 | 3300046460 | Bacteria | 5118 |
| 414 | Ga0495638_0028103 | 3300046460 | Bacteria | 3634 |
| 415 | Ga0495638_0083788 | 3300046460 | Bacteria | 1930 |
| 416 | Ga0495638_0084376 | 3300046460 | Bacteria | 1922 |
| 417 | Ga0495638_0097596 | 3300046460 | Bacteria | 1761 |
| 418 | Ga0495638_0111073 | 3300046460 | Bacteria | 1628 |
| 419 | Ga0495638_0116695 | 3300046460 | Bacteria | 1581 |
| 420 | Ga0495638_0134801 | 3300046460 | Bacteria | 1447 |
| 421 | Ga0495638_0203110 | 3300046460 | Bacteria | 1117 |
| 422 | Ga0495638_0221724 | 3300046460 | Bacteria | 1056 |
| 423 | Ga0495653_0009661 | 3300046463 | Bacteria | 7889 |
| 424 | Ga0495653_0018187 | 3300046463 | Bacteria | 5712 |
| 425 | Ga0495653_0035403 | 3300046463 | Bacteria | 3939 |
| 426 | Ga0495650_0001786 | 3300046471 | Bacteria | 19471 |
| 427 | Ga0495650_0011839 | 3300046471 | Bacteria | 4735 |
| 428 | Ga0495650_0012047 | 3300046471 | Bacteria | 4679 |
| 429 | Ga0495650_0015563 | 3300046471 | Bacteria | 3895 |
| 430 | Ga0495650_0030937 | 3300046471 | Bacteria | 2416 |
| 431 | Ga0495650_0098300 | 3300046471 | Bacteria | 1102 |
| 432 | Ga0495582_0034309 | 3300046473 | Bacteria | 2789 |
| 433 | Ga0495605_0000016 | 3300046474 | Bacteria | 289508 |
| 434 | Ga0495605_0000031 | 3300046474 | Bacteria | 213242 |
| 435 | Ga0495605_0000917 | 3300046474 | Bacteria | 20251 |
| 436 | Ga0495605_0003709 | 3300046474 | Bacteria | 9061 |
| 437 | Ga0495605_0004707 | 3300046474 | Bacteria | 7981 |
| 438 | Ga0495605_0012909 | 3300046474 | Bacteria | 4622 |
| 439 | Ga0495605_0020163 | 3300046474 | Bacteria | 3545 |
| 440 | Ga0495605_0029273 | 3300046474 | Bacteria | 2837 |
| 441 | Ga0495605_0038274 | 3300046474 | Bacteria | 2407 |
| 442 | Ga0495605_0045604 | 3300046474 | Bacteria | 2160 |
| 443 | Ga0495639_0001930 | 3300046475 | Bacteria | 9203 |
| 444 | Ga0495639_0022310 | 3300046475 | Bacteria | 2776 |
| 445 | Ga0495584_0003475 | 3300046491 | Bacteria | 8661 |
| 446 | Ga0495584_0004191 | 3300046491 | Bacteria | 7779 |
| 447 | Ga0495584_0010552 | 3300046491 | Bacteria | 4744 |
| 448 | Ga0495584_0024071 | 3300046491 | Bacteria | 3087 |
| 449 | Ga0495584_0027340 | 3300046491 | Bacteria | 2890 |
| 450 | Ga0495584_0042112 | 3300046491 | Bacteria | 2304 |
| 451 | Ga0495584_0082595 | 3300046491 | Bacteria | 1617 |
| 452 | Ga0495584_0092493 | 3300046491 | Bacteria | 1525 |
| 453 | Ga0495584_0103383 | 3300046491 | Bacteria | 1440 |
| 454 | Ga0495585_0004523 | 3300046492 | Bacteria | 9010 |
| 455 | Ga0495585_0005559 | 3300046492 | Bacteria | 7923 |
| 456 | Ga0495585_0013222 | 3300046492 | Bacteria | 4835 |
| 457 | Ga0495585_0042969 | 3300046492 | Bacteria | 2529 |
| 458 | Ga0495585_0048827 | 3300046492 | Bacteria | 2352 |
| 459 | Ga0495585_0049967 | 3300046492 | Bacteria | 2320 |
| 460 | Ga0495585_0066460 | 3300046492 | Bacteria | 1974 |
| 461 | Ga0495585_0072113 | 3300046492 | Bacteria | 1882 |
| 462 | Ga0495585_0072861 | 3300046492 | Bacteria | 1870 |
| 463 | Ga0495585_0077270 | 3300046492 | Bacteria | 1807 |
| 464 | Ga0495585_0142747 | 3300046492 | Bacteria | 1253 |
| 465 | Ga0495594_0010081 | 3300046499 | Bacteria | 4894 |
| 466 | Ga0495594_0031690 | 3300046499 | Bacteria | 2867 |
| 467 | Ga0495594_0047830 | 3300046499 | Bacteria | 2349 |
| 468 | Ga0495596_0003952 | 3300046500 | Bacteria | 7332 |
| 469 | Ga0495596_0016460 | 3300046500 | Bacteria | 3071 |
| 470 | Ga0495607_0000162 | 3300046501 | Bacteria | 71325 |
| 471 | Ga0495607_0000566 | 3300046501 | Bacteria | 36103 |
| 472 | Ga0495607_0001224 | 3300046501 | Bacteria | 23039 |
| 473 | Ga0495607_0005921 | 3300046501 | Bacteria | 8671 |
| 474 | Ga0495607_0013895 | 3300046501 | Bacteria | 5260 |
| 475 | Ga0495607_0026684 | 3300046501 | Bacteria | 3582 |
| 476 | Ga0495607_0028908 | 3300046501 | Bacteria | 3414 |
| 477 | Ga0495607_0036902 | 3300046501 | Bacteria | 2940 |
| 478 | Ga0495607_0042021 | 3300046501 | Bacteria | 2712 |
| 479 | Ga0495607_0048157 | 3300046501 | Bacteria | 2493 |
| 480 | Ga0495607_0049410 | 3300046501 | Bacteria | 2452 |
| 481 | Ga0495607_0055547 | 3300046501 | Bacteria | 2277 |
| 482 | Ga0495607_0060550 | 3300046501 | Bacteria | 2154 |
| 483 | Ga0495607_0175758 | 3300046501 | Bacteria | 1077 |
| 484 | Ga0495583_0000041 | 3300046506 | Bacteria | 234707 |
| 485 | Ga0495583_0000698 | 3300046506 | Bacteria | 43244 |
| 486 | Ga0495583_0001999 | 3300046506 | Bacteria | 18668 |
| 487 | Ga0495583_0013199 | 3300046506 | Bacteria | 4621 |
| 488 | Ga0495583_0025229 | 3300046506 | Bacteria | 2973 |
| 489 | Ga0495583_0025374 | 3300046506 | Bacteria | 2961 |
| 490 | Ga0495583_0072459 | 3300046506 | Bacteria | 1511 |
| 491 | Ga0495606_0002535 | 3300046507 | Bacteria | 21017 |
| 492 | Ga0495606_0009839 | 3300046507 | Bacteria | 8023 |
| 493 | Ga0495606_0018681 | 3300046507 | Bacteria | 5188 |
| 494 | Ga0495606_0033013 | 3300046507 | Bacteria | 3576 |
| 495 | Ga0495606_0039096 | 3300046507 | Bacteria | 3202 |
| 496 | Ga0495606_0190423 | 3300046507 | Bacteria | 1176 |
| 497 | Ga0495610_0013447 | 3300046512 | Bacteria | 4863 |
| 498 | Ga0495610_0017340 | 3300046512 | Bacteria | 4108 |
| 499 | Ga0495610_0018209 | 3300046512 | Bacteria | 3975 |
| 500 | Ga0495610_0023445 | 3300046512 | Bacteria | 3354 |
| 501 | Ga0495610_0037736 | 3300046512 | Bacteria | 2456 |
| 502 | Ga0495610_0060137 | 3300046512 | Bacteria | 1810 |
| 503 | Ga0495610_0061875 | 3300046512 | Bacteria | 1776 |
| 504 | Ga0495610_0124723 | 3300046512 | Bacteria | 1124 |
| 505 | Ga0495616_0001130 | 3300046513 | Bacteria | 18916 |
| 506 | Ga0495616_0004373 | 3300046513 | Bacteria | 8913 |
| 507 | Ga0495616_0064488 | 3300046513 | Bacteria | 1787 |
| 508 | Ga0495616_0066627 | 3300046513 | Bacteria | 1751 |
| 509 | Ga0495616_0123915 | 3300046513 | Bacteria | 1190 |
| 510 | Ga0495620_0000013 | 3300046515 | Bacteria | 160349 |
| 511 | Ga0495620_0000015 | 3300046515 | Bacteria | 154625 |
| 512 | Ga0495620_0010128 | 3300046515 | Bacteria | 4983 |
| 513 | Ga0495620_0013776 | 3300046515 | Bacteria | 4133 |
| 514 | Ga0495620_0027507 | 3300046515 | Bacteria | 2659 |
| 515 | Ga0495630_0065472 | 3300046517 | Bacteria | 2731 |
| 516 | Ga0495630_0109774 | 3300046517 | Bacteria | 2089 |
| 517 | Ga0495631_0000635 | 3300046518 | Bacteria | 22971 |
| 518 | Ga0495631_0012293 | 3300046518 | Bacteria | 4187 |
| 519 | Ga0495631_0014178 | 3300046518 | Bacteria | 3851 |
| 520 | Ga0495631_0040095 | 3300046518 | Bacteria | 2075 |
| 521 | Ga0495631_0052373 | 3300046518 | Bacteria | 1782 |
| 522 | Ga0495631_0061981 | 3300046518 | Bacteria | 1621 |
| 523 | Ga0495631_0107489 | 3300046518 | Bacteria | 1199 |
| 524 | Ga0495632_0000217 | 3300046519 | Bacteria | 58142 |
| 525 | Ga0495632_0005235 | 3300046519 | Bacteria | 8636 |
| 526 | Ga0495632_0006704 | 3300046519 | Bacteria | 7361 |
| 527 | Ga0495632_0010845 | 3300046519 | Bacteria | 5360 |
| 528 | Ga0495632_0012977 | 3300046519 | Bacteria | 4776 |
| 529 | Ga0495632_0013137 | 3300046519 | Bacteria | 4741 |
| 530 | Ga0495632_0015983 | 3300046519 | Bacteria | 4187 |
| 531 | Ga0495632_0017098 | 3300046519 | Bacteria | 4013 |
| 532 | Ga0495632_0021570 | 3300046519 | Bacteria | 3469 |
| 533 | Ga0495632_0037714 | 3300046519 | Bacteria | 2450 |
| 534 | Ga0495632_0071991 | 3300046519 | Bacteria | 1659 |
| 535 | Ga0495632_0077674 | 3300046519 | Bacteria | 1587 |
| 536 | Ga0495632_0118313 | 3300046519 | Bacteria | 1239 |
| 537 | Ga0495637_0000381 | 3300046520 | Bacteria | 33258 |
| 538 | Ga0495637_0003308 | 3300046520 | Bacteria | 8571 |
| 539 | Ga0495637_0007187 | 3300046520 | Bacteria | 5543 |
| 540 | Ga0495637_0009513 | 3300046520 | Bacteria | 4735 |
| 541 | Ga0495637_0011974 | 3300046520 | Bacteria | 4158 |
| 542 | Ga0495637_0012545 | 3300046520 | Bacteria | 4049 |
| 543 | Ga0495637_0013794 | 3300046520 | Bacteria | 3828 |
| 544 | Ga0495637_0017806 | 3300046520 | Bacteria | 3302 |
| 545 | Ga0495637_0020579 | 3300046520 | Bacteria | 3035 |
| 546 | Ga0495637_0028441 | 3300046520 | Bacteria | 2497 |
| 547 | Ga0495637_0031160 | 3300046520 | Bacteria | 2360 |
| 548 | Ga0495637_0039255 | 3300046520 | Bacteria | 2044 |
| 549 | Ga0495637_0040168 | 3300046520 | Bacteria | 2015 |
| 550 | Ga0495637_0041340 | 3300046520 | Bacteria | 1978 |
| 551 | Ga0495637_0044102 | 3300046520 | Bacteria | 1900 |
| 552 | Ga0495637_0049744 | 3300046520 | Bacteria | 1759 |
| 553 | Ga0495637_0052071 | 3300046520 | Bacteria | 1710 |
| 554 | Ga0495637_0080267 | 3300046520 | Bacteria | 1301 |
| 555 | Ga0495643_0002001 | 3300046522 | Bacteria | 16994 |
| 556 | Ga0495643_0002058 | 3300046522 | Bacteria | 16681 |
| 557 | Ga0495643_0013131 | 3300046522 | Bacteria | 4971 |
| 558 | Ga0495643_0023247 | 3300046522 | Bacteria | 3525 |
| 559 | Ga0495643_0044163 | 3300046522 | Bacteria | 2422 |
| 560 | Ga0495643_0085971 | 3300046522 | Bacteria | 1629 |
| 561 | Ga0495643_0166499 | 3300046522 | Bacteria | 1080 |
| 562 | Ga0495643_0210797 | 3300046522 | Bacteria | 927 |
| 563 | Ga0495644_0003315 | 3300046523 | Bacteria | 6364 |
| 564 | Ga0495644_0006231 | 3300046523 | Bacteria | 4638 |
| 565 | Ga0495644_0026504 | 3300046523 | Bacteria | 2198 |
| 566 | Ga0495644_0038103 | 3300046523 | Bacteria | 1813 |
| 567 | Ga0495648_0000491 | 3300046524 | Bacteria | 42524 |
| 568 | Ga0495648_0006371 | 3300046524 | Bacteria | 9647 |
| 569 | Ga0495648_0019057 | 3300046524 | Bacteria | 4839 |
| 570 | Ga0495648_0027715 | 3300046524 | Bacteria | 3788 |
| 571 | Ga0495648_0053504 | 3300046524 | Bacteria | 2445 |
| 572 | Ga0495648_0053694 | 3300046524 | Bacteria | 2439 |
| 573 | Ga0495648_0100133 | 3300046524 | Bacteria | 1601 |
| 574 | Ga0495648_0107478 | 3300046524 | Bacteria | 1525 |
| 575 | Ga0495648_0156955 | 3300046524 | Bacteria | 1180 |
| 576 | Ga0495666_0012934 | 3300046526 | Bacteria | 4158 |
| 577 | Ga0495666_0039955 | 3300046526 | Bacteria | 2276 |
| 578 | Ga0495666_0073093 | 3300046526 | Bacteria | 1627 |
| 579 | Ga0495642_0000097 | 3300046528 | Bacteria | 49030 |
| 580 | Ga0495642_0001859 | 3300046528 | Bacteria | 9009 |
| 581 | Ga0495642_0004237 | 3300046528 | Bacteria | 5581 |
| 582 | Ga0495654_0002407 | 3300046530 | Bacteria | 12063 |
| 583 | Ga0495654_0003357 | 3300046530 | Bacteria | 9863 |
| 584 | Ga0495654_0005010 | 3300046530 | Bacteria | 7775 |
| 585 | Ga0495654_0006722 | 3300046530 | Bacteria | 6506 |
| 586 | Ga0495654_0008163 | 3300046530 | Bacteria | 5800 |
| 587 | Ga0495654_0012957 | 3300046530 | Bacteria | 4469 |
| 588 | Ga0495654_0015256 | 3300046530 | Bacteria | 4082 |
| 589 | Ga0495654_0027538 | 3300046530 | Bacteria | 2913 |
| 590 | Ga0495654_0029347 | 3300046530 | Bacteria | 2805 |
| 591 | Ga0495654_0042593 | 3300046530 | Bacteria | 2252 |
| 592 | Ga0495654_0045971 | 3300046530 | Bacteria | 2152 |
| 593 | Ga0495654_0055987 | 3300046530 | Bacteria | 1907 |
| 594 | Ga0495654_0063832 | 3300046530 | Bacteria | 1762 |
| 595 | Ga0495654_0069104 | 3300046530 | Bacteria | 1677 |
| 596 | Ga0495654_0089076 | 3300046530 | Bacteria | 1434 |
| 597 | Ga0495654_0110992 | 3300046530 | Bacteria | 1251 |
| 598 | Ga0495654_0124592 | 3300046530 | Bacteria | 1162 |
| 599 | Ga0495586_0060315 | 3300046535 | Bacteria | 2062 |
| 600 | Ga0495587_0034356 | 3300046536 | Bacteria | 3058 |
| 601 | Ga0495587_0046458 | 3300046536 | Bacteria | 2577 |
| 602 | Ga0495609_0000015 | 3300046538 | Bacteria | 322474 |
| 603 | Ga0495609_0000066 | 3300046538 | Bacteria | 131202 |
| 604 | Ga0495609_0000070 | 3300046538 | Bacteria | 128181 |
| 605 | Ga0495609_0004218 | 3300046538 | Bacteria | 7951 |
| 606 | Ga0495609_0007336 | 3300046538 | Bacteria | 5516 |
| 607 | Ga0495609_0055546 | 3300046538 | Bacteria | 1756 |
| 608 | Ga0495609_0070513 | 3300046538 | Bacteria | 1536 |
| 609 | Ga0495597_0000005 | 3300046542 | Bacteria | 286580 |
| 610 | Ga0495597_0002158 | 3300046542 | Bacteria | 12930 |
| 611 | Ga0495597_0016962 | 3300046542 | Bacteria | 3433 |
| 612 | Ga0495597_0028135 | 3300046542 | Bacteria | 2574 |
| 613 | Ga0495597_0062218 | 3300046542 | Bacteria | 1624 |
| 614 | Ga0495622_0002478 | 3300046557 | Bacteria | 8930 |
| 615 | Ga0495622_0010641 | 3300046557 | Bacteria | 4244 |
| 616 | Ga0495622_0012691 | 3300046557 | Bacteria | 3905 |
| 617 | Ga0495622_0027676 | 3300046557 | Bacteria | 2645 |
| 618 | Ga0495622_0039371 | 3300046557 | Bacteria | 2201 |
| 619 | Ga0495633_0000060 | 3300046558 | Bacteria | 144561 |
| 620 | Ga0495633_0035970 | 3300046558 | Bacteria | 2375 |
| 621 | Ga0495633_0050809 | 3300046558 | Bacteria | 1953 |
| 622 | Ga0495656_0008233 | 3300046615 | Bacteria | 3716 |
| 623 | Ga0495656_0090793 | 3300046615 | Bacteria | 1396 |
| 624 | Ga0495668_0004245 | 3300046616 | Bacteria | 10296 |
| 625 | Ga0495668_0026574 | 3300046616 | Bacteria | 3283 |
| 626 | Ga0495668_0051766 | 3300046616 | Bacteria | 2273 |
| 627 | Ga0495668_0061318 | 3300046616 | Bacteria | 2074 |
| 628 | Ga0495668_0090575 | 3300046616 | Bacteria | 1676 |
| 629 | Ga0495634_0001715 | 3300046642 | Bacteria | 19024 |
| 630 | Ga0495634_0211204 | 3300046642 | Bacteria | 1201 |
| 631 | Ga0495611_0000817 | 3300046648 | Bacteria | 17225 |
| 632 | Ga0495611_0000934 | 3300046648 | Bacteria | 15695 |
| 633 | Ga0495611_0090840 | 3300046648 | Bacteria | 1411 |
| 634 | Ga0495625_0001491 | 3300046660 | Bacteria | 28149 |
| 635 | Ga0495625_0009777 | 3300046660 | Bacteria | 7979 |
| 636 | Ga0495625_0014823 | 3300046660 | Bacteria | 6202 |
| 637 | Ga0495625_0031221 | 3300046660 | Bacteria | 3964 |
| 638 | Ga0495625_0042717 | 3300046660 | Bacteria | 3292 |
| 639 | Ga0495625_0077707 | 3300046660 | Bacteria | 2318 |
| 640 | Ga0495625_0079533 | 3300046660 | Bacteria | 2285 |
| 641 | Ga0495625_0118193 | 3300046660 | Bacteria | 1806 |
| 642 | Ga0495625_0166964 | 3300046660 | Bacteria | 1471 |
| 643 | Ga0495635_0005514 | 3300046663 | Bacteria | 8800 |
| 644 | Ga0495635_0006971 | 3300046663 | Bacteria | 7894 |
| 645 | Ga0495659_0001693 | 3300046664 | Bacteria | 7373 |
| 646 | Ga0495659_0013279 | 3300046664 | Bacteria | 2681 |
| 647 | Ga0495661_0000110 | 3300046665 | Bacteria | 97854 |
| 648 | Ga0495661_0000139 | 3300046665 | Bacteria | 85160 |
| 649 | Ga0495661_0000194 | 3300046665 | Bacteria | 70173 |
| 650 | Ga0495661_0000304 | 3300046665 | Bacteria | 56019 |
| 651 | Ga0495661_0081571 | 3300046665 | Bacteria | 1863 |
| 652 | Ga0495661_0088921 | 3300046665 | Bacteria | 1762 |
| 653 | Ga0495588_0001397 | 3300046674 | Bacteria | 10320 |
| 654 | Ga0495657_0093451 | 3300046675 | Bacteria | 1925 |
| 655 | Ga0495623_0024250 | 3300046679 | Bacteria | 3911 |
| 656 | Ga0495623_0060098 | 3300046679 | Bacteria | 2385 |
| 657 | Ga0495646_0048954 | 3300046680 | Bacteria | 2566 |
| 658 | Ga0495646_0106616 | 3300046680 | Bacteria | 1599 |
| 659 | Ga0495669_0012665 | 3300046684 | Bacteria | 3591 |
| 660 | Ga0495613_0063638 | 3300046689 | Bacteria | 2698 |
| 661 | Ga0495624_0011063 | 3300046690 | Bacteria | 6210 |
| 662 | Ga0495670_0043323 | 3300046691 | Bacteria | 2246 |
| 663 | Ga0495670_0048843 | 3300046691 | Bacteria | 2116 |
| 664 | Ga0495670_0063197 | 3300046691 | Bacteria | 1863 |
| 665 | Ga0495670_0070265 | 3300046691 | Bacteria | 1771 |
| 666 | Ga0495670_0070579 | 3300046691 | Bacteria | 1767 |
| 667 | Ga0495670_0091929 | 3300046691 | Bacteria | 1553 |
| 668 | Ga0495671_0002259 | 3300046692 | Bacteria | 12245 |
| 669 | Ga0495671_0008071 | 3300046692 | Bacteria | 5943 |
| 670 | Ga0495671_0010083 | 3300046692 | Bacteria | 5252 |
| 671 | Ga0495671_0045812 | 3300046692 | Bacteria | 2188 |
| 672 | Ga0495671_0075286 | 3300046692 | Bacteria | 1655 |
| 673 | Ga0495671_0077677 | 3300046692 | Bacteria | 1627 |
| 674 | Ga0495671_0131644 | 3300046692 | Bacteria | 1219 |
| 675 | Ga0495671_0135458 | 3300046692 | Bacteria | 1201 |
| 676 | Ga0495671_0189561 | 3300046692 | Bacteria | 998 |
| 677 | Ga0495649_0010015 | 3300046694 | Bacteria | 5603 |
| 678 | Ga0495649_0012226 | 3300046694 | Bacteria | 5004 |
| 679 | Ga0495649_0016114 | 3300046694 | Bacteria | 4241 |
| 680 | Ga0495649_0023293 | 3300046694 | Bacteria | 3460 |
| 681 | Ga0495649_0031126 | 3300046694 | Bacteria | 2943 |
| 682 | Ga0495649_0045899 | 3300046694 | Bacteria | 2380 |
| 683 | Ga0495649_0047424 | 3300046694 | Bacteria | 2336 |
| 684 | Ga0495649_0049048 | 3300046694 | Bacteria | 2293 |
| 685 | Ga0495649_0080939 | 3300046694 | Bacteria | 1736 |
| 686 | Ga0495649_0137999 | 3300046694 | Bacteria | 1284 |
| 687 | Ga0495649_0139555 | 3300046694 | Bacteria | 1276 |
| 688 | Ga0495589_0004531 | 3300046794 | Bacteria | 7387 |
| 689 | Ga0495589_0007586 | 3300046794 | Bacteria | 5684 |
| 690 | Ga0495589_0009282 | 3300046794 | Bacteria | 5115 |
| 691 | Ga0495589_0071619 | 3300046794 | Bacteria | 1693 |
| 692 | Ga0495600_0015424 | 3300046809 | Bacteria | 4830 |
| 693 | Ga0495600_0054749 | 3300046809 | Bacteria | 2605 |
| 694 | Ga0495600_0102968 | 3300046809 | Bacteria | 1860 |
| 695 | Ga0495660_0000469 | 3300046810 | Bacteria | 33478 |
| 696 | Ga0495660_0008400 | 3300046810 | Bacteria | 6042 |
| 697 | Ga0495660_0009165 | 3300046810 | Bacteria | 5780 |
| 698 | Ga0495660_0012657 | 3300046810 | Bacteria | 4897 |
| 699 | Ga0495660_0017631 | 3300046810 | Bacteria | 4108 |
| 700 | Ga0495660_0023858 | 3300046810 | Bacteria | 3486 |
| 701 | Ga0495660_0032179 | 3300046810 | Bacteria | 2945 |
| 702 | Ga0495660_0036400 | 3300046810 | Bacteria | 2745 |
| 703 | Ga0495660_0036679 | 3300046810 | Bacteria | 2733 |
| 704 | Ga0495660_0065774 | 3300046810 | Bacteria | 1934 |
| 705 | Ga0495660_0070394 | 3300046810 | Bacteria | 1856 |
| 706 | Ga0495660_0074058 | 3300046810 | Bacteria | 1799 |
| 707 | Ga0495660_0098684 | 3300046810 | Bacteria | 1506 |
| 708 | Ga0495660_0147356 | 3300046810 | Bacteria | 1165 |
| 709 | Ga0495660_0180797 | 3300046810 | Bacteria | 1020 |
| 710 | Ga0495581_0034122 | 3300047315 | Bacteria | 2944 |
| 711 | Ga0495581_0053092 | 3300047315 | Bacteria | 2341 |
| 712 | Ga0495604_0005968 | 3300047317 | Bacteria | 9667 |
| 713 | Ga0495604_0015007 | 3300047317 | Bacteria | 6180 |
| 714 | Ga0495604_0122428 | 3300047317 | Bacteria | 1881 |
| 715 | Ga0495636_0045497 | 3300047318 | Bacteria | 1829 |
| 716 | Ga0495674_0013987 | 3300047319 | Bacteria | 7526 |
| 717 | Ga0495672_0003898 | 3300047320 | Bacteria | 12520 |
| 718 | Ga0495672_0010049 | 3300047320 | Bacteria | 6778 |
| 719 | Ga0495672_0010488 | 3300047320 | Bacteria | 6600 |
| 720 | Ga0495672_0011159 | 3300047320 | Bacteria | 6353 |
| 721 | Ga0495672_0017369 | 3300047320 | Bacteria | 4814 |
| 722 | Ga0495672_0033043 | 3300047320 | Bacteria | 3209 |
| 723 | Ga0495672_0039094 | 3300047320 | Bacteria | 2887 |
| 724 | Ga0495672_0054233 | 3300047320 | Bacteria | 2344 |
| 725 | Ga0495672_0078358 | 3300047320 | Bacteria | 1848 |
| 726 | Ga0495672_0087989 | 3300047320 | Bacteria | 1713 |
| 727 | Ga0495672_0093579 | 3300047320 | Bacteria | 1645 |
| 728 | Ga0495672_0093653 | 3300047320 | Bacteria | 1644 |
| 729 | Ga0495672_0101790 | 3300047320 | Bacteria | 1556 |
| 730 | Ga0495672_0149530 | 3300047320 | Bacteria | 1212 |
| 731 | Ga0495672_0151469 | 3300047320 | Bacteria | 1202 |
| 732 | Ga0495676_0000013 | 3300047321 | Bacteria | 213031 |
| 733 | Ga0495676_0009626 | 3300047321 | Bacteria | 8793 |
| 734 | Ga0495676_0019756 | 3300047321 | Bacteria | 5922 |
| 735 | Ga0495680_0000389 | 3300047322 | Bacteria | 49112 |
| 736 | Ga0495680_0051855 | 3300047322 | Bacteria | 3200 |
| 737 | Ga0495680_0078655 | 3300047322 | Bacteria | 2495 |
| 738 | Ga0495680_0132019 | 3300047322 | Bacteria | 1834 |
| 739 | Ga0495683_0000027 | 3300047323 | Bacteria | 153730 |
| 740 | Ga0495683_0000261 | 3300047323 | Bacteria | 47209 |
| 741 | Ga0495683_0004737 | 3300047323 | Bacteria | 7646 |
| 742 | Ga0495683_0005086 | 3300047323 | Bacteria | 7353 |
| 743 | Ga0495683_0017386 | 3300047323 | Bacteria | 3728 |
| 744 | Ga0495683_0022429 | 3300047323 | Bacteria | 3246 |
| 745 | Ga0495683_0026508 | 3300047323 | Bacteria | 2966 |
| 746 | Ga0495683_0037153 | 3300047323 | Bacteria | 2470 |
| 747 | Ga0495683_0057727 | 3300047323 | Bacteria | 1928 |
| 748 | Ga0495683_0108210 | 3300047323 | Bacteria | 1329 |
| 749 | Ga0495683_0118939 | 3300047323 | Bacteria | 1255 |
| 750 | Ga0495683_0121135 | 3300047323 | Bacteria | 1241 |
| 751 | Ga0495683_0144895 | 3300047323 | Bacteria | 1110 |
| 752 | Ga0495687_005844 | 3300047443 | Bacteria | 7704 |
| 753 | Ga0495687_013303 | 3300047443 | Bacteria | 4306 |
| 754 | Ga0495687_017430 | 3300047443 | Bacteria | 3584 |
| 755 | Ga0495687_036841 | 3300047443 | Bacteria | 2184 |
| 756 | Ga0495675_0001992 | 3300047444 | Bacteria | 12194 |
| 757 | Ga0495675_0113108 | 3300047444 | Bacteria | 1693 |
| 758 | Ga0495677_0004953 | 3300047445 | Bacteria | 5079 |
| 759 | Ga0495679_000206 | 3300047446 | Bacteria | 51518 |
| 760 | Ga0495679_001765 | 3300047446 | Bacteria | 11865 |
| 761 | Ga0495679_019678 | 3300047446 | Bacteria | 2365 |
| 762 | Ga0495679_021420 | 3300047446 | Bacteria | 2232 |
| 763 | Ga0495685_036695 | 3300047447 | Bacteria | 1682 |
| 764 | Ga0495673_0002278 | 3300047469 | Bacteria | 13760 |
| 765 | Ga0495673_0005752 | 3300047469 | Bacteria | 7433 |
| 766 | Ga0495673_0005888 | 3300047469 | Bacteria | 7320 |
| 767 | Ga0495673_0011917 | 3300047469 | Bacteria | 4643 |
| 768 | Ga0495673_0014906 | 3300047469 | Bacteria | 4025 |
| 769 | Ga0495673_0015222 | 3300047469 | Bacteria | 3970 |
| 770 | Ga0495673_0018742 | 3300047469 | Bacteria | 3483 |
| 771 | Ga0495673_0022950 | 3300047469 | Bacteria | 3047 |
| 772 | Ga0495673_0024014 | 3300047469 | Bacteria | 2954 |
| 773 | Ga0495673_0038565 | 3300047469 | Bacteria | 2172 |
| 774 | Ga0495673_0042216 | 3300047469 | Bacteria | 2048 |
| 775 | Ga0495673_0050387 | 3300047469 | Bacteria | 1827 |
| 776 | Ga0495673_0050886 | 3300047469 | Bacteria | 1816 |
| 777 | Ga0495673_0063147 | 3300047469 | Bacteria | 1579 |
| 778 | Ga0495673_0090907 | 3300047469 | Bacteria | 1247 |
| 779 | Ga0495681_0000933 | 3300047470 | Bacteria | 22521 |
| 780 | Ga0495681_0005006 | 3300047470 | Bacteria | 8932 |
| 781 | Ga0495681_0006277 | 3300047470 | Bacteria | 7828 |
| 782 | Ga0495681_0007132 | 3300047470 | Bacteria | 7201 |
| 783 | Ga0495681_0007434 | 3300047470 | Bacteria | 6999 |
| 784 | Ga0495681_0011304 | 3300047470 | Bacteria | 5325 |
| 785 | Ga0495681_0014618 | 3300047470 | Bacteria | 4485 |
| 786 | Ga0495681_0015582 | 3300047470 | Bacteria | 4294 |
| 787 | Ga0495681_0026422 | 3300047470 | Bacteria | 3021 |
| 788 | Ga0495681_0035133 | 3300047470 | Bacteria | 2491 |
| 789 | Ga0495681_0059790 | 3300047470 | Bacteria | 1760 |
| 790 | Ga0495681_0061499 | 3300047470 | Bacteria | 1729 |
| 791 | Ga0495681_0075599 | 3300047470 | Bacteria | 1516 |
| 792 | Ga0495681_0104002 | 3300047470 | Bacteria | 1238 |
| 793 | Ga0495684_0111655 | 3300047471 | Bacteria | 2062 |
| 794 | Ga0495686_0005865 | 3300047472 | Bacteria | 9574 |
| 795 | Ga0495686_0072055 | 3300047472 | Bacteria | 2125 |
| 796 | Ga0495593_0045550 | 3300047673 | Bacteria | 2340 |
| 797 | Ga0495602_0030701 | 3300048088 | Bacteria | 5092 |
| 798 | Ga0495614_0047085 | 3300048089 | Bacteria | 1849 |
| 799 | Ga0495626_0000056 | 3300048091 | Bacteria | 150654 |
| 800 | Ga0495626_0001227 | 3300048091 | Bacteria | 21100 |
| 801 | Ga0495626_0005367 | 3300048091 | Bacteria | 7532 |
| 802 | Ga0495626_0005402 | 3300048091 | Bacteria | 7493 |
| 803 | Ga0495626_0005494 | 3300048091 | Bacteria | 7383 |
| 804 | Ga0495626_0005538 | 3300048091 | Bacteria | 7346 |
| 805 | Ga0495626_0011405 | 3300048091 | Bacteria | 4702 |
| 806 | Ga0495626_0021571 | 3300048091 | Bacteria | 3194 |
| 807 | Ga0495626_0031306 | 3300048091 | Bacteria | 2561 |
| 808 | Ga0495626_0044990 | 3300048091 | Bacteria | 2062 |
| 809 | Ga0496101_0035587 | 3300048904 | Bacteria | 3523 |
| 810 | Ga0496102_0000242 | 3300048905 | Bacteria | 71504 |
| 811 | Ga0496102_0423730 | 3300048905 | Bacteria | 1250 |
| 812 | Ga0496103_0005866 | 3300048906 | Bacteria | 7335 |
| 813 | Ga0496105_0209384 | 3300048908 | Bacteria | 1590 |
| 814 | Ga0496107_0119091 | 3300048910 | Bacteria | 1944 |
| 815 | Ga0496110_0038308 | 3300048913 | Bacteria | 4171 |
| 816 | Ga0496110_0052260 | 3300048913 | Bacteria | 3591 |
| 817 | Ga0496110_0278104 | 3300048913 | Bacteria | 1524 |
| 818 | Ga0496111_0047643 | 3300048914 | Bacteria | 3087 |
| 819 | Ga0496114_0028827 | 3300048917 | Bacteria | 4559 |
| 820 | Ga0496114_0043828 | 3300048917 | Bacteria | 3710 |
| 821 | Ga0496115_0047584 | 3300048918 | Bacteria | 3430 |
| 822 | Ga0496116_0000126 | 3300048919 | Bacteria | 160425 |
| 823 | Ga0496116_0002028 | 3300048919 | Bacteria | 21733 |
| 824 | Ga0496116_0010805 | 3300048919 | Bacteria | 7616 |
| 825 | Ga0496116_0053813 | 3300048919 | Bacteria | 2656 |
| 826 | Ga0496116_0058892 | 3300048919 | Bacteria | 2501 |
| 827 | Ga0496117_0003126 | 3300048920 | Bacteria | 19758 |
| 828 | Ga0496117_0006498 | 3300048920 | Bacteria | 11792 |
| 829 | Ga0496117_0023336 | 3300048920 | Bacteria | 4933 |
| 830 | Ga0496117_0036924 | 3300048920 | Bacteria | 3647 |
| 831 | Ga0496117_0040121 | 3300048920 | Bacteria | 3448 |
| 832 | Ga0496117_0105075 | 3300048920 | Bacteria | 1776 |
| 833 | Ga0496118_0001807 | 3300048921 | Bacteria | 30813 |
| 834 | Ga0496118_0004616 | 3300048921 | Bacteria | 16182 |
| 835 | Ga0496118_0013626 | 3300048921 | Bacteria | 7676 |
| 836 | Ga0496118_0040470 | 3300048921 | Bacteria | 3705 |
| 837 | Ga0496118_0041417 | 3300048921 | Bacteria | 3647 |
| 838 | Ga0496118_0078499 | 3300048921 | Bacteria | 2335 |
| 839 | Ga0496118_0099746 | 3300048921 | Bacteria | 1967 |
| 840 | Ga0496119_0000112 | 3300048922 | Bacteria | 114767 |
| 841 | Ga0496119_0059393 | 3300048922 | Bacteria | 2297 |
| 842 | Ga0496120_0009793 | 3300048923 | Bacteria | 6755 |
| 843 | Ga0496121_0000142 | 3300048924 | Bacteria | 160072 |
| 844 | Ga0496121_0003009 | 3300048924 | Bacteria | 24478 |
| 845 | Ga0496121_0003989 | 3300048924 | Bacteria | 20359 |
| 846 | Ga0496121_0048899 | 3300048924 | Bacteria | 3593 |
| 847 | Ga0496121_0131863 | 3300048924 | Bacteria | 1868 |
| 848 | Ga0496121_0152333 | 3300048924 | Bacteria | 1700 |
| 849 | Ga0496122_0000122 | 3300048925 | Bacteria | 181491 |
| 850 | Ga0496122_0018867 | 3300048925 | Bacteria | 6339 |
| 851 | Ga0496122_0019568 | 3300048925 | Bacteria | 6175 |
| 852 | Ga0496122_0023279 | 3300048925 | Bacteria | 5468 |
| 853 | Ga0496122_0047710 | 3300048925 | Bacteria | 3303 |
| 854 | Ga0496122_0050923 | 3300048925 | Bacteria | 3153 |
| 855 | Ga0496122_0074368 | 3300048925 | Bacteria | 2404 |
| 856 | Ga0496122_0204774 | 3300048925 | Bacteria | 1149 |
| 857 | Ga0496123_0000391 | 3300048926 | Bacteria | 82015 |
| 858 | Ga0496123_0001340 | 3300048926 | Bacteria | 34830 |
| 859 | Ga0496123_0022720 | 3300048926 | Bacteria | 4823 |
| 860 | Ga0496123_0039683 | 3300048926 | Bacteria | 3290 |
| 861 | Ga0496123_0042255 | 3300048926 | Bacteria | 3148 |
| 862 | Ga0496123_0049954 | 3300048926 | Bacteria | 2799 |
| 863 | Ga0496123_0089571 | 3300048926 | Bacteria | 1832 |
| 864 | Ga0496124_0000222 | 3300048927 | Bacteria | 110854 |
| 865 | Ga0496124_0027948 | 3300048927 | Bacteria | 5052 |
| 866 | Ga0496124_0031437 | 3300048927 | Bacteria | 4699 |
| 867 | Ga0496124_0042438 | 3300048927 | Bacteria | 3917 |
| 868 | Ga0496124_0044384 | 3300048927 | Bacteria | 3814 |
| 869 | Ga0496124_0049542 | 3300048927 | Bacteria | 3583 |
| 870 | Ga0496124_0050720 | 3300048927 | Bacteria | 3534 |
| 871 | Ga0496124_0089843 | 3300048927 | Bacteria | 2507 |
| 872 | Ga0496124_0124989 | 3300048927 | Bacteria | 2050 |
| 873 | Ga0496124_0158616 | 3300048927 | Bacteria | 1766 |
| 874 | Ga0496124_0182132 | 3300048927 | Bacteria | 1615 |
| 875 | Ga0496124_0329520 | 3300048927 | Bacteria | 1089 |
| 876 | Ga0496124_0329531 | 3300048927 | Bacteria | 1089 |
| 877 | Ga0496125_0039458 | 3300048928 | Bacteria | 4064 |
| 878 | Ga0496125_0040148 | 3300048928 | Bacteria | 4017 |
| 879 | Ga0496125_0043847 | 3300048928 | Bacteria | 3791 |
| 880 | Ga0496125_0090275 | 3300048928 | Bacteria | 2300 |
| 881 | Ga0496125_0092749 | 3300048928 | Bacteria | 2256 |
| 882 | Ga0496125_0188204 | 3300048928 | Bacteria | 1366 |
| 883 | Ga0496126_0085998 | 3300048929 | Bacteria | 2772 |
| 884 | Ga0496126_0121779 | 3300048929 | Bacteria | 2261 |
| 885 | Ga0495678_000031 | 3300049459 | Bacteria | 215528 |
| 886 | Ga0495678_000039 | 3300049459 | Bacteria | 191665 |
| 887 | Ga0495678_004719 | 3300049459 | Bacteria | 7782 |
| 888 | Ga0495678_008542 | 3300049459 | Bacteria | 5155 |
| 889 | Ga0495678_017480 | 3300049459 | Bacteria | 3249 |
| 890 | Ga0495678_018063 | 3300049459 | Bacteria | 3179 |
| 891 | Ga0495678_024412 | 3300049459 | Bacteria | 2611 |
| 892 | Ga0495678_039396 | 3300049459 | Bacteria | 1906 |
| 893 | Ga0495682_0000078 | 3300049460 | Bacteria | 85448 |
| 894 | Ga0495682_0000860 | 3300049460 | Bacteria | 18879 |
| 895 | Ga0495682_0004502 | 3300049460 | Bacteria | 5945 |
| 896 | Ga0495682_0049418 | 3300049460 | Bacteria | 1532 |
| 897 | Ga0501314_000374 | 3300049530 | Bacteria | 2714 |
| 898 | Ga0501323_003470 | 3300049539 | Bacteria | 1612 |
| 899 | Ga0501324_004059 | 3300049540 | Bacteria | 1149 |
| 900 | Ga0501034_0000137 | 3300049571 | Bacteria | 136592 |
| 901 | Ga0501037_0076117 | 3300049573 | Bacteria | 2437 |
| 902 | Ga0501222_003868 | 3300049662 | Bacteria | 2031 |
| 903 | Ga0501241_000766 | 3300049758 | Bacteria | 6877 |
| 904 | Ga0501226_000017 | 3300049853 | Bacteria | 150879 |
| 905 | nmdc:mga00v17_112753_c1 | 3300050491 | Bacteria | 1726 |
| 906 | Ga0500618_007836 | 3300053125 | Bacteria | 3017 |
| 907 | Ga0500659_0002202 | 3300053135 | Bacteria | 11827 |
| 908 | Ga0500573_0022482 | 3300053140 | Bacteria | 3619 |
| 909 | Ga0587068_001963 | 3300059641 | Bacteria | 2425 |
| 910 | 2511254429 | 2511231004 | Bacteria | 6669789 |
| 911 | 2511267880 | 2511231006 | Bacteria | 6794709 |
| 912 | 2511274286 | 2511231007 | Bacteria | 6306603 |
| 913 | 2511276418 | 2511231008 | Bacteria | 6624100 |
| 914 | 2511291891 | 2511231010 | Bacteria | 6373152 |
| 915 | 2511294989 | 2511231011 | Bacteria | 6149768 |
| 916 | 2511304396 | 2511231012 | Bacteria | 6738011 |
| 917 | 2511312894 | 2511231014 | Bacteria | 6462302 |
| 918 | 2511319158 | 2511231015 | Bacteria | 6598026 |
| 919 | 2511329312 | 2511231016 | Bacteria | 6704427 |
| 920 | 2511333075 | 2511231017 | Bacteria | 6503007 |
| 921 | 2511341260 | 2511231018 | Bacteria | 6436256 |
| 922 | 2511341803 | 2511231019 | Bacteria | 6520662 |
| 923 | 2511350902 | 2511231020 | Bacteria | 6115223 |
| 924 | 2511354636 | 2511231021 | Bacteria | 7302637 |
| 925 | 2511364928 | 2511231022 | Bacteria | 6719296 |
| 926 | 2511366930 | 2511231023 | Bacteria | 6808468 |
| 927 | 2511375568 | 2511231024 | Bacteria | 5835885 |
| 928 | 2511412242 | 2511231031 | Bacteria | 6558529 |
| 929 | 2511823403 | 2511231156 | Bacteria | 6845832 |
| 930 | 2512328991 | 2512047018 | Bacteria | 6663241 |
| 931 | 2554817012 | 2554235132 | Bacteria | 6772433 |
| 932 | 2555244592 | 2554235231 | Bacteria | 5215788 |
| 933 | 2555668428 | 2554235341 | Bacteria | 6867980 |
| 934 | 2583790626 | 2582580891 | Bacteria | 6800976 |
| 935 | 2597856611 | 2597489887 | Bacteria | 6666321 |
| 936 | 2599330091 | 2599185155 | Bacteria | 5827168 |
| 937 | 2599355428 | 2599185160 | Bacteria | 6844013 |
| 938 | 2599360753 | 2599185161 | Bacteria | 6960462 |
| 939 | 2599367075 | 2599185162 | Bacteria | 6957254 |
| 940 | 2599373865 | 2599185163 | Bacteria | 6995158 |
| 941 | 2599380534 | 2599185164 | Bacteria | 6841688 |
| 942 | 2599386981 | 2599185165 | Bacteria | 6843250 |
| 943 | 2599392723 | 2599185166 | Bacteria | 6959206 |
| 944 | 2599404490 | 2599185168 | Bacteria | 6997636 |
| 945 | 2599462262 | 2599185181 | Bacteria | 6844519 |
| 946 | 2599466696 | 2599185182 | Bacteria | 6883168 |
| 947 | 2599483139 | 2599185185 | Bacteria | 6652270 |
| 948 | 2599490646 | 2599185186 | Bacteria | 6831633 |
| 949 | 2599505304 | 2599185188 | Bacteria | 6164180 |
| 950 | 2599615495 | 2599185212 | Bacteria | 6765997 |
| 951 | 2599772786 | 2599185248 | Bacteria | 6696816 |
| 952 | 2599805040 | 2599185257 | Bacteria | 6492581 |
| 953 | 2599889282 | 2599185289 | Bacteria | 6778765 |
| 954 | 2599896604 | 2599185291 | Bacteria | 6775623 |
| 955 | 2599931858 | 2599185300 | Bacteria | 6062622 |
| 956 | 2599945509 | 2599185302 | Bacteria | 5954930 |
| 957 | 2599956627 | 2599185304 | Bacteria | 5951361 |
| 958 | 2599962565 | 2599185305 | Bacteria | 6748700 |
| 959 | 2599968377 | 2599185306 | Bacteria | 6637356 |
| 960 | 2599974101 | 2599185307 | Bacteria | 6194719 |
| 961 | 2599979564 | 2599185308 | Bacteria | 6621546 |
| 962 | 2599985451 | 2599185309 | Bacteria | 5969593 |
| 963 | 2599991798 | 2599185310 | Bacteria | 6014457 |
| 964 | 2599996613 | 2599185311 | Bacteria | 6354990 |
| 965 | 2600002405 | 2599185312 | Bacteria | 5912071 |
| 966 | 2600006828 | 2599185313 | Bacteria | 6658188 |
| 967 | 2600013376 | 2599185314 | Bacteria | 6621749 |
| 968 | 2600020077 | 2599185315 | Bacteria | 6771107 |
| 969 | 2600026079 | 2599185316 | Bacteria | 6320029 |
| 970 | 2600031724 | 2599185317 | Bacteria | 6435722 |
| 971 | 2600036367 | 2599185318 | Bacteria | 6961590 |
| 972 | 2600043666 | 2599185319 | Bacteria | 6637840 |
| 973 | 2600049938 | 2599185320 | Bacteria | 5963263 |
| 974 | 2600053466 | 2599185321 | Bacteria | 6764560 |
| 975 | 2600061882 | 2599185322 | Bacteria | 6763055 |
| 976 | 2600067108 | 2599185323 | Bacteria | 6688755 |
| 977 | 2600070448 | 2599185324 | Bacteria | 6590677 |
| 978 | 2600080057 | 2599185325 | Bacteria | 6324919 |
| 979 | 2600214884 | 2599185356 | Bacteria | 6843884 |
| 980 | 2600361505 | 2600254930 | Bacteria | 6431253 |
| 981 | 2600363753 | 2600254931 | Bacteria | 6734225 |
| 982 | 2600442968 | 2600254954 | Bacteria | 5100516 |
| 983 | 2601625739 | 2600255283 | Bacteria | 6061572 |
| 984 | 2601774411 | 2600255313 | Bacteria | 6842543 |
| 985 | 2601799912 | 2600255318 | Bacteria | 6383414 |
| 986 | 2602009556 | 2600255389 | Bacteria | 5275336 |
| 987 | 2606074289 | 2603880185 | Bacteria | 6379190 |
| 988 | 2606127151 | 2603880199 | Bacteria | 6377649 |
| 989 | 2608379669 | 2606217733 | Bacteria | 6360972 |
| 990 | 2624479195 | 2623620443 | Bacteria | 6427864 |
| 991 | 2624493804 | 2623620446 | Bacteria | 6500345 |
| 992 | 2643845202 | 2643221565 | Bacteria | 6216018 |
| 993 | 2643873065 | 2643221571 | Bacteria | 6228673 |
| 994 | 2643951966 | 2643221589 | Bacteria | 6250934 |
| 995 | 2644024275 | 2643221602 | Bacteria | 6249926 |
| 996 | 2644187530 | 2643221633 | Bacteria | 6733554 |
| 997 | 2644283576 | 2643221650 | Bacteria | 7029547 |
| 998 | 2652548240 | 2651869719 | Bacteria | 6047974 |
| 999 | 2671090479 | 2667528170 | Bacteria | 6786960 |
| 1000 | 2671098030 | 2667528171 | Bacteria | 6900659 |
| 1001 | 2671127789 | 2667528176 | Bacteria | 6724917 |
| 1002 | 2671768226 | 2671180172 | Bacteria | 6495783 |
| 1003 | 2678262329 | 2675903515 | Bacteria | 6580491 |
| 1004 | 2715751732 | 2713897148 | Bacteria | 5883533 |
| 1005 | 2715759716 | 2713897149 | Bacteria | 6506249 |
| 1006 | 2718633063 | 2718217725 | Bacteria | 5758958 |
| 1007 | 2738691557 | 2738541271 | Bacteria | 5657310 |
| 1008 | 2739198712 | 2738543004 | Bacteria | 6381073 |
| 1009 | 2739256522 | 2738543015 | Bacteria | 6750701 |
| 1010 | 2739267332 | 2738543016 | Bacteria | 5657564 |
| 1011 | 2739314340 | 2738543025 | Bacteria | 6600348 |
| 1012 | 2743736035 | 2740892503 | Bacteria | 6855563 |
| 1013 | 2745008676 | 2744054620 | Bacteria | 6551379 |
| 1014 | 2765585699 | 2765235841 | Bacteria | 6137024 |
| 1015 | 2774121398 | 2773857670 | Bacteria | 6407454 |
| 1016 | 2774136031 | 2773857673 | Bacteria | 6513460 |
| 1017 | 2784260101 | 2784132063 | Bacteria | 6262788 |
| 1018 | 2784315714 | 2784132072 | Bacteria | 6596533 |
| 1019 | 2794596127 | 2791355520 | Bacteria | 5948615 |
| 1020 | 2807406916 | 2806310737 | Bacteria | 5751088 |
| 1021 | 2807455248 | 2806310745 | Bacteria | 5742165 |
| 1022 | 2808856810 | 2808606361 | Bacteria | 6136259 |
| 1023 | 2808904668 | 2808606373 | Bacteria | 4423627 |
| 1024 | 2808924091 | 2808606376 | Bacteria | 6248667 |
| 1025 | 2808929278 | 2808606377 | Bacteria | 6646337 |
| 1026 | 2808936741 | 2808606378 | Bacteria | 6177535 |
| 1027 | 2808941648 | 2808606379 | Bacteria | 5022697 |
| 1028 | 2808946032 | 2808606380 | Bacteria | 6248705 |
| 1029 | 2808951614 | 2808606381 | Bacteria | 6646461 |
| 1030 | 2808957416 | 2808606382 | Bacteria | 6841132 |
| 1031 | 2808965197 | 2808606383 | Bacteria | 6138645 |
| 1032 | 2809000089 | 2808606389 | Bacteria | 6138126 |
| 1033 | 2809216148 | 2808606445 | Bacteria | 6057339 |
| 1034 | 2812368120 | 2811994881 | Bacteria | 6298475 |
| 1035 | 2819654589 | 2818991456 | Bacteria | 6123676 |
| 1036 | 2819703115 | 2818991464 | Bacteria | 6907494 |
| 1037 | 2823424597 | 2823421272 | Bacteria | 5372474 |
| 1038 | 2825653316 | 2825651385 | Bacteria | 6715909 |
| 1039 | 2826585730 | 2826581358 | Bacteria | 5963467 |
| 1040 | 2842818600 | 2842815866 | Bacteria | 5947510 |
| 1041 | 2842832983 | 2842832357 | Bacteria | 5959113 |
| 1042 | 2842848401 | 2842843487 | Bacteria | 6004777 |
| 1043 | 2842853822 | 2842849001 | Bacteria | 5924277 |
| 1044 | 2842858937 | 2842854478 | Bacteria | 6143501 |
| 1045 | 2844668942 | 2844665904 | Bacteria | 6817974 |
| 1046 | 2852658669 | 2852657418 | Bacteria | 6472974 |
| 1047 | 2860340297 | 2860339153 | Bacteria | 6846989 |
| 1048 | 2878031156 | 2878029506 | Bacteria | 6418441 |
| 1049 | 2880232054 | 2880230671 | Bacteria | 6140320 |
| 1050 | 2904522411 | 2904518522 | Bacteria | 6068986 |
| 1051 | 2904551554 | 2904550169 | Bacteria | 6221258 |
| 1052 | 2912967963 | 2912963787 | Bacteria | 5646108 |
| 1053 | 2913038304 | 2913036834 | Bacteria | 6704877 |
| 1054 | 2917072196 | 2917070673 | Bacteria | 6868303 |
| 1055 | 2919064319 | 2919063839 | Bacteria | 6302690 |
| 1056 | 2919159278 | 2919155634 | Bacteria | 4860545 |
| 1057 | 2919386182 | 2919385768 | Bacteria | 5897293 |
| 1058 | 2919462047 | 2919456309 | Bacteria | 6586567 |
| 1059 | 2919481573 | 2919481497 | Bacteria | 6907839 |
| 1060 | 2919491736 | 2919487758 | Bacteria | 5929766 |
| 1061 | 2919504327 | 2919501602 | Bacteria | 5286340 |
| 1062 | 2919700291 | 2919697872 | Bacteria | 6553725 |
| 1063 | 2923155045 | 2923153595 | Bacteria | 6870622 |
| 1064 | 2923522173 | 2923519811 | Bacteria | 6298479 |
| 1065 | 2923587579 | 2923586266 | Bacteria | 6565975 |
| 1066 | 2926065100 | 2926063275 | Bacteria | 5285848 |
| 1067 | 2929145745 | 2929144301 | Bacteria | 6622272 |
| 1068 | 2931370918 | 2931369376 | Bacteria | 6847892 |
| 1069 | 2931399797 | 2931396565 | Bacteria | 7251677 |
| 1070 | 2935354367 | 2935353572 | Unclassified | 6955622 |
| 1071 | 2939637734 | 2939636861 | Bacteria | 6297853 |
| 1072 | 2939652392 | 2939651529 | Bacteria | 5895393 |
| 1073 | 2969305983 | 2969304461 | Bacteria | 6601805 |
| 1074 | 2974292431 | 2974289157 | Bacteria | 6080362 |
| 1075 | 2984290995 | 2984286254 | Bacteria | 6702062 |
| 1076 | 2988733284 | 2988728565 | Bacteria | 6124362 |
| 1077 | 2990198328 | 2990196909 | Bacteria | 4054280 |
| 1078 | 2998141390 | 2998139840 | Bacteria | 6073514 |
| 1079 | 3007400575 | 3007395558 | Bacteria | 6755444 |
| 1080 | 3007420840 | 3007419365 | Bacteria | 7026924 |
| 1081 | 3007512769 | 3007511990 | Bacteria | 6481491 |
| 1082 | 3007616234 | 3007614139 | Bacteria | 6053559 |
| 1083 | 3007620455 | 3007619802 | Bacteria | 6411688 |
| 1084 | 3007723043 | 3007718800 | Bacteria | 5971527 |
| 1085 | 3007808417 | 3007803356 | Bacteria | 5931491 |
| 1086 | 3007855984 | 3007855910 | Bacteria | 5637581 |
| 1087 | 3007863378 | 3007861166 | Bacteria | 6045338 |
| 1088 | 3007867937 | 3007866637 | Bacteria | 5899198 |
| 1089 | 3007875422 | 3007872151 | Bacteria | 5268868 |
| 1090 | 637318790 | 637000220 | Bacteria | 7074893 |
| 1091 | 8015689267 | 8015687852 | Bacteria | 6613826 |
| 1092 | 8019770980 | 8019769354 | Bacteria | 6924660 |
| 1093 | 8019776946 | 8019775933 | Bacteria | 6858656 |
| 1094 | 8029999360 | 8029995093 | Bacteria | 5990776 |
| 1095 | 8034962582 | 8034962539 | Bacteria | 4884839 |
| 1096 | 8052495666 | 8052494512 | Bacteria | 5765634 |
| 1097 | 8054933232 | 8054929484 | Bacteria | 5599761 |
| 1098 | 8055772383 | 8055770955 | Bacteria | 6827675 |
| 1099 | 8055884057 | 8055878733 | Bacteria | 5907058 |
| 1100 | 8056117432 | 8056115690 | Bacteria | 5527654 |
| 1101 | 8056124782 | 8056120720 | Bacteria | 5758328 |
| 1102 | 8056127431 | 8056125926 | Bacteria | 6228218 |
| 1103 | 8056138570 | 8056137416 | Bacteria | 6147080 |
| 1104 | 8056147531 | 8056143049 | Bacteria | 6307666 |
| 1105 | 8056159378 | 8056155041 | Bacteria | 6486948 |
| 1106 | 8056169670 | 8056166840 | Bacteria | 5820959 |
| 1107 | 8056175779 | 8056172158 | Bacteria | 6133900 |
| 1108 | 8056180228 | 8056177738 | Bacteria | 6748268 |
| 1109 | 8056570052 | 8056569372 | Bacteria | 5997322 |
| 1110 | 8057803727 | 8057798959 | Bacteria | 6713499 |
| 1111 | Ga0495605_0027860 | |||
| 1112 | MRS2a_Contig_27 | |||
| 1113 | MRS2a_Contig_6276 | |||
| 1114 | SwRhRL2b_contig_722602 | |||
| 1115 | MRS1b_contig_3814 | |||
| 1116 | JGI25162J39368_1000132 | |||
| 1117 | JGI25163J39215_1001003 | |||
| 1118 | JGI25163J39215_1001640 | |||
| 1119 | JGI25164J39214_1000029 | |||
| 1120 | JGI25164J39214_1000106 | |||
| 1121 | JGI25165J46597_1000111 | |||
| 1122 | JGI25165J46597_1000217 | |||
| 1123 | rootH1_10289084 | |||
| 1124 | Ga0006562J51391_1005324 | |||
| 1125 | Ga0055536_1000043 | |||
| 1126 | Ga0055536_1004002 | |||
| 1127 | Ga0055536_1004073 | |||
| 1128 | Ga0055536_1036712 | |||
| 1129 | Ga0055530_10000031 | |||
| 1130 | Ga0055530_10004130 | |||
| 1131 | Ga0055530_10004172 | |||
| 1132 | Ga0055540_1000415 | |||
| 1133 | Ga0055540_1003406 | |||
| 1134 | Ga0055540_1003457 | |||
| 1135 | Ga0055540_1018326 | |||
| 1136 | Ga0055531_10000283 | |||
| 1137 | Ga0065714_10000009 | |||
| 1138 | Ga0065714_10003519 | |||
| 1139 | Ga0065714_10004035 | |||
| 1140 | Ga0065714_10019813 | |||
| 1141 | Ga0065714_10065522 | |||
| 1142 | Ga0065714_10068042 | |||
| 1143 | Ga0065714_10068362 | |||
| 1144 | Ga0065714_10071009 | |||
| 1145 | Ga0065714_10078627 | |||
| 1146 | Ga0065714_10082576 | |||
| 1147 | Ga0065704_10001998 | |||
| 1148 | Ga0065704_10006243 | |||
| 1149 | Ga0065704_10006864 | |||
| 1150 | Ga0065704_10086866 | |||
| 1151 | Ga0065712_10000649 | |||
| 1152 | Ga0065712_10067895 | |||
| 1153 | Ga0065715_10008316 | |||
| 1154 | Ga0070669_100306876 | |||
| 1155 | Ga0070662_100019401 | |||
| 1156 | Ga0075364_10089589 | |||
| 1157 | Ga0075364_10163874 | |||
| 1158 | Ga0075364_10325072 | |||
| 1159 | Ga0075432_10004652 | |||
| 1160 | Ga0075432_10007662 | |||
| 1161 | Ga0075432_10037467 | |||
| 1162 | Ga0075432_10054030 | |||
| 1163 | Ga0075362_10113548 | |||
| 1164 | Ga0099823_1016692 | |||
| 1165 | Ga0079104_1000090 | |||
| 1166 | Ga0079104_1000134 | |||
| 1167 | Ga0099826_10003760 | |||
| 1168 | Ga0105251_10000004 | |||
| 1169 | Ga0105251_10000149 | |||
| 1170 | Ga0105251_10001609 | |||
| 1171 | Ga0105251_10006481 | |||
| 1172 | Ga0105251_10020224 | |||
| 1173 | Ga0105251_10020962 | |||
| 1174 | Ga0105251_10077823 | |||
| 1175 | Ga0105244_10000922 | |||
| 1176 | Ga0105244_10012941 | |||
| 1177 | Ga0105244_10013329 | |||
| 1178 | Ga0105244_10020751 | |||
| 1179 | Ga0105244_10022164 | |||
| 1180 | Ga0105244_10024012 | |||
| 1181 | Ga0105244_10025221 | |||
| 1182 | Ga0105244_10031172 | |||
| 1183 | Ga0105244_10036374 | |||
| 1184 | Ga0105244_10037258 | |||
| 1185 | Ga0105244_10059997 | |||
| 1186 | Ga0105244_10066409 | |||
| 1187 | Ga0105244_10070997 | |||
| 1188 | Ga0105244_10071768 | |||
| 1189 | Ga0105244_10074577 | |||
| 1190 | Ga0105244_10081183 | |||
| 1191 | Ga0105244_10114729 | |||
| 1192 | Ga0105250_10000235 | |||
| 1193 | Ga0105250_10005280 | |||
| 1194 | Ga0105250_10012229 | |||
| 1195 | Ga0105250_10018577 | |||
| 1196 | Ga0105250_10045489 | |||
| 1197 | Ga0105250_10092306 | |||
| 1198 | Ga0105243_10000144 | |||
| 1199 | Ga0105243_10000218 | |||
| 1200 | Ga0105243_10051760 | |||
| 1201 | Ga0105243_10080446 | |||
| 1202 | Ga0105243_10130389 | |||
| 1203 | Ga0105243_10200699 | |||
| 1204 | Ga0105242_10123597 | |||
| 1205 | Ga0105246_10000228 | |||
| 1206 | Ga0105246_10295921 | |||
| 1207 | Ga0105246_10336244 | |||
| 1208 | Ga0157345_1000028 | |||
| 1209 | Ga0157373_10008179 | |||
| 1210 | Ga0157373_10008952 | |||
| 1211 | Ga0157373_10009220 | |||
| 1212 | Ga0157373_10009462 | |||
| 1213 | Ga0157373_10013114 | |||
| 1214 | Ga0157373_10070497 | |||
| 1215 | Ga0157373_10164417 | |||
| 1216 | Ga0157373_10312381 | |||
| 1217 | Ga0157371_10000230 | |||
| 1218 | Ga0157371_10000460 | |||
| 1219 | Ga0157371_10008723 | |||
| 1220 | Ga0157371_10015482 | |||
| 1221 | Ga0157370_10036735 | |||
| 1222 | Ga0157370_10102041 | |||
| 1223 | Ga0157370_10217470 | |||
| 1224 | Ga0157370_10374505 | |||
| 1225 | Ga0157369_10019705 | |||
| 1226 | Ga0157369_10260890 | |||
| 1227 | Ga0157369_10356841 | |||
| 1228 | Ga0157369_10356882 | |||
| 1229 | Ga0163162_10098170 | |||
| 1230 | Ga0163162_10108221 | |||
| 1231 | Ga0157372_10000815 | |||
| 1232 | Ga0157372_10120467 | |||
| 1233 | Ga0157375_10518220 | |||
| 1234 | Ga0157375_10611678 | |||
| 1235 | Ga0157375_10646505 | |||
| 1236 | Ga0182008_10000783 | |||
| 1237 | Ga0182008_10011690 | |||
| 1238 | Ga0182008_10014603 | |||
| 1239 | Ga0182008_10036226 | |||
| 1240 | Ga0182008_10038445 | |||
| 1241 | Ga0182008_10057774 | |||
| 1242 | Ga0182008_10065702 | |||
| 1243 | Ga0182008_10124341 | |||
| 1244 | Ga0182008_10156246 | |||
| 1245 | Ga0182006_1001311 | |||
| 1246 | Ga0182006_1003963 | |||
| 1247 | Ga0182006_1004043 | |||
| 1248 | Ga0182006_1006595 | |||
| 1249 | Ga0182006_1011169 | |||
| 1250 | Ga0182006_1014072 | |||
| 1251 | Ga0182006_1018198 | |||
| 1252 | Ga0182006_1049750 | |||
| 1253 | Ga0182006_1066701 | |||
| 1254 | Ga0182007_10003527 | |||
| 1255 | Ga0182005_1001973 | |||
| 1256 | Ga0182005_1015473 | |||
| 1257 | Ga0182005_1018865 | |||
| 1258 | Ga0182005_1050588 | |||
| 1259 | Ga0182005_1050589 | |||
| 1260 | Ga0163161_10010705 | |||
| 1261 | Ga0163161_10018309 | |||
| 1262 | Ga0163161_10071149 | |||
| 1263 | Ga0163161_10085613 | |||
| 1264 | Ga0163161_10151862 | |||
| 1265 | Ga0163161_10489344 | |||
| 1266 | Ga0206356_11555357 | |||
| 1267 | Ga0209760_100015 | |||
| 1268 | Ga0209760_100047 | |||
| 1269 | Ga0209563_100515 | |||
| 1270 | Ga0207427_100001 | |||
| 1271 | Ga0207427_100029 | |||
| 1272 | Ga0209437_100003 | |||
| 1273 | Ga0209437_100009 | |||
| 1274 | Ga0209759_1019525 | |||
| 1275 | Ga0209233_1000007 | |||
| 1276 | Ga0209233_1000032 | |||
| 1277 | Ga0209675_1004059 | |||
| 1278 | Ga0209676_1000016 | |||
| 1279 | Ga0209676_1000033 | |||
| 1280 | Ga0209676_1000080 | |||
| 1281 | Ga0209676_1000721 | |||
| 1282 | Ga0209676_1001858 | |||
| 1283 | Ga0209676_1003397 | |||
| 1284 | Ga0209050_1000009 | |||
| 1285 | Ga0209050_1000036 | |||
| 1286 | Ga0209050_1000117 | |||
| 1287 | Ga0209050_1001816 | |||
| 1288 | Ga0209051_1000053 | |||
| 1289 | Ga0209051_1000077 | |||
| 1290 | Ga0209051_1000094 | |||
| 1291 | Ga0209051_1014768 | |||
| 1292 | Ga0209257_1000173 | |||
| 1293 | Ga0209257_1026276 | |||
| 1294 | Ga0207696_1000022 | |||
| 1295 | Ga0207696_1000044 | |||
| 1296 | Ga0207696_1000083 | |||
| 1297 | Ga0207696_1002326 | |||
| 1298 | Ga0207696_1003920 | |||
| 1299 | Ga0207696_1004851 | |||
| 1300 | Ga0207696_1006039 | |||
| 1301 | Ga0207696_1029848 | |||
| 1302 | Ga0207655_1000005 | |||
| 1303 | Ga0207655_1000015 | |||
| 1304 | Ga0207655_1000193 | |||
| 1305 | Ga0207655_1000240 | |||
| 1306 | Ga0207655_1000516 | |||
| 1307 | Ga0207655_1001511 | |||
| 1308 | Ga0207655_1002564 | |||
| 1309 | Ga0207655_1005303 | |||
| 1310 | Ga0207655_1012339 | |||
| 1311 | Ga0207655_1019915 | |||
| 1312 | Ga0207655_1025696 | |||
| 1313 | Ga0207655_1026474 | |||
| 1314 | Ga0207655_1043244 | |||
| 1315 | Ga0207655_1045470 | |||
| 1316 | Ga0207655_1074279 | |||
| 1317 | Ga0207713_1000013 | |||
| 1318 | Ga0207713_1000104 | |||
| 1319 | Ga0207713_1000933 | |||
| 1320 | Ga0207713_1000977 | |||
| 1321 | Ga0207713_1003887 | |||
| 1322 | Ga0207713_1007436 | |||
| 1323 | Ga0207713_1007908 | |||
| 1324 | Ga0207713_1010208 | |||
| 1325 | Ga0207713_1010346 | |||
| 1326 | Ga0207713_1010443 | |||
| 1327 | Ga0207713_1020768 | |||
| 1328 | Ga0207713_1020816 | |||
| 1329 | Ga0207713_1024766 | |||
| 1330 | Ga0207713_1060892 | |||
| 1331 | Ga0207681_10337243 | |||
| 1332 | Ga0207706_10031700 | |||
| 1333 | Ga0207709_10000036 | |||
| 1334 | Ga0207709_10000250 | |||
| 1335 | Ga0207709_10011638 | |||
| 1336 | Ga0207709_10080242 | |||
| 1337 | Ga0209281_1000013 | |||
| 1338 | Ga0209281_1000172 | |||
| 1339 | Ga0209281_1008449 | |||
| 1340 | Ga0209281_1014360 | |||
| 1341 | Ga0209389_1000002 | |||
| 1342 | Ga0209371_1000414 | |||
| 1343 | Ga0209999_1005350 | |||
| 1344 | Ga0209282_1042241 | |||
| 1345 | Ga0207428_10029703 | |||
| 1346 | Ga0207428_10126181 | |||
| 1347 | Ga0207428_10233821 | |||
| 1348 | Ga0207428_10352501 | |||
| 1349 | Ga0268266_10156206 | |||
| 1350 | Ga0307517_10168130 | |||
| 1351 | Ga0307517_10239473 | |||
| 1352 | Ga0268256_1000355 | |||
| 1353 | Ga0314311_1203986 | |||
| 1354 | Ga0316178_1048493 | |||
| 1355 | Ga0316183_1025019 | |||
| 1356 | Ga0316183_1065202 | |||
| 1357 | Ga0316181_1070701 | |||
| 1358 | Ga0307408_100000081 | |||
| 1359 | Ga0307408_100003809 | |||
| 1360 | Ga0307408_100019038 | |||
| 1361 | Ga0307408_100062293 | |||
| 1362 | Ga0307408_100304399 | |||
| 1363 | Ga0307405_10008655 | |||
| 1364 | Ga0307412_10014719 | |||
| 1365 | Ga0307412_10015341 | |||
| 1366 | Ga0307412_10160042 | |||
| 1367 | Ga0307412_10203664 | |||
| 1368 | Ga0307412_10347440 | |||
| 1369 | Ga0307409_100238037 | |||
| 1370 | Ga0307414_10015196 | |||
| 1371 | Ga0307414_10060093 | |||
| 1372 | Ga0307414_10085384 | |||
| 1373 | Ga0307414_10122593 | |||
| 1374 | Ga0307411_10092953 | |||
| 1375 | Ga0307510_10020770 | |||
| 1376 | Ga0307510_10156577 | |||
| 1377 | Ga0237819_00586 | |||
| 1378 | Ga0439436_0006624 | |||
| 1379 | Ga0439438_000992 | |||
| 1380 | Ga0439438_001224 | |||
| 1381 | Ga0439438_002780 | |||
| 1382 | Ga0439438_004117 | |||
| 1383 | Ga0439438_005242 | |||
| 1384 | Ga0439438_005988 | |||
| 1385 | Ga0439438_006395 | |||
| 1386 | Ga0439438_009648 | |||
| 1387 | Ga0439438_015423 | |||
| 1388 | Ga0439438_020237 | |||
| 1389 | Ga0439438_024721 | |||
| 1390 | Ga0439447_000502 | |||
| 1391 | Ga0439447_001881 | |||
| 1392 | Ga0439447_003703 | |||
| 1393 | Ga0439447_007850 | |||
| 1394 | Ga0439447_008366 | |||
| 1395 | Ga0439447_008833 | |||
| 1396 | Ga0439447_010942 | |||
| 1397 | Ga0439466_0000342 | |||
| 1398 | Ga0439466_0001434 | |||
| 1399 | Ga0439466_0001459 | |||
| 1400 | Ga0439466_0002230 | |||
| 1401 | Ga0439466_0003988 | |||
| 1402 | Ga0439466_0005828 | |||
| 1403 | Ga0439466_0007938 | |||
| 1404 | Ga0439466_0012473 | |||
| 1405 | Ga0439466_0015533 | |||
| 1406 | Ga0439466_0018697 | |||
| 1407 | Ga0439466_0021069 | |||
| 1408 | Ga0439466_0054853 | |||
| 1409 | Ga0439465_0003166 | |||
| 1410 | Ga0439465_0027031 | |||
| 1411 | Ga0439431_0002910 | |||
| 1412 | Ga0439431_0005964 | |||
| 1413 | Ga0439431_0007018 | |||
| 1414 | Ga0439445_0033542 | |||
| 1415 | Ga0439445_0050313 | |||
| 1416 | Ga0439432_002305 | |||
| 1417 | Ga0439432_003429 | |||
| 1418 | Ga0439432_005514 | |||
| 1419 | Ga0439432_008520 | |||
| 1420 | Ga0439432_019693 | |||
| 1421 | Ga0439432_023356 | |||
| 1422 | Ga0439432_027182 | |||
| 1423 | Ga0439451_001946 | |||
| 1424 | Ga0439452_000500 | |||
| 1425 | Ga0439452_001277 | |||
| 1426 | Ga0439452_001890 | |||
| 1427 | Ga0439452_001939 | |||
| 1428 | Ga0439452_003673 | |||
| 1429 | Ga0439452_003981 | |||
| 1430 | Ga0439452_009442 | |||
| 1431 | Ga0439452_011351 | |||
| 1432 | Ga0439452_011895 | |||
| 1433 | Ga0439455_0005047 | |||
| 1434 | Ga0439456_000039 | |||
| 1435 | Ga0439456_000851 | |||
| 1436 | Ga0439456_004460 | |||
| 1437 | Ga0439456_005650 | |||
| 1438 | Ga0439456_007987 | |||
| 1439 | Ga0439456_012300 | |||
| 1440 | Ga0439456_017389 | |||
| 1441 | Ga0439463_001515 | |||
| 1442 | Ga0439463_005478 | |||
| 1443 | Ga0439463_017111 | |||
| 1444 | Ga0439463_035096 | |||
| 1445 | Ga0450911_000037 | |||
| 1446 | Ga0450911_000292 | |||
| 1447 | Ga0450911_004861 | |||
| 1448 | Ga0450919_003445 | |||
| 1449 | Ga0450922_001710 | |||
| 1450 | Ga0450922_002063 | |||
| 1451 | Ga0450890_000422 | |||
| 1452 | Ga0450891_002006 | |||
| 1453 | Ga0450900_000809 | |||
| 1454 | Ga0450902_000567 | |||
| 1455 | Ga0450902_020770 | |||
| 1456 | Ga0450903_000781 | |||
| 1457 | Ga0450904_000012 | |||
| 1458 | Ga0450904_001656 | |||
| 1459 | Ga0450905_000074 | |||
| 1460 | Ga0450905_001959 | |||
| 1461 | Ga0450905_004581 | |||
| 1462 | Ga0450905_011138 | |||
| 1463 | Ga0450906_000157 | |||
| 1464 | Ga0450907_000591 | |||
| 1465 | Ga0450907_001368 | |||
| 1466 | Ga0450910_005405 | |||
| 1467 | Ga0450910_008145 | |||
| 1468 | Ga0439446_0001558 | |||
| 1469 | Ga0439446_0002615 | |||
| 1470 | Ga0439446_0004462 | |||
| 1471 | Ga0439446_0005697 | |||
| 1472 | Ga0450909_003876 | |||
| 1473 | Ga0450909_004616 | |||
| 1474 | Ga0450909_006490 | |||
| 1475 | Ga0439434_0000189 | |||
| 1476 | Ga0439434_0002776 | |||
| 1477 | Ga0439434_0019941 | |||
| 1478 | Ga0439459_0001248 | |||
| 1479 | Ga0439464_0001261 | |||
| 1480 | Ga0439460_0000237 | |||
| 1481 | Ga0450916_000955 | |||
| 1482 | Ga0450916_005396 | |||
| 1483 | Ga0450918_005125 | |||
| 1484 | Ga0450893_0003354 | |||
| 1485 | Ga0450893_0004277 | |||
| 1486 | Ga0450901_000655 | |||
| 1487 | Ga0439440_0008818 | |||
| 1488 | Ga0439440_0016140 | |||
| 1489 | Ga0495617_001816 | |||
| 1490 | Ga0495617_012260 | |||
| 1491 | Ga0495617_023649 | |||
| 1492 | Ga0495617_031553 | |||
| 1493 | Ga0495617_033987 | |||
| 1494 | Ga0495617_061220 | |||
| 1495 | Ga0495617_072426 | |||
| 1496 | Ga0495627_000021 | |||
| 1497 | Ga0495627_000279 | |||
| 1498 | Ga0495627_002666 | |||
| 1499 | Ga0495627_002922 | |||
| 1500 | Ga0495627_012582 | |||
| 1501 | Ga0495627_033788 | |||
| 1502 | Ga0495603_0015991 | |||
| 1503 | Ga0495590_0000920 | |||
| 1504 | Ga0495590_0002374 | |||
| 1505 | Ga0495590_0026903 | |||
| 1506 | Ga0495590_0040384 | |||
| 1507 | Ga0495590_0042127 | |||
| 1508 | Ga0495591_000015 | |||
| 1509 | Ga0495591_001627 | |||
| 1510 | Ga0495591_003627 | |||
| 1511 | Ga0495591_003905 | |||
| 1512 | Ga0495591_005627 | |||
| 1513 | Ga0495591_006409 | |||
| 1514 | Ga0495591_006828 | |||
| 1515 | Ga0495591_007829 | |||
| 1516 | Ga0495591_008115 | |||
| 1517 | Ga0495591_008517 | |||
| 1518 | Ga0495591_027684 | |||
| 1519 | Ga0495591_041331 | |||
| 1520 | Ga0495629_0009993 | |||
| 1521 | Ga0495638_0007630 | |||
| 1522 | Ga0495638_0008249 | |||
| 1523 | Ga0495638_0015483 | |||
| 1524 | Ga0495638_0028103 | |||
| 1525 | Ga0495638_0083788 | |||
| 1526 | Ga0495638_0084376 | |||
| 1527 | Ga0495638_0097596 | |||
| 1528 | Ga0495638_0111073 | |||
| 1529 | Ga0495638_0116695 | |||
| 1530 | Ga0495638_0134801 | |||
| 1531 | Ga0495638_0203110 | |||
| 1532 | Ga0495638_0221724 | |||
| 1533 | Ga0495653_0009661 | |||
| 1534 | Ga0495653_0018187 | |||
| 1535 | Ga0495653_0035403 | |||
| 1536 | Ga0495650_0001786 | |||
| 1537 | Ga0495650_0011839 | |||
| 1538 | Ga0495650_0012047 | |||
| 1539 | Ga0495650_0015563 | |||
| 1540 | Ga0495650_0030937 | |||
| 1541 | Ga0495650_0098300 | |||
| 1542 | Ga0495582_0034309 | |||
| 1543 | Ga0495605_0000016 | |||
| 1544 | Ga0495605_0000031 | |||
| 1545 | Ga0495605_0000917 | |||
| 1546 | Ga0495605_0003709 | |||
| 1547 | Ga0495605_0004707 | |||
| 1548 | Ga0495605_0012909 | |||
| 1549 | Ga0495605_0020163 | |||
| 1550 | Ga0495605_0029273 | |||
| 1551 | Ga0495605_0038274 | |||
| 1552 | Ga0495605_0045604 | |||
| 1553 | Ga0495639_0001930 | |||
| 1554 | Ga0495639_0022310 | |||
| 1555 | Ga0495584_0003475 | |||
| 1556 | Ga0495584_0004191 | |||
| 1557 | Ga0495584_0010552 | |||
| 1558 | Ga0495584_0024071 | |||
| 1559 | Ga0495584_0027340 | |||
| 1560 | Ga0495584_0042112 | |||
| 1561 | Ga0495584_0082595 | |||
| 1562 | Ga0495584_0092493 | |||
| 1563 | Ga0495584_0103383 | |||
| 1564 | Ga0495585_0004523 | |||
| 1565 | Ga0495585_0005559 | |||
| 1566 | Ga0495585_0013222 | |||
| 1567 | Ga0495585_0042969 | |||
| 1568 | Ga0495585_0048827 | |||
| 1569 | Ga0495585_0049967 | |||
| 1570 | Ga0495585_0066460 | |||
| 1571 | Ga0495585_0072113 | |||
| 1572 | Ga0495585_0072861 | |||
| 1573 | Ga0495585_0077270 | |||
| 1574 | Ga0495585_0142747 | |||
| 1575 | Ga0495594_0010081 | |||
| 1576 | Ga0495594_0031690 | |||
| 1577 | Ga0495594_0047830 | |||
| 1578 | Ga0495596_0003952 | |||
| 1579 | Ga0495596_0016460 | |||
| 1580 | Ga0495607_0000162 | |||
| 1581 | Ga0495607_0000566 | |||
| 1582 | Ga0495607_0001224 | |||
| 1583 | Ga0495607_0005921 | |||
| 1584 | Ga0495607_0013895 | |||
| 1585 | Ga0495607_0026684 | |||
| 1586 | Ga0495607_0028908 | |||
| 1587 | Ga0495607_0036902 | |||
| 1588 | Ga0495607_0042021 | |||
| 1589 | Ga0495607_0048157 | |||
| 1590 | Ga0495607_0049410 | |||
| 1591 | Ga0495607_0055547 | |||
| 1592 | Ga0495607_0060550 | |||
| 1593 | Ga0495607_0175758 | |||
| 1594 | Ga0495583_0000041 | |||
| 1595 | Ga0495583_0000698 | |||
| 1596 | Ga0495583_0001999 | |||
| 1597 | Ga0495583_0013199 | |||
| 1598 | Ga0495583_0025229 | |||
| 1599 | Ga0495583_0025374 | |||
| 1600 | Ga0495583_0072459 | |||
| 1601 | Ga0495606_0002535 | |||
| 1602 | Ga0495606_0009839 | |||
| 1603 | Ga0495606_0018681 | |||
| 1604 | Ga0495606_0033013 | |||
| 1605 | Ga0495606_0039096 | |||
| 1606 | Ga0495606_0190423 | |||
| 1607 | Ga0495610_0013447 | |||
| 1608 | Ga0495610_0017340 | |||
| 1609 | Ga0495610_0018209 | |||
| 1610 | Ga0495610_0023445 | |||
| 1611 | Ga0495610_0037736 | |||
| 1612 | Ga0495610_0060137 | |||
| 1613 | Ga0495610_0061875 | |||
| 1614 | Ga0495610_0124723 | |||
| 1615 | Ga0495616_0001130 | |||
| 1616 | Ga0495616_0004373 | |||
| 1617 | Ga0495616_0064488 | |||
| 1618 | Ga0495616_0066627 | |||
| 1619 | Ga0495616_0123915 | |||
| 1620 | Ga0495620_0000013 | |||
| 1621 | Ga0495620_0000015 | |||
| 1622 | Ga0495620_0010128 | |||
| 1623 | Ga0495620_0013776 | |||
| 1624 | Ga0495620_0027507 | |||
| 1625 | Ga0495630_0065472 | |||
| 1626 | Ga0495630_0109774 | |||
| 1627 | Ga0495631_0000635 | |||
| 1628 | Ga0495631_0012293 | |||
| 1629 | Ga0495631_0014178 | |||
| 1630 | Ga0495631_0040095 | |||
| 1631 | Ga0495631_0052373 | |||
| 1632 | Ga0495631_0061981 | |||
| 1633 | Ga0495631_0107489 | |||
| 1634 | Ga0495632_0000217 | |||
| 1635 | Ga0495632_0005235 | |||
| 1636 | Ga0495632_0006704 | |||
| 1637 | Ga0495632_0010845 | |||
| 1638 | Ga0495632_0012977 | |||
| 1639 | Ga0495632_0013137 | |||
| 1640 | Ga0495632_0015983 | |||
| 1641 | Ga0495632_0017098 | |||
| 1642 | Ga0495632_0021570 | |||
| 1643 | Ga0495632_0037714 | |||
| 1644 | Ga0495632_0071991 | |||
| 1645 | Ga0495632_0077674 | |||
| 1646 | Ga0495632_0118313 | |||
| 1647 | Ga0495637_0000381 | |||
| 1648 | Ga0495637_0003308 | |||
| 1649 | Ga0495637_0007187 | |||
| 1650 | Ga0495637_0009513 | |||
| 1651 | Ga0495637_0011974 | |||
| 1652 | Ga0495637_0012545 | |||
| 1653 | Ga0495637_0013794 | |||
| 1654 | Ga0495637_0017806 | |||
| 1655 | Ga0495637_0020579 | |||
| 1656 | Ga0495637_0028441 | |||
| 1657 | Ga0495637_0031160 | |||
| 1658 | Ga0495637_0039255 | |||
| 1659 | Ga0495637_0040168 | |||
| 1660 | Ga0495637_0041340 | |||
| 1661 | Ga0495637_0044102 | |||
| 1662 | Ga0495637_0049744 | |||
| 1663 | Ga0495637_0052071 | |||
| 1664 | Ga0495637_0080267 | |||
| 1665 | Ga0495643_0002001 | |||
| 1666 | Ga0495643_0002058 | |||
| 1667 | Ga0495643_0013131 | |||
| 1668 | Ga0495643_0023247 | |||
| 1669 | Ga0495643_0044163 | |||
| 1670 | Ga0495643_0085971 | |||
| 1671 | Ga0495643_0166499 | |||
| 1672 | Ga0495643_0210797 | |||
| 1673 | Ga0495644_0003315 | |||
| 1674 | Ga0495644_0006231 | |||
| 1675 | Ga0495644_0026504 | |||
| 1676 | Ga0495644_0038103 | |||
| 1677 | Ga0495648_0000491 | |||
| 1678 | Ga0495648_0006371 | |||
| 1679 | Ga0495648_0019057 | |||
| 1680 | Ga0495648_0027715 | |||
| 1681 | Ga0495648_0053504 | |||
| 1682 | Ga0495648_0053694 | |||
| 1683 | Ga0495648_0100133 | |||
| 1684 | Ga0495648_0107478 | |||
| 1685 | Ga0495648_0156955 | |||
| 1686 | Ga0495666_0012934 | |||
| 1687 | Ga0495666_0039955 | |||
| 1688 | Ga0495666_0073093 | |||
| 1689 | Ga0495642_0000097 | |||
| 1690 | Ga0495642_0001859 | |||
| 1691 | Ga0495642_0004237 | |||
| 1692 | Ga0495654_0002407 | |||
| 1693 | Ga0495654_0003357 | |||
| 1694 | Ga0495654_0005010 | |||
| 1695 | Ga0495654_0006722 | |||
| 1696 | Ga0495654_0008163 | |||
| 1697 | Ga0495654_0012957 | |||
| 1698 | Ga0495654_0015256 | |||
| 1699 | Ga0495654_0027538 | |||
| 1700 | Ga0495654_0029347 | |||
| 1701 | Ga0495654_0042593 | |||
| 1702 | Ga0495654_0045971 | |||
| 1703 | Ga0495654_0055987 | |||
| 1704 | Ga0495654_0063832 | |||
| 1705 | Ga0495654_0069104 | |||
| 1706 | Ga0495654_0089076 | |||
| 1707 | Ga0495654_0110992 | |||
| 1708 | Ga0495654_0124592 | |||
| 1709 | Ga0495586_0060315 | |||
| 1710 | Ga0495587_0034356 | |||
| 1711 | Ga0495587_0046458 | |||
| 1712 | Ga0495609_0000015 | |||
| 1713 | Ga0495609_0000066 | |||
| 1714 | Ga0495609_0000070 | |||
| 1715 | Ga0495609_0004218 | |||
| 1716 | Ga0495609_0007336 | |||
| 1717 | Ga0495609_0055546 | |||
| 1718 | Ga0495609_0070513 | |||
| 1719 | Ga0495597_0000005 | |||
| 1720 | Ga0495597_0002158 | |||
| 1721 | Ga0495597_0016962 | |||
| 1722 | Ga0495597_0028135 | |||
| 1723 | Ga0495597_0062218 | |||
| 1724 | Ga0495622_0002478 | |||
| 1725 | Ga0495622_0010641 | |||
| 1726 | Ga0495622_0012691 | |||
| 1727 | Ga0495622_0027676 | |||
| 1728 | Ga0495622_0039371 | |||
| 1729 | Ga0495633_0000060 | |||
| 1730 | Ga0495633_0035970 | |||
| 1731 | Ga0495633_0050809 | |||
| 1732 | Ga0495656_0008233 | |||
| 1733 | Ga0495656_0090793 | |||
| 1734 | Ga0495668_0004245 | |||
| 1735 | Ga0495668_0026574 | |||
| 1736 | Ga0495668_0051766 | |||
| 1737 | Ga0495668_0061318 | |||
| 1738 | Ga0495668_0090575 | |||
| 1739 | Ga0495634_0001715 | |||
| 1740 | Ga0495634_0211204 | |||
| 1741 | Ga0495611_0000817 | |||
| 1742 | Ga0495611_0000934 | |||
| 1743 | Ga0495611_0090840 | |||
| 1744 | Ga0495625_0001491 | |||
| 1745 | Ga0495625_0009777 | |||
| 1746 | Ga0495625_0014823 | |||
| 1747 | Ga0495625_0031221 | |||
| 1748 | Ga0495625_0042717 | |||
| 1749 | Ga0495625_0077707 | |||
| 1750 | Ga0495625_0079533 | |||
| 1751 | Ga0495625_0118193 | |||
| 1752 | Ga0495625_0166964 | |||
| 1753 | Ga0495635_0005514 | |||
| 1754 | Ga0495635_0006971 | |||
| 1755 | Ga0495659_0001693 | |||
| 1756 | Ga0495659_0013279 | |||
| 1757 | Ga0495661_0000110 | |||
| 1758 | Ga0495661_0000139 | |||
| 1759 | Ga0495661_0000194 | |||
| 1760 | Ga0495661_0000304 | |||
| 1761 | Ga0495661_0081571 | |||
| 1762 | Ga0495661_0088921 | |||
| 1763 | Ga0495588_0001397 | |||
| 1764 | Ga0495657_0093451 | |||
| 1765 | Ga0495623_0024250 | |||
| 1766 | Ga0495623_0060098 | |||
| 1767 | Ga0495646_0048954 | |||
| 1768 | Ga0495646_0106616 | |||
| 1769 | Ga0495669_0012665 | |||
| 1770 | Ga0495613_0063638 | |||
| 1771 | Ga0495624_0011063 | |||
| 1772 | Ga0495670_0043323 | |||
| 1773 | Ga0495670_0048843 | |||
| 1774 | Ga0495670_0063197 | |||
| 1775 | Ga0495670_0070265 | |||
| 1776 | Ga0495670_0070579 | |||
| 1777 | Ga0495670_0091929 | |||
| 1778 | Ga0495671_0002259 | |||
| 1779 | Ga0495671_0008071 | |||
| 1780 | Ga0495671_0010083 | |||
| 1781 | Ga0495671_0045812 | |||
| 1782 | Ga0495671_0075286 | |||
| 1783 | Ga0495671_0077677 | |||
| 1784 | Ga0495671_0131644 | |||
| 1785 | Ga0495671_0135458 | |||
| 1786 | Ga0495671_0189561 | |||
| 1787 | Ga0495649_0010015 | |||
| 1788 | Ga0495649_0012226 | |||
| 1789 | Ga0495649_0016114 | |||
| 1790 | Ga0495649_0023293 | |||
| 1791 | Ga0495649_0031126 | |||
| 1792 | Ga0495649_0045899 | |||
| 1793 | Ga0495649_0047424 | |||
| 1794 | Ga0495649_0049048 | |||
| 1795 | Ga0495649_0080939 | |||
| 1796 | Ga0495649_0137999 | |||
| 1797 | Ga0495649_0139555 | |||
| 1798 | Ga0495589_0004531 | |||
| 1799 | Ga0495589_0007586 | |||
| 1800 | Ga0495589_0009282 | |||
| 1801 | Ga0495589_0071619 | |||
| 1802 | Ga0495600_0015424 | |||
| 1803 | Ga0495600_0054749 | |||
| 1804 | Ga0495600_0102968 | |||
| 1805 | Ga0495660_0000469 | |||
| 1806 | Ga0495660_0008400 | |||
| 1807 | Ga0495660_0009165 | |||
| 1808 | Ga0495660_0012657 | |||
| 1809 | Ga0495660_0017631 | |||
| 1810 | Ga0495660_0023858 | |||
| 1811 | Ga0495660_0032179 | |||
| 1812 | Ga0495660_0036400 | |||
| 1813 | Ga0495660_0036679 | |||
| 1814 | Ga0495660_0065774 | |||
| 1815 | Ga0495660_0070394 | |||
| 1816 | Ga0495660_0074058 | |||
| 1817 | Ga0495660_0098684 | |||
| 1818 | Ga0495660_0147356 | |||
| 1819 | Ga0495660_0180797 | |||
| 1820 | Ga0495581_0034122 | |||
| 1821 | Ga0495581_0053092 | |||
| 1822 | Ga0495604_0005968 | |||
| 1823 | Ga0495604_0015007 | |||
| 1824 | Ga0495604_0122428 | |||
| 1825 | Ga0495636_0045497 | |||
| 1826 | Ga0495674_0013987 | |||
| 1827 | Ga0495672_0003898 | |||
| 1828 | Ga0495672_0010049 | |||
| 1829 | Ga0495672_0010488 | |||
| 1830 | Ga0495672_0011159 | |||
| 1831 | Ga0495672_0017369 | |||
| 1832 | Ga0495672_0033043 | |||
| 1833 | Ga0495672_0039094 | |||
| 1834 | Ga0495672_0054233 | |||
| 1835 | Ga0495672_0078358 | |||
| 1836 | Ga0495672_0087989 | |||
| 1837 | Ga0495672_0093579 | |||
| 1838 | Ga0495672_0093653 | |||
| 1839 | Ga0495672_0101790 | |||
| 1840 | Ga0495672_0149530 | |||
| 1841 | Ga0495672_0151469 | |||
| 1842 | Ga0495676_0000013 | |||
| 1843 | Ga0495676_0009626 | |||
| 1844 | Ga0495676_0019756 | |||
| 1845 | Ga0495680_0000389 | |||
| 1846 | Ga0495680_0051855 | |||
| 1847 | Ga0495680_0078655 | |||
| 1848 | Ga0495680_0132019 | |||
| 1849 | Ga0495683_0000027 | |||
| 1850 | Ga0495683_0000261 | |||
| 1851 | Ga0495683_0004737 | |||
| 1852 | Ga0495683_0005086 | |||
| 1853 | Ga0495683_0017386 | |||
| 1854 | Ga0495683_0022429 | |||
| 1855 | Ga0495683_0026508 | |||
| 1856 | Ga0495683_0037153 | |||
| 1857 | Ga0495683_0057727 | |||
| 1858 | Ga0495683_0108210 | |||
| 1859 | Ga0495683_0118939 | |||
| 1860 | Ga0495683_0121135 | |||
| 1861 | Ga0495683_0144895 | |||
| 1862 | Ga0495687_005844 | |||
| 1863 | Ga0495687_013303 | |||
| 1864 | Ga0495687_017430 | |||
| 1865 | Ga0495687_036841 | |||
| 1866 | Ga0495675_0001992 | |||
| 1867 | Ga0495675_0113108 | |||
| 1868 | Ga0495677_0004953 | |||
| 1869 | Ga0495679_000206 | |||
| 1870 | Ga0495679_001765 | |||
| 1871 | Ga0495679_019678 | |||
| 1872 | Ga0495679_021420 | |||
| 1873 | Ga0495685_036695 | |||
| 1874 | Ga0495673_0002278 | |||
| 1875 | Ga0495673_0005752 | |||
| 1876 | Ga0495673_0005888 | |||
| 1877 | Ga0495673_0011917 | |||
| 1878 | Ga0495673_0014906 | |||
| 1879 | Ga0495673_0015222 | |||
| 1880 | Ga0495673_0018742 | |||
| 1881 | Ga0495673_0022950 | |||
| 1882 | Ga0495673_0024014 | |||
| 1883 | Ga0495673_0038565 | |||
| 1884 | Ga0495673_0042216 | |||
| 1885 | Ga0495673_0050387 | |||
| 1886 | Ga0495673_0050886 | |||
| 1887 | Ga0495673_0063147 | |||
| 1888 | Ga0495673_0090907 | |||
| 1889 | Ga0495681_0000933 | |||
| 1890 | Ga0495681_0005006 | |||
| 1891 | Ga0495681_0006277 | |||
| 1892 | Ga0495681_0007132 | |||
| 1893 | Ga0495681_0007434 | |||
| 1894 | Ga0495681_0011304 | |||
| 1895 | Ga0495681_0014618 | |||
| 1896 | Ga0495681_0015582 | |||
| 1897 | Ga0495681_0026422 | |||
| 1898 | Ga0495681_0035133 | |||
| 1899 | Ga0495681_0059790 | |||
| 1900 | Ga0495681_0061499 | |||
| 1901 | Ga0495681_0075599 | |||
| 1902 | Ga0495681_0104002 | |||
| 1903 | Ga0495684_0111655 | |||
| 1904 | Ga0495686_0005865 | |||
| 1905 | Ga0495686_0072055 | |||
| 1906 | Ga0495593_0045550 | |||
| 1907 | Ga0495602_0030701 | |||
| 1908 | Ga0495614_0047085 | |||
| 1909 | Ga0495626_0000056 | |||
| 1910 | Ga0495626_0001227 | |||
| 1911 | Ga0495626_0005367 | |||
| 1912 | Ga0495626_0005402 | |||
| 1913 | Ga0495626_0005494 | |||
| 1914 | Ga0495626_0005538 | |||
| 1915 | Ga0495626_0011405 | |||
| 1916 | Ga0495626_0021571 | |||
| 1917 | Ga0495626_0031306 | |||
| 1918 | Ga0495626_0044990 | |||
| 1919 | Ga0496101_0035587 | |||
| 1920 | Ga0496102_0000242 | |||
| 1921 | Ga0496102_0423730 | |||
| 1922 | Ga0496103_0005866 | |||
| 1923 | Ga0496105_0209384 | |||
| 1924 | Ga0496107_0119091 | |||
| 1925 | Ga0496110_0038308 | |||
| 1926 | Ga0496110_0052260 | |||
| 1927 | Ga0496110_0278104 | |||
| 1928 | Ga0496111_0047643 | |||
| 1929 | Ga0496114_0028827 | |||
| 1930 | Ga0496114_0043828 | |||
| 1931 | Ga0496115_0047584 | |||
| 1932 | Ga0496116_0000126 | |||
| 1933 | Ga0496116_0002028 | |||
| 1934 | Ga0496116_0010805 | |||
| 1935 | Ga0496116_0053813 | |||
| 1936 | Ga0496116_0058892 | |||
| 1937 | Ga0496117_0003126 | |||
| 1938 | Ga0496117_0006498 | |||
| 1939 | Ga0496117_0023336 | |||
| 1940 | Ga0496117_0036924 | |||
| 1941 | Ga0496117_0040121 | |||
| 1942 | Ga0496117_0105075 | |||
| 1943 | Ga0496118_0001807 | |||
| 1944 | Ga0496118_0004616 | |||
| 1945 | Ga0496118_0013626 | |||
| 1946 | Ga0496118_0040470 | |||
| 1947 | Ga0496118_0041417 | |||
| 1948 | Ga0496118_0078499 | |||
| 1949 | Ga0496118_0099746 | |||
| 1950 | Ga0496119_0000112 | |||
| 1951 | Ga0496119_0059393 | |||
| 1952 | Ga0496120_0009793 | |||
| 1953 | Ga0496121_0000142 | |||
| 1954 | Ga0496121_0003009 | |||
| 1955 | Ga0496121_0003989 | |||
| 1956 | Ga0496121_0048899 | |||
| 1957 | Ga0496121_0131863 | |||
| 1958 | Ga0496121_0152333 | |||
| 1959 | Ga0496122_0000122 | |||
| 1960 | Ga0496122_0018867 | |||
| 1961 | Ga0496122_0019568 | |||
| 1962 | Ga0496122_0023279 | |||
| 1963 | Ga0496122_0047710 | |||
| 1964 | Ga0496122_0050923 | |||
| 1965 | Ga0496122_0074368 | |||
| 1966 | Ga0496122_0204774 | |||
| 1967 | Ga0496123_0000391 | |||
| 1968 | Ga0496123_0001340 | |||
| 1969 | Ga0496123_0022720 | |||
| 1970 | Ga0496123_0039683 | |||
| 1971 | Ga0496123_0042255 | |||
| 1972 | Ga0496123_0049954 | |||
| 1973 | Ga0496123_0089571 | |||
| 1974 | Ga0496124_0000222 | |||
| 1975 | Ga0496124_0027948 | |||
| 1976 | Ga0496124_0031437 | |||
| 1977 | Ga0496124_0042438 | |||
| 1978 | Ga0496124_0044384 | |||
| 1979 | Ga0496124_0049542 | |||
| 1980 | Ga0496124_0050720 | |||
| 1981 | Ga0496124_0089843 | |||
| 1982 | Ga0496124_0124989 | |||
| 1983 | Ga0496124_0158616 | |||
| 1984 | Ga0496124_0182132 | |||
| 1985 | Ga0496124_0329520 | |||
| 1986 | Ga0496124_0329531 | |||
| 1987 | Ga0496125_0039458 | |||
| 1988 | Ga0496125_0040148 | |||
| 1989 | Ga0496125_0043847 | |||
| 1990 | Ga0496125_0090275 | |||
| 1991 | Ga0496125_0092749 | |||
| 1992 | Ga0496125_0188204 | |||
| 1993 | Ga0496126_0085998 | |||
| 1994 | Ga0496126_0121779 | |||
| 1995 | Ga0495678_000031 | |||
| 1996 | Ga0495678_000039 | |||
| 1997 | Ga0495678_004719 | |||
| 1998 | Ga0495678_008542 | |||
| 1999 | Ga0495678_017480 | |||
| 2000 | Ga0495678_018063 | |||
| 2001 | Ga0495678_024412 | |||
| 2002 | Ga0495678_039396 | |||
| 2003 | Ga0495682_0000078 | |||
| 2004 | Ga0495682_0000860 | |||
| 2005 | Ga0495682_0004502 | |||
| 2006 | Ga0495682_0049418 | |||
| 2007 | Ga0501314_000374 | |||
| 2008 | Ga0501323_003470 | |||
| 2009 | Ga0501324_004059 | |||
| 2010 | Ga0501034_0000137 | |||
| 2011 | Ga0501037_0076117 | |||
| 2012 | Ga0501222_003868 | |||
| 2013 | Ga0501241_000766 | |||
| 2014 | Ga0501226_000017 | |||
| 2015 | nmdc:mga00v17_112753_c1 | |||
| 2016 | Ga0500618_007836 | |||
| 2017 | Ga0500659_0002202 | |||
| 2018 | Ga0500573_0022482 | |||
| 2019 | Ga0587068_001963 | |||
| 2020 | 2511254429 | |||
| 2021 | 2511267880 | |||
| 2022 | 2511274286 | |||
| 2023 | 2511276418 | |||
| 2024 | 2511291891 | |||
| 2025 | 2511294989 | |||
| 2026 | 2511304396 | |||
| 2027 | 2511312894 | |||
| 2028 | 2511319158 | |||
| 2029 | 2511329312 | |||
| 2030 | 2511333075 | |||
| 2031 | 2511341260 | |||
| 2032 | 2511341803 | |||
| 2033 | 2511350902 | |||
| 2034 | 2511354636 | |||
| 2035 | 2511364928 | |||
| 2036 | 2511366930 | |||
| 2037 | 2511375568 | |||
| 2038 | 2511412242 | |||
| 2039 | 2511823403 | |||
| 2040 | 2512328991 | |||
| 2041 | 2554817012 | |||
| 2042 | 2555244592 | |||
| 2043 | 2555668428 | |||
| 2044 | 2583790626 | |||
| 2045 | 2597856611 | |||
| 2046 | 2599330091 | |||
| 2047 | 2599355428 | |||
| 2048 | 2599360753 | |||
| 2049 | 2599367075 | |||
| 2050 | 2599373865 | |||
| 2051 | 2599380534 | |||
| 2052 | 2599386981 | |||
| 2053 | 2599392723 | |||
| 2054 | 2599404490 | |||
| 2055 | 2599462262 | |||
| 2056 | 2599466696 | |||
| 2057 | 2599483139 | |||
| 2058 | 2599490646 | |||
| 2059 | 2599505304 | |||
| 2060 | 2599615495 | |||
| 2061 | 2599772786 | |||
| 2062 | 2599805040 | |||
| 2063 | 2599889282 | |||
| 2064 | 2599896604 | |||
| 2065 | 2599931858 | |||
| 2066 | 2599945509 | |||
| 2067 | 2599956627 | |||
| 2068 | 2599962565 | |||
| 2069 | 2599968377 | |||
| 2070 | 2599974101 | |||
| 2071 | 2599979564 | |||
| 2072 | 2599985451 | |||
| 2073 | 2599991798 | |||
| 2074 | 2599996613 | |||
| 2075 | 2600002405 | |||
| 2076 | 2600006828 | |||
| 2077 | 2600013376 | |||
| 2078 | 2600020077 | |||
| 2079 | 2600026079 | |||
| 2080 | 2600031724 | |||
| 2081 | 2600036367 | |||
| 2082 | 2600043666 | |||
| 2083 | 2600049938 | |||
| 2084 | 2600053466 | |||
| 2085 | 2600061882 | |||
| 2086 | 2600067108 | |||
| 2087 | 2600070448 | |||
| 2088 | 2600080057 | |||
| 2089 | 2600214884 | |||
| 2090 | 2600361505 | |||
| 2091 | 2600363753 | |||
| 2092 | 2600442968 | |||
| 2093 | 2601625739 | |||
| 2094 | 2601774411 | |||
| 2095 | 2601799912 | |||
| 2096 | 2602009556 | |||
| 2097 | 2606074289 | |||
| 2098 | 2606127151 | |||
| 2099 | 2608379669 | |||
| 2100 | 2624479195 | |||
| 2101 | 2624493804 | |||
| 2102 | 2643845202 | |||
| 2103 | 2643873065 | |||
| 2104 | 2643951966 | |||
| 2105 | 2644024275 | |||
| 2106 | 2644187530 | |||
| 2107 | 2644283576 | |||
| 2108 | 2652548240 | |||
| 2109 | 2671090479 | |||
| 2110 | 2671098030 | |||
| 2111 | 2671127789 | |||
| 2112 | 2671768226 | |||
| 2113 | 2678262329 | |||
| 2114 | 2715751732 | |||
| 2115 | 2715759716 | |||
| 2116 | 2718633063 | |||
| 2117 | 2738691557 | |||
| 2118 | 2739198712 | |||
| 2119 | 2739256522 | |||
| 2120 | 2739267332 | |||
| 2121 | 2739314340 | |||
| 2122 | 2743736035 | |||
| 2123 | 2745008676 | |||
| 2124 | 2765585699 | |||
| 2125 | 2774121398 | |||
| 2126 | 2774136031 | |||
| 2127 | 2784260101 | |||
| 2128 | 2784315714 | |||
| 2129 | 2794596127 | |||
| 2130 | 2807406916 | |||
| 2131 | 2807455248 | |||
| 2132 | 2808856810 | |||
| 2133 | 2808904668 | |||
| 2134 | 2808924091 | |||
| 2135 | 2808929278 | |||
| 2136 | 2808936741 | |||
| 2137 | 2808941648 | |||
| 2138 | 2808946032 | |||
| 2139 | 2808951614 | |||
| 2140 | 2808957416 | |||
| 2141 | 2808965197 | |||
| 2142 | 2809000089 | |||
| 2143 | 2809216148 | |||
| 2144 | 2812368120 | |||
| 2145 | 2819654589 | |||
| 2146 | 2819703115 | |||
| 2147 | 2823424597 | |||
| 2148 | 2825653316 | |||
| 2149 | 2826585730 | |||
| 2150 | 2842818600 | |||
| 2151 | 2842832983 | |||
| 2152 | 2842848401 | |||
| 2153 | 2842853822 | |||
| 2154 | 2842858937 | |||
| 2155 | 2844668942 | |||
| 2156 | 2852658669 | |||
| 2157 | 2860340297 | |||
| 2158 | 2878031156 | |||
| 2159 | 2880232054 | |||
| 2160 | 2904522411 | |||
| 2161 | 2904551554 | |||
| 2162 | 2912967963 | |||
| 2163 | 2913038304 | |||
| 2164 | 2917072196 | |||
| 2165 | 2919064319 | |||
| 2166 | 2919159278 | |||
| 2167 | 2919386182 | |||
| 2168 | 2919462047 | |||
| 2169 | 2919481573 | |||
| 2170 | 2919491736 | |||
| 2171 | 2919504327 | |||
| 2172 | 2919700291 | |||
| 2173 | 2923155045 | |||
| 2174 | 2923522173 | |||
| 2175 | 2923587579 | |||
| 2176 | 2926065100 | |||
| 2177 | 2929145745 | |||
| 2178 | 2931370918 | |||
| 2179 | 2931399797 | |||
| 2180 | 2935354367 | |||
| 2181 | 2939637734 | |||
| 2182 | 2939652392 | |||
| 2183 | 2969305983 | |||
| 2184 | 2974292431 | |||
| 2185 | 2984290995 | |||
| 2186 | 2988733284 | |||
| 2187 | 2990198328 | |||
| 2188 | 2998141390 | |||
| 2189 | 3007400575 | |||
| 2190 | 3007420840 | |||
| 2191 | 3007512769 | |||
| 2192 | 3007616234 | |||
| 2193 | 3007620455 | |||
| 2194 | 3007723043 | |||
| 2195 | 3007808417 | |||
| 2196 | 3007855984 | |||
| 2197 | 3007863378 | |||
| 2198 | 3007867937 | |||
| 2199 | 3007875422 | |||
| 2200 | 637318790 | |||
| 2201 | 8015689267 | |||
| 2202 | 8019770980 | |||
| 2203 | 8019776946 | |||
| 2204 | 8029999360 | |||
| 2205 | 8034962582 | |||
| 2206 | 8052495666 | |||
| 2207 | 8054933232 | |||
| 2208 | 8055772383 | |||
| 2209 | 8055884057 | |||
| 2210 | 8056117432 | |||
| 2211 | 8056124782 | |||
| 2212 | 8056127431 | |||
| 2213 | 8056138570 | |||
| 2214 | 8056147531 | |||
| 2215 | 8056159378 | |||
| 2216 | 8056169670 | |||
| 2217 | 8056175779 | |||
| 2218 | 8056180228 | |||
| 2219 | 8056570052 | |||
| 2220 | 8057803727 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6in9-assembly1.cif.gz_A | crystal structure of mucb in complex with muca(peri) | 0.9317 | 24 | 315 |
| 6jau-assembly1.cif.gz_A | the complex structure of pseudomonas aeruginosa muca/mucb. | 0.9299 | 23 | 315 |
| 6in9-assembly1.cif.gz_A | crystal structure of mucb in complex with muca(peri) | 0.9251 | 24 | 315 |
| 6jau-assembly1.cif.gz_A | the complex structure of pseudomonas aeruginosa muca/mucb. | 0.9236 | 23 | 315 |
| 6in9-assembly2.cif.gz_B | crystal structure of mucb in complex with muca(peri) | 0.9172 | 23 | 315 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2p4bB02 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;MucB/RseB, C-terminal domain | 0.8916 | 212 | 312 | 3.30.200.100 |
| 2p4bB02 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;MucB/RseB, C-terminal domain | 0.8745 | 212 | 312 | 3.30.200.100 |
| 2v43A01 | Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX | 0.8146 | 24 | 187 | 2.50.20.10 |
| 2p4bB01 | Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX | 0.7997 | 28 | 180 | 2.50.20.10 |
| 2p4bB01 | Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX | 0.7536 | 28 | 180 | 2.50.20.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3M4ABD5-F1-model_v4 | MucB/RseB C-terminal domain-containing protein | 0.96 | 216 | 318 |
GO:0030288
GO:0032885 GO:0045152 |
| AF-V4QEU7-F1-model_v4 | Sigma factor AlgU regulatory protein MucB | 0.9477 | 30 | 314 |
GO:0030288
GO:0032885 GO:0045152 |
| AF-A0A2V0QCQ3-F1-model_v4 | Negative regulator of sigma E activity | 0.9354 | 128 | 318 |
GO:0030288
GO:0032885 GO:0045152 |
| AF-S6AMD7-F1-model_v4 | Sigma-22 factor regulatory protein MucB | 0.931 | 67 | 318 |
GO:0030288
GO:0032885 GO:0045152 |
| AF-A0A3M2ZNL8-F1-model_v4 | Sigma factor algU regulatory protein MucB | 0.9263 | 228 | 318 |
GO:0030288
GO:0032885 GO:0045152 |