F490249

General Info

Members Datasets Scaffolds Average Seq Length
1112 401 2225 114

Family's Representative Sequence

Representative Sequence 3300005330|Ga0070690_100006793|Ga0070690_1000067934
Length 131
Sequence MFRGCSGSSAASSKAGTVEGEMLKGHLDMIVLAALAPGPAHGYAVIEEIKRRSAGAFDLPEGTVYPVLHRLEQAGLLAGRWVTAESGRRRRVYELTRRGEHALAERRAVWEQFSDAIGSLFKGSRTGKRPA

Samples

Sample ID Description Type Environment
1 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
78 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
81 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
82 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
83 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
98 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
99 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
100 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
105 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
116 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
117 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
118 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
124 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
125 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
126 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
127 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
128 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
129 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
130 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
131 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
132 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
133 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
134 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
135 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
201 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
205 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
206 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
207 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
208 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
209 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
210 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
211 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
212 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
213 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
214 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
215 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
216 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
217 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
218 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
219 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
220 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
221 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
222 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
223 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
224 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
225 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
226 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
227 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
228 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
229 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
230 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
231 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
232 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
233 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
234 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
235 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
236 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
237 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
238 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
239 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
240 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
241 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
242 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
243 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
244 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
245 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
246 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
247 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
248 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
249 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
250 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
251 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
252 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
253 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
254 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
255 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
256 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
257 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
258 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
259 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
260 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
261 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
262 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
263 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
264 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
265 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
266 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
267 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
268 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
269 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
270 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
271 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
272 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
273 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
274 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
275 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
276 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
277 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
278 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
279 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
280 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
281 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
282 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
283 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
284 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
285 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
286 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
287 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
288 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
289 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
290 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
291 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
292 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
293 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
294 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
295 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
296 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
297 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
298 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
299 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
300 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
301 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
302 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
303 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
304 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
305 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
306 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
307 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
308 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
309 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
310 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
311 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
312 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
313 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
314 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
315 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
316 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
317 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
318 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
319 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
320 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
321 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
322 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
323 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
324 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
325 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
326 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
327 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
328 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
329 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
330 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
331 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
332 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
333 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
334 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
335 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
336 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
337 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
338 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
339 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
340 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
341 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
342 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
343 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
344 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
345 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
346 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
347 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
348 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
349 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
350 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
351 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
352 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
353 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
354 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
355 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
356 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
357 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
360 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
361 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
362 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
363 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
364 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
365 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
366 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
367 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
368 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
369 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
370 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
371 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
372 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
373 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
374 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
375 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
376 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
377 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
378 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
379 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
380 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
381 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
382 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
383 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
384 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
385 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
386 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
387 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
388 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
389 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
390 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
391 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
392 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
393 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
394 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
395 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
396 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
397 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
398 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
399 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
400 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
401 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.91
Metatranscriptomes 0
Isolates 0.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.24
Nodule 0.09
Rhizoplane 3.42
Rhizosphere 89.39
Stem 0
Stem Tuber 0
Unclassified 13.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_100006793 3300005330 Bacteria 6506
2 JGI25406J46586_10001887 3300003203 Bacteria 9857
3 JGI25406J46586_10002141 3300003203 Bacteria 9340
4 JGI25165J46597_1001461 3300003214 Bacteria 12328
5 rootL2_10337886 3300003322 Bacteria 1574
6 rootH1_10119389 3300003316 Bacteria 1899
7 rootH1_10119389 3300003323 Bacteria 2065
8 JGI25404J52841_10009099 3300003659 Bacteria 2124
9 JGI25404J52841_10011826 3300003659 Bacteria 1886
10 JGI25404J52841_10014874 3300003659 Bacteria 1689
11 JGI25404J52841_10042530 3300003659 Bacteria 961
12 JGI25404J52841_10062842 3300003659 Bacteria 778
13 Ga0065707_10337243 3300005295 Unclassified 939
14 Ga0065707_10362107 3300005295 Bacteria 902
15 Ga0070658_10008775 3300005327 Bacteria 8122
16 Ga0070658_10065970 3300005327 Bacteria 2956
17 Ga0070676_11258362 3300005328 Bacteria 564
18 Ga0070683_102259806 3300005329 Bacteria 522
19 Ga0070690_100037235 3300005330 Bacteria 3065
20 Ga0070690_100266916 3300005330 Bacteria 1216
21 Ga0068869_100008900 3300005334 Bacteria 6496
22 Ga0068869_100101268 3300005334 Bacteria 2179
23 Ga0068869_100128282 3300005334 Bacteria 1947
24 Ga0070666_10052682 3300005335 Bacteria 2743
25 Ga0070680_100109186 3300005336 Bacteria 2302
26 Ga0070682_100006243 3300005337 Bacteria 6683
27 Ga0070682_100007478 3300005337 Bacteria 6160
28 Ga0070682_100224286 3300005337 Bacteria 1340
29 Ga0070682_101009081 3300005337 Bacteria 691
30 Ga0068868_100000853 3300005338 Bacteria 20711
31 Ga0068868_100017752 3300005338 Bacteria 5306
32 Ga0068868_100151781 3300005338 Bacteria 1908
33 Ga0068868_100999549 3300005338 Unclassified 765
34 Ga0070660_101436337 3300005339 Unclassified 586
35 Ga0070689_100008651 3300005340 Bacteria 7182
36 Ga0070691_10006016 3300005341 Bacteria 5538
37 Ga0070687_100001795 3300005343 Bacteria 7745
38 Ga0070687_100287891 3300005343 Bacteria 1037
39 Ga0070687_100733991 3300005343 Unclassified 693
40 Ga0070661_100054891 3300005344 Bacteria 2918
41 Ga0070661_100083107 3300005344 Bacteria 2365
42 Ga0070692_10023702 3300005345 Bacteria 3010
43 Ga0070692_10063917 3300005345 Unclassified 1945
44 Ga0070668_100123626 3300005347 Bacteria 2071
45 Ga0070668_100305959 3300005347 Bacteria 1334
46 Ga0070669_100261232 3300005353 Bacteria 1382
47 Ga0070675_100147667 3300005354 Bacteria 2014
48 Ga0070675_100275148 3300005354 Bacteria 1478
49 Ga0070675_101318725 3300005354 Bacteria 665
50 Ga0070671_100031052 3300005355 Bacteria 4411
51 Ga0070671_100314005 3300005355 Bacteria 1335
52 Ga0070671_100696357 3300005355 Bacteria 881
53 Ga0070674_100024214 3300005356 Bacteria 3938
54 Ga0070673_100025183 3300005364 Bacteria 4375
55 Ga0070673_100158473 3300005364 Bacteria 1923
56 Ga0070673_100228022 3300005364 Bacteria 1615
57 Ga0070659_100415750 3300005366 Bacteria 1137
58 Ga0070667_100038036 3300005367 Bacteria 4035
59 Ga0070667_101143713 3300005367 Bacteria 728
60 Ga0070703_10013164 3300005406 Bacteria 2346
61 Ga0070709_10006034 3300005434 Bacteria 6589
62 Ga0070709_10139185 3300005434 Bacteria 1666
63 Ga0070709_10215323 3300005434 Bacteria 1367
64 Ga0070709_10372344 3300005434 Bacteria 1060
65 Ga0070709_10474812 3300005434 Unclassified 946
66 Ga0070709_10857604 3300005434 Bacteria 716
67 Ga0070709_11534251 3300005434 Bacteria 541
68 Ga0070714_100053923 3300005435 Bacteria 3434
69 Ga0070714_100480969 3300005435 Bacteria 1182
70 Ga0070714_101016101 3300005435 Unclassified 807
71 Ga0070713_100192057 3300005436 Bacteria 1840
72 Ga0070713_100200951 3300005436 Bacteria 1800
73 Ga0070713_100206442 3300005436 Bacteria 1777
74 Ga0070713_100404849 3300005436 Unclassified 1275
75 Ga0070713_100441825 3300005436 Bacteria 1220
76 Ga0070710_10002263 3300005437 Bacteria 9107
77 Ga0070710_10127382 3300005437 Bacteria 1548
78 Ga0070710_10318172 3300005437 Bacteria 1021
79 Ga0070710_11417406 3300005437 Bacteria 520
80 Ga0070701_10001219 3300005438 Bacteria 9430
81 Ga0070701_10066586 3300005438 Bacteria 1915
82 Ga0070701_10677319 3300005438 Bacteria 691
83 Ga0070701_10852898 3300005438 Bacteria 625
84 Ga0070711_100045309 3300005439 Bacteria 2991
85 Ga0070711_100063199 3300005439 Unclassified 2583
86 Ga0070711_100248677 3300005439 Bacteria 1393
87 Ga0070711_100352252 3300005439 Unclassified 1184
88 Ga0070705_100000960 3300005440 Bacteria 16145
89 Ga0070705_100001523 3300005440 Bacteria 12197
90 Ga0070705_100309830 3300005440 Bacteria 1135
91 Ga0070705_100392720 3300005440 Unclassified 1025
92 Ga0070700_100000945 3300005441 Bacteria 14327
93 Ga0070700_100019025 3300005441 Bacteria 3959
94 Ga0070700_100020384 3300005441 Bacteria 3840
95 Ga0070700_100032706 3300005441 Plasmid 3128
96 Ga0070694_100001002 3300005444 Bacteria 16039
97 Ga0070694_100005244 3300005444 Bacteria 7831
98 Ga0070694_100090475 3300005444 Unclassified 2146
99 Ga0070708_100005027 3300005445 Bacteria 10463
100 Ga0070708_100020786 3300005445 Bacteria 5541
101 Ga0070708_100022950 3300005445 Bacteria 5300
102 Ga0070708_100060473 3300005445 Bacteria 3381
103 Ga0070708_100269550 3300005445 Unclassified 1601
104 Ga0070708_100309158 3300005445 Bacteria 1489
105 Ga0070708_100447577 3300005445 Unclassified 1218
106 Ga0070708_100818024 3300005445 Unclassified 876
107 Ga0070663_100010877 3300005455 Bacteria 5685
108 Ga0070663_100076861 3300005455 Bacteria 2443
109 Ga0070678_100005458 3300005456 Bacteria 7353
110 Ga0070678_100048846 3300005456 Bacteria 3050
111 Ga0070678_101879995 3300005456 Unclassified 565
112 Ga0070681_10015034 3300005458 Bacteria 7699
113 Ga0070681_10323675 3300005458 Bacteria 1451
114 Ga0068867_100003791 3300005459 Bacteria 10636
115 Ga0068867_100007021 3300005459 Bacteria 7960
116 Ga0070706_100030300 3300005467 Bacteria 4985
117 Ga0070706_100032145 3300005467 Bacteria 4840
118 Ga0070706_100130503 3300005467 Bacteria 2345
119 Ga0070706_100351475 3300005467 Bacteria 1374
120 Ga0070706_100493436 3300005467 Unclassified 1139
121 Ga0070706_100609581 3300005467 Bacteria 1014
122 Ga0070706_100809968 3300005467 Bacteria 867
123 Ga0070707_100026395 3300005468 Bacteria 5514
124 Ga0070707_100060452 3300005468 Bacteria 3634
125 Ga0070707_100066915 3300005468 Bacteria 3454
126 Ga0070707_100225601 3300005468 Bacteria 1824
127 Ga0070707_100923278 3300005468 Unclassified 837
128 Ga0070698_100005789 3300005471 Bacteria 13520
129 Ga0070698_100311453 3300005471 Unclassified 1505
130 Ga0070698_101487427 3300005471 Unclassified 628
131 Ga0070699_100002182 3300005518 Bacteria 17711
132 Ga0070699_100013284 3300005518 Bacteria 7102
133 Ga0070699_100013440 3300005518 Bacteria 7051
134 Ga0070699_100363166 3300005518 Unclassified 1306
135 Ga0070699_100598728 3300005518 Bacteria 1005
136 Ga0070699_100751836 3300005518 Unclassified 892
137 Ga0070699_101016661 3300005518 Bacteria 760
138 Ga0070699_101701340 3300005518 Unclassified 578
139 Ga0070679_100010243 3300005530 Bacteria 8889
140 Ga0070679_100036676 3300005530 Bacteria 4866
141 Ga0070684_100106220 3300005535 Bacteria 2513
142 Ga0070697_100004145 3300005536 Bacteria 11108
143 Ga0070697_100045901 3300005536 Bacteria 3541
144 Ga0070697_100117038 3300005536 Bacteria 2226
145 Ga0070697_100120585 3300005536 Bacteria 2193
146 Ga0070697_100785615 3300005536 Bacteria 842
147 Ga0070697_100801901 3300005536 Bacteria 833
148 Ga0070697_102056523 3300005536 Bacteria 511
149 Ga0068853_100073762 3300005539 Bacteria 2976
150 Ga0068853_100135353 3300005539 Bacteria 2208
151 Ga0068853_100567437 3300005539 Bacteria 1076
152 Ga0068853_100614450 3300005539 Bacteria 1033
153 Ga0068853_101718673 3300005539 Bacteria 608
154 Ga0070672_100029329 3300005543 Bacteria 4125
155 Ga0070686_100004344 3300005544 Bacteria 7809
156 Ga0070686_100610914 3300005544 Bacteria 860
157 Ga0070686_100947623 3300005544 Bacteria 703
158 Ga0070695_100000890 3300005545 Bacteria 16129
159 Ga0070695_100004519 3300005545 Bacteria 8166
160 Ga0070695_100024704 3300005545 Plasmid 3704
161 Ga0070695_100183342 3300005545 Bacteria 1485
162 Ga0070695_101102087 3300005545 Bacteria 650
163 Ga0070696_100001274 3300005546 Bacteria 16398
164 Ga0070696_100003459 3300005546 Bacteria 10497
165 Ga0070696_100009740 3300005546 Bacteria 6430
166 Ga0070696_101319216 3300005546 Bacteria 613
167 Ga0070693_100000946 3300005547 Bacteria 12882
168 Ga0070665_100002432 3300005548 Bacteria 20525
169 Ga0070665_100274935 3300005548 Bacteria 1686
170 Ga0070704_100000720 3300005549 Bacteria 16145
171 Ga0070704_100003859 3300005549 Bacteria 8631
172 Ga0070704_100011646 3300005549 Bacteria 5400
173 Ga0070704_100241945 3300005549 Unclassified 1477
174 Ga0070704_100438018 3300005549 Bacteria 1123
175 Ga0070704_101111262 3300005549 Bacteria 718
176 Ga0070704_101932652 3300005549 Unclassified 547
177 Ga0068855_100028209 3300005563 Bacteria 6714
178 Ga0068855_100054434 3300005563 Bacteria 4703
179 Ga0068855_100121318 3300005563 Bacteria 2991
180 Ga0068855_100131470 3300005563 Bacteria 2858
181 Ga0068855_100577689 3300005563 Bacteria 1214
182 Ga0068855_100596404 3300005563 Bacteria 1192
183 Ga0070664_100756982 3300005564 Bacteria 907
184 Ga0068854_100071134 3300005578 Bacteria 2544
185 Ga0068856_100000020 3300005614 Bacteria 146775
186 Ga0068856_100012224 3300005614 Bacteria 8318
187 Ga0068856_100055813 3300005614 Bacteria 3898
188 Ga0068856_100070259 3300005614 Bacteria 3464
189 Ga0068856_101056637 3300005614 Bacteria 830
190 Ga0068856_101322335 3300005614 Bacteria 736
191 Ga0070702_100001934 3300005615 Bacteria 8711
192 Ga0070702_100222417 3300005615 Unclassified 1263
193 Ga0070702_100658126 3300005615 Bacteria 793
194 Ga0068852_100028004 3300005616 Bacteria 4604
195 Ga0068852_100117450 3300005616 Bacteria 2429
196 Ga0068852_100643525 3300005616 Bacteria 1067
197 Ga0068852_101313636 3300005616 Unclassified 745
198 Ga0068852_101592090 3300005616 Bacteria 676
199 Ga0068859_100017559 3300005617 Bacteria 7194
200 Ga0068859_100043295 3300005617 Bacteria 4525
201 Ga0068859_101135566 3300005617 Bacteria 860
202 Ga0068859_101304495 3300005617 Bacteria 800
203 Ga0068859_101756321 3300005617 Bacteria 685
204 Ga0068864_100064794 3300005618 Bacteria 3170
205 Ga0068864_100892939 3300005618 Bacteria 877
206 Ga0068866_10001108 3300005718 Bacteria 11846
207 Ga0068866_10004840 3300005718 Bacteria 5529
208 Ga0068866_10110234 3300005718 Bacteria 1534
209 Ga0068861_100001526 3300005719 Bacteria 14664
210 Ga0068861_100006520 3300005719 Bacteria 7960
211 Ga0068861_100066647 3300005719 Plasmid 2776
212 Ga0068851_10449770 3300005834 Bacteria 765
213 Ga0068870_10039714 3300005840 Bacteria 2436
214 Ga0068870_10109071 3300005840 Bacteria 1577
215 Ga0068863_100075486 3300005841 Bacteria 3189
216 Ga0068863_100280274 3300005841 Bacteria 1615
217 Ga0068863_100415487 3300005841 Bacteria 1317
218 Ga0068863_101666698 3300005841 Unclassified 647
219 Ga0068863_102064688 3300005841 Bacteria 580
220 Ga0068858_100013028 3300005842 Bacteria 7843
221 Ga0068858_100033717 3300005842 Bacteria 4749
222 Ga0068858_100078638 3300005842 Bacteria 3065
223 Ga0068858_100244227 3300005842 Bacteria 1704
224 Ga0068858_100273334 3300005842 Bacteria 1608
225 Ga0068858_100330542 3300005842 Bacteria 1458
226 Ga0068858_100356695 3300005842 Bacteria 1401
227 Ga0068858_102333631 3300005842 Bacteria 529
228 Ga0068860_100001387 3300005843 Bacteria 26293
229 Ga0068860_100009890 3300005843 Bacteria 9457
230 Ga0068860_100226002 3300005843 Bacteria 1818
231 Ga0068860_100387892 3300005843 Bacteria 1380
232 Ga0068860_100585683 3300005843 Bacteria 1120
233 Ga0068860_100934314 3300005843 Bacteria 884
234 Ga0068860_101110956 3300005843 Bacteria 810
235 Ga0068860_101169655 3300005843 Unclassified 789
236 Ga0068862_100004521 3300005844 Bacteria 11724
237 Ga0068862_100010396 3300005844 Bacteria 7682
238 Ga0068862_100010541 3300005844 Bacteria 7638
239 Ga0068862_101050295 3300005844 Bacteria 808
240 Ga0081455_10021818 3300005937 Bacteria 5998
241 Ga0081455_10133795 3300005937 Bacteria 1935
242 Ga0081540_1000017 3300005983 Bacteria 164991
243 Ga0081540_1009476 3300005983 Bacteria 6708
244 Ga0081540_1011827 3300005983 Bacteria 5799
245 Ga0081540_1020958 3300005983 Bacteria 3912
246 Ga0081540_1021473 3300005983 Bacteria 3842
247 Ga0081540_1071592 3300005983 Bacteria 1601
248 Ga0081540_1073374 3300005983 Bacteria 1572
249 Ga0081540_1129558 3300005983 Unclassified 1032
250 Ga0081540_1159051 3300005983 Bacteria 879
251 Ga0081539_10000148 3300005985 Bacteria 163442
252 Ga0081539_10005052 3300005985 Bacteria 13859
253 Ga0070717_10034975 3300006028 Bacteria 4064
254 Ga0070717_10169520 3300006028 Unclassified 1898
255 Ga0070717_10249781 3300006028 Bacteria 1567
256 Ga0070717_10287754 3300006028 Bacteria 1458
257 Ga0070717_10391990 3300006028 Bacteria 1246
258 Ga0070717_10891208 3300006028 Bacteria 810
259 Ga0070717_10950078 3300006028 Bacteria 783
260 Ga0075365_10049991 3300006038 Bacteria 2757
261 Ga0070715_10008466 3300006163 Bacteria 3586
262 Ga0070715_10040363 3300006163 Bacteria 1951
263 Ga0070715_10164582 3300006163 Unclassified 1099
264 Ga0070715_10813703 3300006163 Bacteria 568
265 Ga0070716_100003406 3300006173 Bacteria 7480
266 Ga0070716_100184666 3300006173 Bacteria 1372
267 Ga0070716_100215972 3300006173 Bacteria 1285
268 Ga0070716_100551929 3300006173 Bacteria 859
269 Ga0070712_100004944 3300006175 Bacteria 8242
270 Ga0070712_100017122 3300006175 Bacteria 4687
271 Ga0070712_100123103 3300006175 Bacteria 1955
272 Ga0070712_100183279 3300006175 Bacteria 1633
273 Ga0070712_100281080 3300006175 Bacteria 1341
274 Ga0070712_100493004 3300006175 Bacteria 1026
275 Ga0070712_100840129 3300006175 Bacteria 789
276 Ga0070712_101214771 3300006175 Bacteria 656
277 Ga0075367_10265892 3300006178 Unclassified 1077
278 Ga0075366_10232724 3300006195 Bacteria 1123
279 Ga0097621_100002687 3300006237 Bacteria 12170
280 Ga0097621_100317024 3300006237 Unclassified 1380
281 Ga0097621_100329779 3300006237 Unclassified 1353
282 Ga0097621_101460842 3300006237 Bacteria 648
283 Ga0068871_100002733 3300006358 Bacteria 12044
284 Ga0068871_100044285 3300006358 Bacteria 3578
285 Ga0068871_100284242 3300006358 Bacteria 1448
286 Ga0068871_100480043 3300006358 Bacteria 1118
287 Ga0075428_100010654 3300006844 Bacteria 10217
288 Ga0075428_100042342 3300006844 Bacteria 5006
289 Ga0075428_100058774 3300006844 Unclassified 4210
290 Ga0075428_100108601 3300006844 Bacteria 3024
291 Ga0075428_100289018 3300006844 Bacteria 1764
292 Ga0075428_100350033 3300006844 Bacteria 1586
293 Ga0075428_100541315 3300006844 Bacteria 1245
294 Ga0075430_100305390 3300006846 Bacteria 1316
295 Ga0075430_100415757 3300006846 Bacteria 1110
296 Ga0075430_101177864 3300006846 Bacteria 631
297 Ga0075431_100062961 3300006847 Unclassified 3828
298 Ga0075431_101081392 3300006847 Unclassified 767
299 Ga0075431_101460673 3300006847 Bacteria 643
300 Ga0075433_10004987 3300006852 Bacteria 10399
301 Ga0075433_10014343 3300006852 Bacteria 6472
302 Ga0075433_10047645 3300006852 Bacteria 3728
303 Ga0075433_10071176 3300006852 Bacteria 3057
304 Ga0075433_10147391 3300006852 Bacteria 2092
305 Ga0075433_10149824 3300006852 Bacteria 2075
306 Ga0075433_10167488 3300006852 Bacteria 1955
307 Ga0075433_10234482 3300006852 Bacteria 1629
308 Ga0075433_10733792 3300006852 Bacteria 864
309 Ga0075433_11324418 3300006852 Bacteria 624
310 Ga0075433_11560393 3300006852 Unclassified 570
311 Ga0075434_100006965 3300006871 Bacteria 10420
312 Ga0075434_100037472 3300006871 Bacteria 4800
313 Ga0075434_100071430 3300006871 Bacteria 3463
314 Ga0075434_100143514 3300006871 Bacteria 2408
315 Ga0075434_100187310 3300006871 Bacteria 2090
316 Ga0075434_100669454 3300006871 Bacteria 1056
317 Ga0075434_100973940 3300006871 Bacteria 862
318 Ga0075434_101026835 3300006871 Bacteria 838
319 Ga0075434_102645525 3300006871 Unclassified 502
320 Ga0075429_100603658 3300006880 Bacteria 962
321 Ga0075429_100972753 3300006880 Unclassified 742
322 Ga0075429_101282315 3300006880 Unclassified 639
323 Ga0068865_100000371 3300006881 Bacteria 24845
324 Ga0068865_100008081 3300006881 Bacteria 6496
325 Ga0068865_100151686 3300006881 Unclassified 1759
326 Ga0068865_100168002 3300006881 Bacteria 1679
327 Ga0068865_100218792 3300006881 Bacteria 1488
328 Ga0075436_100005846 3300006914 Bacteria 8450
329 Ga0075436_100008120 3300006914 Bacteria 7184
330 Ga0075436_100010094 3300006914 Bacteria 6462
331 Ga0075436_100041242 3300006914 Unclassified 3184
332 Ga0075436_100075904 3300006914 Unclassified 2327
333 Ga0097620_100017557 3300006931 Bacteria 7194
334 Ga0097620_100043295 3300006931 Bacteria 4525
335 Ga0097620_101135569 3300006931 Bacteria 860
336 Ga0097620_101304348 3300006931 Bacteria 800
337 Ga0097620_101756391 3300006931 Bacteria 685
338 Ga0075435_100027248 3300007076 Bacteria 4467
339 Ga0075435_100029211 3300007076 Bacteria 4326
340 Ga0075435_100054133 3300007076 Bacteria 3238
341 Ga0075435_100168011 3300007076 Bacteria 1850
342 Ga0075435_100206560 3300007076 Bacteria 1665
343 Ga0075435_100290638 3300007076 Unclassified 1396
344 Ga0075435_100401480 3300007076 Bacteria 1179
345 Ga0099794_10004947 3300007265 Bacteria 5300
346 Ga0099794_10018666 3300007265 Bacteria 3113
347 Ga0099794_10035612 3300007265 Bacteria 2350
348 Ga0099795_10036701 3300007788 Bacteria 1721
349 Ga0099795_10085580 3300007788 Bacteria 1213
350 Ga0099795_10299634 3300007788 Unclassified 707
351 Ga0099795_10320368 3300007788 Bacteria 686
352 Ga0105250_10537743 3300009092 Bacteria 534
353 Ga0105240_10070557 3300009093 Bacteria 4322
354 Ga0105240_10189264 3300009093 Bacteria 2421
355 Ga0105240_10206245 3300009093 Unclassified 2300
356 Ga0111539_10006252 3300009094 Bacteria 15372
357 Ga0111539_10022576 3300009094 Bacteria 7731
358 Ga0111539_10096841 3300009094 Bacteria 3466
359 Ga0111539_10131862 3300009094 Plasmid 2926
360 Ga0111539_10198331 3300009094 Bacteria 2341
361 Ga0111539_10345482 3300009094 Bacteria 1732
362 Ga0111539_11187959 3300009094 Unclassified 886
363 Ga0111539_11247466 3300009094 Bacteria 863
364 Ga0111539_11518513 3300009094 Bacteria 777
365 Ga0105245_10005407 3300009098 Bacteria 11223
366 Ga0105245_10011676 3300009098 Bacteria 7644
367 Ga0105245_10109446 3300009098 Bacteria 2568
368 Ga0105245_10605776 3300009098 Unclassified 1122
369 Ga0105245_11422877 3300009098 Bacteria 743
370 Ga0105245_11960299 3300009098 Bacteria 639
371 Ga0105247_10130168 3300009101 Bacteria 1639
372 Ga0105247_10204377 3300009101 Bacteria 1329
373 Ga0105247_11025531 3300009101 Bacteria 646
374 Ga0114129_10060720 3300009147 Bacteria 5285
375 Ga0114129_10128548 3300009147 Bacteria 3482
376 Ga0114129_10198715 3300009147 Bacteria 2717
377 Ga0114129_10267568 3300009147 Unclassified 2288
378 Ga0114129_10807745 3300009147 Bacteria 1196
379 Ga0114129_10858410 3300009147 Bacteria 1153
380 Ga0114129_10863105 3300009147 Unclassified 1150
381 Ga0114129_10895500 3300009147 Bacteria 1125
382 Ga0114129_11076774 3300009147 Bacteria 1008
383 Ga0114129_11382258 3300009147 Bacteria 869
384 Ga0114129_11731272 3300009147 Bacteria 762
385 Ga0114129_11955472 3300009147 Bacteria 710
386 Ga0114129_13038139 3300009147 Unclassified 550
387 Ga0105243_10005316 3300009148 Bacteria 10064
388 Ga0105243_10179725 3300009148 Bacteria 1839
389 Ga0105243_10356522 3300009148 Unclassified 1345
390 Ga0105243_10402402 3300009148 Bacteria 1272
391 Ga0105243_12612438 3300009148 Unclassified 545
392 Ga0105241_10270256 3300009174 Bacteria 1448
393 Ga0105241_10272895 3300009174 Bacteria 1441
394 Ga0105241_10389328 3300009174 Bacteria 1220
395 Ga0105241_11033009 3300009174 Bacteria 771
396 Ga0105242_10009845 3300009176 Bacteria 7324
397 Ga0105242_10033092 3300009176 Bacteria 4138
398 Ga0105242_10113300 3300009176 Bacteria 2316
399 Ga0105242_10386044 3300009176 Unclassified 1303
400 Ga0105242_10580299 3300009176 Unclassified 1080
401 Ga0105242_10850575 3300009176 Bacteria 908
402 Ga0105248_10101134 3300009177 Bacteria 3249
403 Ga0105248_10103771 3300009177 Bacteria 3205
404 Ga0105248_10522818 3300009177 Bacteria 1338
405 Ga0105248_11227272 3300009177 Bacteria 848
406 Ga0105237_10000370 3300009545 Bacteria 63860
407 Ga0105237_10562319 3300009545 Bacteria 1147
408 Ga0105238_10110466 3300009551 Bacteria 2730
409 Ga0105238_10130080 3300009551 Bacteria 2496
410 Ga0105238_10212606 3300009551 Bacteria 1910
411 Ga0105238_10312834 3300009551 Bacteria 1556
412 Ga0105238_10656570 3300009551 Bacteria 1059
413 Ga0105249_10002322 3300009553 Bacteria 16512
414 Ga0105249_10009839 3300009553 Bacteria 8380
415 Ga0105249_10117484 3300009553 Unclassified 2523
416 Ga0105249_10337108 3300009553 Bacteria 1524
417 Ga0105249_11490663 3300009553 Bacteria 749
418 Ga0105249_11845687 3300009553 Bacteria 677
419 Ga0099796_10009747 3300010159 Bacteria 2612
420 Ga0099796_10116515 3300010159 Unclassified 1022
421 Ga0105239_10000387 3300010375 Bacteria 64448
422 Ga0105239_10049013 3300010375 Plasmid 4631
423 Ga0105239_10158168 3300010375 Bacteria 2531
424 Ga0105239_10433796 3300010375 Bacteria 1489
425 Ga0105239_11644679 3300010375 Bacteria 743
426 Ga0105239_12917764 3300010375 Unclassified 558
427 Ga0105239_13012033 3300010375 Bacteria 549
428 Ga0105246_10014526 3300011119 Bacteria 4953
429 Ga0105246_10045631 3300011119 Bacteria 2985
430 Ga0105246_10156093 3300011119 Bacteria 1733
431 Ga0105246_11135735 3300011119 Bacteria 715
432 Ga0157345_1037443 3300012498 Bacteria 570
433 Ga0157370_10036754 3300013104 Bacteria 4751
434 Ga0157369_10064445 3300013105 Bacteria 3947
435 Ga0157369_11017376 3300013105 Bacteria 848
436 Ga0157374_10034640 3300013296 Bacteria 4614
437 Ga0157374_10530678 3300013296 Bacteria 1183
438 Ga0157374_10858082 3300013296 Bacteria 925
439 Ga0157374_12697543 3300013296 Bacteria 525
440 Ga0157378_10006479 3300013297 Bacteria 10236
441 Ga0157378_10083229 3300013297 Bacteria 2895
442 Ga0157378_10121706 3300013297 Bacteria 2406
443 Ga0157378_10720358 3300013297 Bacteria 1018
444 Ga0157378_11823961 3300013297 Unclassified 656
445 Ga0163162_10000948 3300013306 Bacteria 26987
446 Ga0163162_10158225 3300013306 Bacteria 2386
447 Ga0163162_10733973 3300013306 Bacteria 1108
448 Ga0163162_11018690 3300013306 Bacteria 936
449 Ga0163162_11400539 3300013306 Bacteria 795
450 Ga0163162_11421969 3300013306 Bacteria 789
451 Ga0163162_11694865 3300013306 Bacteria 722
452 Ga0163162_12320121 3300013306 Bacteria 617
453 Ga0157372_10228286 3300013307 Bacteria 2158
454 Ga0157372_10228669 3300013307 Bacteria 2156
455 Ga0157375_10018315 3300013308 Bacteria 6349
456 Ga0157375_11397341 3300013308 Bacteria 824
457 Ga0157375_11578399 3300013308 Bacteria 776
458 Ga0163163_10152513 3300014325 Bacteria 2354
459 Ga0157380_10060349 3300014326 Bacteria 3030
460 Ga0157380_10265179 3300014326 Bacteria 1562
461 Ga0157380_10604096 3300014326 Bacteria 1086
462 Ga0157380_12049418 3300014326 Unclassified 634
463 Ga0182008_10048549 3300014497 Unclassified 2108
464 Ga0157377_10059726 3300014745 Bacteria 2174
465 Ga0157377_11188649 3300014745 Bacteria 590
466 Ga0157379_10360144 3300014968 Bacteria 1333
467 Ga0157379_10367250 3300014968 Bacteria 1319
468 Ga0157379_10550206 3300014968 Bacteria 1074
469 Ga0157376_10069404 3300014969 Bacteria 2988
470 Ga0157376_10343531 3300014969 Bacteria 1426
471 Ga0157376_11105150 3300014969 Bacteria 819
472 Ga0163161_10640394 3300017792 Bacteria 880
473 Ga0213874_10067976 3300021377 Bacteria 1130
474 Ga0213876_10106075 3300021384 Bacteria 1491
475 Ga0213876_10196532 3300021384 Bacteria 1072
476 Ga0213876_10234643 3300021384 Bacteria 975
477 Ga0207427_105635 3300025231 Bacteria 1727
478 Ga0209233_1000289 3300025261 Bacteria 65502
479 Ga0207697_10259461 3300025315 Bacteria 769
480 Ga0207656_10363541 3300025321 Bacteria 724
481 Ga0207653_10024692 3300025885 Unclassified 1919
482 Ga0207653_10215145 3300025885 Bacteria 728
483 Ga0207692_10003361 3300025898 Bacteria 6241
484 Ga0207692_10724648 3300025898 Bacteria 647
485 Ga0207692_11066379 3300025898 Unclassified 535
486 Ga0207642_10004578 3300025899 Bacteria 4467
487 Ga0207710_10031604 3300025900 Bacteria 2316
488 Ga0207710_10367871 3300025900 Bacteria 734
489 Ga0207688_10089197 3300025901 Bacteria 1769
490 Ga0207688_10105024 3300025901 Bacteria 1635
491 Ga0207680_10078010 3300025903 Bacteria 2073
492 Ga0207680_10182767 3300025903 Bacteria 1419
493 Ga0207647_10083996 3300025904 Bacteria 1906
494 Ga0207647_10630701 3300025904 Unclassified 589
495 Ga0207685_10008537 3300025905 Bacteria 2924
496 Ga0207685_10569308 3300025905 Unclassified 604
497 Ga0207699_10000908 3300025906 Bacteria 14147
498 Ga0207699_10027605 3300025906 Bacteria 3145
499 Ga0207699_10445512 3300025906 Bacteria 928
500 Ga0207699_10481820 3300025906 Bacteria 893
501 Ga0207699_10806144 3300025906 Bacteria 690
502 Ga0207645_10893714 3300025907 Bacteria 603
503 Ga0207643_10024968 3300025908 Bacteria 3300
504 Ga0207705_10035556 3300025909 Bacteria 3564
505 Ga0207705_10107107 3300025909 Bacteria 2062
506 Ga0207684_10015285 3300025910 Bacteria 6611
507 Ga0207684_10077079 3300025910 Bacteria 2834
508 Ga0207684_10081582 3300025910 Bacteria 2752
509 Ga0207684_10117239 3300025910 Bacteria 2281
510 Ga0207684_10287467 3300025910 Bacteria 1418
511 Ga0207654_10008924 3300025911 Bacteria 5085
512 Ga0207654_10097947 3300025911 Bacteria 1801
513 Ga0207654_10259608 3300025911 Bacteria 1167
514 Ga0207707_10002162 3300025912 Bacteria 17780
515 Ga0207707_10203319 3300025912 Bacteria 1727
516 Ga0207695_10053693 3300025913 Unclassified 4213
517 Ga0207695_10397456 3300025913 Bacteria 1263
518 Ga0207695_10940351 3300025913 Bacteria 744
519 Ga0207671_10002221 3300025914 Bacteria 21054
520 Ga0207671_10725603 3300025914 Bacteria 790
521 Ga0207693_10009032 3300025915 Bacteria 8134
522 Ga0207693_10121695 3300025915 Bacteria 2050
523 Ga0207693_10169648 3300025915 Bacteria 1718
524 Ga0207693_10263699 3300025915 Bacteria 1350
525 Ga0207693_10271747 3300025915 Bacteria 1328
526 Ga0207693_10541341 3300025915 Bacteria 908
527 Ga0207693_10725242 3300025915 Unclassified 769
528 Ga0207693_11335533 3300025915 Bacteria 535
529 Ga0207663_10009558 3300025916 Bacteria 5129
530 Ga0207663_10048740 3300025916 Bacteria 2624
531 Ga0207663_10132212 3300025916 Bacteria 1726
532 Ga0207663_10325704 3300025916 Bacteria 1156
533 Ga0207663_10384219 3300025916 Unclassified 1070
534 Ga0207663_11405935 3300025916 Bacteria 562
535 Ga0207660_10131642 3300025917 Bacteria 1904
536 Ga0207662_10014139 3300025918 Bacteria 4471
537 Ga0207662_10263782 3300025918 Bacteria 1135
538 Ga0207662_10732502 3300025918 Unclassified 694
539 Ga0207649_10208997 3300025920 Bacteria 1383
540 Ga0207652_10020892 3300025921 Bacteria 5398
541 Ga0207652_10140411 3300025921 Bacteria 2160
542 Ga0207652_10869712 3300025921 Bacteria 797
543 Ga0207646_10023805 3300025922 Bacteria 5620
544 Ga0207646_10041136 3300025922 Bacteria 4156
545 Ga0207646_10117172 3300025922 Bacteria 2392
546 Ga0207646_10319287 3300025922 Unclassified 1403
547 Ga0207681_10086528 3300025923 Bacteria 2227
548 Ga0207694_10084844 3300025924 Bacteria 2492
549 Ga0207694_10264218 3300025924 Bacteria 1410
550 Ga0207694_10440968 3300025924 Bacteria 1086
551 Ga0207659_10076817 3300025926 Bacteria 2456
552 Ga0207659_10171874 3300025926 Bacteria 1710
553 Ga0207687_10007167 3300025927 Bacteria 7351
554 Ga0207687_10135654 3300025927 Bacteria 1861
555 Ga0207687_10890742 3300025927 Bacteria 761
556 Ga0207687_11442994 3300025927 Bacteria 591
557 Ga0207700_10133198 3300025928 Bacteria 2032
558 Ga0207700_10163381 3300025928 Bacteria 1851
559 Ga0207700_10637935 3300025928 Bacteria 949
560 Ga0207700_10923038 3300025928 Bacteria 781
561 Ga0207700_11890415 3300025928 Bacteria 523
562 Ga0207664_10026668 3300025929 Bacteria 4369
563 Ga0207664_11208086 3300025929 Bacteria 674
564 Ga0207644_10287697 3300025931 Bacteria 1321
565 Ga0207690_10202396 3300025932 Bacteria 1509
566 Ga0207706_10132174 3300025933 Bacteria 2195
567 Ga0207706_10716009 3300025933 Bacteria 854
568 Ga0207686_10002819 3300025934 Bacteria 9389
569 Ga0207686_10039885 3300025934 Bacteria 2851
570 Ga0207686_10915891 3300025934 Unclassified 708
571 Ga0207709_10004575 3300025935 Bacteria 7963
572 Ga0207709_10055241 3300025935 Bacteria 2452
573 Ga0207709_10463207 3300025935 Unclassified 982
574 Ga0207709_10634316 3300025935 Bacteria 849
575 Ga0207670_10030440 3300025936 Bacteria 3448
576 Ga0207669_10135675 3300025937 Bacteria 1699
577 Ga0207704_10017858 3300025938 Bacteria 3689
578 Ga0207704_10122918 3300025938 Bacteria 1781
579 Ga0207704_10392491 3300025938 Unclassified 1093
580 Ga0207704_10522481 3300025938 Bacteria 960
581 Ga0207665_10002149 3300025939 Bacteria 13344
582 Ga0207665_10042315 3300025939 Bacteria 3045
583 Ga0207665_10334746 3300025939 Bacteria 1139
584 Ga0207665_11627082 3300025939 Bacteria 512
585 Ga0207691_10045164 3300025940 Bacteria 4051
586 Ga0207711_10103806 3300025941 Bacteria 2517
587 Ga0207711_10285480 3300025941 Bacteria 1520
588 Ga0207711_10393101 3300025941 Bacteria 1288
589 Ga0207711_10628313 3300025941 Bacteria 1002
590 Ga0207689_10003642 3300025942 Bacteria 14069
591 Ga0207689_10104783 3300025942 Bacteria 2324
592 Ga0207689_10106083 3300025942 Bacteria 2308
593 Ga0207689_10245901 3300025942 Bacteria 1479
594 Ga0207679_10907129 3300025945 Bacteria 806
595 Ga0207667_10049586 3300025949 Bacteria 4433
596 Ga0207667_10103644 3300025949 Bacteria 2934
597 Ga0207667_11238471 3300025949 Bacteria 724
598 Ga0207651_10010022 3300025960 Bacteria 5226
599 Ga0207651_11249022 3300025960 Bacteria 667
600 Ga0207712_10004995 3300025961 Bacteria 8389
601 Ga0207712_10076205 3300025961 Bacteria 2427
602 Ga0207712_10631499 3300025961 Bacteria 929
603 Ga0207712_10694098 3300025961 Bacteria 888
604 Ga0207712_11214861 3300025961 Bacteria 673
605 Ga0207712_11949034 3300025961 Unclassified 526
606 Ga0207668_10125315 3300025972 Bacteria 1952
607 Ga0207668_10552359 3300025972 Unclassified 998
608 Ga0207640_10009095 3300025981 Bacteria 5547
609 Ga0207640_10383925 3300025981 Bacteria 1139
610 Ga0207658_10116726 3300025986 Bacteria 2120
611 Ga0207658_10897069 3300025986 Bacteria 807
612 Ga0207677_10003788 3300026023 Bacteria 8034
613 Ga0207677_10012673 3300026023 Bacteria 4857
614 Ga0207677_10175028 3300026023 Bacteria 1682
615 Ga0207677_11645827 3300026023 Bacteria 595
616 Ga0207703_10022563 3300026035 Bacteria 4938
617 Ga0207703_10026073 3300026035 Bacteria 4599
618 Ga0207703_10317685 3300026035 Bacteria 1425
619 Ga0207703_10569163 3300026035 Bacteria 1070
620 Ga0207703_10786014 3300026035 Bacteria 908
621 Ga0207639_10311002 3300026041 Bacteria 1395
622 Ga0207639_10345845 3300026041 Bacteria 1327
623 Ga0207639_10574035 3300026041 Bacteria 1038
624 Ga0207639_11096127 3300026041 Bacteria 747
625 Ga0207678_10050255 3300026067 Bacteria 3603
626 Ga0207708_10002595 3300026075 Bacteria 13302
627 Ga0207708_10003135 3300026075 Bacteria 12170
628 Ga0207708_10053564 3300026075 Plasmid 3074
629 Ga0207708_10148501 3300026075 Bacteria 1843
630 Ga0207708_11175908 3300026075 Bacteria 670
631 Ga0207708_11707529 3300026075 Unclassified 553
632 Ga0207702_10002142 3300026078 Bacteria 18978
633 Ga0207702_10023268 3300026078 Bacteria 5137
634 Ga0207702_10212266 3300026078 Bacteria 1800
635 Ga0207702_10625534 3300026078 Bacteria 1058
636 Ga0207702_10722596 3300026078 Bacteria 982
637 Ga0207702_11088537 3300026078 Bacteria 793
638 Ga0207702_11378990 3300026078 Bacteria 699
639 Ga0207641_10048224 3300026088 Bacteria 3595
640 Ga0207641_10078020 3300026088 Bacteria 2868
641 Ga0207641_10147447 3300026088 Bacteria 2129
642 Ga0207641_10680953 3300026088 Bacteria 1012
643 Ga0207641_10754912 3300026088 Bacteria 960
644 Ga0207641_11935362 3300026088 Bacteria 591
645 Ga0207648_10000224 3300026089 Bacteria 60987
646 Ga0207648_10011597 3300026089 Bacteria 8298
647 Ga0207648_10799523 3300026089 Bacteria 878
648 Ga0207676_10025180 3300026095 Bacteria 4414
649 Ga0207676_11968686 3300026095 Bacteria 583
650 Ga0207675_100000173 3300026118 Bacteria 57923
651 Ga0207675_100015873 3300026118 Bacteria 7024
652 Ga0207675_100096920 3300026118 Plasmid 2777
653 Ga0207675_100604305 3300026118 Bacteria 1100
654 Ga0207683_10078207 3300026121 Bacteria 2931
655 Ga0207683_10196874 3300026121 Bacteria 1831
656 Ga0207683_10742914 3300026121 Unclassified 910
657 Ga0207698_10027036 3300026142 Bacteria 4068
658 Ga0207698_10180132 3300026142 Bacteria 1871
659 Ga0207698_10759403 3300026142 Bacteria 969
660 Ga0207698_10852009 3300026142 Bacteria 916
661 Ga0207698_11039727 3300026142 Bacteria 831
662 Ga0207698_11270277 3300026142 Unclassified 751
663 Ga0209179_1121226 3300027512 Bacteria 584
664 Ga0209588_1013946 3300027671 Bacteria 2456
665 Ga0209588_1168184 3300027671 Bacteria 690
666 Ga0207428_10156691 3300027907 Bacteria 1732
667 Ga0207428_10169366 3300027907 Bacteria 1655
668 Ga0207428_10255166 3300027907 Unclassified 1307
669 Ga0207428_10721163 3300027907 Unclassified 712
670 Ga0207428_11032674 3300027907 Unclassified 577
671 Ga0268266_10000242 3300028379 Bacteria 92333
672 Ga0268266_10278061 3300028379 Unclassified 1556
673 Ga0268265_10003582 3300028380 Bacteria 11094
674 Ga0268265_10008946 3300028380 Bacteria 6772
675 Ga0268265_10018603 3300028380 Bacteria 4818
676 Ga0268265_10376074 3300028380 Bacteria 1305
677 Ga0268264_10001267 3300028381 Bacteria 23987
678 Ga0268264_10002698 3300028381 Bacteria 15494
679 Ga0268264_10006722 3300028381 Bacteria 9667
680 Ga0268264_10105953 3300028381 Bacteria 2453
681 Ga0268264_10214156 3300028381 Bacteria 1770
682 Ga0268264_10508273 3300028381 Bacteria 1176
683 Ga0268264_10870013 3300028381 Bacteria 903
684 Ga0268264_11124172 3300028381 Bacteria 794
685 Ga0307517_10479375 3300028786 Unclassified 638
686 Ga0265338_10013390 3300028800 Bacteria 9265
687 Ga0265324_10053585 3300029957 Unclassified 1385
688 Ga0307511_10029041 3300030521 Bacteria 5004
689 Ga0265325_10051363 3300031241 Unclassified 2120
690 Ga0265329_10012508 3300031242 Bacteria 3047
691 Ga0265340_10346509 3300031247 Unclassified 656
692 Ga0265339_10000466 3300031249 Bacteria 31644
693 Ga0265331_10103575 3300031250 Unclassified 1308
694 Ga0307509_10168485 3300031507 Bacteria 2074
695 Ga0307509_10251575 3300031507 Bacteria 1550
696 Ga0307509_10834444 3300031507 Bacteria 586
697 Ga0265313_10000063 3300031595 Bacteria 104056
698 Ga0307508_10003178 3300031616 Bacteria 16796
699 Ga0307508_10132624 3300031616 Bacteria 2095
700 Ga0307508_10144936 3300031616 Bacteria 1979
701 Ga0307508_10159048 3300031616 Bacteria 1863
702 Ga0265342_10147739 3300031712 Unclassified 1307
703 Ga0307510_10097189 3300033180 Bacteria 2757
704 Ga0316215_1016829 3300033544 Bacteria 737
705 Ga0373930_0025124 3300034816 Bacteria 1194
706 Ga0373930_0124048 3300034816 Bacteria 631
707 Ga0373958_0010886 3300034819 Bacteria 1526
708 Ga0373938_0006459 3300034957 Bacteria 2027
709 Ga0373926_0004927 3300035083 Bacteria 4384
710 Ga0373926_0034192 3300035083 Unclassified 1798
711 Ga0373928_0188475 3300035084 Unclassified 589
712 Ga0373929_0262906 3300035085 Bacteria 504
713 Ga0373934_0008207 3300035086 Bacteria 3889
714 Ga0373940_0016583 3300035088 Bacteria 1826
715 Ga0373944_0055001 3300035089 Bacteria 1263
716 Ga0373949_0150434 3300035090 Bacteria 673
717 Ga0373951_0008184 3300035091 Bacteria 2368
718 Ga0373923_0172860 3300035111 Unclassified 990
719 Ga0373923_0249947 3300035111 Bacteria 830
720 Ga0373932_0002887 3300035112 Bacteria 4246
721 Ga0373932_0342496 3300035112 Bacteria 567
722 Ga0373936_0016010 3300035113 Bacteria 2878
723 Ga0373936_0054714 3300035113 Unclassified 1619
724 Ga0373939_0004800 3300035114 Bacteria 3204
725 Ga0373939_0294823 3300035114 Bacteria 645
726 Ga0373939_0386399 3300035114 Bacteria 577
727 Ga0373941_0482113 3300035115 Bacteria 525
728 Ga0373945_0052167 3300035116 Bacteria 1506
729 Ga0373945_0255354 3300035116 Bacteria 741
730 Ga0373953_0192473 3300035117 Unclassified 881
731 Ga0373953_0303853 3300035117 Bacteria 696
732 Ga0373954_0000989 3300035118 Bacteria 11211
733 Ga0373954_0013488 3300035118 Bacteria 3642
734 Ga0373954_0021762 3300035118 Bacteria 2904
735 Ga0373956_0059437 3300035119 Bacteria 1729
736 Ga0373956_0071356 3300035119 Bacteria 1585
737 Ga0373957_0023592 3300035120 Bacteria 2202
738 Ga0373960_0032538 3300035121 Bacteria 1465
739 Ga0373943_0047697 3300035170 Bacteria 2095
740 Ga0373943_0056818 3300035170 Bacteria 1943
741 Ga0373943_0097275 3300035170 Bacteria 1533
742 Ga0373946_0011226 3300035171 Bacteria 3336
743 Ga0373946_0170101 3300035171 Bacteria 1028
744 Ga0373955_0019007 3300035172 Bacteria 3427
745 Ga0373955_0030177 3300035172 Bacteria 2827
746 Ga0373955_0269499 3300035172 Bacteria 1023
747 Ga0373955_0665392 3300035172 Bacteria 639
748 Ga0373942_0076561 3300035207 Bacteria 986
749 Ga0373942_0121261 3300035207 Bacteria 817
750 Ga0373942_0161925 3300035207 Unclassified 724
751 Ga0373942_0283571 3300035207 Bacteria 571
752 Ga0373962_0002853 3300035242 Bacteria 4135
753 Ga0373962_0020937 3300035242 Bacteria 1722
754 Ga0373924_0034613 3300035410 Bacteria 2045
755 Ga0373924_0156817 3300035410 Unclassified 997
756 Ga0373931_0198727 3300035691 Bacteria 1196
757 Ga0373931_0217615 3300035691 Bacteria 1148
758 Ga0373931_0649673 3300035691 Unclassified 693
759 Ga0373935_0013747 3300035692 Bacteria 4887
760 Ga0373935_0041914 3300035692 Bacteria 2877
761 Ga0373935_0142231 3300035692 Bacteria 1622
762 Ga0373935_1205463 3300035692 Bacteria 564
763 Ga0373927_0027959 3300035695 Bacteria 3680
764 Ga0373927_0036402 3300035695 Bacteria 3201
765 Ga0373927_0043373 3300035695 Bacteria 2912
766 Ga0373927_0160871 3300035695 Bacteria 1471
767 Ga0373927_0444729 3300035695 Bacteria 856
768 Ga0373933_0001979 3300035724 Bacteria 11812
769 Ga0373933_0074040 3300035724 Unclassified 2076
770 Ga0373933_0138106 3300035724 Bacteria 1537
771 Ga0373933_0370808 3300035724 Bacteria 932
772 Ga0373947_0018523 3300035725 Bacteria 4008
773 Ga0373947_0023699 3300035725 Bacteria 3573
774 Ga0373947_0053494 3300035725 Bacteria 2435
775 Ga0373947_0658780 3300035725 Bacteria 714
776 Ga0373937_0003310 3300036401 Bacteria 13532
777 Ga0373937_0061922 3300036401 Bacteria 3439
778 Ga0373937_0166338 3300036401 Bacteria 2068
779 Ga0373937_0246582 3300036401 Bacteria 1683
780 Ga0373925_0010015 3300037068 Bacteria 6884
781 Ga0373925_0050127 3300037068 Bacteria 3113
782 Ga0373925_0072555 3300037068 Bacteria 2604
783 Ga0373925_0101498 3300037068 Bacteria 2212
784 Ga0373925_0959791 3300037068 Bacteria 704
785 Ga0436365_0189303 3300039437 Bacteria 3225
786 Ga0436365_0646644 3300039437 Bacteria 1816
787 Ga0436365_0688814 3300039437 Bacteria 2286
788 Ga0436365_0808037 3300039437 Bacteria 1971
789 Ga0436360_0563693 3300039438 Bacteria 1568
790 Ga0436361_0284160 3300039447 Bacteria 737
791 Ga0436363_0115460 3300039450 Bacteria 1849
792 Ga0436363_1017314 3300039450 Bacteria 518
793 Ga0436363_1338148 3300039450 Bacteria 577
794 Ga0436363_1507714 3300039450 Bacteria 2345
795 Ga0451845_0860828 3300041501 Bacteria 507
796 Ga0451853_1812974 3300041512 Bacteria 2386
797 Ga0451853_2293970 3300041512 Bacteria 1068
798 Ga0439441_011464 3300042001 Bacteria 1504
799 Ga0439443_013141 3300042003 Bacteria 1234
800 Ga0439435_0039704 3300042436 Bacteria 1312
801 Ga0466969_0065742 3300044656 Bacteria 1752
802 Ga0466965_0015772 3300044683 Bacteria 3591
803 Ga0466966_0050725 3300044684 Bacteria 2638
804 Ga0466961_0085615 3300044693 Bacteria 1992
805 Ga0466963_0036867 3300044694 Bacteria 3190
806 Ga0466963_0710610 3300044694 Bacteria 709
807 Ga0466963_1129484 3300044694 Bacteria 551
808 Ga0466964_0228445 3300044706 Bacteria 907
809 Ga0466971_0009264 3300044719 Bacteria 4301
810 Ga0466970_0044648 3300044765 Bacteria 2359
811 Ga0466957_0014580 3300044842 Bacteria 4578
812 Ga0466959_0000067 3300045049 Bacteria 73663
813 Ga0451576_0055286 3300045051 Bacteria 4153
814 Ga0451576_0086989 3300045051 Bacteria 3250
815 Ga0466958_0012896 3300045836 Bacteria 4745
816 Ga0466967_0333409 3300045976 Bacteria 1465
817 Ga0466967_0542778 3300045976 Bacteria 1144
818 Ga0466967_1582649 3300045976 Bacteria 653
819 Ga0495592_0003640 3300046454 Bacteria 11090
820 Ga0495592_0006910 3300046454 Bacteria 8477
821 Ga0495592_0009958 3300046454 Bacteria 7159
822 Ga0495603_0002708 3300046455 Bacteria 10442
823 Ga0495603_0010247 3300046455 Bacteria 5674
824 Ga0495603_0084698 3300046455 Bacteria 1856
825 Ga0495603_0697971 3300046455 Bacteria 580
826 Ga0495629_0018417 3300046459 Bacteria 4999
827 Ga0495629_0543270 3300046459 Unclassified 780
828 Ga0495629_0587238 3300046459 Bacteria 746
829 Ga0495629_0651029 3300046459 Bacteria 702
830 Ga0495651_0000963 3300046462 Bacteria 22308
831 Ga0495651_0387539 3300046462 Bacteria 915
832 Ga0495653_0001125 3300046463 Bacteria 20598
833 Ga0495653_0169592 3300046463 Bacteria 1508
834 Ga0495653_0268514 3300046463 Unclassified 1125
835 Ga0495580_0029456 3300046472 Bacteria 3984
836 Ga0495580_0043459 3300046472 Bacteria 3198
837 Ga0495580_0061759 3300046472 Bacteria 2630
838 Ga0495580_0380907 3300046472 Bacteria 953
839 Ga0495580_0468957 3300046472 Bacteria 843
840 Ga0495582_0078417 3300046473 Bacteria 1832
841 Ga0495582_0192425 3300046473 Bacteria 1164
842 Ga0495582_0247412 3300046473 Unclassified 1022
843 Ga0495582_0603067 3300046473 Bacteria 635
844 Ga0495582_0869836 3300046473 Bacteria 521
845 Ga0495639_0003042 3300046475 Bacteria 7301
846 Ga0495639_0105696 3300046475 Bacteria 1333
847 Ga0495639_0132506 3300046475 Bacteria 1194
848 Ga0495639_0137809 3300046475 Bacteria 1172
849 Ga0495664_0031222 3300046477 Bacteria 3122
850 Ga0495664_0233099 3300046477 Bacteria 1114
851 Ga0495664_0303240 3300046477 Bacteria 964
852 Ga0495584_0103594 3300046491 Bacteria 1439
853 Ga0495585_0057853 3300046492 Bacteria 2139
854 Ga0495594_0112199 3300046499 Bacteria 1537
855 Ga0495594_0266496 3300046499 Bacteria 976
856 Ga0495608_0001315 3300046511 Bacteria 17687
857 Ga0495608_0166440 3300046511 Bacteria 1400
858 Ga0495608_0498170 3300046511 Bacteria 738
859 Ga0495610_0089043 3300046512 Bacteria 1402
860 Ga0495616_0453354 3300046513 Bacteria 519
861 Ga0495628_0001543 3300046516 Bacteria 21073
862 Ga0495628_0063247 3300046516 Bacteria 2900
863 Ga0495628_0132842 3300046516 Bacteria 1903
864 Ga0495630_0057528 3300046517 Bacteria 2914
865 Ga0495630_0331817 3300046517 Bacteria 1163
866 Ga0495630_0344286 3300046517 Bacteria 1141
867 Ga0495644_0085015 3300046523 Unclassified 1193
868 Ga0495666_0043456 3300046526 Bacteria 2171
869 Ga0495652_0002500 3300046529 Bacteria 18861
870 Ga0495652_0003234 3300046529 Bacteria 16239
871 Ga0495652_0144356 3300046529 Bacteria 1868
872 Ga0495665_0123315 3300046531 Bacteria 1357
873 Ga0495665_0345357 3300046531 Unclassified 758
874 Ga0495640_0012357 3300046533 Bacteria 6527
875 Ga0495640_0031105 3300046533 Bacteria 3813
876 Ga0495586_0028588 3300046535 Bacteria 2983
877 Ga0495586_0420661 3300046535 Bacteria 769
878 Ga0495586_0631913 3300046535 Bacteria 618
879 Ga0495587_0000403 3300046536 Bacteria 30588
880 Ga0495587_0336627 3300046536 Bacteria 842
881 Ga0495598_0130292 3300046537 Bacteria 862
882 Ga0495609_0408837 3300046538 Bacteria 543
883 Ga0495621_0076088 3300046539 Bacteria 1245
884 Ga0495621_0153021 3300046539 Bacteria 908
885 Ga0495621_0216700 3300046539 Bacteria 774
886 Ga0495621_0544501 3300046539 Bacteria 504
887 Ga0495645_0002102 3300046543 Bacteria 13528
888 Ga0495645_0058807 3300046543 Bacteria 2788
889 Ga0495633_0382848 3300046558 Bacteria 636
890 Ga0495667_0000635 3300046559 Bacteria 22308
891 Ga0495667_0109849 3300046559 Bacteria 1782
892 Ga0495667_0213665 3300046559 Bacteria 1232
893 Ga0495656_0003820 3300046615 Bacteria 5120
894 Ga0495656_0064658 3300046615 Unclassified 1607
895 Ga0495656_0629820 3300046615 Unclassified 575
896 Ga0495634_0075018 3300046642 Bacteria 2222
897 Ga0495635_0001210 3300046663 Bacteria 17257
898 Ga0495635_0386101 3300046663 Unclassified 931
899 Ga0495659_0087809 3300046664 Bacteria 1190
900 Ga0495659_0230402 3300046664 Bacteria 767
901 Ga0495588_0300910 3300046674 Bacteria 844
902 Ga0495588_0451497 3300046674 Unclassified 674
903 Ga0495657_0004192 3300046675 Bacteria 11539
904 Ga0495657_0566565 3300046675 Unclassified 659
905 Ga0495599_0000506 3300046678 Bacteria 22253
906 Ga0495599_0001151 3300046678 Bacteria 14987
907 Ga0495599_0157116 3300046678 Bacteria 1407
908 Ga0495599_0429792 3300046678 Bacteria 784
909 Ga0495623_0006303 3300046679 Bacteria 7713
910 Ga0495623_0177283 3300046679 Bacteria 1241
911 Ga0495646_0181323 3300046680 Unclassified 1155
912 Ga0495647_0007643 3300046681 Bacteria 3629
913 Ga0495647_0094022 3300046681 Bacteria 1233
914 Ga0495658_0029636 3300046683 Bacteria 2965
915 Ga0495669_0303636 3300046684 Bacteria 770
916 Ga0495613_0107053 3300046689 Bacteria 2017
917 Ga0495613_0318189 3300046689 Unclassified 1074
918 Ga0495624_0039316 3300046690 Bacteria 3033
919 Ga0495624_0571811 3300046690 Bacteria 674
920 Ga0495624_0739111 3300046690 Bacteria 583
921 Ga0495589_0309082 3300046794 Bacteria 732
922 Ga0495600_0000221 3300046809 Bacteria 32170
923 Ga0495600_0092839 3300046809 Bacteria 1969
924 Ga0495581_0093252 3300047315 Bacteria 1748
925 Ga0495581_0408845 3300047315 Unclassified 791
926 Ga0495604_0004895 3300047317 Bacteria 10616
927 Ga0495604_0188186 3300047317 Bacteria 1440
928 Ga0495604_0590007 3300047317 Unclassified 713
929 Ga0495636_0094985 3300047318 Bacteria 1298
930 Ga0495636_0260983 3300047318 Bacteria 803
931 Ga0495636_0348353 3300047318 Unclassified 699
932 Ga0495674_0062853 3300047319 Bacteria 3231
933 Ga0495674_0886521 3300047319 Unclassified 689
934 Ga0495676_0105736 3300047321 Bacteria 2074
935 Ga0495676_0174948 3300047321 Bacteria 1508
936 Ga0495680_0002034 3300047322 Bacteria 21172
937 Ga0495680_0379043 3300047322 Bacteria 980
938 Ga0495680_1057474 3300047322 Bacteria 515
939 Ga0495675_0000445 3300047444 Bacteria 27423
940 Ga0495675_0577907 3300047444 Bacteria 639
941 Ga0495679_069628 3300047446 Bacteria 1016
942 Ga0495684_0002918 3300047471 Bacteria 13461
943 Ga0495684_0008094 3300047471 Bacteria 8129
944 Ga0495593_0031236 3300047673 Bacteria 2911
945 Ga0495593_0032812 3300047673 Bacteria 2829
946 Ga0495602_0000907 3300048088 Bacteria 28629
947 Ga0495602_0355528 3300048088 Bacteria 1056
948 Ga0495615_0123544 3300048090 Bacteria 751
949 Ga0495615_0305983 3300048090 Bacteria 516
950 Ga0496100_0004243 3300048903 Bacteria 7576
951 Ga0496100_1087277 3300048903 Bacteria 630
952 Ga0496100_1594161 3300048903 Bacteria 516
953 Ga0496101_0013036 3300048904 Bacteria 5562
954 Ga0496101_0608988 3300048904 Unclassified 863
955 Ga0496101_1528640 3300048904 Bacteria 519
956 Ga0496102_0002815 3300048905 Bacteria 14815
957 Ga0496102_0013493 3300048905 Bacteria 7077
958 Ga0496103_0038797 3300048906 Bacteria 2925
959 Ga0496103_0160904 3300048906 Bacteria 1440
960 Ga0496103_0317986 3300048906 Unclassified 1001
961 Ga0496104_0024816 3300048907 Bacteria 5519
962 Ga0496104_0037551 3300048907 Bacteria 4530
963 Ga0496104_1213955 3300048907 Bacteria 657
964 Ga0496105_0359280 3300048908 Unclassified 1162
965 Ga0496105_0492227 3300048908 Bacteria 963
966 Ga0496106_0005419 3300048909 Bacteria 9436
967 Ga0496106_0042125 3300048909 Bacteria 3423
968 Ga0496106_0324083 3300048909 Bacteria 1237
969 Ga0496106_0900043 3300048909 Unclassified 699
970 Ga0496107_0004141 3300048910 Bacteria 9779
971 Ga0496107_0010943 3300048910 Bacteria 6312
972 Ga0496107_0252185 3300048910 Unclassified 1313
973 Ga0496108_0375939 3300048911 Bacteria 1240
974 Ga0496109_0516377 3300048912 Bacteria 1127
975 Ga0496110_0515879 3300048913 Bacteria 1087
976 Ga0496110_1703633 3300048913 Bacteria 540
977 Ga0496111_0271030 3300048914 Bacteria 1259
978 Ga0496111_0628444 3300048914 Unclassified 785
979 Ga0496112_0000096 3300048915 Bacteria 57298
980 Ga0496112_0374771 3300048915 Bacteria 1364
981 Ga0496113_0638719 3300048916 Bacteria 851
982 Ga0496114_0197396 3300048917 Bacteria 1761
983 Ga0496114_0252219 3300048917 Bacteria 1553
984 Ga0496115_0009460 3300048918 Bacteria 7239
985 Ga0496115_0223648 3300048918 Bacteria 1553
986 Ga0496115_0553331 3300048918 Unclassified 919
987 Ga0496115_1461320 3300048918 Unclassified 502
988 Ga0496117_0039426 3300048920 Bacteria 3487
989 Ga0496118_0118254 3300048921 Bacteria 1736
990 Ga0496119_0140206 3300048922 Bacteria 1306
991 Ga0496121_0000146 3300048924 Bacteria 154459
992 Ga0496121_0119021 3300048924 Bacteria 1998
993 Ga0496121_0180861 3300048924 Bacteria 1522
994 Ga0496124_0001997 3300048927 Bacteria 27793
995 Ga0496124_0777645 3300048927 Unclassified 596
996 Ga0496125_0034974 3300048928 Bacteria 4419
997 Ga0496126_0017240 3300048929 Bacteria 7197
998 Ga0496126_0070810 3300048929 Bacteria 3106
999 Ga0496126_0115385 3300048929 Bacteria 2335
1000 Ga0496126_0317823 3300048929 Bacteria 1281
1001 Ga0496126_0360766 3300048929 Bacteria 1187
1002 Ga0496126_0802883 3300048929 Bacteria 722
1003 Ga0501046_0094240 3300049580 Bacteria 2301
1004 Ga0501047_0114632 3300049581 Bacteria 2577
1005 Ga0501070_0053294 3300049586 Bacteria 3356
1006 Ga0501073_0118336 3300049589 Bacteria 1836
1007 Ga0501080_0191459 3300049742 Bacteria 1879
1008 Ga0501044_0742710 3300049823 Unclassified 864
1009 nmdc:mga03n38_611866_c1 3300050490 Unclassified 621
1010 nmdc:mga0yw44_299420_c1 3300050492 Bacteria 1077
1011 nmdc:mga0yw44_73828_c1 3300050492 Unclassified 2123
1012 nmdc:mga0k408_205537_c1 3300050493 Unclassified 1175
1013 nmdc:mga06z11_164783_c1 3300050494 Unclassified 1269
1014 nmdc:mga05p37_140455_c1 3300050507 Bacteria 919
1015 nmdc:mga05p37_151567_c1 3300050507 Bacteria 2835
1016 nmdc:mga05p37_1843008_c1 3300050507 Bacteria 581
1017 nmdc:mga05p37_2215258_c1 3300050507 Unclassified 510
1018 nmdc:mga05p37_25558_c1 3300050507 Bacteria 7184
1019 nmdc:mga05p37_296512_c1 3300050507 Bacteria 1923
1020 nmdc:mga05p37_310828_c1 3300050507 Bacteria 1868
1021 nmdc:mga05p37_370982_c1 3300050507 Bacteria 1679
1022 nmdc:mga05p37_413108_c1 3300050507 Unclassified 1572
1023 nmdc:mga09592_1024044_c1 3300050508 Unclassified 689
1024 nmdc:mga09592_1159996_c1 3300050508 Unclassified 640
1025 nmdc:mga09592_357571_c1 3300050508 Bacteria 1264
1026 nmdc:mga09592_747624_c1 3300050508 Bacteria 830
1027 nmdc:mga0qj67_112358_c1 3300050509 Bacteria 2199
1028 nmdc:mga0qj67_1125835_c1 3300050509 Bacteria 612
1029 nmdc:mga0qj67_362970_c1 3300050509 Bacteria 1170
1030 nmdc:mga0qj67_750811_c1 3300050509 Bacteria 774
1031 nmdc:mga06r32_1074588_c1 3300050510 Bacteria 755
1032 nmdc:mga06r32_1880017_c1 3300050510 Unclassified 533
1033 nmdc:mga06r32_240242_c1 3300050510 Unclassified 1799
1034 nmdc:mga06r32_557801_c1 3300050510 Bacteria 1119
1035 nmdc:mga08y16_109859_c1 3300050511 Bacteria 2871
1036 nmdc:mga08y16_1153965_c1 3300050511 Bacteria 747
1037 nmdc:mga08y16_13722_c1 3300050511 Bacteria 8530
1038 nmdc:mga08y16_1556317_c1 3300050511 Unclassified 620
1039 nmdc:mga08y16_261818_c1 3300050511 Bacteria 1786
1040 nmdc:mga08y16_370963_c1 3300050511 Bacteria 1468
1041 nmdc:mga08y16_720677_c1 3300050511 Bacteria 996
1042 nmdc:mga08y16_722418_c1 3300050511 Bacteria 994
1043 nmdc:mga0n895_1373849_c1 3300050512 Bacteria 675
1044 nmdc:mga0n895_146629_c1 3300050512 Bacteria 2390
1045 nmdc:mga0n895_18398_c1 3300050512 Bacteria 6465
1046 nmdc:mga0n895_1857186_c1 3300050512 Bacteria 562
1047 nmdc:mga0n895_218852_c1 3300050512 Unclassified 1933
1048 nmdc:mga0n895_226956_c1 3300050512 Bacteria 1896
1049 nmdc:mga0n895_268236_c1 3300050512 Bacteria 1732
1050 nmdc:mga0n895_339793_c1 3300050512 Unclassified 1521
1051 nmdc:mga0n895_467849_c1 3300050512 Bacteria 1272
1052 nmdc:mga0n895_609006_c1 3300050512 Bacteria 1094
1053 nmdc:mga0rr50_1563296_c1 3300050513 Bacteria 557
1054 nmdc:mga0rr50_1827369_c1 3300050513 Unclassified 511
1055 nmdc:mga0rr50_191601_c1 3300050513 Bacteria 1676
1056 nmdc:mga0rr50_237470_c1 3300050513 Bacteria 1510
1057 nmdc:mga0rr50_340413_c1 3300050513 Bacteria 1260
1058 nmdc:mga0rr50_3442_c1 3300050513 Bacteria 9109
1059 nmdc:mga0rr50_3837_c1 3300050513 Bacteria 8726
1060 nmdc:mga0rr50_6313_c1 3300050513 Bacteria 7201
1061 nmdc:mga08x19_100909_c1 3300050514 Unclassified 1915
1062 nmdc:mga08x19_11168_c1 3300050514 Bacteria 5406
1063 nmdc:mga08x19_268382_c1 3300050514 Bacteria 1181
1064 nmdc:mga08x19_528434_c1 3300050514 Bacteria 834
1065 nmdc:mga08x19_8204_c1 3300050514 Bacteria 6207
1066 nmdc:mga08x19_96211_c1 3300050514 Bacteria 1960
1067 nmdc:mga0a205_11210_c1 3300050515 Bacteria 8251
1068 nmdc:mga0a205_209145_c1 3300050515 Bacteria 1840
1069 nmdc:mga0a205_257142_c1 3300050515 Bacteria 1624
1070 nmdc:mga0a205_28575_c1 3300050515 Bacteria 5333
1071 nmdc:mga0a205_55061_c1 3300050515 Bacteria 3842
1072 nmdc:mga0a205_682226_c1 3300050515 Unclassified 878
1073 nmdc:mga0a205_75632_c1 3300050515 Unclassified 1203
1074 nmdc:mga0a205_9216_c1 3300050515 Bacteria 9011
1075 Ga0495601_0019191 3300053077 Bacteria 4168
1076 Ga0495601_0174488 3300053077 Bacteria 1405
1077 Ga0495601_0432075 3300053077 Unclassified 852
1078 Ga0495601_0433569 3300053077 Unclassified 851
1079 Ga0495612_0430709 3300053078 Unclassified 601
1080 Ga0500635_0051634 3300053080 Bacteria 1410
1081 Ga0495655_0004032 3300053083 Bacteria 2481
1082 Ga0495655_0147215 3300053083 Bacteria 738
1083 Ga0495595_0003581 3300053084 Bacteria 6167
1084 Ga0495595_0302101 3300053084 Unclassified 805
1085 Ga0495619_0000884 3300053085 Bacteria 19715
1086 Ga0495619_0308859 3300053085 Unclassified 1095
1087 Ga0495619_0461688 3300053085 Unclassified 875
1088 Ga0500647_0147796 3300053091 Unclassified 1098
1089 Ga0500566_0000207 3300053094 Bacteria 31105
1090 Ga0500640_003553 3300053095 Bacteria 5477
1091 Ga0500554_000856 3300053102 Bacteria 5978
1092 Ga0500558_280872 3300053106 Unclassified 530
1093 Ga0500572_000072 3300053111 Bacteria 32032
1094 Ga0500572_000676 3300053111 Bacteria 11214
1095 Ga0500591_131498 3300053115 Unclassified 1008
1096 Ga0500608_172703 3300053122 Unclassified 924
1097 Ga0500614_000572 3300053123 Bacteria 9506
1098 Ga0500590_044056 3300053148 Bacteria 2286
1099 Ga0500590_120347 3300053148 Unclassified 1231
1100 Ga0500603_000313 3300053150 Bacteria 12755
1101 Ga0500603_000691 3300053150 Bacteria 8222
1102 Ga0500630_001066 3300053159 Bacteria 12827
1103 Ga0500638_002777 3300053162 Bacteria 6250
1104 Ga0500639_000072 3300053163 Bacteria 46512
1105 Ga0500636_0009805 3300053177 Bacteria 5578
1106 Ga0500636_0428624 3300053177 Bacteria 605
1107 Ga0500637_0002631 3300053178 Bacteria 8033
1108 Ga0500637_0059209 3300053178 Bacteria 2192
1109 Ga0500637_0246891 3300053178 Bacteria 998
1110 Ga0500596_007783 3300053735 Bacteria 1737
1111 Ga0500661_065958 3300055283 Unclassified 658
1112 Ga0466962_0070083 3300061719 Bacteria 1674
1113 3005475086 3005474847 Bacteria 9259049
1114 Ga0070690_100006793
1115 JGI25406J46586_10001887
1116 JGI25406J46586_10002141
1117 JGI25165J46597_1001461
1118 rootL2_10337886
1119 rootH1_10119389
1120 JGI25404J52841_10009099
1121 JGI25404J52841_10011826
1122 JGI25404J52841_10014874
1123 JGI25404J52841_10042530
1124 JGI25404J52841_10062842
1125 Ga0065707_10337243
1126 Ga0065707_10362107
1127 Ga0070658_10008775
1128 Ga0070658_10065970
1129 Ga0070676_11258362
1130 Ga0070683_102259806
1131 Ga0070690_100037235
1132 Ga0070690_100266916
1133 Ga0068869_100008900
1134 Ga0068869_100101268
1135 Ga0068869_100128282
1136 Ga0070666_10052682
1137 Ga0070680_100109186
1138 Ga0070682_100006243
1139 Ga0070682_100007478
1140 Ga0070682_100224286
1141 Ga0070682_101009081
1142 Ga0068868_100000853
1143 Ga0068868_100017752
1144 Ga0068868_100151781
1145 Ga0068868_100999549
1146 Ga0070660_101436337
1147 Ga0070689_100008651
1148 Ga0070691_10006016
1149 Ga0070687_100001795
1150 Ga0070687_100287891
1151 Ga0070687_100733991
1152 Ga0070661_100054891
1153 Ga0070661_100083107
1154 Ga0070692_10023702
1155 Ga0070692_10063917
1156 Ga0070668_100123626
1157 Ga0070668_100305959
1158 Ga0070669_100261232
1159 Ga0070675_100147667
1160 Ga0070675_100275148
1161 Ga0070675_101318725
1162 Ga0070671_100031052
1163 Ga0070671_100314005
1164 Ga0070671_100696357
1165 Ga0070674_100024214
1166 Ga0070673_100025183
1167 Ga0070673_100158473
1168 Ga0070673_100228022
1169 Ga0070659_100415750
1170 Ga0070667_100038036
1171 Ga0070667_101143713
1172 Ga0070703_10013164
1173 Ga0070709_10006034
1174 Ga0070709_10139185
1175 Ga0070709_10215323
1176 Ga0070709_10372344
1177 Ga0070709_10474812
1178 Ga0070709_10857604
1179 Ga0070709_11534251
1180 Ga0070714_100053923
1181 Ga0070714_100480969
1182 Ga0070714_101016101
1183 Ga0070713_100192057
1184 Ga0070713_100200951
1185 Ga0070713_100206442
1186 Ga0070713_100404849
1187 Ga0070713_100441825
1188 Ga0070710_10002263
1189 Ga0070710_10127382
1190 Ga0070710_10318172
1191 Ga0070710_11417406
1192 Ga0070701_10001219
1193 Ga0070701_10066586
1194 Ga0070701_10677319
1195 Ga0070701_10852898
1196 Ga0070711_100045309
1197 Ga0070711_100063199
1198 Ga0070711_100248677
1199 Ga0070711_100352252
1200 Ga0070705_100000960
1201 Ga0070705_100001523
1202 Ga0070705_100309830
1203 Ga0070705_100392720
1204 Ga0070700_100000945
1205 Ga0070700_100019025
1206 Ga0070700_100020384
1207 Ga0070700_100032706
1208 Ga0070694_100001002
1209 Ga0070694_100005244
1210 Ga0070694_100090475
1211 Ga0070708_100005027
1212 Ga0070708_100020786
1213 Ga0070708_100022950
1214 Ga0070708_100060473
1215 Ga0070708_100269550
1216 Ga0070708_100309158
1217 Ga0070708_100447577
1218 Ga0070708_100818024
1219 Ga0070663_100010877
1220 Ga0070663_100076861
1221 Ga0070678_100005458
1222 Ga0070678_100048846
1223 Ga0070678_101879995
1224 Ga0070681_10015034
1225 Ga0070681_10323675
1226 Ga0068867_100003791
1227 Ga0068867_100007021
1228 Ga0070706_100030300
1229 Ga0070706_100032145
1230 Ga0070706_100130503
1231 Ga0070706_100351475
1232 Ga0070706_100493436
1233 Ga0070706_100609581
1234 Ga0070706_100809968
1235 Ga0070707_100026395
1236 Ga0070707_100060452
1237 Ga0070707_100066915
1238 Ga0070707_100225601
1239 Ga0070707_100923278
1240 Ga0070698_100005789
1241 Ga0070698_100311453
1242 Ga0070698_101487427
1243 Ga0070699_100002182
1244 Ga0070699_100013284
1245 Ga0070699_100013440
1246 Ga0070699_100363166
1247 Ga0070699_100598728
1248 Ga0070699_100751836
1249 Ga0070699_101016661
1250 Ga0070699_101701340
1251 Ga0070679_100010243
1252 Ga0070679_100036676
1253 Ga0070684_100106220
1254 Ga0070697_100004145
1255 Ga0070697_100045901
1256 Ga0070697_100117038
1257 Ga0070697_100120585
1258 Ga0070697_100785615
1259 Ga0070697_100801901
1260 Ga0070697_102056523
1261 Ga0068853_100073762
1262 Ga0068853_100135353
1263 Ga0068853_100567437
1264 Ga0068853_100614450
1265 Ga0068853_101718673
1266 Ga0070672_100029329
1267 Ga0070686_100004344
1268 Ga0070686_100610914
1269 Ga0070686_100947623
1270 Ga0070695_100000890
1271 Ga0070695_100004519
1272 Ga0070695_100024704
1273 Ga0070695_100183342
1274 Ga0070695_101102087
1275 Ga0070696_100001274
1276 Ga0070696_100003459
1277 Ga0070696_100009740
1278 Ga0070696_101319216
1279 Ga0070693_100000946
1280 Ga0070665_100002432
1281 Ga0070665_100274935
1282 Ga0070704_100000720
1283 Ga0070704_100003859
1284 Ga0070704_100011646
1285 Ga0070704_100241945
1286 Ga0070704_100438018
1287 Ga0070704_101111262
1288 Ga0070704_101932652
1289 Ga0068855_100028209
1290 Ga0068855_100054434
1291 Ga0068855_100121318
1292 Ga0068855_100131470
1293 Ga0068855_100577689
1294 Ga0068855_100596404
1295 Ga0070664_100756982
1296 Ga0068854_100071134
1297 Ga0068856_100000020
1298 Ga0068856_100012224
1299 Ga0068856_100055813
1300 Ga0068856_100070259
1301 Ga0068856_101056637
1302 Ga0068856_101322335
1303 Ga0070702_100001934
1304 Ga0070702_100222417
1305 Ga0070702_100658126
1306 Ga0068852_100028004
1307 Ga0068852_100117450
1308 Ga0068852_100643525
1309 Ga0068852_101313636
1310 Ga0068852_101592090
1311 Ga0068859_100017559
1312 Ga0068859_100043295
1313 Ga0068859_101135566
1314 Ga0068859_101304495
1315 Ga0068859_101756321
1316 Ga0068864_100064794
1317 Ga0068864_100892939
1318 Ga0068866_10001108
1319 Ga0068866_10004840
1320 Ga0068866_10110234
1321 Ga0068861_100001526
1322 Ga0068861_100006520
1323 Ga0068861_100066647
1324 Ga0068851_10449770
1325 Ga0068870_10039714
1326 Ga0068870_10109071
1327 Ga0068863_100075486
1328 Ga0068863_100280274
1329 Ga0068863_100415487
1330 Ga0068863_101666698
1331 Ga0068863_102064688
1332 Ga0068858_100013028
1333 Ga0068858_100033717
1334 Ga0068858_100078638
1335 Ga0068858_100244227
1336 Ga0068858_100273334
1337 Ga0068858_100330542
1338 Ga0068858_100356695
1339 Ga0068858_102333631
1340 Ga0068860_100001387
1341 Ga0068860_100009890
1342 Ga0068860_100226002
1343 Ga0068860_100387892
1344 Ga0068860_100585683
1345 Ga0068860_100934314
1346 Ga0068860_101110956
1347 Ga0068860_101169655
1348 Ga0068862_100004521
1349 Ga0068862_100010396
1350 Ga0068862_100010541
1351 Ga0068862_101050295
1352 Ga0081455_10021818
1353 Ga0081455_10133795
1354 Ga0081540_1000017
1355 Ga0081540_1009476
1356 Ga0081540_1011827
1357 Ga0081540_1020958
1358 Ga0081540_1021473
1359 Ga0081540_1071592
1360 Ga0081540_1073374
1361 Ga0081540_1129558
1362 Ga0081540_1159051
1363 Ga0081539_10000148
1364 Ga0081539_10005052
1365 Ga0070717_10034975
1366 Ga0070717_10169520
1367 Ga0070717_10249781
1368 Ga0070717_10287754
1369 Ga0070717_10391990
1370 Ga0070717_10891208
1371 Ga0070717_10950078
1372 Ga0075365_10049991
1373 Ga0070715_10008466
1374 Ga0070715_10040363
1375 Ga0070715_10164582
1376 Ga0070715_10813703
1377 Ga0070716_100003406
1378 Ga0070716_100184666
1379 Ga0070716_100215972
1380 Ga0070716_100551929
1381 Ga0070712_100004944
1382 Ga0070712_100017122
1383 Ga0070712_100123103
1384 Ga0070712_100183279
1385 Ga0070712_100281080
1386 Ga0070712_100493004
1387 Ga0070712_100840129
1388 Ga0070712_101214771
1389 Ga0075367_10265892
1390 Ga0075366_10232724
1391 Ga0097621_100002687
1392 Ga0097621_100317024
1393 Ga0097621_100329779
1394 Ga0097621_101460842
1395 Ga0068871_100002733
1396 Ga0068871_100044285
1397 Ga0068871_100284242
1398 Ga0068871_100480043
1399 Ga0075428_100010654
1400 Ga0075428_100042342
1401 Ga0075428_100058774
1402 Ga0075428_100108601
1403 Ga0075428_100289018
1404 Ga0075428_100350033
1405 Ga0075428_100541315
1406 Ga0075430_100305390
1407 Ga0075430_100415757
1408 Ga0075430_101177864
1409 Ga0075431_100062961
1410 Ga0075431_101081392
1411 Ga0075431_101460673
1412 Ga0075433_10004987
1413 Ga0075433_10014343
1414 Ga0075433_10047645
1415 Ga0075433_10071176
1416 Ga0075433_10147391
1417 Ga0075433_10149824
1418 Ga0075433_10167488
1419 Ga0075433_10234482
1420 Ga0075433_10733792
1421 Ga0075433_11324418
1422 Ga0075433_11560393
1423 Ga0075434_100006965
1424 Ga0075434_100037472
1425 Ga0075434_100071430
1426 Ga0075434_100143514
1427 Ga0075434_100187310
1428 Ga0075434_100669454
1429 Ga0075434_100973940
1430 Ga0075434_101026835
1431 Ga0075434_102645525
1432 Ga0075429_100603658
1433 Ga0075429_100972753
1434 Ga0075429_101282315
1435 Ga0068865_100000371
1436 Ga0068865_100008081
1437 Ga0068865_100151686
1438 Ga0068865_100168002
1439 Ga0068865_100218792
1440 Ga0075436_100005846
1441 Ga0075436_100008120
1442 Ga0075436_100010094
1443 Ga0075436_100041242
1444 Ga0075436_100075904
1445 Ga0097620_100017557
1446 Ga0097620_100043295
1447 Ga0097620_101135569
1448 Ga0097620_101304348
1449 Ga0097620_101756391
1450 Ga0075435_100027248
1451 Ga0075435_100029211
1452 Ga0075435_100054133
1453 Ga0075435_100168011
1454 Ga0075435_100206560
1455 Ga0075435_100290638
1456 Ga0075435_100401480
1457 Ga0099794_10004947
1458 Ga0099794_10018666
1459 Ga0099794_10035612
1460 Ga0099795_10036701
1461 Ga0099795_10085580
1462 Ga0099795_10299634
1463 Ga0099795_10320368
1464 Ga0105250_10537743
1465 Ga0105240_10070557
1466 Ga0105240_10189264
1467 Ga0105240_10206245
1468 Ga0111539_10006252
1469 Ga0111539_10022576
1470 Ga0111539_10096841
1471 Ga0111539_10131862
1472 Ga0111539_10198331
1473 Ga0111539_10345482
1474 Ga0111539_11187959
1475 Ga0111539_11247466
1476 Ga0111539_11518513
1477 Ga0105245_10005407
1478 Ga0105245_10011676
1479 Ga0105245_10109446
1480 Ga0105245_10605776
1481 Ga0105245_11422877
1482 Ga0105245_11960299
1483 Ga0105247_10130168
1484 Ga0105247_10204377
1485 Ga0105247_11025531
1486 Ga0114129_10060720
1487 Ga0114129_10128548
1488 Ga0114129_10198715
1489 Ga0114129_10267568
1490 Ga0114129_10807745
1491 Ga0114129_10858410
1492 Ga0114129_10863105
1493 Ga0114129_10895500
1494 Ga0114129_11076774
1495 Ga0114129_11382258
1496 Ga0114129_11731272
1497 Ga0114129_11955472
1498 Ga0114129_13038139
1499 Ga0105243_10005316
1500 Ga0105243_10179725
1501 Ga0105243_10356522
1502 Ga0105243_10402402
1503 Ga0105243_12612438
1504 Ga0105241_10270256
1505 Ga0105241_10272895
1506 Ga0105241_10389328
1507 Ga0105241_11033009
1508 Ga0105242_10009845
1509 Ga0105242_10033092
1510 Ga0105242_10113300
1511 Ga0105242_10386044
1512 Ga0105242_10580299
1513 Ga0105242_10850575
1514 Ga0105248_10101134
1515 Ga0105248_10103771
1516 Ga0105248_10522818
1517 Ga0105248_11227272
1518 Ga0105237_10000370
1519 Ga0105237_10562319
1520 Ga0105238_10110466
1521 Ga0105238_10130080
1522 Ga0105238_10212606
1523 Ga0105238_10312834
1524 Ga0105238_10656570
1525 Ga0105249_10002322
1526 Ga0105249_10009839
1527 Ga0105249_10117484
1528 Ga0105249_10337108
1529 Ga0105249_11490663
1530 Ga0105249_11845687
1531 Ga0099796_10009747
1532 Ga0099796_10116515
1533 Ga0105239_10000387
1534 Ga0105239_10049013
1535 Ga0105239_10158168
1536 Ga0105239_10433796
1537 Ga0105239_11644679
1538 Ga0105239_12917764
1539 Ga0105239_13012033
1540 Ga0105246_10014526
1541 Ga0105246_10045631
1542 Ga0105246_10156093
1543 Ga0105246_11135735
1544 Ga0157345_1037443
1545 Ga0157370_10036754
1546 Ga0157369_10064445
1547 Ga0157369_11017376
1548 Ga0157374_10034640
1549 Ga0157374_10530678
1550 Ga0157374_10858082
1551 Ga0157374_12697543
1552 Ga0157378_10006479
1553 Ga0157378_10083229
1554 Ga0157378_10121706
1555 Ga0157378_10720358
1556 Ga0157378_11823961
1557 Ga0163162_10000948
1558 Ga0163162_10158225
1559 Ga0163162_10733973
1560 Ga0163162_11018690
1561 Ga0163162_11400539
1562 Ga0163162_11421969
1563 Ga0163162_11694865
1564 Ga0163162_12320121
1565 Ga0157372_10228286
1566 Ga0157372_10228669
1567 Ga0157375_10018315
1568 Ga0157375_11397341
1569 Ga0157375_11578399
1570 Ga0163163_10152513
1571 Ga0157380_10060349
1572 Ga0157380_10265179
1573 Ga0157380_10604096
1574 Ga0157380_12049418
1575 Ga0182008_10048549
1576 Ga0157377_10059726
1577 Ga0157377_11188649
1578 Ga0157379_10360144
1579 Ga0157379_10367250
1580 Ga0157379_10550206
1581 Ga0157376_10069404
1582 Ga0157376_10343531
1583 Ga0157376_11105150
1584 Ga0163161_10640394
1585 Ga0213874_10067976
1586 Ga0213876_10106075
1587 Ga0213876_10196532
1588 Ga0213876_10234643
1589 Ga0207427_105635
1590 Ga0209233_1000289
1591 Ga0207697_10259461
1592 Ga0207656_10363541
1593 Ga0207653_10024692
1594 Ga0207653_10215145
1595 Ga0207692_10003361
1596 Ga0207692_10724648
1597 Ga0207692_11066379
1598 Ga0207642_10004578
1599 Ga0207710_10031604
1600 Ga0207710_10367871
1601 Ga0207688_10089197
1602 Ga0207688_10105024
1603 Ga0207680_10078010
1604 Ga0207680_10182767
1605 Ga0207647_10083996
1606 Ga0207647_10630701
1607 Ga0207685_10008537
1608 Ga0207685_10569308
1609 Ga0207699_10000908
1610 Ga0207699_10027605
1611 Ga0207699_10445512
1612 Ga0207699_10481820
1613 Ga0207699_10806144
1614 Ga0207645_10893714
1615 Ga0207643_10024968
1616 Ga0207705_10035556
1617 Ga0207705_10107107
1618 Ga0207684_10015285
1619 Ga0207684_10077079
1620 Ga0207684_10081582
1621 Ga0207684_10117239
1622 Ga0207684_10287467
1623 Ga0207654_10008924
1624 Ga0207654_10097947
1625 Ga0207654_10259608
1626 Ga0207707_10002162
1627 Ga0207707_10203319
1628 Ga0207695_10053693
1629 Ga0207695_10397456
1630 Ga0207695_10940351
1631 Ga0207671_10002221
1632 Ga0207671_10725603
1633 Ga0207693_10009032
1634 Ga0207693_10121695
1635 Ga0207693_10169648
1636 Ga0207693_10263699
1637 Ga0207693_10271747
1638 Ga0207693_10541341
1639 Ga0207693_10725242
1640 Ga0207693_11335533
1641 Ga0207663_10009558
1642 Ga0207663_10048740
1643 Ga0207663_10132212
1644 Ga0207663_10325704
1645 Ga0207663_10384219
1646 Ga0207663_11405935
1647 Ga0207660_10131642
1648 Ga0207662_10014139
1649 Ga0207662_10263782
1650 Ga0207662_10732502
1651 Ga0207649_10208997
1652 Ga0207652_10020892
1653 Ga0207652_10140411
1654 Ga0207652_10869712
1655 Ga0207646_10023805
1656 Ga0207646_10041136
1657 Ga0207646_10117172
1658 Ga0207646_10319287
1659 Ga0207681_10086528
1660 Ga0207694_10084844
1661 Ga0207694_10264218
1662 Ga0207694_10440968
1663 Ga0207659_10076817
1664 Ga0207659_10171874
1665 Ga0207687_10007167
1666 Ga0207687_10135654
1667 Ga0207687_10890742
1668 Ga0207687_11442994
1669 Ga0207700_10133198
1670 Ga0207700_10163381
1671 Ga0207700_10637935
1672 Ga0207700_10923038
1673 Ga0207700_11890415
1674 Ga0207664_10026668
1675 Ga0207664_11208086
1676 Ga0207644_10287697
1677 Ga0207690_10202396
1678 Ga0207706_10132174
1679 Ga0207706_10716009
1680 Ga0207686_10002819
1681 Ga0207686_10039885
1682 Ga0207686_10915891
1683 Ga0207709_10004575
1684 Ga0207709_10055241
1685 Ga0207709_10463207
1686 Ga0207709_10634316
1687 Ga0207670_10030440
1688 Ga0207669_10135675
1689 Ga0207704_10017858
1690 Ga0207704_10122918
1691 Ga0207704_10392491
1692 Ga0207704_10522481
1693 Ga0207665_10002149
1694 Ga0207665_10042315
1695 Ga0207665_10334746
1696 Ga0207665_11627082
1697 Ga0207691_10045164
1698 Ga0207711_10103806
1699 Ga0207711_10285480
1700 Ga0207711_10393101
1701 Ga0207711_10628313
1702 Ga0207689_10003642
1703 Ga0207689_10104783
1704 Ga0207689_10106083
1705 Ga0207689_10245901
1706 Ga0207679_10907129
1707 Ga0207667_10049586
1708 Ga0207667_10103644
1709 Ga0207667_11238471
1710 Ga0207651_10010022
1711 Ga0207651_11249022
1712 Ga0207712_10004995
1713 Ga0207712_10076205
1714 Ga0207712_10631499
1715 Ga0207712_10694098
1716 Ga0207712_11214861
1717 Ga0207712_11949034
1718 Ga0207668_10125315
1719 Ga0207668_10552359
1720 Ga0207640_10009095
1721 Ga0207640_10383925
1722 Ga0207658_10116726
1723 Ga0207658_10897069
1724 Ga0207677_10003788
1725 Ga0207677_10012673
1726 Ga0207677_10175028
1727 Ga0207677_11645827
1728 Ga0207703_10022563
1729 Ga0207703_10026073
1730 Ga0207703_10317685
1731 Ga0207703_10569163
1732 Ga0207703_10786014
1733 Ga0207639_10311002
1734 Ga0207639_10345845
1735 Ga0207639_10574035
1736 Ga0207639_11096127
1737 Ga0207678_10050255
1738 Ga0207708_10002595
1739 Ga0207708_10003135
1740 Ga0207708_10053564
1741 Ga0207708_10148501
1742 Ga0207708_11175908
1743 Ga0207708_11707529
1744 Ga0207702_10002142
1745 Ga0207702_10023268
1746 Ga0207702_10212266
1747 Ga0207702_10625534
1748 Ga0207702_10722596
1749 Ga0207702_11088537
1750 Ga0207702_11378990
1751 Ga0207641_10048224
1752 Ga0207641_10078020
1753 Ga0207641_10147447
1754 Ga0207641_10680953
1755 Ga0207641_10754912
1756 Ga0207641_11935362
1757 Ga0207648_10000224
1758 Ga0207648_10011597
1759 Ga0207648_10799523
1760 Ga0207676_10025180
1761 Ga0207676_11968686
1762 Ga0207675_100000173
1763 Ga0207675_100015873
1764 Ga0207675_100096920
1765 Ga0207675_100604305
1766 Ga0207683_10078207
1767 Ga0207683_10196874
1768 Ga0207683_10742914
1769 Ga0207698_10027036
1770 Ga0207698_10180132
1771 Ga0207698_10759403
1772 Ga0207698_10852009
1773 Ga0207698_11039727
1774 Ga0207698_11270277
1775 Ga0209179_1121226
1776 Ga0209588_1013946
1777 Ga0209588_1168184
1778 Ga0207428_10156691
1779 Ga0207428_10169366
1780 Ga0207428_10255166
1781 Ga0207428_10721163
1782 Ga0207428_11032674
1783 Ga0268266_10000242
1784 Ga0268266_10278061
1785 Ga0268265_10003582
1786 Ga0268265_10008946
1787 Ga0268265_10018603
1788 Ga0268265_10376074
1789 Ga0268264_10001267
1790 Ga0268264_10002698
1791 Ga0268264_10006722
1792 Ga0268264_10105953
1793 Ga0268264_10214156
1794 Ga0268264_10508273
1795 Ga0268264_10870013
1796 Ga0268264_11124172
1797 Ga0307517_10479375
1798 Ga0265338_10013390
1799 Ga0265324_10053585
1800 Ga0307511_10029041
1801 Ga0265325_10051363
1802 Ga0265329_10012508
1803 Ga0265340_10346509
1804 Ga0265339_10000466
1805 Ga0265331_10103575
1806 Ga0307509_10168485
1807 Ga0307509_10251575
1808 Ga0307509_10834444
1809 Ga0265313_10000063
1810 Ga0307508_10003178
1811 Ga0307508_10132624
1812 Ga0307508_10144936
1813 Ga0307508_10159048
1814 Ga0265342_10147739
1815 Ga0307510_10097189
1816 Ga0316215_1016829
1817 Ga0373930_0025124
1818 Ga0373930_0124048
1819 Ga0373958_0010886
1820 Ga0373938_0006459
1821 Ga0373926_0004927
1822 Ga0373926_0034192
1823 Ga0373928_0188475
1824 Ga0373929_0262906
1825 Ga0373934_0008207
1826 Ga0373940_0016583
1827 Ga0373944_0055001
1828 Ga0373949_0150434
1829 Ga0373951_0008184
1830 Ga0373923_0172860
1831 Ga0373923_0249947
1832 Ga0373932_0002887
1833 Ga0373932_0342496
1834 Ga0373936_0016010
1835 Ga0373936_0054714
1836 Ga0373939_0004800
1837 Ga0373939_0294823
1838 Ga0373939_0386399
1839 Ga0373941_0482113
1840 Ga0373945_0052167
1841 Ga0373945_0255354
1842 Ga0373953_0192473
1843 Ga0373953_0303853
1844 Ga0373954_0000989
1845 Ga0373954_0013488
1846 Ga0373954_0021762
1847 Ga0373956_0059437
1848 Ga0373956_0071356
1849 Ga0373957_0023592
1850 Ga0373960_0032538
1851 Ga0373943_0047697
1852 Ga0373943_0056818
1853 Ga0373943_0097275
1854 Ga0373946_0011226
1855 Ga0373946_0170101
1856 Ga0373955_0019007
1857 Ga0373955_0030177
1858 Ga0373955_0269499
1859 Ga0373955_0665392
1860 Ga0373942_0076561
1861 Ga0373942_0121261
1862 Ga0373942_0161925
1863 Ga0373942_0283571
1864 Ga0373962_0002853
1865 Ga0373962_0020937
1866 Ga0373924_0034613
1867 Ga0373924_0156817
1868 Ga0373931_0198727
1869 Ga0373931_0217615
1870 Ga0373931_0649673
1871 Ga0373935_0013747
1872 Ga0373935_0041914
1873 Ga0373935_0142231
1874 Ga0373935_1205463
1875 Ga0373927_0027959
1876 Ga0373927_0036402
1877 Ga0373927_0043373
1878 Ga0373927_0160871
1879 Ga0373927_0444729
1880 Ga0373933_0001979
1881 Ga0373933_0074040
1882 Ga0373933_0138106
1883 Ga0373933_0370808
1884 Ga0373947_0018523
1885 Ga0373947_0023699
1886 Ga0373947_0053494
1887 Ga0373947_0658780
1888 Ga0373937_0003310
1889 Ga0373937_0061922
1890 Ga0373937_0166338
1891 Ga0373937_0246582
1892 Ga0373925_0010015
1893 Ga0373925_0050127
1894 Ga0373925_0072555
1895 Ga0373925_0101498
1896 Ga0373925_0959791
1897 Ga0436365_0189303
1898 Ga0436365_0646644
1899 Ga0436365_0688814
1900 Ga0436365_0808037
1901 Ga0436360_0563693
1902 Ga0436361_0284160
1903 Ga0436363_0115460
1904 Ga0436363_1017314
1905 Ga0436363_1338148
1906 Ga0436363_1507714
1907 Ga0451845_0860828
1908 Ga0451853_1812974
1909 Ga0451853_2293970
1910 Ga0439441_011464
1911 Ga0439443_013141
1912 Ga0439435_0039704
1913 Ga0466969_0065742
1914 Ga0466965_0015772
1915 Ga0466966_0050725
1916 Ga0466961_0085615
1917 Ga0466963_0036867
1918 Ga0466963_0710610
1919 Ga0466963_1129484
1920 Ga0466964_0228445
1921 Ga0466971_0009264
1922 Ga0466970_0044648
1923 Ga0466957_0014580
1924 Ga0466959_0000067
1925 Ga0451576_0055286
1926 Ga0451576_0086989
1927 Ga0466958_0012896
1928 Ga0466967_0333409
1929 Ga0466967_0542778
1930 Ga0466967_1582649
1931 Ga0495592_0003640
1932 Ga0495592_0006910
1933 Ga0495592_0009958
1934 Ga0495603_0002708
1935 Ga0495603_0010247
1936 Ga0495603_0084698
1937 Ga0495603_0697971
1938 Ga0495629_0018417
1939 Ga0495629_0543270
1940 Ga0495629_0587238
1941 Ga0495629_0651029
1942 Ga0495651_0000963
1943 Ga0495651_0387539
1944 Ga0495653_0001125
1945 Ga0495653_0169592
1946 Ga0495653_0268514
1947 Ga0495580_0029456
1948 Ga0495580_0043459
1949 Ga0495580_0061759
1950 Ga0495580_0380907
1951 Ga0495580_0468957
1952 Ga0495582_0078417
1953 Ga0495582_0192425
1954 Ga0495582_0247412
1955 Ga0495582_0603067
1956 Ga0495582_0869836
1957 Ga0495639_0003042
1958 Ga0495639_0105696
1959 Ga0495639_0132506
1960 Ga0495639_0137809
1961 Ga0495664_0031222
1962 Ga0495664_0233099
1963 Ga0495664_0303240
1964 Ga0495584_0103594
1965 Ga0495585_0057853
1966 Ga0495594_0112199
1967 Ga0495594_0266496
1968 Ga0495608_0001315
1969 Ga0495608_0166440
1970 Ga0495608_0498170
1971 Ga0495610_0089043
1972 Ga0495616_0453354
1973 Ga0495628_0001543
1974 Ga0495628_0063247
1975 Ga0495628_0132842
1976 Ga0495630_0057528
1977 Ga0495630_0331817
1978 Ga0495630_0344286
1979 Ga0495644_0085015
1980 Ga0495666_0043456
1981 Ga0495652_0002500
1982 Ga0495652_0003234
1983 Ga0495652_0144356
1984 Ga0495665_0123315
1985 Ga0495665_0345357
1986 Ga0495640_0012357
1987 Ga0495640_0031105
1988 Ga0495586_0028588
1989 Ga0495586_0420661
1990 Ga0495586_0631913
1991 Ga0495587_0000403
1992 Ga0495587_0336627
1993 Ga0495598_0130292
1994 Ga0495609_0408837
1995 Ga0495621_0076088
1996 Ga0495621_0153021
1997 Ga0495621_0216700
1998 Ga0495621_0544501
1999 Ga0495645_0002102
2000 Ga0495645_0058807
2001 Ga0495633_0382848
2002 Ga0495667_0000635
2003 Ga0495667_0109849
2004 Ga0495667_0213665
2005 Ga0495656_0003820
2006 Ga0495656_0064658
2007 Ga0495656_0629820
2008 Ga0495634_0075018
2009 Ga0495635_0001210
2010 Ga0495635_0386101
2011 Ga0495659_0087809
2012 Ga0495659_0230402
2013 Ga0495588_0300910
2014 Ga0495588_0451497
2015 Ga0495657_0004192
2016 Ga0495657_0566565
2017 Ga0495599_0000506
2018 Ga0495599_0001151
2019 Ga0495599_0157116
2020 Ga0495599_0429792
2021 Ga0495623_0006303
2022 Ga0495623_0177283
2023 Ga0495646_0181323
2024 Ga0495647_0007643
2025 Ga0495647_0094022
2026 Ga0495658_0029636
2027 Ga0495669_0303636
2028 Ga0495613_0107053
2029 Ga0495613_0318189
2030 Ga0495624_0039316
2031 Ga0495624_0571811
2032 Ga0495624_0739111
2033 Ga0495589_0309082
2034 Ga0495600_0000221
2035 Ga0495600_0092839
2036 Ga0495581_0093252
2037 Ga0495581_0408845
2038 Ga0495604_0004895
2039 Ga0495604_0188186
2040 Ga0495604_0590007
2041 Ga0495636_0094985
2042 Ga0495636_0260983
2043 Ga0495636_0348353
2044 Ga0495674_0062853
2045 Ga0495674_0886521
2046 Ga0495676_0105736
2047 Ga0495676_0174948
2048 Ga0495680_0002034
2049 Ga0495680_0379043
2050 Ga0495680_1057474
2051 Ga0495675_0000445
2052 Ga0495675_0577907
2053 Ga0495679_069628
2054 Ga0495684_0002918
2055 Ga0495684_0008094
2056 Ga0495593_0031236
2057 Ga0495593_0032812
2058 Ga0495602_0000907
2059 Ga0495602_0355528
2060 Ga0495615_0123544
2061 Ga0495615_0305983
2062 Ga0496100_0004243
2063 Ga0496100_1087277
2064 Ga0496100_1594161
2065 Ga0496101_0013036
2066 Ga0496101_0608988
2067 Ga0496101_1528640
2068 Ga0496102_0002815
2069 Ga0496102_0013493
2070 Ga0496103_0038797
2071 Ga0496103_0160904
2072 Ga0496103_0317986
2073 Ga0496104_0024816
2074 Ga0496104_0037551
2075 Ga0496104_1213955
2076 Ga0496105_0359280
2077 Ga0496105_0492227
2078 Ga0496106_0005419
2079 Ga0496106_0042125
2080 Ga0496106_0324083
2081 Ga0496106_0900043
2082 Ga0496107_0004141
2083 Ga0496107_0010943
2084 Ga0496107_0252185
2085 Ga0496108_0375939
2086 Ga0496109_0516377
2087 Ga0496110_0515879
2088 Ga0496110_1703633
2089 Ga0496111_0271030
2090 Ga0496111_0628444
2091 Ga0496112_0000096
2092 Ga0496112_0374771
2093 Ga0496113_0638719
2094 Ga0496114_0197396
2095 Ga0496114_0252219
2096 Ga0496115_0009460
2097 Ga0496115_0223648
2098 Ga0496115_0553331
2099 Ga0496115_1461320
2100 Ga0496117_0039426
2101 Ga0496118_0118254
2102 Ga0496119_0140206
2103 Ga0496121_0000146
2104 Ga0496121_0119021
2105 Ga0496121_0180861
2106 Ga0496124_0001997
2107 Ga0496124_0777645
2108 Ga0496125_0034974
2109 Ga0496126_0017240
2110 Ga0496126_0070810
2111 Ga0496126_0115385
2112 Ga0496126_0317823
2113 Ga0496126_0360766
2114 Ga0496126_0802883
2115 Ga0501046_0094240
2116 Ga0501047_0114632
2117 Ga0501070_0053294
2118 Ga0501073_0118336
2119 Ga0501080_0191459
2120 Ga0501044_0742710
2121 nmdc:mga03n38_611866_c1
2122 nmdc:mga0yw44_299420_c1
2123 nmdc:mga0yw44_73828_c1
2124 nmdc:mga0k408_205537_c1
2125 nmdc:mga06z11_164783_c1
2126 nmdc:mga05p37_140455_c1
2127 nmdc:mga05p37_151567_c1
2128 nmdc:mga05p37_1843008_c1
2129 nmdc:mga05p37_2215258_c1
2130 nmdc:mga05p37_25558_c1
2131 nmdc:mga05p37_296512_c1
2132 nmdc:mga05p37_310828_c1
2133 nmdc:mga05p37_370982_c1
2134 nmdc:mga05p37_413108_c1
2135 nmdc:mga09592_1024044_c1
2136 nmdc:mga09592_1159996_c1
2137 nmdc:mga09592_357571_c1
2138 nmdc:mga09592_747624_c1
2139 nmdc:mga0qj67_112358_c1
2140 nmdc:mga0qj67_1125835_c1
2141 nmdc:mga0qj67_362970_c1
2142 nmdc:mga0qj67_750811_c1
2143 nmdc:mga06r32_1074588_c1
2144 nmdc:mga06r32_1880017_c1
2145 nmdc:mga06r32_240242_c1
2146 nmdc:mga06r32_557801_c1
2147 nmdc:mga08y16_109859_c1
2148 nmdc:mga08y16_1153965_c1
2149 nmdc:mga08y16_13722_c1
2150 nmdc:mga08y16_1556317_c1
2151 nmdc:mga08y16_261818_c1
2152 nmdc:mga08y16_370963_c1
2153 nmdc:mga08y16_720677_c1
2154 nmdc:mga08y16_722418_c1
2155 nmdc:mga0n895_1373849_c1
2156 nmdc:mga0n895_146629_c1
2157 nmdc:mga0n895_18398_c1
2158 nmdc:mga0n895_1857186_c1
2159 nmdc:mga0n895_218852_c1
2160 nmdc:mga0n895_226956_c1
2161 nmdc:mga0n895_268236_c1
2162 nmdc:mga0n895_339793_c1
2163 nmdc:mga0n895_467849_c1
2164 nmdc:mga0n895_609006_c1
2165 nmdc:mga0rr50_1563296_c1
2166 nmdc:mga0rr50_1827369_c1
2167 nmdc:mga0rr50_191601_c1
2168 nmdc:mga0rr50_237470_c1
2169 nmdc:mga0rr50_340413_c1
2170 nmdc:mga0rr50_3442_c1
2171 nmdc:mga0rr50_3837_c1
2172 nmdc:mga0rr50_6313_c1
2173 nmdc:mga08x19_100909_c1
2174 nmdc:mga08x19_11168_c1
2175 nmdc:mga08x19_268382_c1
2176 nmdc:mga08x19_528434_c1
2177 nmdc:mga08x19_8204_c1
2178 nmdc:mga08x19_96211_c1
2179 nmdc:mga0a205_11210_c1
2180 nmdc:mga0a205_209145_c1
2181 nmdc:mga0a205_257142_c1
2182 nmdc:mga0a205_28575_c1
2183 nmdc:mga0a205_55061_c1
2184 nmdc:mga0a205_682226_c1
2185 nmdc:mga0a205_75632_c1
2186 nmdc:mga0a205_9216_c1
2187 Ga0495601_0019191
2188 Ga0495601_0174488
2189 Ga0495601_0432075
2190 Ga0495601_0433569
2191 Ga0495612_0430709
2192 Ga0500635_0051634
2193 Ga0495655_0004032
2194 Ga0495655_0147215
2195 Ga0495595_0003581
2196 Ga0495595_0302101
2197 Ga0495619_0000884
2198 Ga0495619_0308859
2199 Ga0495619_0461688
2200 Ga0500647_0147796
2201 Ga0500566_0000207
2202 Ga0500640_003553
2203 Ga0500554_000856
2204 Ga0500558_280872
2205 Ga0500572_000072
2206 Ga0500572_000676
2207 Ga0500591_131498
2208 Ga0500608_172703
2209 Ga0500614_000572
2210 Ga0500590_044056
2211 Ga0500590_120347
2212 Ga0500603_000313
2213 Ga0500603_000691
2214 Ga0500630_001066
2215 Ga0500638_002777
2216 Ga0500639_000072
2217 Ga0500636_0009805
2218 Ga0500636_0428624
2219 Ga0500637_0002631
2220 Ga0500637_0059209
2221 Ga0500637_0246891
2222 Ga0500596_007783
2223 Ga0500661_065958
2224 Ga0466962_0070083
2225 3005475086

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

31

105

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5x11-assembly1.cif.gz_A crystal structure of bacillus subtilis padr in complex with operator dna 0.9185 26 105
5x11-assembly1.cif.gz_B crystal structure of bacillus subtilis padr in complex with operator dna 0.9177 26 105
5x11-assembly3.cif.gz_D crystal structure of bacillus subtilis padr in complex with operator dna 0.9157 26 105
5x11-assembly4.cif.gz_H crystal structure of bacillus subtilis padr in complex with operator dna 0.9143 26 105
5x11-assembly2.cif.gz_E crystal structure of bacillus subtilis padr in complex with operator dna 0.9128 26 105
ID Description Score Start End Superfamily
5x11A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9185 26 105 1.10.10.10
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8985 21 124 1.10.10.10
af_O50432_1_88_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8924 27 105 1.10.10.10
5dymA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8901 25 121 1.10.10.10
af_P71704_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8878 27 105 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1X1EXT8-F1-model_v4 PadR family transcriptional regulator 0.9901 18 122
AF-A0A2V7X039-F1-model_v4 PadR family transcriptional regulator 0.9773 27 124
AF-A0A800C6M0-F1-model_v4 PadR family transcriptional regulator 0.9772 27 108
AF-A0A843RSY4-F1-model_v4 PadR family transcriptional regulator 0.9756 25 126
AF-R6PLB6-F1-model_v4 Transcriptional regulator PadR-like family protein 0.9749 30 122

Map