F490255

General Info

Members Datasets Scaffolds Average Seq Length
1112 377 1112 151

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10004499|Ga0157369_1000449916
Length 175
Sequence MRISVRVNGEEHQADCWEGESLLFALREKLGFPGSKNACEQGECGSCSVLLDGTLVCSCLVLAAQADGHEVTTVEGLAQGDHLHAVQQAFVDAGAVQCGFCTPGLVVATVDLLKRNASPTDDEIREALSGNLCRCTGYAKIFDAVRLAAAGVGWTEPAESGAAGFAGGESGASAL

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
108 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
109 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
114 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
115 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
116 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
170 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
171 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
172 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
173 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
174 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
175 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
176 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
177 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
178 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
179 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
180 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
181 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
182 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
183 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
184 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
185 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
186 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
187 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
188 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
189 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
190 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
191 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
192 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
193 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
194 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
195 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
196 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
197 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
198 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
199 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
200 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
201 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
202 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
203 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
204 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
205 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
206 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
207 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
208 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
209 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
210 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
213 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
214 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
215 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
216 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
217 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
218 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
219 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
220 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
221 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
222 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
223 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
224 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
225 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
226 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
227 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
228 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
229 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
230 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
231 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
232 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
233 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
234 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
235 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
236 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
237 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
238 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
239 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
240 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
241 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
242 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
243 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
244 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
245 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
246 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
247 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
248 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
249 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
250 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
251 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
252 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
253 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
254 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
255 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
256 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
257 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
258 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
259 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
260 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
261 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
262 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
263 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
264 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
265 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
266 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
267 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
268 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
269 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
270 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
271 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
272 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
273 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
274 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
275 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
276 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
277 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
278 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
279 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
280 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
281 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
282 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
283 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
284 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
285 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
286 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
287 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
288 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
289 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
290 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
291 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
292 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
293 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
294 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
295 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
296 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
297 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
298 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
299 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
300 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
301 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
302 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
303 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
304 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
305 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
306 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
307 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
308 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
309 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
310 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
311 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
312 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
313 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
314 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
315 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
316 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
317 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
318 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
319 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
320 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
321 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
322 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
323 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
324 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
325 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
326 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
327 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
328 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
329 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
345 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
346 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
347 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
348 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
349 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
350 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
351 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
352 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
353 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
354 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
355 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
356 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
357 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
358 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
359 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
362 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
363 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
364 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
365 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
366 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
367 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
368 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
369 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
370 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
371 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
372 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
373 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
374 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
375 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
376 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
377 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.19
Metatranscriptomes 0.81
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.88
Rhizosphere 88.58
Stem 0
Stem Tuber 0
Unclassified 0.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10007085 3300003373 Bacteria 2806
2 Ga0070658_10092060 3300005327 Bacteria 2499
3 Ga0070658_10118883 3300005327 Bacteria 2195
4 Ga0070658_10124746 3300005327 Bacteria 2142
5 Ga0070658_10482896 3300005327 Bacteria 1069
6 Ga0070683_100050130 3300005329 Bacteria 3863
7 Ga0070683_100272919 3300005329 Bacteria 1609
8 Ga0070683_100495927 3300005329 Bacteria 1166
9 Ga0070683_101564350 3300005329 Bacteria 634
10 Ga0070690_100859593 3300005330 Bacteria 707
11 Ga0070680_100053848 3300005336 Bacteria 3284
12 Ga0070680_100101092 3300005336 Bacteria 2393
13 Ga0070680_100108456 3300005336 Bacteria 2310
14 Ga0070680_100508824 3300005336 Bacteria 1031
15 Ga0070682_100152865 3300005337 Bacteria 1586
16 Ga0068868_100036832 3300005338 Bacteria 3789
17 Ga0070660_100110092 3300005339 Bacteria 2190
18 Ga0070660_100165585 3300005339 Bacteria 1784
19 Ga0070660_100330820 3300005339 Bacteria 1253
20 Ga0070660_100599982 3300005339 Bacteria 920
21 Ga0070660_100745219 3300005339 Bacteria 822
22 Ga0070689_100136273 3300005340 Bacteria 1971
23 Ga0070691_10078192 3300005341 Bacteria 1616
24 Ga0070691_10528816 3300005341 Bacteria 686
25 Ga0070687_100057362 3300005343 Bacteria 2042
26 Ga0070687_100245886 3300005343 Bacteria 1109
27 Ga0070661_100033510 3300005344 Bacteria 3720
28 Ga0070661_100061585 3300005344 Bacteria 2755
29 Ga0070692_10015268 3300005345 Bacteria 3630
30 Ga0070692_10099802 3300005345 Bacteria 1590
31 Ga0070668_100091137 3300005347 Bacteria 2403
32 Ga0070675_100071216 3300005354 Bacteria 2883
33 Ga0070675_101283618 3300005354 Bacteria 674
34 Ga0070671_100242954 3300005355 Bacteria 1529
35 Ga0070671_100748029 3300005355 Bacteria 850
36 Ga0070674_100001639 3300005356 Bacteria 12060
37 Ga0070688_100012006 3300005365 Bacteria 4839
38 Ga0070659_100219681 3300005366 Bacteria 1568
39 Ga0070659_100241014 3300005366 Bacteria 1496
40 Ga0070659_100475469 3300005366 Bacteria 1063
41 Ga0070659_100962857 3300005366 Bacteria 748
42 Ga0070659_101325316 3300005366 Bacteria 639
43 Ga0070709_10024012 3300005434 Bacteria 3586
44 Ga0070714_100053368 3300005435 Bacteria 3450
45 Ga0070714_100092282 3300005435 Bacteria 2654
46 Ga0070714_100361204 3300005435 Bacteria 1365
47 Ga0070714_100429276 3300005435 Bacteria 1253
48 Ga0070714_100453245 3300005435 Bacteria 1219
49 Ga0070714_100691547 3300005435 Bacteria 984
50 Ga0070714_100794008 3300005435 Bacteria 916
51 Ga0070714_101747024 3300005435 Bacteria 607
52 Ga0070713_100088433 3300005436 Bacteria 2659
53 Ga0070713_100094513 3300005436 Bacteria 2577
54 Ga0070713_100505707 3300005436 Bacteria 1140
55 Ga0070713_100938597 3300005436 Bacteria 833
56 Ga0070713_101237419 3300005436 Bacteria 723
57 Ga0070710_10005124 3300005437 Bacteria 6200
58 Ga0070710_10025539 3300005437 Bacteria 3129
59 Ga0070711_100896904 3300005439 Bacteria 756
60 Ga0070705_100072942 3300005440 Bacteria 2081
61 Ga0070705_100117914 3300005440 Bacteria 1708
62 Ga0070705_100347908 3300005440 Bacteria 1080
63 Ga0070705_100894461 3300005440 Bacteria 714
64 Ga0070705_101101782 3300005440 Bacteria 650
65 Ga0070705_101107289 3300005440 Bacteria 648
66 Ga0070700_100063569 3300005441 Bacteria 2335
67 Ga0070694_100156515 3300005444 Bacteria 1669
68 Ga0070694_100443972 3300005444 Bacteria 1023
69 Ga0070708_100132367 3300005445 Bacteria 2309
70 Ga0070708_100179564 3300005445 Bacteria 1978
71 Ga0070708_100675518 3300005445 Bacteria 973
72 Ga0070663_100670482 3300005455 Bacteria 879
73 Ga0070663_100854919 3300005455 Bacteria 783
74 Ga0070663_101685491 3300005455 Bacteria 566
75 Ga0070678_100020686 3300005456 Bacteria 4322
76 Ga0070678_100118341 3300005456 Bacteria 2085
77 Ga0070678_100513407 3300005456 Bacteria 1059
78 Ga0070681_10001129 3300005458 Bacteria 22933
79 Ga0070681_10109636 3300005458 Bacteria 2700
80 Ga0070681_10140248 3300005458 Bacteria 2347
81 Ga0070681_10152188 3300005458 Bacteria 2240
82 Ga0070681_10598725 3300005458 Bacteria 1017
83 Ga0070681_10741668 3300005458 Bacteria 899
84 Ga0070681_10778623 3300005458 Bacteria 873
85 Ga0068867_100030890 3300005459 Bacteria 3865
86 Ga0068867_100244804 3300005459 Bacteria 1456
87 Ga0070685_10223648 3300005466 Bacteria 1234
88 Ga0070685_10551013 3300005466 Bacteria 823
89 Ga0070706_100049868 3300005467 Bacteria 3862
90 Ga0070706_100258145 3300005467 Bacteria 1627
91 Ga0070706_100405326 3300005467 Bacteria 1269
92 Ga0070706_100864650 3300005467 Bacteria 836
93 Ga0070707_100190723 3300005468 Bacteria 1998
94 Ga0070707_100754205 3300005468 Bacteria 937
95 Ga0070707_101046201 3300005468 Bacteria 782
96 Ga0070707_101548580 3300005468 Bacteria 630
97 Ga0070698_100073605 3300005471 Bacteria 3422
98 Ga0070698_100128875 3300005471 Bacteria 2486
99 Ga0070699_100158173 3300005518 Bacteria 2005
100 Ga0070699_100622265 3300005518 Bacteria 985
101 Ga0070699_100880570 3300005518 Bacteria 820
102 Ga0070679_100160109 3300005530 Bacteria 2225
103 Ga0070679_100199276 3300005530 Bacteria 1969
104 Ga0070679_100305321 3300005530 Bacteria 1542
105 Ga0070679_100792900 3300005530 Bacteria 890
106 Ga0070684_100057188 3300005535 Bacteria 3405
107 Ga0070684_100057250 3300005535 Bacteria 3403
108 Ga0070684_100089966 3300005535 Bacteria 2728
109 Ga0070684_100293223 3300005535 Bacteria 1492
110 Ga0070684_100317442 3300005535 Bacteria 1431
111 Ga0070684_100444650 3300005535 Bacteria 1198
112 Ga0070684_100801332 3300005535 Bacteria 881
113 Ga0070697_100102146 3300005536 Bacteria 2382
114 Ga0070697_100109749 3300005536 Bacteria 2298
115 Ga0070697_100385011 3300005536 Bacteria 1215
116 Ga0070697_100829415 3300005536 Bacteria 819
117 Ga0070697_101074971 3300005536 Bacteria 716
118 Ga0068853_100306811 3300005539 Bacteria 1468
119 Ga0070672_101034147 3300005543 Bacteria 729
120 Ga0070686_100032900 3300005544 Bacteria 3182
121 Ga0070695_100089217 3300005545 Bacteria 2055
122 Ga0070695_100159593 3300005545 Bacteria 1581
123 Ga0070695_100192979 3300005545 Bacteria 1451
124 Ga0070696_100048066 3300005546 Bacteria 2961
125 Ga0070696_100056669 3300005546 Bacteria 2733
126 Ga0070696_100581900 3300005546 Bacteria 901
127 Ga0070693_100604571 3300005547 Bacteria 792
128 Ga0070693_100845452 3300005547 Bacteria 682
129 Ga0070665_100053631 3300005548 Bacteria 4044
130 Ga0070665_100870746 3300005548 Bacteria 914
131 Ga0070665_100986248 3300005548 Bacteria 855
132 Ga0070704_100002938 3300005549 Bacteria 9686
133 Ga0068855_100072684 3300005563 Bacteria 3997
134 Ga0068855_100108078 3300005563 Bacteria 3195
135 Ga0068855_100233752 3300005563 Bacteria 2057
136 Ga0068855_100302014 3300005563 Bacteria 1773
137 Ga0068855_100351765 3300005563 Bacteria 1623
138 Ga0068855_100425009 3300005563 Bacteria 1453
139 Ga0070664_100165065 3300005564 Bacteria 1962
140 Ga0070664_100716366 3300005564 Bacteria 933
141 Ga0068857_100019391 3300005577 Bacteria 5971
142 Ga0068857_100033041 3300005577 Bacteria 4574
143 Ga0068857_100059894 3300005577 Bacteria 3383
144 Ga0068857_100300411 3300005577 Bacteria 1480
145 Ga0068854_100658541 3300005578 Bacteria 900
146 Ga0068856_100062119 3300005614 Bacteria 3690
147 Ga0068856_100134039 3300005614 Bacteria 2482
148 Ga0068856_100512191 3300005614 Bacteria 1221
149 Ga0070702_100069911 3300005615 Bacteria 2070
150 Ga0070702_100170582 3300005615 Bacteria 1415
151 Ga0070702_100747294 3300005615 Bacteria 751
152 Ga0068852_100018025 3300005616 Bacteria 5553
153 Ga0068852_100045532 3300005616 Bacteria 3732
154 Ga0068852_100294898 3300005616 Bacteria 1568
155 Ga0068859_100331513 3300005617 Bacteria 1616
156 Ga0068859_101247572 3300005617 Bacteria 819
157 Ga0068864_100129295 3300005618 Bacteria 2267
158 Ga0068864_100669633 3300005618 Bacteria 1012
159 Ga0068866_10045370 3300005718 Bacteria 2204
160 Ga0068866_10104869 3300005718 Bacteria 1566
161 Ga0068861_100222240 3300005719 Bacteria 1597
162 Ga0068861_100572329 3300005719 Bacteria 1033
163 Ga0068858_100832431 3300005842 Bacteria 901
164 Ga0068862_100986186 3300005844 Bacteria 833
165 Ga0068862_101099680 3300005844 Bacteria 790
166 Ga0081455_10010251 3300005937 Bacteria 9529
167 Ga0081455_10011450 3300005937 Bacteria 8912
168 Ga0081455_10012609 3300005937 Bacteria 8423
169 Ga0081455_10243025 3300005937 Bacteria 1321
170 Ga0081455_10363616 3300005937 Bacteria 1016
171 Ga0081455_10564750 3300005937 Bacteria 749
172 Ga0081538_10000518 3300005981 Bacteria 43151
173 Ga0081538_10051296 3300005981 Bacteria 2479
174 Ga0081538_10173146 3300005981 Bacteria 938
175 Ga0081538_10174882 3300005981 Bacteria 929
176 Ga0081539_10018622 3300005985 Bacteria 4807
177 Ga0070717_10014276 3300006028 Bacteria 6109
178 Ga0070717_10521603 3300006028 Bacteria 1075
179 Ga0070715_10011644 3300006163 Bacteria 3173
180 Ga0070715_10510508 3300006163 Bacteria 690
181 Ga0070715_10692049 3300006163 Bacteria 608
182 Ga0070712_100030457 3300006175 Bacteria 3626
183 Ga0070712_100110168 3300006175 Bacteria 2053
184 Ga0070712_100177212 3300006175 Bacteria 1658
185 Ga0070712_100211056 3300006175 Bacteria 1531
186 Ga0070712_101030674 3300006175 Bacteria 713
187 Ga0097621_100870685 3300006237 Bacteria 838
188 Ga0068871_100026449 3300006358 Bacteria 4527
189 Ga0075433_10004384 3300006852 Bacteria 10975
190 Ga0075433_10024478 3300006852 Bacteria 5096
191 Ga0075433_10456585 3300006852 Bacteria 1126
192 Ga0075433_11051538 3300006852 Bacteria 708
193 Ga0075434_100005135 3300006871 Bacteria 11890
194 Ga0075434_100023021 3300006871 Bacteria 6065
195 Ga0075434_100529470 3300006871 Bacteria 1199
196 Ga0075434_101554258 3300006871 Bacteria 670
197 Ga0075434_101591479 3300006871 Bacteria 662
198 Ga0075429_100742484 3300006880 Bacteria 860
199 Ga0068865_100017722 3300006881 Bacteria 4584
200 Ga0075436_100009853 3300006914 Bacteria 6536
201 Ga0097620_100331517 3300006931 Bacteria 1616
202 Ga0097620_101247658 3300006931 Bacteria 819
203 Ga0075435_100000140 3300007076 Bacteria 40976
204 Ga0075435_100020149 3300007076 Bacteria 5103
205 Ga0075435_100024269 3300007076 Bacteria 4703
206 Ga0075435_100045328 3300007076 Bacteria 3525
207 Ga0075435_100806250 3300007076 Bacteria 817
208 Ga0105244_10238047 3300009036 Bacteria 850
209 Ga0105240_10222720 3300009093 Bacteria 2197
210 Ga0105240_10439215 3300009093 Bacteria 1463
211 Ga0105240_10637414 3300009093 Bacteria 1170
212 Ga0105240_10708309 3300009093 Bacteria 1098
213 Ga0105240_11069326 3300009093 Bacteria 860
214 Ga0105240_11110382 3300009093 Bacteria 841
215 Ga0111539_10031415 3300009094 Bacteria 6451
216 Ga0111539_10089729 3300009094 Bacteria 3612
217 Ga0111539_10867885 3300009094 Bacteria 1050
218 Ga0105245_10011977 3300009098 Bacteria 7541
219 Ga0105245_10119636 3300009098 Bacteria 2459
220 Ga0105245_10431456 3300009098 Bacteria 1323
221 Ga0105245_10746476 3300009098 Bacteria 1014
222 Ga0105245_10864972 3300009098 Bacteria 945
223 Ga0105245_11650211 3300009098 Bacteria 693
224 Ga0105247_10203629 3300009101 Bacteria 1331
225 Ga0114129_10009001 3300009147 Bacteria 14238
226 Ga0114129_10048698 3300009147 Bacteria 5955
227 Ga0114129_10056182 3300009147 Bacteria 5514
228 Ga0114129_10385876 3300009147 Bacteria 1849
229 Ga0114129_11103449 3300009147 Bacteria 993
230 Ga0114129_12821085 3300009147 Bacteria 577
231 Ga0105243_10032733 3300009148 Bacteria 4019
232 Ga0105243_10080853 3300009148 Bacteria 2651
233 Ga0105243_10513992 3300009148 Bacteria 1137
234 Ga0105243_10581757 3300009148 Bacteria 1075
235 Ga0105241_10043494 3300009174 Bacteria 3402
236 Ga0105241_10268096 3300009174 Bacteria 1454
237 Ga0105241_10405328 3300009174 Bacteria 1197
238 Ga0105241_10816530 3300009174 Bacteria 860
239 Ga0105242_10006264 3300009176 Bacteria 9162
240 Ga0105242_11961248 3300009176 Bacteria 627
241 Ga0105242_12274041 3300009176 Bacteria 588
242 Ga0105248_10008130 3300009177 Bacteria 11517
243 Ga0105248_10056872 3300009177 Bacteria 4389
244 Ga0105248_10194172 3300009177 Bacteria 2287
245 Ga0105248_10951507 3300009177 Bacteria 970
246 Ga0105248_11117168 3300009177 Bacteria 891
247 Ga0105237_10492868 3300009545 Bacteria 1232
248 Ga0105238_10023360 3300009551 Bacteria 6303
249 Ga0105249_10017957 3300009553 Bacteria 6286
250 Ga0105249_10686243 3300009553 Bacteria 1083
251 Ga0105249_11153319 3300009553 Bacteria 846
252 Ga0105249_12218630 3300009553 Bacteria 622
253 Ga0105239_10096721 3300010375 Bacteria 3262
254 Ga0105239_10515853 3300010375 Bacteria 1360
255 Ga0105239_11824757 3300010375 Bacteria 705
256 Ga0105246_10322712 3300011119 Bacteria 1255
257 Ga0157373_10164163 3300013100 Bacteria 1563
258 Ga0157371_11027283 3300013102 Bacteria 630
259 Ga0157370_10008306 3300013104 Bacteria 11204
260 Ga0157370_10300734 3300013104 Bacteria 1481
261 Ga0157370_10347658 3300013104 Bacteria 1367
262 Ga0157370_10833691 3300013104 Bacteria 838
263 Ga0157370_10932051 3300013104 Bacteria 788
264 Ga0157369_10004499 3300013105 Bacteria 16424
265 Ga0157369_10032180 3300013105 Bacteria 5769
266 Ga0157369_10045279 3300013105 Bacteria 4786
267 Ga0157369_10046810 3300013105 Bacteria 4700
268 Ga0157369_10336345 3300013105 Bacteria 1569
269 Ga0157369_10382575 3300013105 Bacteria 1461
270 Ga0157369_10462735 3300013105 Bacteria 1313
271 Ga0157369_11585855 3300013105 Bacteria 666
272 Ga0157374_10033180 3300013296 Bacteria 4709
273 Ga0157378_10018799 3300013297 Bacteria 6075
274 Ga0157378_10345069 3300013297 Bacteria 1453
275 Ga0157378_11503761 3300013297 Bacteria 718
276 Ga0163162_10030463 3300013306 Bacteria 5345
277 Ga0163162_10263641 3300013306 Bacteria 1855
278 Ga0163162_10736469 3300013306 Bacteria 1106
279 Ga0157372_10029001 3300013307 Bacteria 6038
280 Ga0157372_10140215 3300013307 Bacteria 2785
281 Ga0157372_10304928 3300013307 Bacteria 1853
282 Ga0157372_10524982 3300013307 Bacteria 1380
283 Ga0157372_10741397 3300013307 Bacteria 1142
284 Ga0157375_10064197 3300013308 Bacteria 3655
285 Ga0157375_10263695 3300013308 Bacteria 1884
286 Ga0157375_10510413 3300013308 Bacteria 1366
287 Ga0157375_10569078 3300013308 Bacteria 1294
288 Ga0157375_10839944 3300013308 Bacteria 1065
289 Ga0163163_10208813 3300014325 Bacteria 2001
290 Ga0163163_10351850 3300014325 Bacteria 1529
291 Ga0157380_10134754 3300014326 Bacteria 2112
292 Ga0157380_10692548 3300014326 Bacteria 1023
293 Ga0182008_10413879 3300014497 Bacteria 726
294 Ga0157377_10003323 3300014745 Bacteria 7271
295 Ga0157377_10562207 3300014745 Bacteria 808
296 Ga0157379_10097916 3300014968 Bacteria 2633
297 Ga0157376_10013033 3300014969 Bacteria 6193
298 Ga0157376_10077981 3300014969 Bacteria 2835
299 Ga0182006_1141934 3300015261 Bacteria 820
300 Ga0182007_10231938 3300015262 Bacteria 656
301 Ga0182007_10367363 3300015262 Bacteria 544
302 Ga0197907_11047046 3300020069 Bacteria 1367
303 Ga0197907_11349487 3300020069 Bacteria 1293
304 Ga0206356_10777109 3300020070 Bacteria 1701
305 Ga0206354_10741990 3300020081 Bacteria 2595
306 Ga0206353_10780697 3300020082 Bacteria 735
307 Ga0206353_11185381 3300020082 Bacteria 2081
308 Ga0206353_11283255 3300020082 Bacteria 4825
309 Ga0206353_11751382 3300020082 Bacteria 1296
310 Ga0206353_11789119 3300020082 Bacteria 2995
311 Ga0213873_10039551 3300021358 Bacteria 1209
312 Ga0213874_10142815 3300021377 Bacteria 830
313 Ga0213876_10273908 3300021384 Bacteria 897
314 Ga0213871_10077264 3300021441 Bacteria 949
315 Ga0207692_10064075 3300025898 Bacteria 1912
316 Ga0207692_10113744 3300025898 Bacteria 1505
317 Ga0207710_10343985 3300025900 Bacteria 759
318 Ga0207688_10072754 3300025901 Bacteria 1953
319 Ga0207688_10143079 3300025901 Bacteria 1408
320 Ga0207688_10228445 3300025901 Bacteria 1123
321 Ga0207688_10639295 3300025901 Bacteria 671
322 Ga0207688_10839980 3300025901 Bacteria 582
323 Ga0207685_10003453 3300025905 Bacteria 3846
324 Ga0207685_10042480 3300025905 Bacteria 1707
325 Ga0207685_10429030 3300025905 Bacteria 683
326 Ga0207685_10487818 3300025905 Bacteria 646
327 Ga0207699_10612734 3300025906 Bacteria 793
328 Ga0207684_10039896 3300025910 Bacteria 3980
329 Ga0207684_10308549 3300025910 Bacteria 1364
330 Ga0207684_10702501 3300025910 Bacteria 859
331 Ga0207707_10014838 3300025912 Bacteria 6786
332 Ga0207707_10111137 3300025912 Bacteria 2396
333 Ga0207707_10146159 3300025912 Bacteria 2067
334 Ga0207707_10198241 3300025912 Bacteria 1751
335 Ga0207707_10584770 3300025912 Bacteria 946
336 Ga0207695_10543070 3300025913 Bacteria 1044
337 Ga0207695_11223259 3300025913 Bacteria 631
338 Ga0207695_11391233 3300025913 Bacteria 582
339 Ga0207671_10044114 3300025914 Bacteria 3297
340 Ga0207693_10003565 3300025915 Bacteria 13299
341 Ga0207693_10018792 3300025915 Bacteria 5500
342 Ga0207693_10019938 3300025915 Bacteria 5333
343 Ga0207693_10086334 3300025915 Bacteria 2459
344 Ga0207693_10302964 3300025915 Bacteria 1252
345 Ga0207693_10422443 3300025915 Bacteria 1042
346 Ga0207693_10452898 3300025915 Bacteria 1003
347 Ga0207693_10651909 3300025915 Bacteria 818
348 Ga0207693_11210892 3300025915 Bacteria 569
349 Ga0207663_10007094 3300025916 Bacteria 5786
350 Ga0207663_10226444 3300025916 Bacteria 1363
351 Ga0207663_10381228 3300025916 Bacteria 1074
352 Ga0207660_10009367 3300025917 Bacteria 6338
353 Ga0207660_10028394 3300025917 Bacteria 3826
354 Ga0207660_10183140 3300025917 Bacteria 1628
355 Ga0207660_10185704 3300025917 Bacteria 1617
356 Ga0207660_10193902 3300025917 Bacteria 1583
357 Ga0207660_10444825 3300025917 Bacteria 1047
358 Ga0207662_10269070 3300025918 Bacteria 1124
359 Ga0207657_10000416 3300025919 Bacteria 45222
360 Ga0207657_10000610 3300025919 Bacteria 37898
361 Ga0207657_10004617 3300025919 Bacteria 14547
362 Ga0207657_10022825 3300025919 Bacteria 5842
363 Ga0207657_10151254 3300025919 Bacteria 1890
364 Ga0207657_10154164 3300025919 Bacteria 1869
365 Ga0207657_10296287 3300025919 Bacteria 1282
366 Ga0207657_10463485 3300025919 Bacteria 994
367 Ga0207649_10034017 3300025920 Bacteria 3050
368 Ga0207649_10058915 3300025920 Bacteria 2407
369 Ga0207649_10261521 3300025920 Bacteria 1250
370 Ga0207649_10517658 3300025920 Bacteria 909
371 Ga0207652_10003206 3300025921 Bacteria 13597
372 Ga0207652_10017952 3300025921 Bacteria 5797
373 Ga0207652_10213248 3300025921 Bacteria 1739
374 Ga0207652_10315648 3300025921 Bacteria 1411
375 Ga0207652_11106148 3300025921 Bacteria 693
376 Ga0207646_10116678 3300025922 Bacteria 2398
377 Ga0207646_10140658 3300025922 Bacteria 2173
378 Ga0207646_10480907 3300025922 Bacteria 1120
379 Ga0207646_10956458 3300025922 Bacteria 758
380 Ga0207646_11341739 3300025922 Bacteria 623
381 Ga0207646_11371729 3300025922 Bacteria 616
382 Ga0207646_11774333 3300025922 Bacteria 528
383 Ga0207659_10032822 3300025926 Bacteria 3567
384 Ga0207659_10350236 3300025926 Bacteria 1225
385 Ga0207687_10016945 3300025927 Bacteria 4788
386 Ga0207687_10403443 3300025927 Bacteria 1125
387 Ga0207700_10000004 3300025928 Bacteria 443409
388 Ga0207700_10126938 3300025928 Bacteria 2077
389 Ga0207700_10205214 3300025928 Bacteria 1663
390 Ga0207700_10223947 3300025928 Bacteria 1596
391 Ga0207700_11029053 3300025928 Bacteria 737
392 Ga0207664_10002557 3300025929 Bacteria 12026
393 Ga0207664_10116950 3300025929 Bacteria 2225
394 Ga0207664_10152546 3300025929 Bacteria 1964
395 Ga0207664_10176820 3300025929 Bacteria 1830
396 Ga0207664_10178321 3300025929 Bacteria 1823
397 Ga0207664_10180407 3300025929 Bacteria 1812
398 Ga0207664_11029652 3300025929 Bacteria 737
399 Ga0207644_10178931 3300025931 Bacteria 1661
400 Ga0207644_10423624 3300025931 Bacteria 1091
401 Ga0207644_11057209 3300025931 Bacteria 682
402 Ga0207690_10034236 3300025932 Bacteria 3272
403 Ga0207690_10047168 3300025932 Bacteria 2857
404 Ga0207690_10155708 3300025932 Bacteria 1698
405 Ga0207690_10180276 3300025932 Bacteria 1590
406 Ga0207690_10321389 3300025932 Bacteria 1217
407 Ga0207706_10031346 3300025933 Bacteria 4737
408 Ga0207706_10390263 3300025933 Bacteria 1207
409 Ga0207686_10048195 3300025934 Bacteria 2638
410 Ga0207686_10895129 3300025934 Bacteria 716
411 Ga0207709_10496246 3300025935 Bacteria 952
412 Ga0207669_10075065 3300025937 Bacteria 2141
413 Ga0207669_10292088 3300025937 Bacteria 1235
414 Ga0207669_10968653 3300025937 Bacteria 714
415 Ga0207704_10004032 3300025938 Bacteria 6686
416 Ga0207665_10070955 3300025939 Bacteria 2377
417 Ga0207665_10502673 3300025939 Bacteria 937
418 Ga0207691_10013728 3300025940 Bacteria 7739
419 Ga0207691_10539009 3300025940 Bacteria 990
420 Ga0207711_10090389 3300025941 Bacteria 2692
421 Ga0207711_10096344 3300025941 Bacteria 2611
422 Ga0207711_11140097 3300025941 Bacteria 721
423 Ga0207661_10023738 3300025944 Bacteria 4638
424 Ga0207661_10209783 3300025944 Bacteria 1716
425 Ga0207661_10263049 3300025944 Bacteria 1537
426 Ga0207661_10768524 3300025944 Bacteria 887
427 Ga0207661_10837006 3300025944 Bacteria 847
428 Ga0207667_10099837 3300025949 Bacteria 2995
429 Ga0207667_10136696 3300025949 Bacteria 2524
430 Ga0207667_10143680 3300025949 Bacteria 2456
431 Ga0207667_10194294 3300025949 Bacteria 2082
432 Ga0207667_10239947 3300025949 Bacteria 1855
433 Ga0207667_10253165 3300025949 Bacteria 1801
434 Ga0207667_10594592 3300025949 Bacteria 1116
435 Ga0207667_10884102 3300025949 Bacteria 886
436 Ga0207667_11168952 3300025949 Bacteria 750
437 Ga0207651_10159469 3300025960 Bacteria 1767
438 Ga0207712_10032434 3300025961 Bacteria 3526
439 Ga0207712_10863529 3300025961 Bacteria 798
440 Ga0207668_10197019 3300025972 Bacteria 1601
441 Ga0207640_10812205 3300025981 Bacteria 811
442 Ga0207640_10939913 3300025981 Bacteria 757
443 Ga0207640_11179175 3300025981 Bacteria 680
444 Ga0207677_10094427 3300026023 Bacteria 2183
445 Ga0207677_10568347 3300026023 Bacteria 991
446 Ga0207677_10891209 3300026023 Bacteria 801
447 Ga0207703_10355749 3300026035 Bacteria 1349
448 Ga0207639_10068169 3300026041 Bacteria 2771
449 Ga0207678_10018270 3300026067 Bacteria 6158
450 Ga0207678_10194806 3300026067 Bacteria 1732
451 Ga0207708_10022143 3300026075 Bacteria 4799
452 Ga0207708_10024328 3300026075 Bacteria 4581
453 Ga0207702_10022866 3300026078 Bacteria 5187
454 Ga0207702_10199303 3300026078 Bacteria 1855
455 Ga0207702_10307064 3300026078 Bacteria 1507
456 Ga0207702_11335426 3300026078 Bacteria 711
457 Ga0207641_10704317 3300026088 Bacteria 995
458 Ga0207641_10820819 3300026088 Bacteria 921
459 Ga0207648_10004050 3300026089 Bacteria 15221
460 Ga0207648_10049380 3300026089 Bacteria 3681
461 Ga0207648_10373785 3300026089 Bacteria 1288
462 Ga0207676_10466005 3300026095 Bacteria 1194
463 Ga0207676_10477664 3300026095 Bacteria 1180
464 Ga0207674_10009649 3300026116 Bacteria 11008
465 Ga0207674_10015268 3300026116 Bacteria 8445
466 Ga0207674_10033571 3300026116 Bacteria 5372
467 Ga0207674_10034595 3300026116 Bacteria 5280
468 Ga0207675_100138731 3300026118 Bacteria 2309
469 Ga0207675_101862906 3300026118 Bacteria 620
470 Ga0207683_10002338 3300026121 Bacteria 16626
471 Ga0207683_10105840 3300026121 Bacteria 2515
472 Ga0207683_10206846 3300026121 Bacteria 1785
473 Ga0207683_10703252 3300026121 Bacteria 937
474 Ga0207698_10013668 3300026142 Bacteria 5365
475 Ga0207698_10125784 3300026142 Bacteria 2179
476 Ga0207698_10147953 3300026142 Bacteria 2034
477 Ga0207698_10329570 3300026142 Bacteria 1433
478 Ga0207698_10457688 3300026142 Bacteria 1233
479 Ga0207428_10297768 3300027907 Bacteria 1194
480 Ga0207428_10336607 3300027907 Bacteria 1112
481 Ga0268266_10048959 3300028379 Bacteria 3623
482 Ga0268266_10815941 3300028379 Bacteria 901
483 Ga0268266_10938016 3300028379 Bacteria 837
484 Ga0265319_1120671 3300028563 Bacteria 817
485 Ga0265334_10015319 3300028573 Bacteria 3186
486 Ga0265334_10033057 3300028573 Bacteria 2061
487 Ga0265334_10114416 3300028573 Bacteria 968
488 Ga0265334_10142860 3300028573 Bacteria 847
489 Ga0265318_10010160 3300028577 Bacteria 4112
490 Ga0265318_10025573 3300028577 Bacteria 2330
491 Ga0265318_10266915 3300028577 Bacteria 624
492 Ga0265322_10015344 3300028654 Bacteria 2214
493 Ga0265338_10028139 3300028800 Bacteria 5615
494 Ga0265328_10044387 3300031239 Bacteria 1635
495 Ga0265320_10226574 3300031240 Bacteria 832
496 Ga0265325_10029899 3300031241 Bacteria 2925
497 Ga0265327_10097793 3300031251 Bacteria 1421
498 Ga0265327_10413925 3300031251 Bacteria 584
499 Ga0265316_10181661 3300031344 Bacteria 1566
500 Ga0265316_10761147 3300031344 Bacteria 680
501 Ga0307408_100015573 3300031548 Bacteria 5064
502 Ga0307408_100287868 3300031548 Bacteria 1371
503 Ga0307408_100384526 3300031548 Bacteria 1201
504 Ga0307408_100533329 3300031548 Bacteria 1033
505 Ga0265313_10055786 3300031595 Bacteria 1870
506 Ga0265314_10012245 3300031711 Bacteria 7017
507 Ga0265342_10150680 3300031712 Bacteria 1291
508 Ga0265342_10332060 3300031712 Bacteria 795
509 Ga0307405_10004812 3300031731 Bacteria 6440
510 Ga0307405_10435309 3300031731 Bacteria 1036
511 Ga0307405_11088093 3300031731 Bacteria 686
512 Ga0307413_10597116 3300031824 Bacteria 903
513 Ga0307410_10417627 3300031852 Bacteria 1087
514 Ga0307406_10182313 3300031901 Bacteria 1530
515 Ga0307406_11130915 3300031901 Bacteria 677
516 Ga0307407_10031785 3300031903 Bacteria 2863
517 Ga0307407_10502923 3300031903 Bacteria 889
518 Ga0307412_10560373 3300031911 Bacteria 961
519 Ga0307412_10940949 3300031911 Bacteria 760
520 Ga0307412_11086437 3300031911 Bacteria 711
521 Ga0307409_100025747 3300031995 Bacteria 4134
522 Ga0307409_100061797 3300031995 Bacteria 2929
523 Ga0307416_100040131 3300032002 Bacteria 3633
524 Ga0307416_100118391 3300032002 Bacteria 2353
525 Ga0307416_100222007 3300032002 Bacteria 1813
526 Ga0307416_100360839 3300032002 Bacteria 1475
527 Ga0307416_101218764 3300032002 Bacteria 858
528 Ga0307414_10243475 3300032004 Bacteria 1490
529 Ga0307411_10153998 3300032005 Bacteria 1712
530 Ga0307415_100832037 3300032126 Bacteria 845
531 Ga0307415_101273243 3300032126 Bacteria 695
532 Ga0373959_0019332 3300034820 Bacteria 1290
533 Ga0373926_0095199 3300035083 Bacteria 1110
534 Ga0373934_0137215 3300035086 Bacteria 999
535 Ga0373934_0430607 3300035086 Bacteria 552
536 Ga0373944_0072406 3300035089 Bacteria 1125
537 Ga0373936_0020681 3300035113 Bacteria 2558
538 Ga0373953_0032746 3300035117 Bacteria 2030
539 Ga0373953_0330680 3300035117 Bacteria 667
540 Ga0373957_0025026 3300035120 Bacteria 2148
541 Ga0373943_0000899 3300035170 Bacteria 13105
542 Ga0373943_0039717 3300035170 Bacteria 2269
543 Ga0373943_0087086 3300035170 Bacteria 1611
544 Ga0373946_0044796 3300035171 Bacteria 1828
545 Ga0373955_0008799 3300035172 Bacteria 4704
546 Ga0373942_0049779 3300035207 Bacteria 1171
547 Ga0373924_0079925 3300035410 Bacteria 1389
548 Ga0373931_0039207 3300035691 Bacteria 2482
549 Ga0373927_0135226 3300035695 Bacteria 1611
550 Ga0373927_0281848 3300035695 Bacteria 1093
551 Ga0373933_0297194 3300035724 Bacteria 1045
552 Ga0373947_0003187 3300035725 Bacteria 9757
553 Ga0373947_0033686 3300035725 Bacteria 3026
554 Ga0373947_0060207 3300035725 Bacteria 2305
555 Ga0373947_0760366 3300035725 Bacteria 661
556 Ga0373937_0076296 3300036401 Bacteria 3095
557 Ga0373937_0193836 3300036401 Bacteria 1910
558 Ga0373925_0744518 3300037068 Bacteria 808
559 Ga0395899_0001001 3300037312 Bacteria 25945
560 Ga0395899_0015657 3300037312 Bacteria 5783
561 Ga0395899_0018455 3300037312 Bacteria 5303
562 Ga0395899_0032687 3300037312 Bacteria 3910
563 Ga0395899_0035364 3300037312 Bacteria 3750
564 Ga0395899_0041054 3300037312 Bacteria 3458
565 Ga0395899_0081807 3300037312 Bacteria 2349
566 Ga0395899_0090882 3300037312 Bacteria 2213
567 Ga0395899_0091878 3300037312 Bacteria 2198
568 Ga0395899_0094300 3300037312 Bacteria 2166
569 Ga0395899_0146113 3300037312 Bacteria 1679
570 Ga0395899_0212186 3300037312 Bacteria 1345
571 Ga0395899_0272526 3300037312 Bacteria 1154
572 Ga0395899_0650435 3300037312 Bacteria 666
573 Ga0395899_0948472 3300037312 Bacteria 522
574 Ga0395900_0004233 3300037418 Bacteria 15232
575 Ga0395900_0004700 3300037418 Bacteria 14396
576 Ga0395900_0004724 3300037418 Bacteria 14368
577 Ga0395900_0014519 3300037418 Bacteria 8037
578 Ga0395900_0015755 3300037418 Bacteria 7705
579 Ga0395900_0015897 3300037418 Bacteria 7666
580 Ga0395900_0025692 3300037418 Bacteria 6029
581 Ga0395900_0028300 3300037418 Bacteria 5740
582 Ga0395900_0029582 3300037418 Bacteria 5619
583 Ga0395900_0032992 3300037418 Bacteria 5328
584 Ga0395900_0086108 3300037418 Bacteria 3229
585 Ga0395900_0109879 3300037418 Bacteria 2833
586 Ga0395900_0116756 3300037418 Bacteria 2738
587 Ga0395900_0172876 3300037418 Bacteria 2198
588 Ga0395900_0173719 3300037418 Bacteria 2192
589 Ga0395900_0187989 3300037418 Bacteria 2096
590 Ga0395900_0201725 3300037418 Bacteria 2012
591 Ga0395900_0229164 3300037418 Bacteria 1869
592 Ga0395900_0315526 3300037418 Bacteria 1545
593 Ga0395900_0424851 3300037418 Bacteria 1289
594 Ga0395900_0654618 3300037418 Bacteria 987
595 Ga0395898_0004894 3300037466 Bacteria 14544
596 Ga0395898_0006542 3300037466 Bacteria 12435
597 Ga0395898_0008982 3300037466 Bacteria 10525
598 Ga0395898_0016102 3300037466 Bacteria 7659
599 Ga0395898_0021780 3300037466 Bacteria 6494
600 Ga0395898_0031400 3300037466 Bacteria 5307
601 Ga0395898_0039643 3300037466 Bacteria 4661
602 Ga0395898_0053413 3300037466 Bacteria 3946
603 Ga0395898_0076712 3300037466 Bacteria 3227
604 Ga0395898_0119682 3300037466 Bacteria 2523
605 Ga0395898_0155740 3300037466 Bacteria 2185
606 Ga0395898_0171390 3300037466 Bacteria 2075
607 Ga0395898_0196487 3300037466 Bacteria 1927
608 Ga0395898_0244556 3300037466 Bacteria 1711
609 Ga0395898_0285893 3300037466 Bacteria 1573
610 Ga0395898_0506784 3300037466 Bacteria 1148
611 Ga0395898_0832280 3300037466 Bacteria 863
612 Ga0395898_1158190 3300037466 Bacteria 705
613 Ga0395905_0005063 3300037471 Bacteria 13564
614 Ga0395905_0005451 3300037471 Bacteria 12987
615 Ga0395905_0010082 3300037471 Bacteria 9209
616 Ga0395905_0014689 3300037471 Bacteria 7468
617 Ga0395905_0023069 3300037471 Bacteria 5883
618 Ga0395905_0028306 3300037471 Bacteria 5281
619 Ga0395905_0064605 3300037471 Bacteria 3425
620 Ga0395905_0079795 3300037471 Bacteria 3067
621 Ga0395905_0103737 3300037471 Bacteria 2669
622 Ga0395905_0104764 3300037471 Bacteria 2656
623 Ga0395905_0108622 3300037471 Bacteria 2604
624 Ga0395905_0301032 3300037471 Bacteria 1491
625 Ga0395905_0491894 3300037471 Bacteria 1126
626 Ga0395905_0491959 3300037471 Bacteria 1126
627 Ga0395905_0560368 3300037471 Bacteria 1044
628 Ga0395905_0818853 3300037471 Bacteria 834
629 Ga0395905_1026758 3300037471 Bacteria 728
630 Ga0395901_0002221 3300038443 Bacteria 19812
631 Ga0395901_0002468 3300038443 Bacteria 18763
632 Ga0395901_0016661 3300038443 Bacteria 7487
633 Ga0395901_0017935 3300038443 Bacteria 7225
634 Ga0395901_0018242 3300038443 Bacteria 7164
635 Ga0395901_0029987 3300038443 Bacteria 5603
636 Ga0395901_0036111 3300038443 Bacteria 5105
637 Ga0395901_0049122 3300038443 Bacteria 4382
638 Ga0395901_0052058 3300038443 Bacteria 4256
639 Ga0395901_0053242 3300038443 Bacteria 4205
640 Ga0395901_0095541 3300038443 Bacteria 3114
641 Ga0395901_0115220 3300038443 Bacteria 2823
642 Ga0395901_0168721 3300038443 Bacteria 2297
643 Ga0395901_0181430 3300038443 Bacteria 2208
644 Ga0395901_0284494 3300038443 Bacteria 1717
645 Ga0395901_0291567 3300038443 Bacteria 1693
646 Ga0395901_0408991 3300038443 Bacteria 1393
647 Ga0395901_0475947 3300038443 Bacteria 1274
648 Ga0395901_0667355 3300038443 Bacteria 1041
649 Ga0395901_0745974 3300038443 Bacteria 972
650 Ga0395901_0817566 3300038443 Bacteria 919
651 Ga0395901_1223430 3300038443 Bacteria 716
652 Ga0436365_1553456 3300039437 Bacteria 1073
653 Ga0436360_0506477 3300039438 Bacteria 5147
654 Ga0436360_0511686 3300039438 Bacteria 594
655 Ga0436363_0668989 3300039450 Bacteria 616
656 Ga0436363_1348640 3300039450 Bacteria 678
657 Ga0436362_0327669 3300039453 Bacteria 2618
658 Ga0439438_045069 3300041405 Bacteria 1135
659 Ga0439438_120893 3300041405 Bacteria 630
660 Ga0439461_0003605 3300041410 Bacteria 2553
661 Ga0439465_0098857 3300041413 Bacteria 1006
662 Ga0451835_0827407 3300041492 Bacteria 906
663 Ga0439431_0130726 3300041997 Bacteria 705
664 Ga0439441_012332 3300042001 Bacteria 1465
665 Ga0439445_0242928 3300042004 Bacteria 537
666 Ga0439463_043686 3300042016 Bacteria 1141
667 Ga0450917_008674 3300042120 Bacteria 790
668 Ga0450906_055882 3300042145 Bacteria 699
669 Ga0450907_011944 3300042146 Bacteria 1443
670 Ga0439446_0361271 3300042156 Bacteria 519
671 Ga0450908_042915 3300042184 Bacteria 784
672 Ga0439434_0015538 3300042435 Bacteria 2271
673 Ga0466969_0103243 3300044656 Bacteria 1340
674 Ga0466972_0455956 3300044658 Bacteria 601
675 Ga0466966_0013321 3300044684 Bacteria 5444
676 Ga0466966_0055786 3300044684 Bacteria 2500
677 Ga0466966_0103961 3300044684 Bacteria 1755
678 Ga0466966_0128302 3300044684 Bacteria 1554
679 Ga0466966_0296909 3300044684 Bacteria 971
680 Ga0466961_0001805 3300044693 Bacteria 13266
681 Ga0466963_0003083 3300044694 Bacteria 9444
682 Ga0466963_0041038 3300044694 Bacteria 3034
683 Ga0466964_0003275 3300044706 Bacteria 5892
684 Ga0466964_0004021 3300044706 Bacteria 5405
685 Ga0466964_0006266 3300044706 Bacteria 4432
686 Ga0466964_0007545 3300044706 Bacteria 4070
687 Ga0466964_0125030 3300044706 Bacteria 1164
688 Ga0466971_0026732 3300044719 Bacteria 2581
689 Ga0466968_0026293 3300044735 Bacteria 2387
690 Ga0466968_0265340 3300044735 Bacteria 818
691 Ga0466957_0035461 3300044842 Bacteria 2993
692 Ga0466957_0045276 3300044842 Bacteria 2669
693 Ga0466957_0102563 3300044842 Bacteria 1805
694 Ga0466957_0199451 3300044842 Bacteria 1314
695 Ga0466957_0603646 3300044842 Bacteria 768
696 Ga0466960_0026703 3300044901 Bacteria 2626
697 Ga0466959_0059584 3300045049 Bacteria 2780
698 Ga0466959_0138653 3300045049 Bacteria 1720
699 Ga0466959_0148827 3300045049 Bacteria 1651
700 Ga0466958_0007711 3300045836 Bacteria 5937
701 Ga0466958_0066985 3300045836 Bacteria 2193
702 Ga0466958_0214086 3300045836 Bacteria 1228
703 Ga0466958_0220499 3300045836 Bacteria 1210
704 Ga0466958_0853854 3300045836 Bacteria 594
705 Ga0466967_0001914 3300045976 Bacteria 12584
706 Ga0466967_0003262 3300045976 Bacteria 10507
707 Ga0466967_0011854 3300045976 Bacteria 6631
708 Ga0466967_0015468 3300045976 Bacteria 5982
709 Ga0466967_0025617 3300045976 Bacteria 4867
710 Ga0466967_0054908 3300045976 Bacteria 3508
711 Ga0466967_0084997 3300045976 Bacteria 2864
712 Ga0466967_0087121 3300045976 Bacteria 2830
713 Ga0466967_0094124 3300045976 Bacteria 2727
714 Ga0466967_0115898 3300045976 Bacteria 2468
715 Ga0466967_0137708 3300045976 Bacteria 2271
716 Ga0466967_0160751 3300045976 Bacteria 2108
717 Ga0466967_0179667 3300045976 Bacteria 1995
718 Ga0466967_0213864 3300045976 Bacteria 1829
719 Ga0466967_0237608 3300045976 Bacteria 1737
720 Ga0466967_0433146 3300045976 Bacteria 1283
721 Ga0466967_0551817 3300045976 Bacteria 1134
722 Ga0466967_0858283 3300045976 Bacteria 902
723 Ga0466967_1476351 3300045976 Bacteria 677
724 Ga0495592_0112947 3300046454 Bacteria 1920
725 Ga0495592_0114033 3300046454 Bacteria 1909
726 Ga0495592_0750564 3300046454 Bacteria 583
727 Ga0495603_0023275 3300046455 Bacteria 3751
728 Ga0495629_0046938 3300046459 Bacteria 3029
729 Ga0495629_0114708 3300046459 Bacteria 1877
730 Ga0495629_0483832 3300046459 Bacteria 836
731 Ga0495629_0819019 3300046459 Bacteria 613
732 Ga0495641_0001250 3300046461 Bacteria 21835
733 Ga0495641_0023550 3300046461 Bacteria 3056
734 Ga0495651_0012474 3300046462 Bacteria 6553
735 Ga0495651_0040858 3300046462 Bacteria 3603
736 Ga0495651_0248700 3300046462 Bacteria 1215
737 Ga0495653_0061120 3300046463 Bacteria 2851
738 Ga0495653_0587652 3300046463 Bacteria 686
739 Ga0495582_0000397 3300046473 Bacteria 23729
740 Ga0495582_0127741 3300046473 Bacteria 1435
741 Ga0495605_0061489 3300046474 Bacteria 1797
742 Ga0495605_0183141 3300046474 Bacteria 920
743 Ga0495639_0002254 3300046475 Bacteria 8463
744 Ga0495662_0035472 3300046476 Bacteria 2406
745 Ga0495664_0016551 3300046477 Bacteria 4202
746 Ga0495664_0276691 3300046477 Bacteria 1014
747 Ga0495664_0496142 3300046477 Bacteria 729
748 Ga0495584_0084022 3300046491 Bacteria 1603
749 Ga0495584_0105889 3300046491 Bacteria 1422
750 Ga0495584_0108216 3300046491 Bacteria 1406
751 Ga0495585_0266184 3300046492 Bacteria 851
752 Ga0495596_0074630 3300046500 Bacteria 1317
753 Ga0495596_0105199 3300046500 Bacteria 1096
754 Ga0495596_0156887 3300046500 Bacteria 884
755 Ga0495596_0335123 3300046500 Bacteria 589
756 Ga0495607_0099382 3300046501 Bacteria 1561
757 Ga0495607_0225143 3300046501 Bacteria 915
758 Ga0495607_0245655 3300046501 Bacteria 864
759 Ga0495608_0029157 3300046511 Bacteria 3746
760 Ga0495608_0052486 3300046511 Bacteria 2699
761 Ga0495616_0088845 3300046513 Bacteria 1467
762 Ga0495616_0428307 3300046513 Bacteria 539
763 Ga0495618_0241671 3300046514 Bacteria 1135
764 Ga0495618_0260148 3300046514 Bacteria 1087
765 Ga0495628_0013424 3300046516 Bacteria 6891
766 Ga0495628_0181249 3300046516 Bacteria 1593
767 Ga0495630_0066836 3300046517 Bacteria 2702
768 Ga0495630_0075867 3300046517 Bacteria 2532
769 Ga0495630_0135334 3300046517 Bacteria 1872
770 Ga0495630_0228121 3300046517 Bacteria 1422
771 Ga0495630_0398463 3300046517 Bacteria 1054
772 Ga0495630_0538046 3300046517 Bacteria 896
773 Ga0495631_0325870 3300046518 Bacteria 654
774 Ga0495637_0028523 3300046520 Bacteria 2493
775 Ga0495644_0128343 3300046523 Bacteria 966
776 Ga0495663_0154082 3300046525 Bacteria 786
777 Ga0495663_0268888 3300046525 Bacteria 609
778 Ga0495666_0019709 3300046526 Bacteria 3345
779 Ga0495666_0100536 3300046526 Bacteria 1363
780 Ga0495642_0235976 3300046528 Bacteria 799
781 Ga0495652_0012598 3300046529 Bacteria 7623
782 Ga0495652_0189526 3300046529 Bacteria 1570
783 Ga0495652_0402912 3300046529 Bacteria 968
784 Ga0495665_0026888 3300046531 Bacteria 3089
785 Ga0495640_0035402 3300046533 Bacteria 3533
786 Ga0495640_0044499 3300046533 Bacteria 3086
787 Ga0495586_0103308 3300046535 Bacteria 1583
788 Ga0495587_0022577 3300046536 Bacteria 3874
789 Ga0495587_0048446 3300046536 Bacteria 2516
790 Ga0495598_0102770 3300046537 Bacteria 948
791 Ga0495598_0131980 3300046537 Bacteria 857
792 Ga0495645_0060684 3300046543 Bacteria 2741
793 Ga0495645_0096890 3300046543 Bacteria 2101
794 Ga0495645_0180645 3300046543 Bacteria 1446
795 Ga0495645_0626745 3300046543 Bacteria 659
796 Ga0495667_0041845 3300046559 Bacteria 3037
797 Ga0495667_0050247 3300046559 Bacteria 2753
798 Ga0495667_0478577 3300046559 Bacteria 781
799 Ga0495667_0502674 3300046559 Bacteria 759
800 Ga0495656_0036803 3300046615 Bacteria 2018
801 Ga0495656_0196125 3300046615 Bacteria 1000
802 Ga0495634_0076063 3300046642 Bacteria 2204
803 Ga0495634_0120097 3300046642 Bacteria 1683
804 Ga0495611_0094636 3300046648 Bacteria 1382
805 Ga0495635_0013378 3300046663 Bacteria 5743
806 Ga0495635_0015938 3300046663 Bacteria 5250
807 Ga0495659_0171023 3300046664 Bacteria 881
808 Ga0495661_0370205 3300046665 Bacteria 702
809 Ga0495661_0420876 3300046665 Bacteria 647
810 Ga0495588_0059077 3300046674 Bacteria 1983
811 Ga0495657_0038175 3300046675 Bacteria 3307
812 Ga0495657_0116590 3300046675 Bacteria 1686
813 Ga0495657_0175077 3300046675 Bacteria 1319
814 Ga0495657_0390097 3300046675 Bacteria 820
815 Ga0495657_0562755 3300046675 Bacteria 661
816 Ga0495599_0101990 3300046678 Bacteria 1788
817 Ga0495599_0317149 3300046678 Bacteria 939
818 Ga0495599_0727878 3300046678 Bacteria 570
819 Ga0495623_0041457 3300046679 Bacteria 2935
820 Ga0495623_0118047 3300046679 Bacteria 1601
821 Ga0495646_0101109 3300046680 Bacteria 1653
822 Ga0495646_0105173 3300046680 Bacteria 1613
823 Ga0495647_0001542 3300046681 Bacteria 7117
824 Ga0495658_0001563 3300046683 Bacteria 11965
825 Ga0495669_0300484 3300046684 Bacteria 774
826 Ga0495613_0001506 3300046689 Bacteria 17725
827 Ga0495613_0319079 3300046689 Bacteria 1073
828 Ga0495613_0736123 3300046689 Bacteria 647
829 Ga0495624_0494701 3300046690 Bacteria 732
830 Ga0495649_0564922 3300046694 Bacteria 563
831 Ga0495589_0107891 3300046794 Bacteria 1345
832 Ga0495589_0426537 3300046794 Bacteria 608
833 Ga0495600_0057459 3300046809 Bacteria 2541
834 Ga0495600_0133015 3300046809 Bacteria 1616
835 Ga0495581_0002960 3300047315 Bacteria 9722
836 Ga0495581_0412987 3300047315 Bacteria 787
837 Ga0495604_0003309 3300047317 Bacteria 12857
838 Ga0495604_0163609 3300047317 Bacteria 1570
839 Ga0495604_0166394 3300047317 Bacteria 1554
840 Ga0495636_0246872 3300047318 Bacteria 825
841 Ga0495674_0038374 3300047319 Bacteria 4300
842 Ga0495674_0046005 3300047319 Bacteria 3875
843 Ga0495674_0055190 3300047319 Bacteria 3485
844 Ga0495674_0066253 3300047319 Bacteria 3134
845 Ga0495676_0087650 3300047321 Bacteria 2338
846 Ga0495680_0006197 3300047322 Bacteria 11149
847 Ga0495680_0006671 3300047322 Bacteria 10691
848 Ga0495680_0080049 3300047322 Bacteria 2469
849 Ga0495680_0095433 3300047322 Bacteria 2223
850 Ga0495680_0374265 3300047322 Bacteria 988
851 Ga0495683_0432331 3300047323 Bacteria 543
852 Ga0495675_0054671 3300047444 Bacteria 2533
853 Ga0495684_0019345 3300047471 Bacteria 5242
854 Ga0495684_0029105 3300047471 Bacteria 4239
855 Ga0495593_0004029 3300047673 Bacteria 8758
856 Ga0495602_0006483 3300048088 Bacteria 12277
857 Ga0495602_0087030 3300048088 Bacteria 2606
858 Ga0495602_0132184 3300048088 Bacteria 1988
859 Ga0495602_0157092 3300048088 Bacteria 1780
860 Ga0495614_0197046 3300048089 Bacteria 910
861 Ga0496100_0008217 3300048903 Bacteria 5813
862 Ga0496100_0013049 3300048903 Bacteria 4781
863 Ga0496100_0017810 3300048903 Bacteria 4202
864 Ga0496100_0082161 3300048903 Bacteria 2178
865 Ga0496100_0287704 3300048903 Bacteria 1227
866 Ga0496100_0426778 3300048903 Bacteria 1013
867 Ga0496100_0679569 3300048903 Bacteria 803
868 Ga0496100_0694590 3300048903 Bacteria 794
869 Ga0496101_0001675 3300048904 Bacteria 13292
870 Ga0496101_0003097 3300048904 Bacteria 10285
871 Ga0496101_0088309 3300048904 Bacteria 2302
872 Ga0496101_0159668 3300048904 Bacteria 1728
873 Ga0496101_0167196 3300048904 Bacteria 1689
874 Ga0496101_0285496 3300048904 Bacteria 1291
875 Ga0496101_0465055 3300048904 Bacteria 998
876 Ga0496102_0007218 3300048905 Bacteria 9482
877 Ga0496102_0010358 3300048905 Bacteria 8019
878 Ga0496102_0040337 3300048905 Bacteria 4222
879 Ga0496102_0066040 3300048905 Bacteria 3316
880 Ga0496102_0327479 3300048905 Bacteria 1443
881 Ga0496102_0525111 3300048905 Bacteria 1106
882 Ga0496102_0574841 3300048905 Bacteria 1050
883 Ga0496103_0011909 3300048906 Bacteria 5163
884 Ga0496103_0124345 3300048906 Bacteria 1644
885 Ga0496103_0194786 3300048906 Bacteria 1303
886 Ga0496103_0244348 3300048906 Bacteria 1155
887 Ga0496103_0345080 3300048906 Bacteria 957
888 Ga0496104_0000134 3300048907 Bacteria 68737
889 Ga0496104_0002226 3300048907 Bacteria 16741
890 Ga0496104_0009373 3300048907 Bacteria 8706
891 Ga0496104_0079872 3300048907 Bacteria 3118
892 Ga0496104_0124098 3300048907 Bacteria 2479
893 Ga0496104_0143093 3300048907 Bacteria 2297
894 Ga0496104_0298791 3300048907 Bacteria 1522
895 Ga0496104_0903148 3300048907 Bacteria 788
896 Ga0496104_1156832 3300048907 Bacteria 677
897 Ga0496105_0000334 3300048908 Bacteria 30835
898 Ga0496105_0000429 3300048908 Bacteria 27568
899 Ga0496105_0003332 3300048908 Bacteria 11871
900 Ga0496105_0072352 3300048908 Bacteria 2849
901 Ga0496105_0129599 3300048908 Bacteria 2080
902 Ga0496105_0695540 3300048908 Bacteria 781
903 Ga0496106_0009788 3300048909 Bacteria 7082
904 Ga0496106_0115864 3300048909 Bacteria 2090
905 Ga0496106_0207466 3300048909 Bacteria 1560
906 Ga0496106_0284268 3300048909 Bacteria 1325
907 Ga0496106_0309841 3300048909 Bacteria 1266
908 Ga0496107_0033042 3300048910 Bacteria 3700
909 Ga0496107_0050773 3300048910 Bacteria 2991
910 Ga0496107_0055898 3300048910 Bacteria 2850
911 Ga0496107_0233644 3300048910 Bacteria 1368
912 Ga0496107_0235471 3300048910 Bacteria 1362
913 Ga0496107_0503341 3300048910 Bacteria 898
914 Ga0496108_0003536 3300048911 Bacteria 12533
915 Ga0496108_0017704 3300048911 Bacteria 5829
916 Ga0496108_0033079 3300048911 Bacteria 4295
917 Ga0496108_0129163 3300048911 Bacteria 2172
918 Ga0496108_0138388 3300048911 Bacteria 2097
919 Ga0496108_0466152 3300048911 Bacteria 1104
920 Ga0496108_1372233 3300048911 Bacteria 592
921 Ga0496108_1380347 3300048911 Bacteria 590
922 Ga0496108_1534265 3300048911 Bacteria 553
923 Ga0496109_0000898 3300048912 Bacteria 24813
924 Ga0496109_0004403 3300048912 Bacteria 11769
925 Ga0496109_0023182 3300048912 Bacteria 5507
926 Ga0496109_0042839 3300048912 Bacteria 4102
927 Ga0496109_0070787 3300048912 Bacteria 3201
928 Ga0496109_0078645 3300048912 Bacteria 3037
929 Ga0496109_0112373 3300048912 Bacteria 2533
930 Ga0496109_0187673 3300048912 Bacteria 1942
931 Ga0496109_0213280 3300048912 Bacteria 1816
932 Ga0496109_0252758 3300048912 Bacteria 1660
933 Ga0496110_0000164 3300048913 Bacteria 40268
934 Ga0496110_0006694 3300048913 Bacteria 9159
935 Ga0496110_0014588 3300048913 Bacteria 6528
936 Ga0496110_0015943 3300048913 Bacteria 6266
937 Ga0496110_0108442 3300048913 Bacteria 2493
938 Ga0496110_0117827 3300048913 Bacteria 2391
939 Ga0496110_0139077 3300048913 Bacteria 2195
940 Ga0496110_0198647 3300048913 Bacteria 1822
941 Ga0496110_1237352 3300048913 Bacteria 655
942 Ga0496111_0000228 3300048914 Bacteria 26792
943 Ga0496111_0000295 3300048914 Bacteria 24339
944 Ga0496111_0002679 3300048914 Bacteria 10821
945 Ga0496111_0015328 3300048914 Bacteria 5259
946 Ga0496111_0031537 3300048914 Bacteria 3776
947 Ga0496111_0032440 3300048914 Bacteria 3724
948 Ga0496111_0048024 3300048914 Bacteria 3074
949 Ga0496111_0067212 3300048914 Bacteria 2604
950 Ga0496111_0089012 3300048914 Bacteria 2261
951 Ga0496111_0162974 3300048914 Bacteria 1656
952 Ga0496112_0000291 3300048915 Bacteria 32578
953 Ga0496112_0000443 3300048915 Bacteria 27533
954 Ga0496112_0012008 3300048915 Bacteria 7943
955 Ga0496112_0027889 3300048915 Bacteria 5447
956 Ga0496112_0175579 3300048915 Bacteria 2107
957 Ga0496112_0825665 3300048915 Bacteria 851
958 Ga0496112_1218375 3300048915 Bacteria 669
959 Ga0496113_0001618 3300048916 Bacteria 12672
960 Ga0496113_0158435 3300048916 Bacteria 1789
961 Ga0496113_0263470 3300048916 Bacteria 1377
962 Ga0496113_0307251 3300048916 Bacteria 1270
963 Ga0496113_0335155 3300048916 Bacteria 1213
964 Ga0496113_0569826 3300048916 Bacteria 908
965 Ga0496114_0000281 3300048917 Bacteria 37054
966 Ga0496114_0002188 3300048917 Bacteria 14888
967 Ga0496114_0003176 3300048917 Bacteria 12601
968 Ga0496114_0026662 3300048917 Bacteria 4733
969 Ga0496114_0055144 3300048917 Bacteria 3315
970 Ga0496114_0354314 3300048917 Bacteria 1298
971 Ga0496114_0371130 3300048917 Bacteria 1266
972 Ga0496114_0438328 3300048917 Bacteria 1157
973 Ga0496114_0584784 3300048917 Bacteria 985
974 Ga0496114_0985169 3300048917 Bacteria 726
975 Ga0496115_0015385 3300048918 Bacteria 5803
976 Ga0496115_0022334 3300048918 Bacteria 4900
977 Ga0496115_0027454 3300048918 Bacteria 4452
978 Ga0496115_0057152 3300048918 Bacteria 3137
979 Ga0496115_0060452 3300048918 Bacteria 3053
980 Ga0496115_0231042 3300048918 Bacteria 1525
981 Ga0496115_0380090 3300048918 Bacteria 1149
982 Ga0501031_0005532 3300049568 Bacteria 8224
983 Ga0501031_0104493 3300049568 Bacteria 1848
984 Ga0501031_0342915 3300049568 Bacteria 967
985 Ga0501032_0063899 3300049569 Bacteria 2464
986 Ga0501033_0002824 3300049570 Bacteria 14539
987 Ga0501033_0048171 3300049570 Bacteria 3166
988 Ga0501034_1528207 3300049571 Bacteria 541
989 Ga0501036_0004455 3300049572 Bacteria 11320
990 Ga0501036_0075063 3300049572 Bacteria 2859
991 Ga0501037_0000851 3300049573 Bacteria 22750
992 Ga0501037_0137364 3300049573 Bacteria 1751
993 Ga0501038_0000817 3300049574 Bacteria 27664
994 Ga0501038_0072163 3300049574 Bacteria 2926
995 Ga0501039_0009773 3300049575 Bacteria 7309
996 Ga0501039_0018588 3300049575 Bacteria 5335
997 Ga0501040_0028879 3300049576 Bacteria 3740
998 Ga0501040_0166336 3300049576 Bacteria 1560
999 Ga0501041_0001581 3300049577 Bacteria 12684
1000 Ga0501041_0001675 3300049577 Bacteria 12408
1001 Ga0501042_0013943 3300049578 Bacteria 5476
1002 Ga0501042_0096600 3300049578 Bacteria 2123
1003 Ga0501042_0282203 3300049578 Bacteria 1199
1004 Ga0501043_0016623 3300049579 Bacteria 5767
1005 Ga0501043_0059002 3300049579 Bacteria 3011
1006 Ga0501046_0015550 3300049580 Bacteria 6391
1007 Ga0501046_0017207 3300049580 Bacteria 6040
1008 Ga0501047_0269834 3300049581 Bacteria 1548
1009 Ga0501047_0503782 3300049581 Bacteria 1037
1010 Ga0501048_0054653 3300049582 Bacteria 2836
1011 Ga0501048_0092101 3300049582 Bacteria 2137
1012 Ga0501067_0000154 3300049583 Bacteria 38151
1013 Ga0501067_0018163 3300049583 Bacteria 3895
1014 Ga0501068_0037044 3300049584 Bacteria 2919
1015 Ga0501068_0114948 3300049584 Bacteria 1675
1016 Ga0501069_0006471 3300049585 Bacteria 6125
1017 Ga0501069_0008732 3300049585 Bacteria 5336
1018 Ga0501069_0045665 3300049585 Bacteria 2427
1019 Ga0501069_0136062 3300049585 Bacteria 1408
1020 Ga0501069_0264669 3300049585 Bacteria 1004
1021 Ga0501070_0000243 3300049586 Bacteria 51201
1022 Ga0501070_0029959 3300049586 Bacteria 4559
1023 Ga0501070_0040388 3300049586 Bacteria 3890
1024 Ga0501070_0084234 3300049586 Bacteria 2632
1025 Ga0501070_0478804 3300049586 Bacteria 1001
1026 Ga0501071_0001272 3300049587 Bacteria 14323
1027 Ga0501071_0340956 3300049587 Bacteria 1139
1028 Ga0501072_0106992 3300049588 Bacteria 2224
1029 Ga0501072_0116752 3300049588 Bacteria 2125
1030 Ga0501073_0004374 3300049589 Bacteria 10610
1031 Ga0501074_0012526 3300049590 Bacteria 6166
1032 Ga0501074_0018826 3300049590 Bacteria 5015
1033 Ga0501074_0040111 3300049590 Bacteria 3391
1034 Ga0501074_0165560 3300049590 Bacteria 1578
1035 Ga0501074_0326934 3300049590 Bacteria 1089
1036 Ga0501074_1011591 3300049590 Bacteria 584
1037 Ga0501074_1137081 3300049590 Bacteria 548
1038 Ga0501075_0028059 3300049591 Bacteria 4152
1039 Ga0501076_0009936 3300049592 Bacteria 7035
1040 Ga0501076_0099117 3300049592 Bacteria 2347
1041 Ga0501077_0002323 3300049593 Bacteria 11449
1042 Ga0501077_0002523 3300049593 Bacteria 10961
1043 Ga0501077_0014680 3300049593 Bacteria 4922
1044 Ga0501079_0004378 3300049741 Bacteria 10459
1045 Ga0501079_0178252 3300049741 Bacteria 1658
1046 Ga0501079_0179793 3300049741 Bacteria 1650
1047 Ga0501079_0929063 3300049741 Bacteria 685
1048 Ga0501080_0001996 3300049742 Bacteria 17609
1049 Ga0501080_0153899 3300049742 Bacteria 2124
1050 Ga0501080_0160365 3300049742 Bacteria 2077
1051 Ga0501080_0222874 3300049742 Bacteria 1725
1052 Ga0501080_0252296 3300049742 Bacteria 1609
1053 Ga0501080_0400347 3300049742 Bacteria 1235
1054 Ga0501081_0001229 3300049743 Bacteria 15580
1055 Ga0501083_0083099 3300049744 Bacteria 2121
1056 Ga0501035_0002330 3300049822 Bacteria 18722
1057 Ga0501035_0127654 3300049822 Bacteria 2219
1058 Ga0501035_1171300 3300049822 Bacteria 597
1059 Ga0501044_0103343 3300049823 Bacteria 2864
1060 Ga0501045_0002724 3300049824 Bacteria 12060
1061 Ga0501045_0168652 3300049824 Bacteria 1630
1062 nmdc:mga05p37_105308_c1 3300050507 Bacteria 3470
1063 nmdc:mga05p37_23411_c1 3300050507 Bacteria 7494
1064 nmdc:mga05p37_30852_c1 3300050507 Bacteria 6543
1065 nmdc:mga05p37_374784_c1 3300050507 Bacteria 1669
1066 nmdc:mga06r32_14701_c1 3300050510 Bacteria 7104
1067 nmdc:mga06r32_729328_c1 3300050510 Bacteria 955
1068 nmdc:mga08y16_1054378_c1 3300050511 Bacteria 790
1069 nmdc:mga08y16_1695176_c1 3300050511 Bacteria 587
1070 nmdc:mga08y16_242066_c1 3300050511 Bacteria 1865
1071 nmdc:mga08y16_325712_c1 3300050511 Bacteria 1581
1072 nmdc:mga08y16_95124_c1 3300050511 Bacteria 3103
1073 nmdc:mga0n895_11292_c1 3300050512 Bacteria 7960
1074 nmdc:mga0n895_1345301_c1 3300050512 Bacteria 684
1075 nmdc:mga0n895_2045985_c1 3300050512 Bacteria 530
1076 nmdc:mga0n895_304032_c1 3300050512 Bacteria 1617
1077 nmdc:mga0n895_58476_c1 3300050512 Bacteria 3801
1078 nmdc:mga0n895_8613_c1 3300050512 Bacteria 8850
1079 nmdc:mga0rr50_10287_c1 3300050513 Bacteria 5930
1080 nmdc:mga0rr50_214893_c1 3300050513 Bacteria 1586
1081 nmdc:mga0rr50_225_c1 3300050513 Bacteria 30540
1082 nmdc:mga0rr50_878172_c1 3300050513 Bacteria 765
1083 nmdc:mga08x19_10123_c1 3300050514 Bacteria 5657
1084 nmdc:mga08x19_39705_c1 3300050514 Bacteria 2993
1085 nmdc:mga0a205_181837_c1 3300050515 Bacteria 1997
1086 nmdc:mga0a205_3153_c1 3300050515 Bacteria 14634
1087 nmdc:mga0a205_553517_c1 3300050515 Bacteria 1005
1088 Ga0495601_0073913 3300053077 Bacteria 2180
1089 Ga0495601_0276367 3300053077 Bacteria 1095
1090 Ga0495601_0392264 3300053077 Bacteria 900
1091 Ga0495601_0476578 3300053077 Bacteria 806
1092 Ga0495612_0021233 3300053078 Bacteria 2605
1093 Ga0495612_0202884 3300053078 Bacteria 875
1094 Ga0495655_0017692 3300053083 Bacteria 1556
1095 Ga0495655_0131140 3300053083 Bacteria 772
1096 Ga0495619_0002264 3300053085 Bacteria 12718
1097 Ga0495619_0060049 3300053085 Bacteria 2526
1098 Ga0495619_0664531 3300053085 Bacteria 710
1099 Ga0501084_0000859 3300054114 Bacteria 23456
1100 Ga0501084_0761815 3300054114 Bacteria 815
1101 Ga0590077_129034 3300059426 Bacteria 600
1102 Ga0501082_0008383 3300060353 Bacteria 8916
1103 Ga0501082_0375404 3300060353 Bacteria 1240
1104 Ga0501082_0568272 3300060353 Bacteria 992
1105 Ga0466962_0188099 3300061719 Bacteria 1007
1106 Ga0530510_0022663 3300061734 Bacteria 4474
1107 Ga0530510_0055552 3300061734 Bacteria 2860
1108 Ga0530510_0135001 3300061734 Bacteria 1816
1109 Ga0530510_0248814 3300061734 Bacteria 1324
1110 Ga0530510_0313558 3300061734 Bacteria 1175
1111 Ga0530510_0683490 3300061734 Bacteria 782
1112 Ga0530510_1367719 3300061734 Bacteria 543

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049590 Ga0501074_1011591 Ga0501074_1011591_12_440 141
2 3300048905 Ga0496102_0574841 Ga0496102_0574841_369_809 145
3 3300048913 Ga0496110_0015943 Ga0496110_0015943_1896_2336 145
4 3300048914 Ga0496111_0031537 Ga0496111_0031537_845_1285 145
5 3300005354 Ga0070675_101283618 Ga0070675_1012836182 146
6 3300006163 Ga0070715_10692049 Ga0070715_106920491 146
7 3300015261 Ga0182006_1141934 Ga0182006_11419342 146
8 3300015262 Ga0182007_10231938 Ga0182007_102319382 146
9 3300025905 Ga0207685_10487818 Ga0207685_104878182 146
10 3300025916 Ga0207663_10226444 Ga0207663_102264442 146
11 3300005435 Ga0070714_100453245 Ga0070714_1004532452 147
12 3300005455 Ga0070663_101685491 Ga0070663_1016854911 147
13 3300005518 Ga0070699_100158173 Ga0070699_1001581732 147
14 3300025922 Ga0207646_10956458 Ga0207646_109564582 147
15 3300025929 Ga0207664_10116950 Ga0207664_101169503 147
16 3300028573 Ga0265334_10015319 Ga0265334_100153193 147
17 3300028577 Ga0265318_10010160 Ga0265318_100101603 147
18 3300028654 Ga0265322_10015344 Ga0265322_100153443 147
19 3300028800 Ga0265338_10028139 Ga0265338_100281392 147
20 3300031239 Ga0265328_10044387 Ga0265328_100443872 147
21 3300031241 Ga0265325_10029899 Ga0265325_100298992 147
22 3300031251 Ga0265327_10413925 Ga0265327_104139252 147
23 3300031344 Ga0265316_10761147 Ga0265316_107611472 147
24 3300031595 Ga0265313_10055786 Ga0265313_100557861 147
25 3300031711 Ga0265314_10012245 Ga0265314_100122452 147
26 3300031712 Ga0265342_10150680 Ga0265342_101506802 147
27 3300031712 Ga0265342_10332060 Ga0265342_103320602 147
28 3300005435 Ga0070714_100053368 Ga0070714_1000533682 148
29 3300005435 Ga0070714_100691547 Ga0070714_1006915472 148
30 3300005436 Ga0070713_100094513 Ga0070713_1000945132 148
31 3300005436 Ga0070713_101237419 Ga0070713_1012374192 148
32 3300005440 Ga0070705_101101782 Ga0070705_1011017822 148
33 3300005467 Ga0070706_100258145 Ga0070706_1002581452 148
34 3300005471 Ga0070698_100073605 Ga0070698_1000736053 148
35 3300005471 Ga0070698_100128875 Ga0070698_1001288753 148
36 3300009093 Ga0105240_11069326 Ga0105240_110693262 148
37 3300009093 Ga0105240_11110382 Ga0105240_111103822 148
38 3300021358 Ga0213873_10039551 Ga0213873_100395512 148
39 3300021441 Ga0213871_10077264 Ga0213871_100772641 148
40 3300025910 Ga0207684_10039896 Ga0207684_100398962 148
41 3300025920 Ga0207649_10517658 Ga0207649_105176582 148
42 3300025929 Ga0207664_10002557 Ga0207664_1000255712 148
43 3300025929 Ga0207664_11029652 Ga0207664_110296522 148
44 3300025939 Ga0207665_10502673 Ga0207665_105026732 148
45 3300031240 Ga0265320_10226574 Ga0265320_102265742 148
46 3300044706 Ga0466964_0006266 Ga0466964_0006266_662_1108 148
47 3300045976 Ga0466967_0011854 Ga0466967_0011854_3574_4020 148
48 3300045976 Ga0466967_0433146 Ga0466967_0433146_814_1260 148
49 3300046474 Ga0495605_0061489 Ga0495605_0061489_14_460 148
50 3300048911 Ga0496108_0466152 Ga0496108_0466152_572_1018 148
51 3300035725 Ga0373947_0760366 Ga0373947_0760366_99_548 149
52 3300046459 Ga0495629_0483832 Ga0495629_0483832_19_468 149
53 3300049573 Ga0501037_0137364 Ga0501037_0137364_1068_1538 149
54 3300005467 Ga0070706_100864650 Ga0070706_1008646501 150
55 3300005468 Ga0070707_101046201 Ga0070707_1010462012 150
56 3300005937 Ga0081455_10011450 Ga0081455_100114503 150
57 3300005937 Ga0081455_10363616 Ga0081455_103636162 150
58 3300006852 Ga0075433_10004384 Ga0075433_100043842 150
59 3300006852 Ga0075433_10024478 Ga0075433_100244786 150
60 3300006852 Ga0075433_11051538 Ga0075433_110515381 150
61 3300006871 Ga0075434_100023021 Ga0075434_1000230212 150
62 3300006871 Ga0075434_101554258 Ga0075434_1015542582 150
63 3300006871 Ga0075434_101591479 Ga0075434_1015914792 150
64 3300006880 Ga0075429_100742484 Ga0075429_1007424841 150
65 3300006914 Ga0075436_100009853 Ga0075436_1000098532 150
66 3300007076 Ga0075435_100000140 Ga0075435_10000014013 150
67 3300007076 Ga0075435_100024269 Ga0075435_1000242694 150
68 3300007076 Ga0075435_100806250 Ga0075435_1008062501 150
69 3300009147 Ga0114129_10009001 Ga0114129_1000900118 150
70 3300009147 Ga0114129_10048698 Ga0114129_100486987 150
71 3300009147 Ga0114129_10056182 Ga0114129_100561826 150
72 3300009147 Ga0114129_10385876 Ga0114129_103858762 150
73 3300014326 Ga0157380_10692548 Ga0157380_106925482 150
74 3300015262 Ga0182007_10367363 Ga0182007_103673631 150
75 3300025898 Ga0207692_10113744 Ga0207692_101137442 150
76 3300025910 Ga0207684_10702501 Ga0207684_107025012 150
77 3300025915 Ga0207693_10302964 Ga0207693_103029642 150
78 3300025921 Ga0207652_11106148 Ga0207652_111061482 150
79 3300025922 Ga0207646_11371729 Ga0207646_113717292 150
80 3300027907 Ga0207428_10297768 Ga0207428_102977682 150
81 3300031731 Ga0307405_11088093 Ga0307405_110880932 150
82 3300031901 Ga0307406_11130915 Ga0307406_111309151 150
83 3300031911 Ga0307412_10560373 Ga0307412_105603732 150
84 3300035086 Ga0373934_0137215 Ga0373934_0137215_89_541 150
85 3300035117 Ga0373953_0032746 Ga0373953_0032746_1252_1704 150
86 3300035117 Ga0373953_0330680 Ga0373953_0330680_56_508 150
87 3300035120 Ga0373957_0025026 Ga0373957_0025026_520_972 150
88 3300035170 Ga0373943_0000899 Ga0373943_0000899_3396_3848 150
89 3300035172 Ga0373955_0008799 Ga0373955_0008799_2902_3354 150
90 3300035410 Ga0373924_0079925 Ga0373924_0079925_818_1270 150
91 3300035695 Ga0373927_0135226 Ga0373927_0135226_80_532 150
92 3300035725 Ga0373947_0003187 Ga0373947_0003187_6964_7416 150
93 3300036401 Ga0373937_0076296 Ga0373937_0076296_1351_1803 150
94 3300037312 Ga0395899_0212186 Ga0395899_0212186_798_1250 150
95 3300037418 Ga0395900_0004700 Ga0395900_0004700_2544_2996 150
96 3300037466 Ga0395898_0004894 Ga0395898_0004894_9774_10226 150
97 3300037466 Ga0395898_0119682 Ga0395898_0119682_1981_2433 150
98 3300037466 Ga0395898_0244556 Ga0395898_0244556_571_1023 150
99 3300037471 Ga0395905_0818853 Ga0395905_0818853_191_643 150
100 3300038443 Ga0395901_0036111 Ga0395901_0036111_2452_2904 150
101 3300038443 Ga0395901_0181430 Ga0395901_0181430_146_598 150
102 3300042004 Ga0439445_0242928 Ga0439445_0242928_25_477 150
103 3300045976 Ga0466967_0237608 Ga0466967_0237608_884_1336 150
104 3300045976 Ga0466967_0551817 Ga0466967_0551817_666_1118 150
105 3300046454 Ga0495592_0114033 Ga0495592_0114033_785_1237 150
106 3300046455 Ga0495603_0023275 Ga0495603_0023275_2182_2634 150
107 3300046459 Ga0495629_0114708 Ga0495629_0114708_896_1348 150
108 3300046461 Ga0495641_0001250 Ga0495641_0001250_12694_13146 150
109 3300046462 Ga0495651_0012474 Ga0495651_0012474_4429_4881 150
110 3300046462 Ga0495651_0040858 Ga0495651_0040858_2454_2906 150
111 3300046463 Ga0495653_0061120 Ga0495653_0061120_2303_2755 150
112 3300046473 Ga0495582_0000397 Ga0495582_0000397_17948_18400 150
113 3300046475 Ga0495639_0002254 Ga0495639_0002254_1886_2338 150
114 3300046477 Ga0495664_0016551 Ga0495664_0016551_458_910 150
115 3300046477 Ga0495664_0276691 Ga0495664_0276691_94_546 150
116 3300046501 Ga0495607_0245655 Ga0495607_0245655_356_811 150
117 3300046511 Ga0495608_0029157 Ga0495608_0029157_1943_2395 150
118 3300046514 Ga0495618_0241671 Ga0495618_0241671_270_722 150
119 3300046516 Ga0495628_0013424 Ga0495628_0013424_5030_5482 150
120 3300046517 Ga0495630_0066836 Ga0495630_0066836_2159_2611 150
121 3300046517 Ga0495630_0075867 Ga0495630_0075867_722_1174 150
122 3300046518 Ga0495631_0325870 Ga0495631_0325870_187_639 150
123 3300046526 Ga0495666_0019709 Ga0495666_0019709_1041_1493 150
124 3300046529 Ga0495652_0012598 Ga0495652_0012598_5366_5818 150
125 3300046529 Ga0495652_0189526 Ga0495652_0189526_766_1218 150
126 3300046531 Ga0495665_0026888 Ga0495665_0026888_1523_1975 150
127 3300046533 Ga0495640_0035402 Ga0495640_0035402_651_1103 150
128 3300046535 Ga0495586_0103308 Ga0495586_0103308_139_591 150
129 3300046536 Ga0495587_0022577 Ga0495587_0022577_1710_2162 150
130 3300046536 Ga0495587_0048446 Ga0495587_0048446_304_756 150
131 3300046543 Ga0495645_0060684 Ga0495645_0060684_1351_1803 150
132 3300046543 Ga0495645_0096890 Ga0495645_0096890_589_1041 150
133 3300046559 Ga0495667_0041845 Ga0495667_0041845_825_1277 150
134 3300046642 Ga0495634_0120097 Ga0495634_0120097_640_1092 150
135 3300046663 Ga0495635_0013378 Ga0495635_0013378_3054_3506 150
136 3300046663 Ga0495635_0015938 Ga0495635_0015938_4067_4519 150
137 3300046665 Ga0495661_0370205 Ga0495661_0370205_19_471 150
138 3300046674 Ga0495588_0059077 Ga0495588_0059077_636_1088 150
139 3300046675 Ga0495657_0116590 Ga0495657_0116590_56_508 150
140 3300046675 Ga0495657_0175077 Ga0495657_0175077_418_870 150
141 3300046678 Ga0495599_0101990 Ga0495599_0101990_253_705 150
142 3300046679 Ga0495623_0041457 Ga0495623_0041457_2043_2495 150
143 3300046679 Ga0495623_0118047 Ga0495623_0118047_469_921 150
144 3300046680 Ga0495646_0101109 Ga0495646_0101109_358_810 150
145 3300046680 Ga0495646_0105173 Ga0495646_0105173_1138_1590 150
146 3300046681 Ga0495647_0001542 Ga0495647_0001542_4576_5028 150
147 3300046683 Ga0495658_0001563 Ga0495658_0001563_11227_11679 150
148 3300046689 Ga0495613_0001506 Ga0495613_0001506_10309_10761 150
149 3300046809 Ga0495600_0057459 Ga0495600_0057459_265_717 150
150 3300046809 Ga0495600_0133015 Ga0495600_0133015_756_1208 150
151 3300047315 Ga0495581_0002960 Ga0495581_0002960_615_1067 150
152 3300047317 Ga0495604_0003309 Ga0495604_0003309_3711_4163 150
153 3300047317 Ga0495604_0166394 Ga0495604_0166394_1003_1455 150
154 3300047319 Ga0495674_0066253 Ga0495674_0066253_1962_2414 150
155 3300047322 Ga0495680_0006197 Ga0495680_0006197_7500_7952 150
156 3300047322 Ga0495680_0080049 Ga0495680_0080049_363_815 150
157 3300047444 Ga0495675_0054671 Ga0495675_0054671_1996_2448 150
158 3300047471 Ga0495684_0019345 Ga0495684_0019345_1956_2408 150
159 3300047471 Ga0495684_0029105 Ga0495684_0029105_708_1160 150
160 3300047673 Ga0495593_0004029 Ga0495593_0004029_1043_1495 150
161 3300048088 Ga0495602_0006483 Ga0495602_0006483_10145_10597 150
162 3300048088 Ga0495602_0132184 Ga0495602_0132184_707_1159 150
163 3300048904 Ga0496101_0285496 Ga0496101_0285496_763_1215 150
164 3300048904 Ga0496101_0465055 Ga0496101_0465055_172_624 150
165 3300048905 Ga0496102_0007218 Ga0496102_0007218_4136_4588 150
166 3300048906 Ga0496103_0194786 Ga0496103_0194786_88_540 150
167 3300048907 Ga0496104_0298791 Ga0496104_0298791_79_531 150
168 3300048909 Ga0496106_0115864 Ga0496106_0115864_1503_1955 150
169 3300048911 Ga0496108_0138388 Ga0496108_0138388_948_1400 150
170 3300048912 Ga0496109_0070787 Ga0496109_0070787_361_813 150
171 3300048912 Ga0496109_0252758 Ga0496109_0252758_250_702 150
172 3300048913 Ga0496110_0139077 Ga0496110_0139077_61_513 150
173 3300048914 Ga0496111_0032440 Ga0496111_0032440_375_827 150
174 3300048915 Ga0496112_1218375 Ga0496112_1218375_40_492 150
175 3300048916 Ga0496113_0307251 Ga0496113_0307251_615_1067 150
176 3300048917 Ga0496114_0026662 Ga0496114_0026662_2891_3343 150
177 3300048917 Ga0496114_0985169 Ga0496114_0985169_154_606 150
178 3300048918 Ga0496115_0022334 Ga0496115_0022334_1925_2377 150
179 3300048918 Ga0496115_0060452 Ga0496115_0060452_2033_2485 150
180 3300049568 Ga0501031_0342915 Ga0501031_0342915_378_830 150
181 3300049590 Ga0501074_0326934 Ga0501074_0326934_229_681 150
182 3300050507 nmdc:mga05p37_105308_c1 nmdc:mga05p37_105308_c1_1691_2143 150
183 3300050507 nmdc:mga05p37_23411_c1 nmdc:mga05p37_23411_c1_6236_6688 150
184 3300050507 nmdc:mga05p37_30852_c1 nmdc:mga05p37_30852_c1_907_1359 150
185 3300050510 nmdc:mga06r32_14701_c1 nmdc:mga06r32_14701_c1_4658_5110 150
186 3300050510 nmdc:mga06r32_729328_c1 nmdc:mga06r32_729328_c1_218_670 150
187 3300050511 nmdc:mga08y16_242066_c1 nmdc:mga08y16_242066_c1_55_507 150
188 3300050512 nmdc:mga0n895_11292_c1 nmdc:mga0n895_11292_c1_4190_4642 150
189 3300050512 nmdc:mga0n895_1345301_c1 nmdc:mga0n895_1345301_c1_98_550 150
190 3300050512 nmdc:mga0n895_8613_c1 nmdc:mga0n895_8613_c1_1467_1919 150
191 3300050513 nmdc:mga0rr50_225_c1 nmdc:mga0rr50_225_c1_23265_23717 150
192 3300050513 nmdc:mga0rr50_878172_c1 nmdc:mga0rr50_878172_c1_130_582 150
193 3300050514 nmdc:mga08x19_10123_c1 nmdc:mga08x19_10123_c1_797_1249 150
194 3300050514 nmdc:mga08x19_39705_c1 nmdc:mga08x19_39705_c1_1176_1628 150
195 3300050515 nmdc:mga0a205_181837_c1 nmdc:mga0a205_181837_c1_1479_1931 150
196 3300050515 nmdc:mga0a205_3153_c1 nmdc:mga0a205_3153_c1_2398_2850 150
197 3300053077 Ga0495601_0073913 Ga0495601_0073913_100_552 150
198 3300053078 Ga0495612_0021233 Ga0495612_0021233_2073_2525 150
199 3300053078 Ga0495612_0202884 Ga0495612_0202884_85_537 150
200 3300053085 Ga0495619_0002264 Ga0495619_0002264_8835_9287 150
201 3300053085 Ga0495619_0060049 Ga0495619_0060049_1926_2378 150
202 3300005327 Ga0070658_10092060 Ga0070658_100920602 151
203 3300005327 Ga0070658_10124746 Ga0070658_101247462 151
204 3300005327 Ga0070658_10482896 Ga0070658_104828962 151
205 3300005329 Ga0070683_100050130 Ga0070683_1000501302 151
206 3300005329 Ga0070683_100272919 Ga0070683_1002729191 151
207 3300005329 Ga0070683_100495927 Ga0070683_1004959272 151
208 3300005329 Ga0070683_101564350 Ga0070683_1015643501 151
209 3300005330 Ga0070690_100859593 Ga0070690_1008595931 151
210 3300005336 Ga0070680_100053848 Ga0070680_1000538483 151
211 3300005336 Ga0070680_100101092 Ga0070680_1001010922 151
212 3300005336 Ga0070680_100108456 Ga0070680_1001084563 151
213 3300005337 Ga0070682_100152865 Ga0070682_1001528652 151
214 3300005339 Ga0070660_100110092 Ga0070660_1001100922 151
215 3300005339 Ga0070660_100165585 Ga0070660_1001655852 151
216 3300005339 Ga0070660_100599982 Ga0070660_1005999822 151
217 3300005339 Ga0070660_100745219 Ga0070660_1007452191 151
218 3300005341 Ga0070691_10078192 Ga0070691_100781922 151
219 3300005341 Ga0070691_10528816 Ga0070691_105288162 151
220 3300005343 Ga0070687_100245886 Ga0070687_1002458862 151
221 3300005344 Ga0070661_100033510 Ga0070661_1000335103 151
222 3300005344 Ga0070661_100061585 Ga0070661_1000615852 151
223 3300005345 Ga0070692_10099802 Ga0070692_100998022 151
224 3300005354 Ga0070675_100071216 Ga0070675_1000712163 151
225 3300005355 Ga0070671_100748029 Ga0070671_1007480292 151
226 3300005366 Ga0070659_100219681 Ga0070659_1002196812 151
227 3300005366 Ga0070659_100241014 Ga0070659_1002410142 151
228 3300005366 Ga0070659_100475469 Ga0070659_1004754691 151
229 3300005366 Ga0070659_100962857 Ga0070659_1009628571 151
230 3300005366 Ga0070659_101325316 Ga0070659_1013253161 151
231 3300005435 Ga0070714_100429276 Ga0070714_1004292761 151
232 3300005435 Ga0070714_101747024 Ga0070714_1017470241 151
233 3300005436 Ga0070713_100505707 Ga0070713_1005057071 151
234 3300005436 Ga0070713_100938597 Ga0070713_1009385972 151
235 3300005440 Ga0070705_100072942 Ga0070705_1000729422 151
236 3300005440 Ga0070705_100894461 Ga0070705_1008944611 151
237 3300005440 Ga0070705_101107289 Ga0070705_1011072891 151
238 3300005445 Ga0070708_100132367 Ga0070708_1001323672 151
239 3300005445 Ga0070708_100675518 Ga0070708_1006755182 151
240 3300005455 Ga0070663_100854919 Ga0070663_1008549192 151
241 3300005456 Ga0070678_100118341 Ga0070678_1001183412 151
242 3300005456 Ga0070678_100513407 Ga0070678_1005134072 151
243 3300005458 Ga0070681_10001129 Ga0070681_100011293 151
244 3300005458 Ga0070681_10598725 Ga0070681_105987252 151
245 3300005458 Ga0070681_10741668 Ga0070681_107416682 151
246 3300005458 Ga0070681_10778623 Ga0070681_107786232 151
247 3300005459 Ga0068867_100244804 Ga0068867_1002448042 151
248 3300005466 Ga0070685_10551013 Ga0070685_105510132 151
249 3300005468 Ga0070707_100190723 Ga0070707_1001907232 151
250 3300005530 Ga0070679_100160109 Ga0070679_1001601092 151
251 3300005530 Ga0070679_100199276 Ga0070679_1001992762 151
252 3300005535 Ga0070684_100057188 Ga0070684_1000571883 151
253 3300005535 Ga0070684_100057250 Ga0070684_1000572502 151
254 3300005535 Ga0070684_100089966 Ga0070684_1000899663 151
255 3300005535 Ga0070684_100293223 Ga0070684_1002932231 151
256 3300005535 Ga0070684_100444650 Ga0070684_1004446502 151
257 3300005535 Ga0070684_100801332 Ga0070684_1008013322 151
258 3300005536 Ga0070697_100102146 Ga0070697_1001021462 151
259 3300005536 Ga0070697_100109749 Ga0070697_1001097492 151
260 3300005536 Ga0070697_101074971 Ga0070697_1010749712 151
261 3300005545 Ga0070695_100089217 Ga0070695_1000892172 151
262 3300005546 Ga0070696_100048066 Ga0070696_1000480662 151
263 3300005547 Ga0070693_100604571 Ga0070693_1006045712 151
264 3300005548 Ga0070665_100870746 Ga0070665_1008707461 151
265 3300005548 Ga0070665_100986248 Ga0070665_1009862482 151
266 3300005563 Ga0068855_100072684 Ga0068855_1000726842 151
267 3300005563 Ga0068855_100108078 Ga0068855_1001080781 151
268 3300005563 Ga0068855_100233752 Ga0068855_1002337522 151
269 3300005563 Ga0068855_100302014 Ga0068855_1003020142 151
270 3300005564 Ga0070664_100165065 Ga0070664_1001650653 151
271 3300005564 Ga0070664_100716366 Ga0070664_1007163662 151
272 3300005577 Ga0068857_100019391 Ga0068857_1000193913 151
273 3300005577 Ga0068857_100033041 Ga0068857_1000330414 151
274 3300005577 Ga0068857_100059894 Ga0068857_1000598943 151
275 3300005577 Ga0068857_100300411 Ga0068857_1003004112 151
276 3300005578 Ga0068854_100658541 Ga0068854_1006585411 151
277 3300005614 Ga0068856_100062119 Ga0068856_1000621193 151
278 3300005614 Ga0068856_100134039 Ga0068856_1001340393 151
279 3300005614 Ga0068856_100512191 Ga0068856_1005121911 151
280 3300005615 Ga0070702_100170582 Ga0070702_1001705822 151
281 3300005615 Ga0070702_100747294 Ga0070702_1007472941 151
282 3300005616 Ga0068852_100018025 Ga0068852_1000180253 151
283 3300005616 Ga0068852_100294898 Ga0068852_1002948982 151
284 3300005617 Ga0068859_101247572 Ga0068859_1012475722 151
285 3300005618 Ga0068864_100129295 Ga0068864_1001292952 151
286 3300005618 Ga0068864_100669633 Ga0068864_1006696332 151
287 3300005718 Ga0068866_10045370 Ga0068866_100453703 151
288 3300005719 Ga0068861_100572329 Ga0068861_1005723292 151
289 3300005844 Ga0068862_100986186 Ga0068862_1009861862 151
290 3300005937 Ga0081455_10012609 Ga0081455_100126096 151
291 3300005937 Ga0081455_10243025 Ga0081455_102430252 151
292 3300005981 Ga0081538_10051296 Ga0081538_100512962 151
293 3300005985 Ga0081539_10018622 Ga0081539_100186223 151
294 3300006028 Ga0070717_10014276 Ga0070717_100142764 151
295 3300006028 Ga0070717_10521603 Ga0070717_105216032 151
296 3300006175 Ga0070712_100030457 Ga0070712_1000304574 151
297 3300006175 Ga0070712_100211056 Ga0070712_1002110561 151
298 3300006237 Ga0097621_100870685 Ga0097621_1008706852 151
299 3300006852 Ga0075433_10456585 Ga0075433_104565852 151
300 3300006931 Ga0097620_101247658 Ga0097620_1012476582 151
301 3300009093 Ga0105240_10222720 Ga0105240_102227203 151
302 3300009094 Ga0111539_10031415 Ga0111539_100314152 151
303 3300009094 Ga0111539_10867885 Ga0111539_108678852 151
304 3300009098 Ga0105245_10119636 Ga0105245_101196362 151
305 3300009098 Ga0105245_10431456 Ga0105245_104314562 151
306 3300009098 Ga0105245_10746476 Ga0105245_107464762 151
307 3300009098 Ga0105245_10864972 Ga0105245_108649722 151
308 3300009147 Ga0114129_12821085 Ga0114129_128210851 151
309 3300009148 Ga0105243_10080853 Ga0105243_100808534 151
310 3300009148 Ga0105243_10513992 Ga0105243_105139922 151
311 3300009148 Ga0105243_10581757 Ga0105243_105817572 151
312 3300009174 Ga0105241_10268096 Ga0105241_102680962 151
313 3300009176 Ga0105242_11961248 Ga0105242_119612481 151
314 3300009176 Ga0105242_12274041 Ga0105242_122740412 151
315 3300009177 Ga0105248_10056872 Ga0105248_100568725 151
316 3300009177 Ga0105248_10194172 Ga0105248_101941723 151
317 3300009177 Ga0105248_10951507 Ga0105248_109515072 151
318 3300009545 Ga0105237_10492868 Ga0105237_104928682 151
319 3300009551 Ga0105238_10023360 Ga0105238_100233607 151
320 3300009553 Ga0105249_10686243 Ga0105249_106862432 151
321 3300009553 Ga0105249_11153319 Ga0105249_111533192 151
322 3300009553 Ga0105249_12218630 Ga0105249_122186302 151
323 3300010375 Ga0105239_10096721 Ga0105239_100967212 151
324 3300010375 Ga0105239_10515853 Ga0105239_105158532 151
325 3300010375 Ga0105239_11824757 Ga0105239_118247572 151
326 3300011119 Ga0105246_10322712 Ga0105246_103227122 151
327 3300013102 Ga0157371_11027283 Ga0157371_110272832 151
328 3300013104 Ga0157370_10008306 Ga0157370_1000830613 151
329 3300013104 Ga0157370_10300734 Ga0157370_103007342 151
330 3300013104 Ga0157370_10347658 Ga0157370_103476582 151
331 3300013104 Ga0157370_10833691 Ga0157370_108336912 151
332 3300013105 Ga0157369_10046810 Ga0157369_100468103 151
333 3300013105 Ga0157369_10336345 Ga0157369_103363451 151
334 3300013105 Ga0157369_10382575 Ga0157369_103825753 151
335 3300013105 Ga0157369_10462735 Ga0157369_104627352 151
336 3300013105 Ga0157369_11585855 Ga0157369_115858552 151
337 3300013297 Ga0157378_10345069 Ga0157378_103450692 151
338 3300013297 Ga0157378_11503761 Ga0157378_115037611 151
339 3300013306 Ga0163162_10263641 Ga0163162_102636412 151
340 3300013306 Ga0163162_10736469 Ga0163162_107364692 151
341 3300013307 Ga0157372_10029001 Ga0157372_100290013 151
342 3300013307 Ga0157372_10140215 Ga0157372_101402152 151
343 3300013307 Ga0157372_10304928 Ga0157372_103049281 151
344 3300013307 Ga0157372_10741397 Ga0157372_107413972 151
345 3300013308 Ga0157375_10263695 Ga0157375_102636952 151
346 3300013308 Ga0157375_10510413 Ga0157375_105104132 151
347 3300014325 Ga0163163_10208813 Ga0163163_102088132 151
348 3300014325 Ga0163163_10351850 Ga0163163_103518501 151
349 3300014497 Ga0182008_10413879 Ga0182008_104138792 151
350 3300014968 Ga0157379_10097916 Ga0157379_100979163 151
351 3300020069 Ga0197907_11047046 Ga0197907_110470462 151
352 3300020069 Ga0197907_11349487 Ga0197907_113494872 151
353 3300020081 Ga0206354_10741990 Ga0206354_107419902 151
354 3300020082 Ga0206353_10780697 Ga0206353_107806972 151
355 3300020082 Ga0206353_11751382 Ga0206353_117513822 151
356 3300020082 Ga0206353_11789119 Ga0206353_117891193 151
357 3300021377 Ga0213874_10142815 Ga0213874_101428152 151
358 3300021384 Ga0213876_10273908 Ga0213876_102739082 151
359 3300025900 Ga0207710_10343985 Ga0207710_103439851 151
360 3300025901 Ga0207688_10072754 Ga0207688_100727543 151
361 3300025901 Ga0207688_10143079 Ga0207688_101430792 151
362 3300025901 Ga0207688_10228445 Ga0207688_102284452 151
363 3300025901 Ga0207688_10639295 Ga0207688_106392951 151
364 3300025901 Ga0207688_10839980 Ga0207688_108399802 151
365 3300025912 Ga0207707_10014838 Ga0207707_100148387 151
366 3300025912 Ga0207707_10111137 Ga0207707_101111371 151
367 3300025912 Ga0207707_10198241 Ga0207707_101982412 151
368 3300025912 Ga0207707_10584770 Ga0207707_105847702 151
369 3300025913 Ga0207695_10543070 Ga0207695_105430702 151
370 3300025914 Ga0207671_10044114 Ga0207671_100441143 151
371 3300025915 Ga0207693_10019938 Ga0207693_100199384 151
372 3300025915 Ga0207693_10086334 Ga0207693_100863342 151
373 3300025915 Ga0207693_10422443 Ga0207693_104224432 151
374 3300025917 Ga0207660_10009367 Ga0207660_100093674 151
375 3300025917 Ga0207660_10185704 Ga0207660_101857042 151
376 3300025917 Ga0207660_10444825 Ga0207660_104448253 151
377 3300025918 Ga0207662_10269070 Ga0207662_102690701 151
378 3300025919 Ga0207657_10000416 Ga0207657_1000041641 151
379 3300025919 Ga0207657_10000610 Ga0207657_1000061016 151
380 3300025919 Ga0207657_10004617 Ga0207657_100046172 151
381 3300025919 Ga0207657_10151254 Ga0207657_101512542 151
382 3300025919 Ga0207657_10154164 Ga0207657_101541643 151
383 3300025920 Ga0207649_10034017 Ga0207649_100340172 151
384 3300025920 Ga0207649_10261521 Ga0207649_102615212 151
385 3300025921 Ga0207652_10003206 Ga0207652_1000320615 151
386 3300025921 Ga0207652_10017952 Ga0207652_100179522 151
387 3300025921 Ga0207652_10213248 Ga0207652_102132482 151
388 3300025922 Ga0207646_10140658 Ga0207646_101406583 151
389 3300025926 Ga0207659_10032822 Ga0207659_100328223 151
390 3300025927 Ga0207687_10403443 Ga0207687_104034432 151
391 3300025928 Ga0207700_10000004 Ga0207700_10000004253 151
392 3300025928 Ga0207700_10126938 Ga0207700_101269382 151
393 3300025928 Ga0207700_10223947 Ga0207700_102239472 151
394 3300025929 Ga0207664_10152546 Ga0207664_101525463 151
395 3300025929 Ga0207664_10176820 Ga0207664_101768202 151
396 3300025931 Ga0207644_10178931 Ga0207644_101789312 151
397 3300025931 Ga0207644_10423624 Ga0207644_104236242 151
398 3300025932 Ga0207690_10034236 Ga0207690_100342363 151
399 3300025932 Ga0207690_10155708 Ga0207690_101557083 151
400 3300025932 Ga0207690_10180276 Ga0207690_101802762 151
401 3300025932 Ga0207690_10321389 Ga0207690_103213892 151
402 3300025933 Ga0207706_10031346 Ga0207706_100313462 151
403 3300025934 Ga0207686_10895129 Ga0207686_108951292 151
404 3300025935 Ga0207709_10496246 Ga0207709_104962462 151
405 3300025937 Ga0207669_10075065 Ga0207669_100750653 151
406 3300025937 Ga0207669_10292088 Ga0207669_102920882 151
407 3300025937 Ga0207669_10968653 Ga0207669_109686531 151
408 3300025939 Ga0207665_10070955 Ga0207665_100709552 151
409 3300025940 Ga0207691_10539009 Ga0207691_105390092 151
410 3300025941 Ga0207711_10090389 Ga0207711_100903892 151
411 3300025944 Ga0207661_10023738 Ga0207661_100237383 151
412 3300025944 Ga0207661_10263049 Ga0207661_102630492 151
413 3300025944 Ga0207661_10768524 Ga0207661_107685242 151
414 3300025944 Ga0207661_10837006 Ga0207661_108370062 151
415 3300025949 Ga0207667_10099837 Ga0207667_100998373 151
416 3300025949 Ga0207667_10136696 Ga0207667_101366963 151
417 3300025949 Ga0207667_10143680 Ga0207667_101436802 151
418 3300025949 Ga0207667_10253165 Ga0207667_102531652 151
419 3300025949 Ga0207667_10594592 Ga0207667_105945922 151
420 3300025949 Ga0207667_11168952 Ga0207667_111689522 151
421 3300025961 Ga0207712_10863529 Ga0207712_108635292 151
422 3300025981 Ga0207640_10812205 Ga0207640_108122051 151
423 3300025981 Ga0207640_10939913 Ga0207640_109399132 151
424 3300026023 Ga0207677_10568347 Ga0207677_105683472 151
425 3300026023 Ga0207677_10891209 Ga0207677_108912092 151
426 3300026067 Ga0207678_10194806 Ga0207678_101948062 151
427 3300026075 Ga0207708_10024328 Ga0207708_100243282 151
428 3300026078 Ga0207702_10022866 Ga0207702_100228664 151
429 3300026078 Ga0207702_10199303 Ga0207702_101993032 151
430 3300026078 Ga0207702_10307064 Ga0207702_103070642 151
431 3300026078 Ga0207702_11335426 Ga0207702_113354261 151
432 3300026088 Ga0207641_10704317 Ga0207641_107043172 151
433 3300026088 Ga0207641_10820819 Ga0207641_108208192 151
434 3300026089 Ga0207648_10049380 Ga0207648_100493805 151
435 3300026089 Ga0207648_10373785 Ga0207648_103737852 151
436 3300026095 Ga0207676_10477664 Ga0207676_104776642 151
437 3300026116 Ga0207674_10009649 Ga0207674_1000964912 151
438 3300026116 Ga0207674_10015268 Ga0207674_100152688 151
439 3300026116 Ga0207674_10033571 Ga0207674_100335712 151
440 3300026116 Ga0207674_10034595 Ga0207674_100345955 151
441 3300026118 Ga0207675_101862906 Ga0207675_1018629061 151
442 3300026121 Ga0207683_10105840 Ga0207683_101058402 151
443 3300026121 Ga0207683_10206846 Ga0207683_102068462 151
444 3300026142 Ga0207698_10013668 Ga0207698_100136683 151
445 3300026142 Ga0207698_10147953 Ga0207698_101479531 151
446 3300026142 Ga0207698_10329570 Ga0207698_103295702 151
447 3300028379 Ga0268266_10048959 Ga0268266_100489591 151
448 3300028379 Ga0268266_10938016 Ga0268266_109380162 151
449 3300028573 Ga0265334_10114416 Ga0265334_101144162 151
450 3300028573 Ga0265334_10142860 Ga0265334_101428601 151
451 3300028577 Ga0265318_10266915 Ga0265318_102669151 151
452 3300031251 Ga0265327_10097793 Ga0265327_100977932 151
453 3300031548 Ga0307408_100015573 Ga0307408_1000155732 151
454 3300031548 Ga0307408_100287868 Ga0307408_1002878682 151
455 3300031548 Ga0307408_100384526 Ga0307408_1003845261 151
456 3300031731 Ga0307405_10004812 Ga0307405_100048127 151
457 3300031731 Ga0307405_10435309 Ga0307405_104353092 151
458 3300031824 Ga0307413_10597116 Ga0307413_105971162 151
459 3300031852 Ga0307410_10417627 Ga0307410_104176272 151
460 3300031901 Ga0307406_10182313 Ga0307406_101823132 151
461 3300031903 Ga0307407_10031785 Ga0307407_100317852 151
462 3300031903 Ga0307407_10502923 Ga0307407_105029232 151
463 3300031911 Ga0307412_10940949 Ga0307412_109409492 151
464 3300031911 Ga0307412_11086437 Ga0307412_110864371 151
465 3300031995 Ga0307409_100025747 Ga0307409_1000257476 151
466 3300031995 Ga0307409_100061797 Ga0307409_1000617971 151
467 3300032002 Ga0307416_100040131 Ga0307416_1000401312 151
468 3300032002 Ga0307416_100118391 Ga0307416_1001183912 151
469 3300032002 Ga0307416_100360839 Ga0307416_1003608392 151
470 3300032004 Ga0307414_10243475 Ga0307414_102434752 151
471 3300032005 Ga0307411_10153998 Ga0307411_101539982 151
472 3300032126 Ga0307415_100832037 Ga0307415_1008320372 151
473 3300032126 Ga0307415_101273243 Ga0307415_1012732431 151
474 3300035083 Ga0373926_0095199 Ga0373926_0095199_131_586 151
475 3300035086 Ga0373934_0430607 Ga0373934_0430607_36_491 151
476 3300035089 Ga0373944_0072406 Ga0373944_0072406_657_1112 151
477 3300035113 Ga0373936_0020681 Ga0373936_0020681_1008_1463 151
478 3300035170 Ga0373943_0039717 Ga0373943_0039717_858_1313 151
479 3300035170 Ga0373943_0087086 Ga0373943_0087086_12_467 151
480 3300035171 Ga0373946_0044796 Ga0373946_0044796_794_1249 151
481 3300035691 Ga0373931_0039207 Ga0373931_0039207_793_1248 151
482 3300035695 Ga0373927_0281848 Ga0373927_0281848_65_520 151
483 3300035724 Ga0373933_0297194 Ga0373933_0297194_216_671 151
484 3300035725 Ga0373947_0033686 Ga0373947_0033686_1734_2189 151
485 3300035725 Ga0373947_0060207 Ga0373947_0060207_1514_1969 151
486 3300036401 Ga0373937_0193836 Ga0373937_0193836_1197_1652 151
487 3300037312 Ga0395899_0001001 Ga0395899_0001001_23055_23510 151
488 3300037312 Ga0395899_0015657 Ga0395899_0015657_1747_2214 151
489 3300037312 Ga0395899_0018455 Ga0395899_0018455_1370_1828 151
490 3300037312 Ga0395899_0032687 Ga0395899_0032687_1179_1634 151
491 3300037312 Ga0395899_0041054 Ga0395899_0041054_786_1241 151
492 3300037312 Ga0395899_0081807 Ga0395899_0081807_850_1305 151
493 3300037312 Ga0395899_0094300 Ga0395899_0094300_203_670 151
494 3300037312 Ga0395899_0272526 Ga0395899_0272526_22_480 151
495 3300037312 Ga0395899_0650435 Ga0395899_0650435_187_642 151
496 3300037418 Ga0395900_0004233 Ga0395900_0004233_2234_2701 151
497 3300037418 Ga0395900_0004724 Ga0395900_0004724_3614_4069 151
498 3300037418 Ga0395900_0014519 Ga0395900_0014519_1105_1560 151
499 3300037418 Ga0395900_0015755 Ga0395900_0015755_3855_4313 151
500 3300037418 Ga0395900_0025692 Ga0395900_0025692_2259_2714 151
501 3300037418 Ga0395900_0032992 Ga0395900_0032992_1461_1928 151
502 3300037418 Ga0395900_0173719 Ga0395900_0173719_882_1337 151
503 3300037418 Ga0395900_0187989 Ga0395900_0187989_1625_2083 151
504 3300037418 Ga0395900_0229164 Ga0395900_0229164_957_1412 151
505 3300037418 Ga0395900_0424851 Ga0395900_0424851_661_1116 151
506 3300037418 Ga0395900_0654618 Ga0395900_0654618_346_801 151
507 3300037466 Ga0395898_0008982 Ga0395898_0008982_6627_7082 151
508 3300037466 Ga0395898_0016102 Ga0395898_0016102_5823_6281 151
509 3300037466 Ga0395898_0021780 Ga0395898_0021780_2814_3281 151
510 3300037466 Ga0395898_0031400 Ga0395898_0031400_2775_3230 151
511 3300037466 Ga0395898_0039643 Ga0395898_0039643_1692_2147 151
512 3300037466 Ga0395898_0285893 Ga0395898_0285893_480_935 151
513 3300037466 Ga0395898_0506784 Ga0395898_0506784_674_1132 151
514 3300037471 Ga0395905_0005063 Ga0395905_0005063_10177_10632 151
515 3300037471 Ga0395905_0005451 Ga0395905_0005451_6506_6961 151
516 3300037471 Ga0395905_0014689 Ga0395905_0014689_5950_6408 151
517 3300037471 Ga0395905_0023069 Ga0395905_0023069_3201_3656 151
518 3300037471 Ga0395905_0028306 Ga0395905_0028306_3239_3706 151
519 3300037471 Ga0395905_0064605 Ga0395905_0064605_1374_1841 151
520 3300037471 Ga0395905_0104764 Ga0395905_0104764_1530_1985 151
521 3300037471 Ga0395905_0301032 Ga0395905_0301032_538_993 151
522 3300037471 Ga0395905_0491959 Ga0395905_0491959_362_817 151
523 3300037471 Ga0395905_0560368 Ga0395905_0560368_412_867 151
524 3300037471 Ga0395905_1026758 Ga0395905_1026758_43_498 151
525 3300038443 Ga0395901_0002221 Ga0395901_0002221_17232_17699 151
526 3300038443 Ga0395901_0002468 Ga0395901_0002468_10150_10605 151
527 3300038443 Ga0395901_0029987 Ga0395901_0029987_1132_1599 151
528 3300038443 Ga0395901_0049122 Ga0395901_0049122_2736_3194 151
529 3300038443 Ga0395901_0053242 Ga0395901_0053242_621_1076 151
530 3300038443 Ga0395901_0095541 Ga0395901_0095541_2511_2966 151
531 3300038443 Ga0395901_0284494 Ga0395901_0284494_181_639 151
532 3300038443 Ga0395901_0291567 Ga0395901_0291567_649_1104 151
533 3300038443 Ga0395901_0475947 Ga0395901_0475947_585_1040 151
534 3300038443 Ga0395901_0667355 Ga0395901_0667355_26_481 151
535 3300038443 Ga0395901_1223430 Ga0395901_1223430_78_533 151
536 3300039437 Ga0436365_1553456 Ga0436365_1553456_274_729 151
537 3300039450 Ga0436363_0668989 Ga0436363_0668989_141_596 151
538 3300039450 Ga0436363_1348640 Ga0436363_1348640_10_465 151
539 3300041405 Ga0439438_045069 Ga0439438_045069_68_523 151
540 3300041405 Ga0439438_120893 Ga0439438_120893_56_511 151
541 3300041410 Ga0439461_0003605 Ga0439461_0003605_1803_2258 151
542 3300041413 Ga0439465_0098857 Ga0439465_0098857_384_839 151
543 3300041492 Ga0451835_0827407 Ga0451835_0827407_347_805 151
544 3300041997 Ga0439431_0130726 Ga0439431_0130726_108_563 151
545 3300042001 Ga0439441_012332 Ga0439441_012332_61_516 151
546 3300042016 Ga0439463_043686 Ga0439463_043686_568_1032 151
547 3300042120 Ga0450917_008674 Ga0450917_008674_320_775 151
548 3300042146 Ga0450907_011944 Ga0450907_011944_795_1253 151
549 3300042435 Ga0439434_0015538 Ga0439434_0015538_290_745 151
550 3300044656 Ga0466969_0103243 Ga0466969_0103243_516_974 151
551 3300044658 Ga0466972_0455956 Ga0466972_0455956_101_556 151
552 3300044684 Ga0466966_0128302 Ga0466966_0128302_175_633 151
553 3300044694 Ga0466963_0003083 Ga0466963_0003083_988_1443 151
554 3300044706 Ga0466964_0007545 Ga0466964_0007545_3541_3996 151
555 3300044842 Ga0466957_0035461 Ga0466957_0035461_1893_2348 151
556 3300044842 Ga0466957_0603646 Ga0466957_0603646_262_720 151
557 3300045049 Ga0466959_0148827 Ga0466959_0148827_1106_1564 151
558 3300045836 Ga0466958_0214086 Ga0466958_0214086_373_828 151
559 3300045976 Ga0466967_0001914 Ga0466967_0001914_7080_7535 151
560 3300045976 Ga0466967_0003262 Ga0466967_0003262_9700_10155 151
561 3300045976 Ga0466967_0015468 Ga0466967_0015468_1798_2253 151
562 3300045976 Ga0466967_0054908 Ga0466967_0054908_1901_2356 151
563 3300045976 Ga0466967_0137708 Ga0466967_0137708_127_582 151
564 3300045976 Ga0466967_0858283 Ga0466967_0858283_65_520 151
565 3300045976 Ga0466967_1476351 Ga0466967_1476351_199_657 151
566 3300046454 Ga0495592_0112947 Ga0495592_0112947_1336_1791 151
567 3300046454 Ga0495592_0750564 Ga0495592_0750564_108_563 151
568 3300046459 Ga0495629_0046938 Ga0495629_0046938_1145_1600 151
569 3300046459 Ga0495629_0819019 Ga0495629_0819019_53_508 151
570 3300046461 Ga0495641_0023550 Ga0495641_0023550_2241_2696 151
571 3300046462 Ga0495651_0248700 Ga0495651_0248700_99_554 151
572 3300046463 Ga0495653_0587652 Ga0495653_0587652_19_474 151
573 3300046473 Ga0495582_0127741 Ga0495582_0127741_26_481 151
574 3300046474 Ga0495605_0183141 Ga0495605_0183141_422_877 151
575 3300046476 Ga0495662_0035472 Ga0495662_0035472_1567_2022 151
576 3300046491 Ga0495584_0108216 Ga0495584_0108216_140_598 151
577 3300046492 Ga0495585_0266184 Ga0495585_0266184_190_654 151
578 3300046500 Ga0495596_0074630 Ga0495596_0074630_817_1275 151
579 3300046500 Ga0495596_0156887 Ga0495596_0156887_79_534 151
580 3300046500 Ga0495596_0335123 Ga0495596_0335123_85_561 151
581 3300046501 Ga0495607_0225143 Ga0495607_0225143_374_838 151
582 3300046511 Ga0495608_0052486 Ga0495608_0052486_1348_1803 151
583 3300046513 Ga0495616_0428307 Ga0495616_0428307_68_523 151
584 3300046514 Ga0495618_0260148 Ga0495618_0260148_416_871 151
585 3300046516 Ga0495628_0181249 Ga0495628_0181249_765_1220 151
586 3300046517 Ga0495630_0135334 Ga0495630_0135334_1241_1696 151
587 3300046517 Ga0495630_0228121 Ga0495630_0228121_211_666 151
588 3300046517 Ga0495630_0398463 Ga0495630_0398463_348_803 151
589 3300046517 Ga0495630_0538046 Ga0495630_0538046_96_551 151
590 3300046520 Ga0495637_0028523 Ga0495637_0028523_328_792 151
591 3300046523 Ga0495644_0128343 Ga0495644_0128343_369_833 151
592 3300046525 Ga0495663_0154082 Ga0495663_0154082_201_656 151
593 3300046525 Ga0495663_0268888 Ga0495663_0268888_43_498 151
594 3300046528 Ga0495642_0235976 Ga0495642_0235976_301_756 151
595 3300046533 Ga0495640_0044499 Ga0495640_0044499_1060_1515 151
596 3300046537 Ga0495598_0102770 Ga0495598_0102770_59_523 151
597 3300046537 Ga0495598_0131980 Ga0495598_0131980_260_718 151
598 3300046543 Ga0495645_0180645 Ga0495645_0180645_591_1046 151
599 3300046543 Ga0495645_0626745 Ga0495645_0626745_186_641 151
600 3300046559 Ga0495667_0050247 Ga0495667_0050247_343_798 151
601 3300046559 Ga0495667_0478577 Ga0495667_0478577_129_584 151
602 3300046615 Ga0495656_0196125 Ga0495656_0196125_475_930 151
603 3300046642 Ga0495634_0076063 Ga0495634_0076063_1658_2113 151
604 3300046648 Ga0495611_0094636 Ga0495611_0094636_503_967 151
605 3300046664 Ga0495659_0171023 Ga0495659_0171023_399_854 151
606 3300046665 Ga0495661_0420876 Ga0495661_0420876_50_505 151
607 3300046675 Ga0495657_0390097 Ga0495657_0390097_153_608 151
608 3300046675 Ga0495657_0562755 Ga0495657_0562755_69_524 151
609 3300046678 Ga0495599_0317149 Ga0495599_0317149_258_713 151
610 3300046678 Ga0495599_0727878 Ga0495599_0727878_10_465 151
611 3300046684 Ga0495669_0300484 Ga0495669_0300484_175_639 151
612 3300046689 Ga0495613_0319079 Ga0495613_0319079_267_722 151
613 3300046689 Ga0495613_0736123 Ga0495613_0736123_42_497 151
614 3300046690 Ga0495624_0494701 Ga0495624_0494701_168_623 151
615 3300046694 Ga0495649_0564922 Ga0495649_0564922_46_510 151
616 3300046794 Ga0495589_0426537 Ga0495589_0426537_17_472 151
617 3300047315 Ga0495581_0412987 Ga0495581_0412987_68_526 151
618 3300047318 Ga0495636_0246872 Ga0495636_0246872_179_643 151
619 3300047319 Ga0495674_0038374 Ga0495674_0038374_2355_2810 151
620 3300047319 Ga0495674_0055190 Ga0495674_0055190_1348_1803 151
621 3300047321 Ga0495676_0087650 Ga0495676_0087650_735_1190 151
622 3300047322 Ga0495680_0006671 Ga0495680_0006671_8869_9324 151
623 3300047322 Ga0495680_0374265 Ga0495680_0374265_226_681 151
624 3300047323 Ga0495683_0432331 Ga0495683_0432331_33_488 151
625 3300048088 Ga0495602_0157092 Ga0495602_0157092_449_904 151
626 3300048903 Ga0496100_0013049 Ga0496100_0013049_2611_3066 151
627 3300048903 Ga0496100_0017810 Ga0496100_0017810_2338_2793 151
628 3300048903 Ga0496100_0287704 Ga0496100_0287704_738_1193 151
629 3300048903 Ga0496100_0679569 Ga0496100_0679569_27_491 151
630 3300048903 Ga0496100_0694590 Ga0496100_0694590_314_769 151
631 3300048904 Ga0496101_0003097 Ga0496101_0003097_2968_3423 151
632 3300048904 Ga0496101_0088309 Ga0496101_0088309_168_623 151
633 3300048904 Ga0496101_0167196 Ga0496101_0167196_798_1253 151
634 3300048905 Ga0496102_0010358 Ga0496102_0010358_6434_6889 151
635 3300048905 Ga0496102_0327479 Ga0496102_0327479_164_619 151
636 3300048906 Ga0496103_0124345 Ga0496103_0124345_834_1289 151
637 3300048906 Ga0496103_0345080 Ga0496103_0345080_466_921 151
638 3300048907 Ga0496104_0000134 Ga0496104_0000134_37034_37489 151
639 3300048907 Ga0496104_0002226 Ga0496104_0002226_3648_4103 151
640 3300048907 Ga0496104_0009373 Ga0496104_0009373_7140_7595 151
641 3300048907 Ga0496104_0079872 Ga0496104_0079872_408_863 151
642 3300048907 Ga0496104_0124098 Ga0496104_0124098_205_660 151
643 3300048907 Ga0496104_1156832 Ga0496104_1156832_94_549 151
644 3300048908 Ga0496105_0000334 Ga0496105_0000334_11867_12322 151
645 3300048908 Ga0496105_0000429 Ga0496105_0000429_1685_2140 151
646 3300048908 Ga0496105_0003332 Ga0496105_0003332_10578_11033 151
647 3300048909 Ga0496106_0009788 Ga0496106_0009788_6555_7010 151
648 3300048909 Ga0496106_0207466 Ga0496106_0207466_444_899 151
649 3300048909 Ga0496106_0284268 Ga0496106_0284268_195_650 151
650 3300048910 Ga0496107_0050773 Ga0496107_0050773_1742_2197 151
651 3300048910 Ga0496107_0055898 Ga0496107_0055898_2080_2535 151
652 3300048910 Ga0496107_0503341 Ga0496107_0503341_407_862 151
653 3300048911 Ga0496108_0003536 Ga0496108_0003536_3648_4103 151
654 3300048911 Ga0496108_0017704 Ga0496108_0017704_3289_3744 151
655 3300048911 Ga0496108_0033079 Ga0496108_0033079_2328_2783 151
656 3300048911 Ga0496108_1372233 Ga0496108_1372233_41_496 151
657 3300048911 Ga0496108_1380347 Ga0496108_1380347_101_556 151
658 3300048911 Ga0496108_1534265 Ga0496108_1534265_70_525 151
659 3300048912 Ga0496109_0000898 Ga0496109_0000898_21612_22067 151
660 3300048912 Ga0496109_0004403 Ga0496109_0004403_4253_4708 151
661 3300048912 Ga0496109_0023182 Ga0496109_0023182_2114_2569 151
662 3300048912 Ga0496109_0042839 Ga0496109_0042839_2414_2869 151
663 3300048912 Ga0496109_0112373 Ga0496109_0112373_1438_1902 151
664 3300048913 Ga0496110_0000164 Ga0496110_0000164_36841_37296 151
665 3300048913 Ga0496110_0006694 Ga0496110_0006694_4620_5075 151
666 3300048913 Ga0496110_0014588 Ga0496110_0014588_1821_2276 151
667 3300048913 Ga0496110_0108442 Ga0496110_0108442_75_530 151
668 3300048913 Ga0496110_0117827 Ga0496110_0117827_1025_1489 151
669 3300048914 Ga0496111_0000228 Ga0496111_0000228_10820_11275 151
670 3300048914 Ga0496111_0000295 Ga0496111_0000295_20127_20582 151
671 3300048914 Ga0496111_0002679 Ga0496111_0002679_6191_6646 151
672 3300048914 Ga0496111_0015328 Ga0496111_0015328_3595_4050 151
673 3300048914 Ga0496111_0048024 Ga0496111_0048024_1367_1831 151
674 3300048914 Ga0496111_0089012 Ga0496111_0089012_1576_2031 151
675 3300048914 Ga0496111_0162974 Ga0496111_0162974_925_1380 151
676 3300048915 Ga0496112_0000291 Ga0496112_0000291_28348_28803 151
677 3300048915 Ga0496112_0000443 Ga0496112_0000443_6148_6603 151
678 3300048915 Ga0496112_0825665 Ga0496112_0825665_366_821 151
679 3300048916 Ga0496113_0001618 Ga0496113_0001618_5233_5688 151
680 3300048916 Ga0496113_0158435 Ga0496113_0158435_65_523 151
681 3300048916 Ga0496113_0263470 Ga0496113_0263470_287_751 151
682 3300048916 Ga0496113_0569826 Ga0496113_0569826_259_714 151
683 3300048917 Ga0496114_0000281 Ga0496114_0000281_34772_35227 151
684 3300048917 Ga0496114_0003176 Ga0496114_0003176_3384_3839 151
685 3300048917 Ga0496114_0371130 Ga0496114_0371130_668_1123 151
686 3300048917 Ga0496114_0438328 Ga0496114_0438328_318_773 151
687 3300048918 Ga0496115_0015385 Ga0496115_0015385_1074_1529 151
688 3300048918 Ga0496115_0057152 Ga0496115_0057152_1158_1613 151
689 3300048918 Ga0496115_0231042 Ga0496115_0231042_258_713 151
690 3300048918 Ga0496115_0380090 Ga0496115_0380090_94_549 151
691 3300049568 Ga0501031_0104493 Ga0501031_0104493_402_860 151
692 3300049570 Ga0501033_0048171 Ga0501033_0048171_1416_1874 151
693 3300049571 Ga0501034_1528207 Ga0501034_1528207_29_484 151
694 3300049572 Ga0501036_0004455 Ga0501036_0004455_9441_9899 151
695 3300049574 Ga0501038_0072163 Ga0501038_0072163_1029_1487 151
696 3300049575 Ga0501039_0009773 Ga0501039_0009773_4845_5303 151
697 3300049576 Ga0501040_0028879 Ga0501040_0028879_2962_3420 151
698 3300049577 Ga0501041_0001675 Ga0501041_0001675_3634_4092 151
699 3300049578 Ga0501042_0013943 Ga0501042_0013943_1023_1481 151
700 3300049578 Ga0501042_0096600 Ga0501042_0096600_730_1188 151
701 3300049579 Ga0501043_0059002 Ga0501043_0059002_1892_2350 151
702 3300049580 Ga0501046_0015550 Ga0501046_0015550_4694_5152 151
703 3300049582 Ga0501048_0054653 Ga0501048_0054653_2322_2780 151
704 3300049583 Ga0501067_0000154 Ga0501067_0000154_12096_12551 151
705 3300049583 Ga0501067_0018163 Ga0501067_0018163_344_799 151
706 3300049584 Ga0501068_0114948 Ga0501068_0114948_266_721 151
707 3300049585 Ga0501069_0006471 Ga0501069_0006471_1816_2271 151
708 3300049586 Ga0501070_0084234 Ga0501070_0084234_731_1189 151
709 3300049587 Ga0501071_0001272 Ga0501071_0001272_4403_4861 151
710 3300049588 Ga0501072_0106992 Ga0501072_0106992_295_753 151
711 3300049590 Ga0501074_0012526 Ga0501074_0012526_2543_2998 151
712 3300049590 Ga0501074_0018826 Ga0501074_0018826_3338_3796 151
713 3300049592 Ga0501076_0009936 Ga0501076_0009936_5822_6280 151
714 3300049593 Ga0501077_0002323 Ga0501077_0002323_9754_10212 151
715 3300049741 Ga0501079_0004378 Ga0501079_0004378_608_1066 151
716 3300049742 Ga0501080_0160365 Ga0501080_0160365_203_661 151
717 3300049742 Ga0501080_0252296 Ga0501080_0252296_148_603 151
718 3300049743 Ga0501081_0001229 Ga0501081_0001229_9559_10017 151
719 3300049822 Ga0501035_0127654 Ga0501035_0127654_666_1124 151
720 3300049822 Ga0501035_1171300 Ga0501035_1171300_122_580 151
721 3300049824 Ga0501045_0002724 Ga0501045_0002724_1398_1856 151
722 3300050511 nmdc:mga08y16_1054378_c1 nmdc:mga08y16_1054378_c1_198_653 151
723 3300050511 nmdc:mga08y16_1695176_c1 nmdc:mga08y16_1695176_c1_109_564 151
724 3300050515 nmdc:mga0a205_553517_c1 nmdc:mga0a205_553517_c1_17_472 151
725 3300053077 Ga0495601_0276367 Ga0495601_0276367_432_887 151
726 3300053077 Ga0495601_0476578 Ga0495601_0476578_270_725 151
727 3300053083 Ga0495655_0131140 Ga0495655_0131140_44_499 151
728 3300054114 Ga0501084_0000859 Ga0501084_0000859_10554_11012 151
729 3300059426 Ga0590077_129034 Ga0590077_129034_39_494 151
730 3300060353 Ga0501082_0008383 Ga0501082_0008383_1384_1842 151
731 3300060353 Ga0501082_0568272 Ga0501082_0568272_88_543 151
732 3300061734 Ga0530510_0022663 Ga0530510_0022663_2100_2555 151
733 3300061734 Ga0530510_0055552 Ga0530510_0055552_320_778 151
734 3300061734 Ga0530510_0683490 Ga0530510_0683490_192_647 151
735 3300003373 JGI25407J50210_10007085 JGI25407J50210_100070853 152
736 3300005327 Ga0070658_10118883 Ga0070658_101188832 152
737 3300005336 Ga0070680_100508824 Ga0070680_1005088241 152
738 3300005338 Ga0068868_100036832 Ga0068868_1000368324 152
739 3300005339 Ga0070660_100330820 Ga0070660_1003308202 152
740 3300005340 Ga0070689_100136273 Ga0070689_1001362732 152
741 3300005343 Ga0070687_100057362 Ga0070687_1000573621 152
742 3300005345 Ga0070692_10015268 Ga0070692_100152682 152
743 3300005347 Ga0070668_100091137 Ga0070668_1000911372 152
744 3300005355 Ga0070671_100242954 Ga0070671_1002429541 152
745 3300005356 Ga0070674_100001639 Ga0070674_1000016392 152
746 3300005365 Ga0070688_100012006 Ga0070688_1000120062 152
747 3300005434 Ga0070709_10024012 Ga0070709_100240123 152
748 3300005435 Ga0070714_100092282 Ga0070714_1000922823 152
749 3300005435 Ga0070714_100361204 Ga0070714_1003612042 152
750 3300005435 Ga0070714_100794008 Ga0070714_1007940081 152
751 3300005436 Ga0070713_100088433 Ga0070713_1000884332 152
752 3300005437 Ga0070710_10005124 Ga0070710_100051247 152
753 3300005437 Ga0070710_10025539 Ga0070710_100255392 152
754 3300005439 Ga0070711_100896904 Ga0070711_1008969042 152
755 3300005440 Ga0070705_100117914 Ga0070705_1001179142 152
756 3300005440 Ga0070705_100347908 Ga0070705_1003479081 152
757 3300005441 Ga0070700_100063569 Ga0070700_1000635692 152
758 3300005444 Ga0070694_100156515 Ga0070694_1001565153 152
759 3300005444 Ga0070694_100443972 Ga0070694_1004439722 152
760 3300005445 Ga0070708_100179564 Ga0070708_1001795642 152
761 3300005455 Ga0070663_100670482 Ga0070663_1006704821 152
762 3300005456 Ga0070678_100020686 Ga0070678_1000206865 152
763 3300005458 Ga0070681_10109636 Ga0070681_101096362 152
764 3300005458 Ga0070681_10140248 Ga0070681_101402483 152
765 3300005458 Ga0070681_10152188 Ga0070681_101521882 152
766 3300005459 Ga0068867_100030890 Ga0068867_1000308903 152
767 3300005466 Ga0070685_10223648 Ga0070685_102236481 152
768 3300005467 Ga0070706_100049868 Ga0070706_1000498684 152
769 3300005467 Ga0070706_100405326 Ga0070706_1004053262 152
770 3300005468 Ga0070707_100754205 Ga0070707_1007542052 152
771 3300005468 Ga0070707_101548580 Ga0070707_1015485801 152
772 3300005518 Ga0070699_100622265 Ga0070699_1006222651 152
773 3300005518 Ga0070699_100880570 Ga0070699_1008805701 152
774 3300005530 Ga0070679_100305321 Ga0070679_1003053212 152
775 3300005530 Ga0070679_100792900 Ga0070679_1007929002 152
776 3300005535 Ga0070684_100317442 Ga0070684_1003174422 152
777 3300005536 Ga0070697_100385011 Ga0070697_1003850112 152
778 3300005536 Ga0070697_100829415 Ga0070697_1008294151 152
779 3300005539 Ga0068853_100306811 Ga0068853_1003068112 152
780 3300005543 Ga0070672_101034147 Ga0070672_1010341472 152
781 3300005544 Ga0070686_100032900 Ga0070686_1000329003 152
782 3300005545 Ga0070695_100159593 Ga0070695_1001595932 152
783 3300005545 Ga0070695_100192979 Ga0070695_1001929792 152
784 3300005546 Ga0070696_100056669 Ga0070696_1000566692 152
785 3300005546 Ga0070696_100581900 Ga0070696_1005819002 152
786 3300005547 Ga0070693_100845452 Ga0070693_1008454521 152
787 3300005548 Ga0070665_100053631 Ga0070665_1000536313 152
788 3300005549 Ga0070704_100002938 Ga0070704_1000029382 152
789 3300005563 Ga0068855_100351765 Ga0068855_1003517652 152
790 3300005563 Ga0068855_100425009 Ga0068855_1004250091 152
791 3300005615 Ga0070702_100069911 Ga0070702_1000699112 152
792 3300005616 Ga0068852_100045532 Ga0068852_1000455323 152
793 3300005617 Ga0068859_100331513 Ga0068859_1003315132 152
794 3300005718 Ga0068866_10104869 Ga0068866_101048692 152
795 3300005719 Ga0068861_100222240 Ga0068861_1002222402 152
796 3300005842 Ga0068858_100832431 Ga0068858_1008324312 152
797 3300005844 Ga0068862_101099680 Ga0068862_1010996802 152
798 3300005937 Ga0081455_10010251 Ga0081455_100102519 152
799 3300005937 Ga0081455_10564750 Ga0081455_105647502 152
800 3300005981 Ga0081538_10000518 Ga0081538_1000051836 152
801 3300005981 Ga0081538_10173146 Ga0081538_101731462 152
802 3300005981 Ga0081538_10174882 Ga0081538_101748822 152
803 3300006163 Ga0070715_10011644 Ga0070715_100116443 152
804 3300006163 Ga0070715_10510508 Ga0070715_105105082 152
805 3300006175 Ga0070712_100110168 Ga0070712_1001101682 152
806 3300006175 Ga0070712_100177212 Ga0070712_1001772122 152
807 3300006175 Ga0070712_101030674 Ga0070712_1010306741 152
808 3300006358 Ga0068871_100026449 Ga0068871_1000264494 152
809 3300006871 Ga0075434_100005135 Ga0075434_1000051359 152
810 3300006871 Ga0075434_100529470 Ga0075434_1005294702 152
811 3300006881 Ga0068865_100017722 Ga0068865_1000177224 152
812 3300006931 Ga0097620_100331517 Ga0097620_1003315172 152
813 3300007076 Ga0075435_100020149 Ga0075435_1000201497 152
814 3300007076 Ga0075435_100045328 Ga0075435_1000453283 152
815 3300009036 Ga0105244_10238047 Ga0105244_102380472 152
816 3300009093 Ga0105240_10439215 Ga0105240_104392152 152
817 3300009093 Ga0105240_10637414 Ga0105240_106374142 152
818 3300009093 Ga0105240_10708309 Ga0105240_107083092 152
819 3300009094 Ga0111539_10089729 Ga0111539_100897293 152
820 3300009098 Ga0105245_10011977 Ga0105245_100119776 152
821 3300009098 Ga0105245_11650211 Ga0105245_116502112 152
822 3300009101 Ga0105247_10203629 Ga0105247_102036292 152
823 3300009147 Ga0114129_11103449 Ga0114129_111034492 152
824 3300009148 Ga0105243_10032733 Ga0105243_100327332 152
825 3300009174 Ga0105241_10043494 Ga0105241_100434942 152
826 3300009174 Ga0105241_10405328 Ga0105241_104053281 152
827 3300009174 Ga0105241_10816530 Ga0105241_108165302 152
828 3300009176 Ga0105242_10006264 Ga0105242_1000626411 152
829 3300009177 Ga0105248_10008130 Ga0105248_100081303 152
830 3300009177 Ga0105248_11117168 Ga0105248_111171682 152
831 3300009553 Ga0105249_10017957 Ga0105249_100179576 152
832 3300013100 Ga0157373_10164163 Ga0157373_101641631 152
833 3300013104 Ga0157370_10932051 Ga0157370_109320512 152
834 3300013105 Ga0157369_10004499 Ga0157369_1000449916 152
835 3300013105 Ga0157369_10032180 Ga0157369_100321802 152
836 3300013105 Ga0157369_10045279 Ga0157369_100452794 152
837 3300013296 Ga0157374_10033180 Ga0157374_100331802 152
838 3300013297 Ga0157378_10018799 Ga0157378_100187994 152
839 3300013306 Ga0163162_10030463 Ga0163162_100304632 152
840 3300013307 Ga0157372_10524982 Ga0157372_105249822 152
841 3300013308 Ga0157375_10064197 Ga0157375_100641974 152
842 3300013308 Ga0157375_10569078 Ga0157375_105690782 152
843 3300013308 Ga0157375_10839944 Ga0157375_108399442 152
844 3300014326 Ga0157380_10134754 Ga0157380_101347543 152
845 3300014745 Ga0157377_10003323 Ga0157377_100033239 152
846 3300014745 Ga0157377_10562207 Ga0157377_105622071 152
847 3300014969 Ga0157376_10013033 Ga0157376_100130332 152
848 3300014969 Ga0157376_10077981 Ga0157376_100779813 152
849 3300020070 Ga0206356_10777109 Ga0206356_107771092 152
850 3300020082 Ga0206353_11185381 Ga0206353_111853812 152
851 3300020082 Ga0206353_11283255 Ga0206353_112832552 152
852 3300025898 Ga0207692_10064075 Ga0207692_100640753 152
853 3300025905 Ga0207685_10003453 Ga0207685_100034532 152
854 3300025905 Ga0207685_10042480 Ga0207685_100424802 152
855 3300025905 Ga0207685_10429030 Ga0207685_104290302 152
856 3300025906 Ga0207699_10612734 Ga0207699_106127342 152
857 3300025910 Ga0207684_10308549 Ga0207684_103085492 152
858 3300025912 Ga0207707_10146159 Ga0207707_101461592 152
859 3300025913 Ga0207695_11223259 Ga0207695_112232591 152
860 3300025913 Ga0207695_11391233 Ga0207695_113912331 152
861 3300025915 Ga0207693_10003565 Ga0207693_100035653 152
862 3300025915 Ga0207693_10018792 Ga0207693_100187925 152
863 3300025915 Ga0207693_10452898 Ga0207693_104528982 152
864 3300025915 Ga0207693_10651909 Ga0207693_106519091 152
865 3300025915 Ga0207693_11210892 Ga0207693_112108921 152
866 3300025916 Ga0207663_10007094 Ga0207663_100070943 152
867 3300025916 Ga0207663_10381228 Ga0207663_103812282 152
868 3300025917 Ga0207660_10028394 Ga0207660_100283942 152
869 3300025917 Ga0207660_10183140 Ga0207660_101831402 152
870 3300025917 Ga0207660_10193902 Ga0207660_101939022 152
871 3300025919 Ga0207657_10022825 Ga0207657_100228252 152
872 3300025919 Ga0207657_10296287 Ga0207657_102962872 152
873 3300025919 Ga0207657_10463485 Ga0207657_104634852 152
874 3300025920 Ga0207649_10058915 Ga0207649_100589152 152
875 3300025921 Ga0207652_10315648 Ga0207652_103156482 152
876 3300025922 Ga0207646_10116678 Ga0207646_101166782 152
877 3300025922 Ga0207646_10480907 Ga0207646_104809072 152
878 3300025922 Ga0207646_11341739 Ga0207646_113417391 152
879 3300025922 Ga0207646_11774333 Ga0207646_117743331 152
880 3300025926 Ga0207659_10350236 Ga0207659_103502362 152
881 3300025927 Ga0207687_10016945 Ga0207687_100169454 152
882 3300025928 Ga0207700_10205214 Ga0207700_102052142 152
883 3300025928 Ga0207700_11029053 Ga0207700_110290532 152
884 3300025929 Ga0207664_10178321 Ga0207664_101783212 152
885 3300025929 Ga0207664_10180407 Ga0207664_101804072 152
886 3300025931 Ga0207644_11057209 Ga0207644_110572092 152
887 3300025932 Ga0207690_10047168 Ga0207690_100471682 152
888 3300025933 Ga0207706_10390263 Ga0207706_103902632 152
889 3300025934 Ga0207686_10048195 Ga0207686_100481953 152
890 3300025938 Ga0207704_10004032 Ga0207704_100040323 152
891 3300025940 Ga0207691_10013728 Ga0207691_100137282 152
892 3300025941 Ga0207711_10096344 Ga0207711_100963442 152
893 3300025941 Ga0207711_11140097 Ga0207711_111400972 152
894 3300025944 Ga0207661_10209783 Ga0207661_102097833 152
895 3300025949 Ga0207667_10194294 Ga0207667_101942943 152
896 3300025949 Ga0207667_10239947 Ga0207667_102399473 152
897 3300025949 Ga0207667_10884102 Ga0207667_108841022 152
898 3300025960 Ga0207651_10159469 Ga0207651_101594693 152
899 3300025961 Ga0207712_10032434 Ga0207712_100324343 152
900 3300025972 Ga0207668_10197019 Ga0207668_101970192 152
901 3300025981 Ga0207640_11179175 Ga0207640_111791751 152
902 3300026023 Ga0207677_10094427 Ga0207677_100944273 152
903 3300026035 Ga0207703_10355749 Ga0207703_103557492 152
904 3300026041 Ga0207639_10068169 Ga0207639_100681692 152
905 3300026067 Ga0207678_10018270 Ga0207678_100182702 152
906 3300026075 Ga0207708_10022143 Ga0207708_100221432 152
907 3300026089 Ga0207648_10004050 Ga0207648_1000405013 152
908 3300026095 Ga0207676_10466005 Ga0207676_104660052 152
909 3300026118 Ga0207675_100138731 Ga0207675_1001387313 152
910 3300026121 Ga0207683_10002338 Ga0207683_1000233811 152
911 3300026121 Ga0207683_10703252 Ga0207683_107032522 152
912 3300026142 Ga0207698_10125784 Ga0207698_101257842 152
913 3300026142 Ga0207698_10457688 Ga0207698_104576882 152
914 3300027907 Ga0207428_10336607 Ga0207428_103366072 152
915 3300028379 Ga0268266_10815941 Ga0268266_108159411 152
916 3300028563 Ga0265319_1120671 Ga0265319_11206712 152
917 3300028573 Ga0265334_10033057 Ga0265334_100330572 152
918 3300028577 Ga0265318_10025573 Ga0265318_100255732 152
919 3300031344 Ga0265316_10181661 Ga0265316_101816612 152
920 3300031548 Ga0307408_100533329 Ga0307408_1005333292 152
921 3300032002 Ga0307416_100222007 Ga0307416_1002220074 152
922 3300032002 Ga0307416_101218764 Ga0307416_1012187642 152
923 3300034820 Ga0373959_0019332 Ga0373959_0019332_769_1227 152
924 3300035207 Ga0373942_0049779 Ga0373942_0049779_345_803 152
925 3300037068 Ga0373925_0744518 Ga0373925_0744518_274_738 152
926 3300037312 Ga0395899_0035364 Ga0395899_0035364_255_722 152
927 3300037312 Ga0395899_0090882 Ga0395899_0090882_141_599 152
928 3300037312 Ga0395899_0091878 Ga0395899_0091878_37_498 152
929 3300037312 Ga0395899_0146113 Ga0395899_0146113_435_893 152
930 3300037312 Ga0395899_0948472 Ga0395899_0948472_25_483 152
931 3300037418 Ga0395900_0015897 Ga0395900_0015897_1089_1547 152
932 3300037418 Ga0395900_0028300 Ga0395900_0028300_4120_4578 152
933 3300037418 Ga0395900_0029582 Ga0395900_0029582_2319_2780 152
934 3300037418 Ga0395900_0086108 Ga0395900_0086108_993_1451 152
935 3300037418 Ga0395900_0109879 Ga0395900_0109879_1317_1775 152
936 3300037418 Ga0395900_0116756 Ga0395900_0116756_1407_1874 152
937 3300037418 Ga0395900_0172876 Ga0395900_0172876_1529_1996 152
938 3300037418 Ga0395900_0201725 Ga0395900_0201725_32_490 152
939 3300037418 Ga0395900_0315526 Ga0395900_0315526_678_1136 152
940 3300037466 Ga0395898_0006542 Ga0395898_0006542_7423_7881 152
941 3300037466 Ga0395898_0053413 Ga0395898_0053413_1407_1868 152
942 3300037466 Ga0395898_0076712 Ga0395898_0076712_1591_2049 152
943 3300037466 Ga0395898_0155740 Ga0395898_0155740_1698_2165 152
944 3300037466 Ga0395898_0171390 Ga0395898_0171390_186_644 152
945 3300037466 Ga0395898_0196487 Ga0395898_0196487_512_979 152
946 3300037466 Ga0395898_0832280 Ga0395898_0832280_53_520 152
947 3300037466 Ga0395898_1158190 Ga0395898_1158190_182_640 152
948 3300037471 Ga0395905_0010082 Ga0395905_0010082_6430_6891 152
949 3300037471 Ga0395905_0079795 Ga0395905_0079795_1641_2108 152
950 3300037471 Ga0395905_0103737 Ga0395905_0103737_948_1406 152
951 3300037471 Ga0395905_0108622 Ga0395905_0108622_1883_2350 152
952 3300037471 Ga0395905_0491894 Ga0395905_0491894_624_1082 152
953 3300038443 Ga0395901_0016661 Ga0395901_0016661_4875_5333 152
954 3300038443 Ga0395901_0017935 Ga0395901_0017935_2972_3430 152
955 3300038443 Ga0395901_0018242 Ga0395901_0018242_4657_5115 152
956 3300038443 Ga0395901_0052058 Ga0395901_0052058_1655_2113 152
957 3300038443 Ga0395901_0115220 Ga0395901_0115220_26_484 152
958 3300038443 Ga0395901_0168721 Ga0395901_0168721_450_908 152
959 3300038443 Ga0395901_0408991 Ga0395901_0408991_534_992 152
960 3300038443 Ga0395901_0745974 Ga0395901_0745974_37_498 152
961 3300038443 Ga0395901_0817566 Ga0395901_0817566_21_488 152
962 3300039438 Ga0436360_0506477 Ga0436360_0506477_4078_4542 152
963 3300039438 Ga0436360_0511686 Ga0436360_0511686_122_580 152
964 3300039453 Ga0436362_0327669 Ga0436362_0327669_691_1155 152
965 3300042145 Ga0450906_055882 Ga0450906_055882_179_640 152
966 3300042156 Ga0439446_0361271 Ga0439446_0361271_19_483 152
967 3300042184 Ga0450908_042915 Ga0450908_042915_240_701 152
968 3300044684 Ga0466966_0013321 Ga0466966_0013321_4446_4904 152
969 3300044684 Ga0466966_0055786 Ga0466966_0055786_1444_1905 152
970 3300044684 Ga0466966_0103961 Ga0466966_0103961_367_825 152
971 3300044684 Ga0466966_0296909 Ga0466966_0296909_214_672 152
972 3300044693 Ga0466961_0001805 Ga0466961_0001805_385_843 152
973 3300044694 Ga0466963_0041038 Ga0466963_0041038_1471_1929 152
974 3300044706 Ga0466964_0003275 Ga0466964_0003275_5164_5622 152
975 3300044706 Ga0466964_0004021 Ga0466964_0004021_3947_4405 152
976 3300044706 Ga0466964_0125030 Ga0466964_0125030_333_791 152
977 3300044719 Ga0466971_0026732 Ga0466971_0026732_39_497 152
978 3300044735 Ga0466968_0026293 Ga0466968_0026293_613_1071 152
979 3300044735 Ga0466968_0265340 Ga0466968_0265340_62_520 152
980 3300044842 Ga0466957_0045276 Ga0466957_0045276_1520_1978 152
981 3300044842 Ga0466957_0102563 Ga0466957_0102563_952_1410 152
982 3300044842 Ga0466957_0199451 Ga0466957_0199451_801_1259 152
983 3300044901 Ga0466960_0026703 Ga0466960_0026703_366_824 152
984 3300045049 Ga0466959_0059584 Ga0466959_0059584_1489_1947 152
985 3300045049 Ga0466959_0138653 Ga0466959_0138653_825_1283 152
986 3300045836 Ga0466958_0007711 Ga0466958_0007711_3545_4003 152
987 3300045836 Ga0466958_0066985 Ga0466958_0066985_1337_1795 152
988 3300045836 Ga0466958_0220499 Ga0466958_0220499_152_610 152
989 3300045836 Ga0466958_0853854 Ga0466958_0853854_91_549 152
990 3300045976 Ga0466967_0025617 Ga0466967_0025617_4309_4767 152
991 3300045976 Ga0466967_0084997 Ga0466967_0084997_519_977 152
992 3300045976 Ga0466967_0087121 Ga0466967_0087121_515_973 152
993 3300045976 Ga0466967_0094124 Ga0466967_0094124_2084_2542 152
994 3300045976 Ga0466967_0115898 Ga0466967_0115898_1886_2344 152
995 3300045976 Ga0466967_0160751 Ga0466967_0160751_868_1338 152
996 3300045976 Ga0466967_0179667 Ga0466967_0179667_302_760 152
997 3300045976 Ga0466967_0213864 Ga0466967_0213864_539_997 152
998 3300046477 Ga0495664_0496142 Ga0495664_0496142_25_483 152
999 3300046491 Ga0495584_0084022 Ga0495584_0084022_696_1154 152
1000 3300046491 Ga0495584_0105889 Ga0495584_0105889_358_825 152
1001 3300046500 Ga0495596_0105199 Ga0495596_0105199_312_770 152
1002 3300046501 Ga0495607_0099382 Ga0495607_0099382_1062_1520 152
1003 3300046513 Ga0495616_0088845 Ga0495616_0088845_480_938 152
1004 3300046526 Ga0495666_0100536 Ga0495666_0100536_193_651 152
1005 3300046529 Ga0495652_0402912 Ga0495652_0402912_21_479 152
1006 3300046559 Ga0495667_0502674 Ga0495667_0502674_190_648 152
1007 3300046615 Ga0495656_0036803 Ga0495656_0036803_686_1144 152
1008 3300046675 Ga0495657_0038175 Ga0495657_0038175_2270_2728 152
1009 3300046794 Ga0495589_0107891 Ga0495589_0107891_480_938 152
1010 3300047317 Ga0495604_0163609 Ga0495604_0163609_250_708 152
1011 3300047319 Ga0495674_0046005 Ga0495674_0046005_2697_3155 152
1012 3300047322 Ga0495680_0095433 Ga0495680_0095433_1267_1725 152
1013 3300048088 Ga0495602_0087030 Ga0495602_0087030_1249_1707 152
1014 3300048089 Ga0495614_0197046 Ga0495614_0197046_16_474 152
1015 3300048903 Ga0496100_0008217 Ga0496100_0008217_3460_3918 152
1016 3300048903 Ga0496100_0082161 Ga0496100_0082161_577_1035 152
1017 3300048903 Ga0496100_0426778 Ga0496100_0426778_264_722 152
1018 3300048904 Ga0496101_0001675 Ga0496101_0001675_10673_11131 152
1019 3300048904 Ga0496101_0159668 Ga0496101_0159668_752_1210 152
1020 3300048905 Ga0496102_0040337 Ga0496102_0040337_2773_3231 152
1021 3300048905 Ga0496102_0066040 Ga0496102_0066040_716_1174 152
1022 3300048905 Ga0496102_0525111 Ga0496102_0525111_253_711 152
1023 3300048906 Ga0496103_0011909 Ga0496103_0011909_3539_3997 152
1024 3300048906 Ga0496103_0244348 Ga0496103_0244348_474_932 152
1025 3300048907 Ga0496104_0143093 Ga0496104_0143093_790_1248 152
1026 3300048907 Ga0496104_0903148 Ga0496104_0903148_127_585 152
1027 3300048908 Ga0496105_0072352 Ga0496105_0072352_765_1223 152
1028 3300048908 Ga0496105_0129599 Ga0496105_0129599_442_900 152
1029 3300048908 Ga0496105_0695540 Ga0496105_0695540_216_674 152
1030 3300048909 Ga0496106_0309841 Ga0496106_0309841_693_1151 152
1031 3300048910 Ga0496107_0033042 Ga0496107_0033042_2416_2874 152
1032 3300048910 Ga0496107_0233644 Ga0496107_0233644_574_1032 152
1033 3300048910 Ga0496107_0235471 Ga0496107_0235471_280_738 152
1034 3300048911 Ga0496108_0129163 Ga0496108_0129163_576_1034 152
1035 3300048912 Ga0496109_0078645 Ga0496109_0078645_102_560 152
1036 3300048912 Ga0496109_0187673 Ga0496109_0187673_256_714 152
1037 3300048912 Ga0496109_0213280 Ga0496109_0213280_100_558 152
1038 3300048913 Ga0496110_0198647 Ga0496110_0198647_1133_1591 152
1039 3300048913 Ga0496110_1237352 Ga0496110_1237352_20_478 152
1040 3300048914 Ga0496111_0067212 Ga0496111_0067212_1506_1964 152
1041 3300048915 Ga0496112_0012008 Ga0496112_0012008_3939_4397 152
1042 3300048915 Ga0496112_0027889 Ga0496112_0027889_2806_3264 152
1043 3300048915 Ga0496112_0175579 Ga0496112_0175579_38_496 152
1044 3300048916 Ga0496113_0335155 Ga0496113_0335155_233_691 152
1045 3300048917 Ga0496114_0002188 Ga0496114_0002188_5360_5818 152
1046 3300048917 Ga0496114_0055144 Ga0496114_0055144_1400_1858 152
1047 3300048917 Ga0496114_0354314 Ga0496114_0354314_535_993 152
1048 3300048917 Ga0496114_0584784 Ga0496114_0584784_175_639 152
1049 3300048918 Ga0496115_0027454 Ga0496115_0027454_1052_1510 152
1050 3300049568 Ga0501031_0005532 Ga0501031_0005532_7648_8106 152
1051 3300049569 Ga0501032_0063899 Ga0501032_0063899_238_696 152
1052 3300049570 Ga0501033_0002824 Ga0501033_0002824_8803_9261 152
1053 3300049572 Ga0501036_0075063 Ga0501036_0075063_495_953 152
1054 3300049573 Ga0501037_0000851 Ga0501037_0000851_11815_12273 152
1055 3300049574 Ga0501038_0000817 Ga0501038_0000817_21405_21863 152
1056 3300049575 Ga0501039_0018588 Ga0501039_0018588_4159_4617 152
1057 3300049576 Ga0501040_0166336 Ga0501040_0166336_608_1066 152
1058 3300049577 Ga0501041_0001581 Ga0501041_0001581_3291_3749 152
1059 3300049578 Ga0501042_0282203 Ga0501042_0282203_247_705 152
1060 3300049579 Ga0501043_0016623 Ga0501043_0016623_5264_5722 152
1061 3300049580 Ga0501046_0017207 Ga0501046_0017207_5080_5538 152
1062 3300049581 Ga0501047_0269834 Ga0501047_0269834_167_625 152
1063 3300049581 Ga0501047_0503782 Ga0501047_0503782_162_620 152
1064 3300049582 Ga0501048_0092101 Ga0501048_0092101_119_577 152
1065 3300049584 Ga0501068_0037044 Ga0501068_0037044_239_697 152
1066 3300049585 Ga0501069_0008732 Ga0501069_0008732_3585_4043 152
1067 3300049585 Ga0501069_0045665 Ga0501069_0045665_1656_2114 152
1068 3300049585 Ga0501069_0136062 Ga0501069_0136062_512_970 152
1069 3300049585 Ga0501069_0264669 Ga0501069_0264669_236_694 152
1070 3300049586 Ga0501070_0000243 Ga0501070_0000243_17968_18426 152
1071 3300049586 Ga0501070_0029959 Ga0501070_0029959_1770_2228 152
1072 3300049586 Ga0501070_0040388 Ga0501070_0040388_2744_3202 152
1073 3300049586 Ga0501070_0478804 Ga0501070_0478804_515_973 152
1074 3300049587 Ga0501071_0340956 Ga0501071_0340956_74_532 152
1075 3300049588 Ga0501072_0116752 Ga0501072_0116752_1421_1879 152
1076 3300049589 Ga0501073_0004374 Ga0501073_0004374_263_721 152
1077 3300049590 Ga0501074_0040111 Ga0501074_0040111_1479_1937 152
1078 3300049590 Ga0501074_0165560 Ga0501074_0165560_515_973 152
1079 3300049590 Ga0501074_1137081 Ga0501074_1137081_20_478 152
1080 3300049591 Ga0501075_0028059 Ga0501075_0028059_3585_4043 152
1081 3300049592 Ga0501076_0099117 Ga0501076_0099117_110_568 152
1082 3300049593 Ga0501077_0002523 Ga0501077_0002523_8724_9182 152
1083 3300049593 Ga0501077_0014680 Ga0501077_0014680_79_543 152
1084 3300049741 Ga0501079_0178252 Ga0501079_0178252_895_1359 152
1085 3300049741 Ga0501079_0179793 Ga0501079_0179793_259_717 152
1086 3300049741 Ga0501079_0929063 Ga0501079_0929063_81_539 152
1087 3300049742 Ga0501080_0001996 Ga0501080_0001996_11477_11935 152
1088 3300049742 Ga0501080_0153899 Ga0501080_0153899_177_635 152
1089 3300049742 Ga0501080_0222874 Ga0501080_0222874_577_1035 152
1090 3300049742 Ga0501080_0400347 Ga0501080_0400347_242_700 152
1091 3300049744 Ga0501083_0083099 Ga0501083_0083099_735_1193 152
1092 3300049822 Ga0501035_0002330 Ga0501035_0002330_9329_9787 152
1093 3300049823 Ga0501044_0103343 Ga0501044_0103343_1593_2051 152
1094 3300049824 Ga0501045_0168652 Ga0501045_0168652_934_1392 152
1095 3300050507 nmdc:mga05p37_374784_c1 nmdc:mga05p37_374784_c1_978_1436 152
1096 3300050511 nmdc:mga08y16_325712_c1 nmdc:mga08y16_325712_c1_828_1286 152
1097 3300050511 nmdc:mga08y16_95124_c1 nmdc:mga08y16_95124_c1_1674_2132 152
1098 3300050512 nmdc:mga0n895_2045985_c1 nmdc:mga0n895_2045985_c1_15_473 152
1099 3300050512 nmdc:mga0n895_304032_c1 nmdc:mga0n895_304032_c1_130_591 152
1100 3300050512 nmdc:mga0n895_58476_c1 nmdc:mga0n895_58476_c1_3080_3538 152
1101 3300050513 nmdc:mga0rr50_10287_c1 nmdc:mga0rr50_10287_c1_5089_5547 152
1102 3300050513 nmdc:mga0rr50_214893_c1 nmdc:mga0rr50_214893_c1_783_1244 152
1103 3300053077 Ga0495601_0392264 Ga0495601_0392264_363_821 152
1104 3300053083 Ga0495655_0017692 Ga0495655_0017692_844_1302 152
1105 3300053085 Ga0495619_0664531 Ga0495619_0664531_219_677 152
1106 3300054114 Ga0501084_0761815 Ga0501084_0761815_239_697 152
1107 3300060353 Ga0501082_0375404 Ga0501082_0375404_736_1194 152
1108 3300061719 Ga0466962_0188099 Ga0466962_0188099_508_966 152
1109 3300061734 Ga0530510_0135001 Ga0530510_0135001_658_1116 152
1110 3300061734 Ga0530510_0248814 Ga0530510_0248814_259_717 152
1111 3300061734 Ga0530510_0313558 Ga0530510_0313558_443_901 152
1112 3300061734 Ga0530510_1367719 Ga0530510_1367719_29_493 152

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

73

146

0.96

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

5

83

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zoh-assembly1.cif.gz_C-2 crystal structure of glyceraldehyde oxidoreductase 0.9725 1 151
1n5w-assembly1.cif.gz_D crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.9649 1 151
1ffv-assembly1.cif.gz_A carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.9633 1 151
1t3q-assembly1.cif.gz_D crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 0.958 1 150
4zoh-assembly1.cif.gz_C-2 crystal structure of glyceraldehyde oxidoreductase 0.9538 1 151
ID Description Score Start End Superfamily
af_Q46801_1_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9833 1 73 3.10.20.30
5y6qA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9752 1 75 3.10.20.30
1n5wA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9705 1 75 3.10.20.30
1sb3C02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9587 78 151 1.10.150.120
1sb3F01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9568 1 75 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A1F2XY32-F1-model_v4 (2Fe-2S)-binding protein 0.9875 1 150 GO:0016491
GO:0046872
GO:0051537
AF-A0A538BUE3-F1-model_v4 (2Fe-2S)-binding protein 0.9861 1 151 GO:0016491
GO:0046872
GO:0051537
AF-A0A536R2F2-F1-model_v4 (2Fe-2S)-binding protein 0.9824 1 150 GO:0016491
GO:0046872
GO:0051537
AF-A0A535DQ93-F1-model_v4 (2Fe-2S)-binding protein 0.9818 1 151 GO:0016491
GO:0046872
GO:0051537
AF-A0A2V6YN69-F1-model_v4 Ferredoxin 0.9815 1 151 GO:0016903
GO:0046872
GO:0051537

Feature Viewer

pLDDT pTM Quality
90.61 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map