F490255
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1112 | 377 | 1112 | 151 |
Family's Representative Sequence
| Representative Sequence | 3300013105|Ga0157369_10004499|Ga0157369_1000449916 |
| Length | 175 |
| Sequence | MRISVRVNGEEHQADCWEGESLLFALREKLGFPGSKNACEQGECGSCSVLLDGTLVCSCLVLAAQADGHEVTTVEGLAQGDHLHAVQQAFVDAGAVQCGFCTPGLVVATVDLLKRNASPTDDEIREALSGNLCRCTGYAKIFDAVRLAAAGVGWTEPAESGAAGFAGGESGASAL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 63 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 64 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 65 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 71 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 72 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 73 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 74 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 77 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 104 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 108 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 109 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 114 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 115 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 116 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 117 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 168 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 170 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 171 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 172 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 173 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 174 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 175 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 176 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 177 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 178 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 179 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 180 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 181 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 182 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 183 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 184 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 185 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 186 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 187 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 188 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 189 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 190 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 191 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 192 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 193 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 194 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 195 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 196 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 197 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 198 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 199 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 200 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 201 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 202 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 203 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 204 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 206 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 207 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 208 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 209 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 210 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 212 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 213 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 214 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 215 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 216 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 217 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 218 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 219 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 220 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 221 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 222 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 223 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 224 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 225 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 226 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 227 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 228 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 229 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 230 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 231 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 232 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 233 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 234 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 235 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 236 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 237 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 238 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 239 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 240 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 241 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 242 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 243 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 244 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 245 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 246 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 247 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 248 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 316 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 317 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 318 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 319 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 320 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 321 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 324 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 325 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 326 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 327 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 328 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 329 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 375 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 377 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.19 |
| Metatranscriptomes | 0.81 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 10.88 |
| Rhizosphere | 88.58 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.54 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25407J50210_10007085 | 3300003373 | Bacteria | 2806 |
| 2 | Ga0070658_10092060 | 3300005327 | Bacteria | 2499 |
| 3 | Ga0070658_10118883 | 3300005327 | Bacteria | 2195 |
| 4 | Ga0070658_10124746 | 3300005327 | Bacteria | 2142 |
| 5 | Ga0070658_10482896 | 3300005327 | Bacteria | 1069 |
| 6 | Ga0070683_100050130 | 3300005329 | Bacteria | 3863 |
| 7 | Ga0070683_100272919 | 3300005329 | Bacteria | 1609 |
| 8 | Ga0070683_100495927 | 3300005329 | Bacteria | 1166 |
| 9 | Ga0070683_101564350 | 3300005329 | Bacteria | 634 |
| 10 | Ga0070690_100859593 | 3300005330 | Bacteria | 707 |
| 11 | Ga0070680_100053848 | 3300005336 | Bacteria | 3284 |
| 12 | Ga0070680_100101092 | 3300005336 | Bacteria | 2393 |
| 13 | Ga0070680_100108456 | 3300005336 | Bacteria | 2310 |
| 14 | Ga0070680_100508824 | 3300005336 | Bacteria | 1031 |
| 15 | Ga0070682_100152865 | 3300005337 | Bacteria | 1586 |
| 16 | Ga0068868_100036832 | 3300005338 | Bacteria | 3789 |
| 17 | Ga0070660_100110092 | 3300005339 | Bacteria | 2190 |
| 18 | Ga0070660_100165585 | 3300005339 | Bacteria | 1784 |
| 19 | Ga0070660_100330820 | 3300005339 | Bacteria | 1253 |
| 20 | Ga0070660_100599982 | 3300005339 | Bacteria | 920 |
| 21 | Ga0070660_100745219 | 3300005339 | Bacteria | 822 |
| 22 | Ga0070689_100136273 | 3300005340 | Bacteria | 1971 |
| 23 | Ga0070691_10078192 | 3300005341 | Bacteria | 1616 |
| 24 | Ga0070691_10528816 | 3300005341 | Bacteria | 686 |
| 25 | Ga0070687_100057362 | 3300005343 | Bacteria | 2042 |
| 26 | Ga0070687_100245886 | 3300005343 | Bacteria | 1109 |
| 27 | Ga0070661_100033510 | 3300005344 | Bacteria | 3720 |
| 28 | Ga0070661_100061585 | 3300005344 | Bacteria | 2755 |
| 29 | Ga0070692_10015268 | 3300005345 | Bacteria | 3630 |
| 30 | Ga0070692_10099802 | 3300005345 | Bacteria | 1590 |
| 31 | Ga0070668_100091137 | 3300005347 | Bacteria | 2403 |
| 32 | Ga0070675_100071216 | 3300005354 | Bacteria | 2883 |
| 33 | Ga0070675_101283618 | 3300005354 | Bacteria | 674 |
| 34 | Ga0070671_100242954 | 3300005355 | Bacteria | 1529 |
| 35 | Ga0070671_100748029 | 3300005355 | Bacteria | 850 |
| 36 | Ga0070674_100001639 | 3300005356 | Bacteria | 12060 |
| 37 | Ga0070688_100012006 | 3300005365 | Bacteria | 4839 |
| 38 | Ga0070659_100219681 | 3300005366 | Bacteria | 1568 |
| 39 | Ga0070659_100241014 | 3300005366 | Bacteria | 1496 |
| 40 | Ga0070659_100475469 | 3300005366 | Bacteria | 1063 |
| 41 | Ga0070659_100962857 | 3300005366 | Bacteria | 748 |
| 42 | Ga0070659_101325316 | 3300005366 | Bacteria | 639 |
| 43 | Ga0070709_10024012 | 3300005434 | Bacteria | 3586 |
| 44 | Ga0070714_100053368 | 3300005435 | Bacteria | 3450 |
| 45 | Ga0070714_100092282 | 3300005435 | Bacteria | 2654 |
| 46 | Ga0070714_100361204 | 3300005435 | Bacteria | 1365 |
| 47 | Ga0070714_100429276 | 3300005435 | Bacteria | 1253 |
| 48 | Ga0070714_100453245 | 3300005435 | Bacteria | 1219 |
| 49 | Ga0070714_100691547 | 3300005435 | Bacteria | 984 |
| 50 | Ga0070714_100794008 | 3300005435 | Bacteria | 916 |
| 51 | Ga0070714_101747024 | 3300005435 | Bacteria | 607 |
| 52 | Ga0070713_100088433 | 3300005436 | Bacteria | 2659 |
| 53 | Ga0070713_100094513 | 3300005436 | Bacteria | 2577 |
| 54 | Ga0070713_100505707 | 3300005436 | Bacteria | 1140 |
| 55 | Ga0070713_100938597 | 3300005436 | Bacteria | 833 |
| 56 | Ga0070713_101237419 | 3300005436 | Bacteria | 723 |
| 57 | Ga0070710_10005124 | 3300005437 | Bacteria | 6200 |
| 58 | Ga0070710_10025539 | 3300005437 | Bacteria | 3129 |
| 59 | Ga0070711_100896904 | 3300005439 | Bacteria | 756 |
| 60 | Ga0070705_100072942 | 3300005440 | Bacteria | 2081 |
| 61 | Ga0070705_100117914 | 3300005440 | Bacteria | 1708 |
| 62 | Ga0070705_100347908 | 3300005440 | Bacteria | 1080 |
| 63 | Ga0070705_100894461 | 3300005440 | Bacteria | 714 |
| 64 | Ga0070705_101101782 | 3300005440 | Bacteria | 650 |
| 65 | Ga0070705_101107289 | 3300005440 | Bacteria | 648 |
| 66 | Ga0070700_100063569 | 3300005441 | Bacteria | 2335 |
| 67 | Ga0070694_100156515 | 3300005444 | Bacteria | 1669 |
| 68 | Ga0070694_100443972 | 3300005444 | Bacteria | 1023 |
| 69 | Ga0070708_100132367 | 3300005445 | Bacteria | 2309 |
| 70 | Ga0070708_100179564 | 3300005445 | Bacteria | 1978 |
| 71 | Ga0070708_100675518 | 3300005445 | Bacteria | 973 |
| 72 | Ga0070663_100670482 | 3300005455 | Bacteria | 879 |
| 73 | Ga0070663_100854919 | 3300005455 | Bacteria | 783 |
| 74 | Ga0070663_101685491 | 3300005455 | Bacteria | 566 |
| 75 | Ga0070678_100020686 | 3300005456 | Bacteria | 4322 |
| 76 | Ga0070678_100118341 | 3300005456 | Bacteria | 2085 |
| 77 | Ga0070678_100513407 | 3300005456 | Bacteria | 1059 |
| 78 | Ga0070681_10001129 | 3300005458 | Bacteria | 22933 |
| 79 | Ga0070681_10109636 | 3300005458 | Bacteria | 2700 |
| 80 | Ga0070681_10140248 | 3300005458 | Bacteria | 2347 |
| 81 | Ga0070681_10152188 | 3300005458 | Bacteria | 2240 |
| 82 | Ga0070681_10598725 | 3300005458 | Bacteria | 1017 |
| 83 | Ga0070681_10741668 | 3300005458 | Bacteria | 899 |
| 84 | Ga0070681_10778623 | 3300005458 | Bacteria | 873 |
| 85 | Ga0068867_100030890 | 3300005459 | Bacteria | 3865 |
| 86 | Ga0068867_100244804 | 3300005459 | Bacteria | 1456 |
| 87 | Ga0070685_10223648 | 3300005466 | Bacteria | 1234 |
| 88 | Ga0070685_10551013 | 3300005466 | Bacteria | 823 |
| 89 | Ga0070706_100049868 | 3300005467 | Bacteria | 3862 |
| 90 | Ga0070706_100258145 | 3300005467 | Bacteria | 1627 |
| 91 | Ga0070706_100405326 | 3300005467 | Bacteria | 1269 |
| 92 | Ga0070706_100864650 | 3300005467 | Bacteria | 836 |
| 93 | Ga0070707_100190723 | 3300005468 | Bacteria | 1998 |
| 94 | Ga0070707_100754205 | 3300005468 | Bacteria | 937 |
| 95 | Ga0070707_101046201 | 3300005468 | Bacteria | 782 |
| 96 | Ga0070707_101548580 | 3300005468 | Bacteria | 630 |
| 97 | Ga0070698_100073605 | 3300005471 | Bacteria | 3422 |
| 98 | Ga0070698_100128875 | 3300005471 | Bacteria | 2486 |
| 99 | Ga0070699_100158173 | 3300005518 | Bacteria | 2005 |
| 100 | Ga0070699_100622265 | 3300005518 | Bacteria | 985 |
| 101 | Ga0070699_100880570 | 3300005518 | Bacteria | 820 |
| 102 | Ga0070679_100160109 | 3300005530 | Bacteria | 2225 |
| 103 | Ga0070679_100199276 | 3300005530 | Bacteria | 1969 |
| 104 | Ga0070679_100305321 | 3300005530 | Bacteria | 1542 |
| 105 | Ga0070679_100792900 | 3300005530 | Bacteria | 890 |
| 106 | Ga0070684_100057188 | 3300005535 | Bacteria | 3405 |
| 107 | Ga0070684_100057250 | 3300005535 | Bacteria | 3403 |
| 108 | Ga0070684_100089966 | 3300005535 | Bacteria | 2728 |
| 109 | Ga0070684_100293223 | 3300005535 | Bacteria | 1492 |
| 110 | Ga0070684_100317442 | 3300005535 | Bacteria | 1431 |
| 111 | Ga0070684_100444650 | 3300005535 | Bacteria | 1198 |
| 112 | Ga0070684_100801332 | 3300005535 | Bacteria | 881 |
| 113 | Ga0070697_100102146 | 3300005536 | Bacteria | 2382 |
| 114 | Ga0070697_100109749 | 3300005536 | Bacteria | 2298 |
| 115 | Ga0070697_100385011 | 3300005536 | Bacteria | 1215 |
| 116 | Ga0070697_100829415 | 3300005536 | Bacteria | 819 |
| 117 | Ga0070697_101074971 | 3300005536 | Bacteria | 716 |
| 118 | Ga0068853_100306811 | 3300005539 | Bacteria | 1468 |
| 119 | Ga0070672_101034147 | 3300005543 | Bacteria | 729 |
| 120 | Ga0070686_100032900 | 3300005544 | Bacteria | 3182 |
| 121 | Ga0070695_100089217 | 3300005545 | Bacteria | 2055 |
| 122 | Ga0070695_100159593 | 3300005545 | Bacteria | 1581 |
| 123 | Ga0070695_100192979 | 3300005545 | Bacteria | 1451 |
| 124 | Ga0070696_100048066 | 3300005546 | Bacteria | 2961 |
| 125 | Ga0070696_100056669 | 3300005546 | Bacteria | 2733 |
| 126 | Ga0070696_100581900 | 3300005546 | Bacteria | 901 |
| 127 | Ga0070693_100604571 | 3300005547 | Bacteria | 792 |
| 128 | Ga0070693_100845452 | 3300005547 | Bacteria | 682 |
| 129 | Ga0070665_100053631 | 3300005548 | Bacteria | 4044 |
| 130 | Ga0070665_100870746 | 3300005548 | Bacteria | 914 |
| 131 | Ga0070665_100986248 | 3300005548 | Bacteria | 855 |
| 132 | Ga0070704_100002938 | 3300005549 | Bacteria | 9686 |
| 133 | Ga0068855_100072684 | 3300005563 | Bacteria | 3997 |
| 134 | Ga0068855_100108078 | 3300005563 | Bacteria | 3195 |
| 135 | Ga0068855_100233752 | 3300005563 | Bacteria | 2057 |
| 136 | Ga0068855_100302014 | 3300005563 | Bacteria | 1773 |
| 137 | Ga0068855_100351765 | 3300005563 | Bacteria | 1623 |
| 138 | Ga0068855_100425009 | 3300005563 | Bacteria | 1453 |
| 139 | Ga0070664_100165065 | 3300005564 | Bacteria | 1962 |
| 140 | Ga0070664_100716366 | 3300005564 | Bacteria | 933 |
| 141 | Ga0068857_100019391 | 3300005577 | Bacteria | 5971 |
| 142 | Ga0068857_100033041 | 3300005577 | Bacteria | 4574 |
| 143 | Ga0068857_100059894 | 3300005577 | Bacteria | 3383 |
| 144 | Ga0068857_100300411 | 3300005577 | Bacteria | 1480 |
| 145 | Ga0068854_100658541 | 3300005578 | Bacteria | 900 |
| 146 | Ga0068856_100062119 | 3300005614 | Bacteria | 3690 |
| 147 | Ga0068856_100134039 | 3300005614 | Bacteria | 2482 |
| 148 | Ga0068856_100512191 | 3300005614 | Bacteria | 1221 |
| 149 | Ga0070702_100069911 | 3300005615 | Bacteria | 2070 |
| 150 | Ga0070702_100170582 | 3300005615 | Bacteria | 1415 |
| 151 | Ga0070702_100747294 | 3300005615 | Bacteria | 751 |
| 152 | Ga0068852_100018025 | 3300005616 | Bacteria | 5553 |
| 153 | Ga0068852_100045532 | 3300005616 | Bacteria | 3732 |
| 154 | Ga0068852_100294898 | 3300005616 | Bacteria | 1568 |
| 155 | Ga0068859_100331513 | 3300005617 | Bacteria | 1616 |
| 156 | Ga0068859_101247572 | 3300005617 | Bacteria | 819 |
| 157 | Ga0068864_100129295 | 3300005618 | Bacteria | 2267 |
| 158 | Ga0068864_100669633 | 3300005618 | Bacteria | 1012 |
| 159 | Ga0068866_10045370 | 3300005718 | Bacteria | 2204 |
| 160 | Ga0068866_10104869 | 3300005718 | Bacteria | 1566 |
| 161 | Ga0068861_100222240 | 3300005719 | Bacteria | 1597 |
| 162 | Ga0068861_100572329 | 3300005719 | Bacteria | 1033 |
| 163 | Ga0068858_100832431 | 3300005842 | Bacteria | 901 |
| 164 | Ga0068862_100986186 | 3300005844 | Bacteria | 833 |
| 165 | Ga0068862_101099680 | 3300005844 | Bacteria | 790 |
| 166 | Ga0081455_10010251 | 3300005937 | Bacteria | 9529 |
| 167 | Ga0081455_10011450 | 3300005937 | Bacteria | 8912 |
| 168 | Ga0081455_10012609 | 3300005937 | Bacteria | 8423 |
| 169 | Ga0081455_10243025 | 3300005937 | Bacteria | 1321 |
| 170 | Ga0081455_10363616 | 3300005937 | Bacteria | 1016 |
| 171 | Ga0081455_10564750 | 3300005937 | Bacteria | 749 |
| 172 | Ga0081538_10000518 | 3300005981 | Bacteria | 43151 |
| 173 | Ga0081538_10051296 | 3300005981 | Bacteria | 2479 |
| 174 | Ga0081538_10173146 | 3300005981 | Bacteria | 938 |
| 175 | Ga0081538_10174882 | 3300005981 | Bacteria | 929 |
| 176 | Ga0081539_10018622 | 3300005985 | Bacteria | 4807 |
| 177 | Ga0070717_10014276 | 3300006028 | Bacteria | 6109 |
| 178 | Ga0070717_10521603 | 3300006028 | Bacteria | 1075 |
| 179 | Ga0070715_10011644 | 3300006163 | Bacteria | 3173 |
| 180 | Ga0070715_10510508 | 3300006163 | Bacteria | 690 |
| 181 | Ga0070715_10692049 | 3300006163 | Bacteria | 608 |
| 182 | Ga0070712_100030457 | 3300006175 | Bacteria | 3626 |
| 183 | Ga0070712_100110168 | 3300006175 | Bacteria | 2053 |
| 184 | Ga0070712_100177212 | 3300006175 | Bacteria | 1658 |
| 185 | Ga0070712_100211056 | 3300006175 | Bacteria | 1531 |
| 186 | Ga0070712_101030674 | 3300006175 | Bacteria | 713 |
| 187 | Ga0097621_100870685 | 3300006237 | Bacteria | 838 |
| 188 | Ga0068871_100026449 | 3300006358 | Bacteria | 4527 |
| 189 | Ga0075433_10004384 | 3300006852 | Bacteria | 10975 |
| 190 | Ga0075433_10024478 | 3300006852 | Bacteria | 5096 |
| 191 | Ga0075433_10456585 | 3300006852 | Bacteria | 1126 |
| 192 | Ga0075433_11051538 | 3300006852 | Bacteria | 708 |
| 193 | Ga0075434_100005135 | 3300006871 | Bacteria | 11890 |
| 194 | Ga0075434_100023021 | 3300006871 | Bacteria | 6065 |
| 195 | Ga0075434_100529470 | 3300006871 | Bacteria | 1199 |
| 196 | Ga0075434_101554258 | 3300006871 | Bacteria | 670 |
| 197 | Ga0075434_101591479 | 3300006871 | Bacteria | 662 |
| 198 | Ga0075429_100742484 | 3300006880 | Bacteria | 860 |
| 199 | Ga0068865_100017722 | 3300006881 | Bacteria | 4584 |
| 200 | Ga0075436_100009853 | 3300006914 | Bacteria | 6536 |
| 201 | Ga0097620_100331517 | 3300006931 | Bacteria | 1616 |
| 202 | Ga0097620_101247658 | 3300006931 | Bacteria | 819 |
| 203 | Ga0075435_100000140 | 3300007076 | Bacteria | 40976 |
| 204 | Ga0075435_100020149 | 3300007076 | Bacteria | 5103 |
| 205 | Ga0075435_100024269 | 3300007076 | Bacteria | 4703 |
| 206 | Ga0075435_100045328 | 3300007076 | Bacteria | 3525 |
| 207 | Ga0075435_100806250 | 3300007076 | Bacteria | 817 |
| 208 | Ga0105244_10238047 | 3300009036 | Bacteria | 850 |
| 209 | Ga0105240_10222720 | 3300009093 | Bacteria | 2197 |
| 210 | Ga0105240_10439215 | 3300009093 | Bacteria | 1463 |
| 211 | Ga0105240_10637414 | 3300009093 | Bacteria | 1170 |
| 212 | Ga0105240_10708309 | 3300009093 | Bacteria | 1098 |
| 213 | Ga0105240_11069326 | 3300009093 | Bacteria | 860 |
| 214 | Ga0105240_11110382 | 3300009093 | Bacteria | 841 |
| 215 | Ga0111539_10031415 | 3300009094 | Bacteria | 6451 |
| 216 | Ga0111539_10089729 | 3300009094 | Bacteria | 3612 |
| 217 | Ga0111539_10867885 | 3300009094 | Bacteria | 1050 |
| 218 | Ga0105245_10011977 | 3300009098 | Bacteria | 7541 |
| 219 | Ga0105245_10119636 | 3300009098 | Bacteria | 2459 |
| 220 | Ga0105245_10431456 | 3300009098 | Bacteria | 1323 |
| 221 | Ga0105245_10746476 | 3300009098 | Bacteria | 1014 |
| 222 | Ga0105245_10864972 | 3300009098 | Bacteria | 945 |
| 223 | Ga0105245_11650211 | 3300009098 | Bacteria | 693 |
| 224 | Ga0105247_10203629 | 3300009101 | Bacteria | 1331 |
| 225 | Ga0114129_10009001 | 3300009147 | Bacteria | 14238 |
| 226 | Ga0114129_10048698 | 3300009147 | Bacteria | 5955 |
| 227 | Ga0114129_10056182 | 3300009147 | Bacteria | 5514 |
| 228 | Ga0114129_10385876 | 3300009147 | Bacteria | 1849 |
| 229 | Ga0114129_11103449 | 3300009147 | Bacteria | 993 |
| 230 | Ga0114129_12821085 | 3300009147 | Bacteria | 577 |
| 231 | Ga0105243_10032733 | 3300009148 | Bacteria | 4019 |
| 232 | Ga0105243_10080853 | 3300009148 | Bacteria | 2651 |
| 233 | Ga0105243_10513992 | 3300009148 | Bacteria | 1137 |
| 234 | Ga0105243_10581757 | 3300009148 | Bacteria | 1075 |
| 235 | Ga0105241_10043494 | 3300009174 | Bacteria | 3402 |
| 236 | Ga0105241_10268096 | 3300009174 | Bacteria | 1454 |
| 237 | Ga0105241_10405328 | 3300009174 | Bacteria | 1197 |
| 238 | Ga0105241_10816530 | 3300009174 | Bacteria | 860 |
| 239 | Ga0105242_10006264 | 3300009176 | Bacteria | 9162 |
| 240 | Ga0105242_11961248 | 3300009176 | Bacteria | 627 |
| 241 | Ga0105242_12274041 | 3300009176 | Bacteria | 588 |
| 242 | Ga0105248_10008130 | 3300009177 | Bacteria | 11517 |
| 243 | Ga0105248_10056872 | 3300009177 | Bacteria | 4389 |
| 244 | Ga0105248_10194172 | 3300009177 | Bacteria | 2287 |
| 245 | Ga0105248_10951507 | 3300009177 | Bacteria | 970 |
| 246 | Ga0105248_11117168 | 3300009177 | Bacteria | 891 |
| 247 | Ga0105237_10492868 | 3300009545 | Bacteria | 1232 |
| 248 | Ga0105238_10023360 | 3300009551 | Bacteria | 6303 |
| 249 | Ga0105249_10017957 | 3300009553 | Bacteria | 6286 |
| 250 | Ga0105249_10686243 | 3300009553 | Bacteria | 1083 |
| 251 | Ga0105249_11153319 | 3300009553 | Bacteria | 846 |
| 252 | Ga0105249_12218630 | 3300009553 | Bacteria | 622 |
| 253 | Ga0105239_10096721 | 3300010375 | Bacteria | 3262 |
| 254 | Ga0105239_10515853 | 3300010375 | Bacteria | 1360 |
| 255 | Ga0105239_11824757 | 3300010375 | Bacteria | 705 |
| 256 | Ga0105246_10322712 | 3300011119 | Bacteria | 1255 |
| 257 | Ga0157373_10164163 | 3300013100 | Bacteria | 1563 |
| 258 | Ga0157371_11027283 | 3300013102 | Bacteria | 630 |
| 259 | Ga0157370_10008306 | 3300013104 | Bacteria | 11204 |
| 260 | Ga0157370_10300734 | 3300013104 | Bacteria | 1481 |
| 261 | Ga0157370_10347658 | 3300013104 | Bacteria | 1367 |
| 262 | Ga0157370_10833691 | 3300013104 | Bacteria | 838 |
| 263 | Ga0157370_10932051 | 3300013104 | Bacteria | 788 |
| 264 | Ga0157369_10004499 | 3300013105 | Bacteria | 16424 |
| 265 | Ga0157369_10032180 | 3300013105 | Bacteria | 5769 |
| 266 | Ga0157369_10045279 | 3300013105 | Bacteria | 4786 |
| 267 | Ga0157369_10046810 | 3300013105 | Bacteria | 4700 |
| 268 | Ga0157369_10336345 | 3300013105 | Bacteria | 1569 |
| 269 | Ga0157369_10382575 | 3300013105 | Bacteria | 1461 |
| 270 | Ga0157369_10462735 | 3300013105 | Bacteria | 1313 |
| 271 | Ga0157369_11585855 | 3300013105 | Bacteria | 666 |
| 272 | Ga0157374_10033180 | 3300013296 | Bacteria | 4709 |
| 273 | Ga0157378_10018799 | 3300013297 | Bacteria | 6075 |
| 274 | Ga0157378_10345069 | 3300013297 | Bacteria | 1453 |
| 275 | Ga0157378_11503761 | 3300013297 | Bacteria | 718 |
| 276 | Ga0163162_10030463 | 3300013306 | Bacteria | 5345 |
| 277 | Ga0163162_10263641 | 3300013306 | Bacteria | 1855 |
| 278 | Ga0163162_10736469 | 3300013306 | Bacteria | 1106 |
| 279 | Ga0157372_10029001 | 3300013307 | Bacteria | 6038 |
| 280 | Ga0157372_10140215 | 3300013307 | Bacteria | 2785 |
| 281 | Ga0157372_10304928 | 3300013307 | Bacteria | 1853 |
| 282 | Ga0157372_10524982 | 3300013307 | Bacteria | 1380 |
| 283 | Ga0157372_10741397 | 3300013307 | Bacteria | 1142 |
| 284 | Ga0157375_10064197 | 3300013308 | Bacteria | 3655 |
| 285 | Ga0157375_10263695 | 3300013308 | Bacteria | 1884 |
| 286 | Ga0157375_10510413 | 3300013308 | Bacteria | 1366 |
| 287 | Ga0157375_10569078 | 3300013308 | Bacteria | 1294 |
| 288 | Ga0157375_10839944 | 3300013308 | Bacteria | 1065 |
| 289 | Ga0163163_10208813 | 3300014325 | Bacteria | 2001 |
| 290 | Ga0163163_10351850 | 3300014325 | Bacteria | 1529 |
| 291 | Ga0157380_10134754 | 3300014326 | Bacteria | 2112 |
| 292 | Ga0157380_10692548 | 3300014326 | Bacteria | 1023 |
| 293 | Ga0182008_10413879 | 3300014497 | Bacteria | 726 |
| 294 | Ga0157377_10003323 | 3300014745 | Bacteria | 7271 |
| 295 | Ga0157377_10562207 | 3300014745 | Bacteria | 808 |
| 296 | Ga0157379_10097916 | 3300014968 | Bacteria | 2633 |
| 297 | Ga0157376_10013033 | 3300014969 | Bacteria | 6193 |
| 298 | Ga0157376_10077981 | 3300014969 | Bacteria | 2835 |
| 299 | Ga0182006_1141934 | 3300015261 | Bacteria | 820 |
| 300 | Ga0182007_10231938 | 3300015262 | Bacteria | 656 |
| 301 | Ga0182007_10367363 | 3300015262 | Bacteria | 544 |
| 302 | Ga0197907_11047046 | 3300020069 | Bacteria | 1367 |
| 303 | Ga0197907_11349487 | 3300020069 | Bacteria | 1293 |
| 304 | Ga0206356_10777109 | 3300020070 | Bacteria | 1701 |
| 305 | Ga0206354_10741990 | 3300020081 | Bacteria | 2595 |
| 306 | Ga0206353_10780697 | 3300020082 | Bacteria | 735 |
| 307 | Ga0206353_11185381 | 3300020082 | Bacteria | 2081 |
| 308 | Ga0206353_11283255 | 3300020082 | Bacteria | 4825 |
| 309 | Ga0206353_11751382 | 3300020082 | Bacteria | 1296 |
| 310 | Ga0206353_11789119 | 3300020082 | Bacteria | 2995 |
| 311 | Ga0213873_10039551 | 3300021358 | Bacteria | 1209 |
| 312 | Ga0213874_10142815 | 3300021377 | Bacteria | 830 |
| 313 | Ga0213876_10273908 | 3300021384 | Bacteria | 897 |
| 314 | Ga0213871_10077264 | 3300021441 | Bacteria | 949 |
| 315 | Ga0207692_10064075 | 3300025898 | Bacteria | 1912 |
| 316 | Ga0207692_10113744 | 3300025898 | Bacteria | 1505 |
| 317 | Ga0207710_10343985 | 3300025900 | Bacteria | 759 |
| 318 | Ga0207688_10072754 | 3300025901 | Bacteria | 1953 |
| 319 | Ga0207688_10143079 | 3300025901 | Bacteria | 1408 |
| 320 | Ga0207688_10228445 | 3300025901 | Bacteria | 1123 |
| 321 | Ga0207688_10639295 | 3300025901 | Bacteria | 671 |
| 322 | Ga0207688_10839980 | 3300025901 | Bacteria | 582 |
| 323 | Ga0207685_10003453 | 3300025905 | Bacteria | 3846 |
| 324 | Ga0207685_10042480 | 3300025905 | Bacteria | 1707 |
| 325 | Ga0207685_10429030 | 3300025905 | Bacteria | 683 |
| 326 | Ga0207685_10487818 | 3300025905 | Bacteria | 646 |
| 327 | Ga0207699_10612734 | 3300025906 | Bacteria | 793 |
| 328 | Ga0207684_10039896 | 3300025910 | Bacteria | 3980 |
| 329 | Ga0207684_10308549 | 3300025910 | Bacteria | 1364 |
| 330 | Ga0207684_10702501 | 3300025910 | Bacteria | 859 |
| 331 | Ga0207707_10014838 | 3300025912 | Bacteria | 6786 |
| 332 | Ga0207707_10111137 | 3300025912 | Bacteria | 2396 |
| 333 | Ga0207707_10146159 | 3300025912 | Bacteria | 2067 |
| 334 | Ga0207707_10198241 | 3300025912 | Bacteria | 1751 |
| 335 | Ga0207707_10584770 | 3300025912 | Bacteria | 946 |
| 336 | Ga0207695_10543070 | 3300025913 | Bacteria | 1044 |
| 337 | Ga0207695_11223259 | 3300025913 | Bacteria | 631 |
| 338 | Ga0207695_11391233 | 3300025913 | Bacteria | 582 |
| 339 | Ga0207671_10044114 | 3300025914 | Bacteria | 3297 |
| 340 | Ga0207693_10003565 | 3300025915 | Bacteria | 13299 |
| 341 | Ga0207693_10018792 | 3300025915 | Bacteria | 5500 |
| 342 | Ga0207693_10019938 | 3300025915 | Bacteria | 5333 |
| 343 | Ga0207693_10086334 | 3300025915 | Bacteria | 2459 |
| 344 | Ga0207693_10302964 | 3300025915 | Bacteria | 1252 |
| 345 | Ga0207693_10422443 | 3300025915 | Bacteria | 1042 |
| 346 | Ga0207693_10452898 | 3300025915 | Bacteria | 1003 |
| 347 | Ga0207693_10651909 | 3300025915 | Bacteria | 818 |
| 348 | Ga0207693_11210892 | 3300025915 | Bacteria | 569 |
| 349 | Ga0207663_10007094 | 3300025916 | Bacteria | 5786 |
| 350 | Ga0207663_10226444 | 3300025916 | Bacteria | 1363 |
| 351 | Ga0207663_10381228 | 3300025916 | Bacteria | 1074 |
| 352 | Ga0207660_10009367 | 3300025917 | Bacteria | 6338 |
| 353 | Ga0207660_10028394 | 3300025917 | Bacteria | 3826 |
| 354 | Ga0207660_10183140 | 3300025917 | Bacteria | 1628 |
| 355 | Ga0207660_10185704 | 3300025917 | Bacteria | 1617 |
| 356 | Ga0207660_10193902 | 3300025917 | Bacteria | 1583 |
| 357 | Ga0207660_10444825 | 3300025917 | Bacteria | 1047 |
| 358 | Ga0207662_10269070 | 3300025918 | Bacteria | 1124 |
| 359 | Ga0207657_10000416 | 3300025919 | Bacteria | 45222 |
| 360 | Ga0207657_10000610 | 3300025919 | Bacteria | 37898 |
| 361 | Ga0207657_10004617 | 3300025919 | Bacteria | 14547 |
| 362 | Ga0207657_10022825 | 3300025919 | Bacteria | 5842 |
| 363 | Ga0207657_10151254 | 3300025919 | Bacteria | 1890 |
| 364 | Ga0207657_10154164 | 3300025919 | Bacteria | 1869 |
| 365 | Ga0207657_10296287 | 3300025919 | Bacteria | 1282 |
| 366 | Ga0207657_10463485 | 3300025919 | Bacteria | 994 |
| 367 | Ga0207649_10034017 | 3300025920 | Bacteria | 3050 |
| 368 | Ga0207649_10058915 | 3300025920 | Bacteria | 2407 |
| 369 | Ga0207649_10261521 | 3300025920 | Bacteria | 1250 |
| 370 | Ga0207649_10517658 | 3300025920 | Bacteria | 909 |
| 371 | Ga0207652_10003206 | 3300025921 | Bacteria | 13597 |
| 372 | Ga0207652_10017952 | 3300025921 | Bacteria | 5797 |
| 373 | Ga0207652_10213248 | 3300025921 | Bacteria | 1739 |
| 374 | Ga0207652_10315648 | 3300025921 | Bacteria | 1411 |
| 375 | Ga0207652_11106148 | 3300025921 | Bacteria | 693 |
| 376 | Ga0207646_10116678 | 3300025922 | Bacteria | 2398 |
| 377 | Ga0207646_10140658 | 3300025922 | Bacteria | 2173 |
| 378 | Ga0207646_10480907 | 3300025922 | Bacteria | 1120 |
| 379 | Ga0207646_10956458 | 3300025922 | Bacteria | 758 |
| 380 | Ga0207646_11341739 | 3300025922 | Bacteria | 623 |
| 381 | Ga0207646_11371729 | 3300025922 | Bacteria | 616 |
| 382 | Ga0207646_11774333 | 3300025922 | Bacteria | 528 |
| 383 | Ga0207659_10032822 | 3300025926 | Bacteria | 3567 |
| 384 | Ga0207659_10350236 | 3300025926 | Bacteria | 1225 |
| 385 | Ga0207687_10016945 | 3300025927 | Bacteria | 4788 |
| 386 | Ga0207687_10403443 | 3300025927 | Bacteria | 1125 |
| 387 | Ga0207700_10000004 | 3300025928 | Bacteria | 443409 |
| 388 | Ga0207700_10126938 | 3300025928 | Bacteria | 2077 |
| 389 | Ga0207700_10205214 | 3300025928 | Bacteria | 1663 |
| 390 | Ga0207700_10223947 | 3300025928 | Bacteria | 1596 |
| 391 | Ga0207700_11029053 | 3300025928 | Bacteria | 737 |
| 392 | Ga0207664_10002557 | 3300025929 | Bacteria | 12026 |
| 393 | Ga0207664_10116950 | 3300025929 | Bacteria | 2225 |
| 394 | Ga0207664_10152546 | 3300025929 | Bacteria | 1964 |
| 395 | Ga0207664_10176820 | 3300025929 | Bacteria | 1830 |
| 396 | Ga0207664_10178321 | 3300025929 | Bacteria | 1823 |
| 397 | Ga0207664_10180407 | 3300025929 | Bacteria | 1812 |
| 398 | Ga0207664_11029652 | 3300025929 | Bacteria | 737 |
| 399 | Ga0207644_10178931 | 3300025931 | Bacteria | 1661 |
| 400 | Ga0207644_10423624 | 3300025931 | Bacteria | 1091 |
| 401 | Ga0207644_11057209 | 3300025931 | Bacteria | 682 |
| 402 | Ga0207690_10034236 | 3300025932 | Bacteria | 3272 |
| 403 | Ga0207690_10047168 | 3300025932 | Bacteria | 2857 |
| 404 | Ga0207690_10155708 | 3300025932 | Bacteria | 1698 |
| 405 | Ga0207690_10180276 | 3300025932 | Bacteria | 1590 |
| 406 | Ga0207690_10321389 | 3300025932 | Bacteria | 1217 |
| 407 | Ga0207706_10031346 | 3300025933 | Bacteria | 4737 |
| 408 | Ga0207706_10390263 | 3300025933 | Bacteria | 1207 |
| 409 | Ga0207686_10048195 | 3300025934 | Bacteria | 2638 |
| 410 | Ga0207686_10895129 | 3300025934 | Bacteria | 716 |
| 411 | Ga0207709_10496246 | 3300025935 | Bacteria | 952 |
| 412 | Ga0207669_10075065 | 3300025937 | Bacteria | 2141 |
| 413 | Ga0207669_10292088 | 3300025937 | Bacteria | 1235 |
| 414 | Ga0207669_10968653 | 3300025937 | Bacteria | 714 |
| 415 | Ga0207704_10004032 | 3300025938 | Bacteria | 6686 |
| 416 | Ga0207665_10070955 | 3300025939 | Bacteria | 2377 |
| 417 | Ga0207665_10502673 | 3300025939 | Bacteria | 937 |
| 418 | Ga0207691_10013728 | 3300025940 | Bacteria | 7739 |
| 419 | Ga0207691_10539009 | 3300025940 | Bacteria | 990 |
| 420 | Ga0207711_10090389 | 3300025941 | Bacteria | 2692 |
| 421 | Ga0207711_10096344 | 3300025941 | Bacteria | 2611 |
| 422 | Ga0207711_11140097 | 3300025941 | Bacteria | 721 |
| 423 | Ga0207661_10023738 | 3300025944 | Bacteria | 4638 |
| 424 | Ga0207661_10209783 | 3300025944 | Bacteria | 1716 |
| 425 | Ga0207661_10263049 | 3300025944 | Bacteria | 1537 |
| 426 | Ga0207661_10768524 | 3300025944 | Bacteria | 887 |
| 427 | Ga0207661_10837006 | 3300025944 | Bacteria | 847 |
| 428 | Ga0207667_10099837 | 3300025949 | Bacteria | 2995 |
| 429 | Ga0207667_10136696 | 3300025949 | Bacteria | 2524 |
| 430 | Ga0207667_10143680 | 3300025949 | Bacteria | 2456 |
| 431 | Ga0207667_10194294 | 3300025949 | Bacteria | 2082 |
| 432 | Ga0207667_10239947 | 3300025949 | Bacteria | 1855 |
| 433 | Ga0207667_10253165 | 3300025949 | Bacteria | 1801 |
| 434 | Ga0207667_10594592 | 3300025949 | Bacteria | 1116 |
| 435 | Ga0207667_10884102 | 3300025949 | Bacteria | 886 |
| 436 | Ga0207667_11168952 | 3300025949 | Bacteria | 750 |
| 437 | Ga0207651_10159469 | 3300025960 | Bacteria | 1767 |
| 438 | Ga0207712_10032434 | 3300025961 | Bacteria | 3526 |
| 439 | Ga0207712_10863529 | 3300025961 | Bacteria | 798 |
| 440 | Ga0207668_10197019 | 3300025972 | Bacteria | 1601 |
| 441 | Ga0207640_10812205 | 3300025981 | Bacteria | 811 |
| 442 | Ga0207640_10939913 | 3300025981 | Bacteria | 757 |
| 443 | Ga0207640_11179175 | 3300025981 | Bacteria | 680 |
| 444 | Ga0207677_10094427 | 3300026023 | Bacteria | 2183 |
| 445 | Ga0207677_10568347 | 3300026023 | Bacteria | 991 |
| 446 | Ga0207677_10891209 | 3300026023 | Bacteria | 801 |
| 447 | Ga0207703_10355749 | 3300026035 | Bacteria | 1349 |
| 448 | Ga0207639_10068169 | 3300026041 | Bacteria | 2771 |
| 449 | Ga0207678_10018270 | 3300026067 | Bacteria | 6158 |
| 450 | Ga0207678_10194806 | 3300026067 | Bacteria | 1732 |
| 451 | Ga0207708_10022143 | 3300026075 | Bacteria | 4799 |
| 452 | Ga0207708_10024328 | 3300026075 | Bacteria | 4581 |
| 453 | Ga0207702_10022866 | 3300026078 | Bacteria | 5187 |
| 454 | Ga0207702_10199303 | 3300026078 | Bacteria | 1855 |
| 455 | Ga0207702_10307064 | 3300026078 | Bacteria | 1507 |
| 456 | Ga0207702_11335426 | 3300026078 | Bacteria | 711 |
| 457 | Ga0207641_10704317 | 3300026088 | Bacteria | 995 |
| 458 | Ga0207641_10820819 | 3300026088 | Bacteria | 921 |
| 459 | Ga0207648_10004050 | 3300026089 | Bacteria | 15221 |
| 460 | Ga0207648_10049380 | 3300026089 | Bacteria | 3681 |
| 461 | Ga0207648_10373785 | 3300026089 | Bacteria | 1288 |
| 462 | Ga0207676_10466005 | 3300026095 | Bacteria | 1194 |
| 463 | Ga0207676_10477664 | 3300026095 | Bacteria | 1180 |
| 464 | Ga0207674_10009649 | 3300026116 | Bacteria | 11008 |
| 465 | Ga0207674_10015268 | 3300026116 | Bacteria | 8445 |
| 466 | Ga0207674_10033571 | 3300026116 | Bacteria | 5372 |
| 467 | Ga0207674_10034595 | 3300026116 | Bacteria | 5280 |
| 468 | Ga0207675_100138731 | 3300026118 | Bacteria | 2309 |
| 469 | Ga0207675_101862906 | 3300026118 | Bacteria | 620 |
| 470 | Ga0207683_10002338 | 3300026121 | Bacteria | 16626 |
| 471 | Ga0207683_10105840 | 3300026121 | Bacteria | 2515 |
| 472 | Ga0207683_10206846 | 3300026121 | Bacteria | 1785 |
| 473 | Ga0207683_10703252 | 3300026121 | Bacteria | 937 |
| 474 | Ga0207698_10013668 | 3300026142 | Bacteria | 5365 |
| 475 | Ga0207698_10125784 | 3300026142 | Bacteria | 2179 |
| 476 | Ga0207698_10147953 | 3300026142 | Bacteria | 2034 |
| 477 | Ga0207698_10329570 | 3300026142 | Bacteria | 1433 |
| 478 | Ga0207698_10457688 | 3300026142 | Bacteria | 1233 |
| 479 | Ga0207428_10297768 | 3300027907 | Bacteria | 1194 |
| 480 | Ga0207428_10336607 | 3300027907 | Bacteria | 1112 |
| 481 | Ga0268266_10048959 | 3300028379 | Bacteria | 3623 |
| 482 | Ga0268266_10815941 | 3300028379 | Bacteria | 901 |
| 483 | Ga0268266_10938016 | 3300028379 | Bacteria | 837 |
| 484 | Ga0265319_1120671 | 3300028563 | Bacteria | 817 |
| 485 | Ga0265334_10015319 | 3300028573 | Bacteria | 3186 |
| 486 | Ga0265334_10033057 | 3300028573 | Bacteria | 2061 |
| 487 | Ga0265334_10114416 | 3300028573 | Bacteria | 968 |
| 488 | Ga0265334_10142860 | 3300028573 | Bacteria | 847 |
| 489 | Ga0265318_10010160 | 3300028577 | Bacteria | 4112 |
| 490 | Ga0265318_10025573 | 3300028577 | Bacteria | 2330 |
| 491 | Ga0265318_10266915 | 3300028577 | Bacteria | 624 |
| 492 | Ga0265322_10015344 | 3300028654 | Bacteria | 2214 |
| 493 | Ga0265338_10028139 | 3300028800 | Bacteria | 5615 |
| 494 | Ga0265328_10044387 | 3300031239 | Bacteria | 1635 |
| 495 | Ga0265320_10226574 | 3300031240 | Bacteria | 832 |
| 496 | Ga0265325_10029899 | 3300031241 | Bacteria | 2925 |
| 497 | Ga0265327_10097793 | 3300031251 | Bacteria | 1421 |
| 498 | Ga0265327_10413925 | 3300031251 | Bacteria | 584 |
| 499 | Ga0265316_10181661 | 3300031344 | Bacteria | 1566 |
| 500 | Ga0265316_10761147 | 3300031344 | Bacteria | 680 |
| 501 | Ga0307408_100015573 | 3300031548 | Bacteria | 5064 |
| 502 | Ga0307408_100287868 | 3300031548 | Bacteria | 1371 |
| 503 | Ga0307408_100384526 | 3300031548 | Bacteria | 1201 |
| 504 | Ga0307408_100533329 | 3300031548 | Bacteria | 1033 |
| 505 | Ga0265313_10055786 | 3300031595 | Bacteria | 1870 |
| 506 | Ga0265314_10012245 | 3300031711 | Bacteria | 7017 |
| 507 | Ga0265342_10150680 | 3300031712 | Bacteria | 1291 |
| 508 | Ga0265342_10332060 | 3300031712 | Bacteria | 795 |
| 509 | Ga0307405_10004812 | 3300031731 | Bacteria | 6440 |
| 510 | Ga0307405_10435309 | 3300031731 | Bacteria | 1036 |
| 511 | Ga0307405_11088093 | 3300031731 | Bacteria | 686 |
| 512 | Ga0307413_10597116 | 3300031824 | Bacteria | 903 |
| 513 | Ga0307410_10417627 | 3300031852 | Bacteria | 1087 |
| 514 | Ga0307406_10182313 | 3300031901 | Bacteria | 1530 |
| 515 | Ga0307406_11130915 | 3300031901 | Bacteria | 677 |
| 516 | Ga0307407_10031785 | 3300031903 | Bacteria | 2863 |
| 517 | Ga0307407_10502923 | 3300031903 | Bacteria | 889 |
| 518 | Ga0307412_10560373 | 3300031911 | Bacteria | 961 |
| 519 | Ga0307412_10940949 | 3300031911 | Bacteria | 760 |
| 520 | Ga0307412_11086437 | 3300031911 | Bacteria | 711 |
| 521 | Ga0307409_100025747 | 3300031995 | Bacteria | 4134 |
| 522 | Ga0307409_100061797 | 3300031995 | Bacteria | 2929 |
| 523 | Ga0307416_100040131 | 3300032002 | Bacteria | 3633 |
| 524 | Ga0307416_100118391 | 3300032002 | Bacteria | 2353 |
| 525 | Ga0307416_100222007 | 3300032002 | Bacteria | 1813 |
| 526 | Ga0307416_100360839 | 3300032002 | Bacteria | 1475 |
| 527 | Ga0307416_101218764 | 3300032002 | Bacteria | 858 |
| 528 | Ga0307414_10243475 | 3300032004 | Bacteria | 1490 |
| 529 | Ga0307411_10153998 | 3300032005 | Bacteria | 1712 |
| 530 | Ga0307415_100832037 | 3300032126 | Bacteria | 845 |
| 531 | Ga0307415_101273243 | 3300032126 | Bacteria | 695 |
| 532 | Ga0373959_0019332 | 3300034820 | Bacteria | 1290 |
| 533 | Ga0373926_0095199 | 3300035083 | Bacteria | 1110 |
| 534 | Ga0373934_0137215 | 3300035086 | Bacteria | 999 |
| 535 | Ga0373934_0430607 | 3300035086 | Bacteria | 552 |
| 536 | Ga0373944_0072406 | 3300035089 | Bacteria | 1125 |
| 537 | Ga0373936_0020681 | 3300035113 | Bacteria | 2558 |
| 538 | Ga0373953_0032746 | 3300035117 | Bacteria | 2030 |
| 539 | Ga0373953_0330680 | 3300035117 | Bacteria | 667 |
| 540 | Ga0373957_0025026 | 3300035120 | Bacteria | 2148 |
| 541 | Ga0373943_0000899 | 3300035170 | Bacteria | 13105 |
| 542 | Ga0373943_0039717 | 3300035170 | Bacteria | 2269 |
| 543 | Ga0373943_0087086 | 3300035170 | Bacteria | 1611 |
| 544 | Ga0373946_0044796 | 3300035171 | Bacteria | 1828 |
| 545 | Ga0373955_0008799 | 3300035172 | Bacteria | 4704 |
| 546 | Ga0373942_0049779 | 3300035207 | Bacteria | 1171 |
| 547 | Ga0373924_0079925 | 3300035410 | Bacteria | 1389 |
| 548 | Ga0373931_0039207 | 3300035691 | Bacteria | 2482 |
| 549 | Ga0373927_0135226 | 3300035695 | Bacteria | 1611 |
| 550 | Ga0373927_0281848 | 3300035695 | Bacteria | 1093 |
| 551 | Ga0373933_0297194 | 3300035724 | Bacteria | 1045 |
| 552 | Ga0373947_0003187 | 3300035725 | Bacteria | 9757 |
| 553 | Ga0373947_0033686 | 3300035725 | Bacteria | 3026 |
| 554 | Ga0373947_0060207 | 3300035725 | Bacteria | 2305 |
| 555 | Ga0373947_0760366 | 3300035725 | Bacteria | 661 |
| 556 | Ga0373937_0076296 | 3300036401 | Bacteria | 3095 |
| 557 | Ga0373937_0193836 | 3300036401 | Bacteria | 1910 |
| 558 | Ga0373925_0744518 | 3300037068 | Bacteria | 808 |
| 559 | Ga0395899_0001001 | 3300037312 | Bacteria | 25945 |
| 560 | Ga0395899_0015657 | 3300037312 | Bacteria | 5783 |
| 561 | Ga0395899_0018455 | 3300037312 | Bacteria | 5303 |
| 562 | Ga0395899_0032687 | 3300037312 | Bacteria | 3910 |
| 563 | Ga0395899_0035364 | 3300037312 | Bacteria | 3750 |
| 564 | Ga0395899_0041054 | 3300037312 | Bacteria | 3458 |
| 565 | Ga0395899_0081807 | 3300037312 | Bacteria | 2349 |
| 566 | Ga0395899_0090882 | 3300037312 | Bacteria | 2213 |
| 567 | Ga0395899_0091878 | 3300037312 | Bacteria | 2198 |
| 568 | Ga0395899_0094300 | 3300037312 | Bacteria | 2166 |
| 569 | Ga0395899_0146113 | 3300037312 | Bacteria | 1679 |
| 570 | Ga0395899_0212186 | 3300037312 | Bacteria | 1345 |
| 571 | Ga0395899_0272526 | 3300037312 | Bacteria | 1154 |
| 572 | Ga0395899_0650435 | 3300037312 | Bacteria | 666 |
| 573 | Ga0395899_0948472 | 3300037312 | Bacteria | 522 |
| 574 | Ga0395900_0004233 | 3300037418 | Bacteria | 15232 |
| 575 | Ga0395900_0004700 | 3300037418 | Bacteria | 14396 |
| 576 | Ga0395900_0004724 | 3300037418 | Bacteria | 14368 |
| 577 | Ga0395900_0014519 | 3300037418 | Bacteria | 8037 |
| 578 | Ga0395900_0015755 | 3300037418 | Bacteria | 7705 |
| 579 | Ga0395900_0015897 | 3300037418 | Bacteria | 7666 |
| 580 | Ga0395900_0025692 | 3300037418 | Bacteria | 6029 |
| 581 | Ga0395900_0028300 | 3300037418 | Bacteria | 5740 |
| 582 | Ga0395900_0029582 | 3300037418 | Bacteria | 5619 |
| 583 | Ga0395900_0032992 | 3300037418 | Bacteria | 5328 |
| 584 | Ga0395900_0086108 | 3300037418 | Bacteria | 3229 |
| 585 | Ga0395900_0109879 | 3300037418 | Bacteria | 2833 |
| 586 | Ga0395900_0116756 | 3300037418 | Bacteria | 2738 |
| 587 | Ga0395900_0172876 | 3300037418 | Bacteria | 2198 |
| 588 | Ga0395900_0173719 | 3300037418 | Bacteria | 2192 |
| 589 | Ga0395900_0187989 | 3300037418 | Bacteria | 2096 |
| 590 | Ga0395900_0201725 | 3300037418 | Bacteria | 2012 |
| 591 | Ga0395900_0229164 | 3300037418 | Bacteria | 1869 |
| 592 | Ga0395900_0315526 | 3300037418 | Bacteria | 1545 |
| 593 | Ga0395900_0424851 | 3300037418 | Bacteria | 1289 |
| 594 | Ga0395900_0654618 | 3300037418 | Bacteria | 987 |
| 595 | Ga0395898_0004894 | 3300037466 | Bacteria | 14544 |
| 596 | Ga0395898_0006542 | 3300037466 | Bacteria | 12435 |
| 597 | Ga0395898_0008982 | 3300037466 | Bacteria | 10525 |
| 598 | Ga0395898_0016102 | 3300037466 | Bacteria | 7659 |
| 599 | Ga0395898_0021780 | 3300037466 | Bacteria | 6494 |
| 600 | Ga0395898_0031400 | 3300037466 | Bacteria | 5307 |
| 601 | Ga0395898_0039643 | 3300037466 | Bacteria | 4661 |
| 602 | Ga0395898_0053413 | 3300037466 | Bacteria | 3946 |
| 603 | Ga0395898_0076712 | 3300037466 | Bacteria | 3227 |
| 604 | Ga0395898_0119682 | 3300037466 | Bacteria | 2523 |
| 605 | Ga0395898_0155740 | 3300037466 | Bacteria | 2185 |
| 606 | Ga0395898_0171390 | 3300037466 | Bacteria | 2075 |
| 607 | Ga0395898_0196487 | 3300037466 | Bacteria | 1927 |
| 608 | Ga0395898_0244556 | 3300037466 | Bacteria | 1711 |
| 609 | Ga0395898_0285893 | 3300037466 | Bacteria | 1573 |
| 610 | Ga0395898_0506784 | 3300037466 | Bacteria | 1148 |
| 611 | Ga0395898_0832280 | 3300037466 | Bacteria | 863 |
| 612 | Ga0395898_1158190 | 3300037466 | Bacteria | 705 |
| 613 | Ga0395905_0005063 | 3300037471 | Bacteria | 13564 |
| 614 | Ga0395905_0005451 | 3300037471 | Bacteria | 12987 |
| 615 | Ga0395905_0010082 | 3300037471 | Bacteria | 9209 |
| 616 | Ga0395905_0014689 | 3300037471 | Bacteria | 7468 |
| 617 | Ga0395905_0023069 | 3300037471 | Bacteria | 5883 |
| 618 | Ga0395905_0028306 | 3300037471 | Bacteria | 5281 |
| 619 | Ga0395905_0064605 | 3300037471 | Bacteria | 3425 |
| 620 | Ga0395905_0079795 | 3300037471 | Bacteria | 3067 |
| 621 | Ga0395905_0103737 | 3300037471 | Bacteria | 2669 |
| 622 | Ga0395905_0104764 | 3300037471 | Bacteria | 2656 |
| 623 | Ga0395905_0108622 | 3300037471 | Bacteria | 2604 |
| 624 | Ga0395905_0301032 | 3300037471 | Bacteria | 1491 |
| 625 | Ga0395905_0491894 | 3300037471 | Bacteria | 1126 |
| 626 | Ga0395905_0491959 | 3300037471 | Bacteria | 1126 |
| 627 | Ga0395905_0560368 | 3300037471 | Bacteria | 1044 |
| 628 | Ga0395905_0818853 | 3300037471 | Bacteria | 834 |
| 629 | Ga0395905_1026758 | 3300037471 | Bacteria | 728 |
| 630 | Ga0395901_0002221 | 3300038443 | Bacteria | 19812 |
| 631 | Ga0395901_0002468 | 3300038443 | Bacteria | 18763 |
| 632 | Ga0395901_0016661 | 3300038443 | Bacteria | 7487 |
| 633 | Ga0395901_0017935 | 3300038443 | Bacteria | 7225 |
| 634 | Ga0395901_0018242 | 3300038443 | Bacteria | 7164 |
| 635 | Ga0395901_0029987 | 3300038443 | Bacteria | 5603 |
| 636 | Ga0395901_0036111 | 3300038443 | Bacteria | 5105 |
| 637 | Ga0395901_0049122 | 3300038443 | Bacteria | 4382 |
| 638 | Ga0395901_0052058 | 3300038443 | Bacteria | 4256 |
| 639 | Ga0395901_0053242 | 3300038443 | Bacteria | 4205 |
| 640 | Ga0395901_0095541 | 3300038443 | Bacteria | 3114 |
| 641 | Ga0395901_0115220 | 3300038443 | Bacteria | 2823 |
| 642 | Ga0395901_0168721 | 3300038443 | Bacteria | 2297 |
| 643 | Ga0395901_0181430 | 3300038443 | Bacteria | 2208 |
| 644 | Ga0395901_0284494 | 3300038443 | Bacteria | 1717 |
| 645 | Ga0395901_0291567 | 3300038443 | Bacteria | 1693 |
| 646 | Ga0395901_0408991 | 3300038443 | Bacteria | 1393 |
| 647 | Ga0395901_0475947 | 3300038443 | Bacteria | 1274 |
| 648 | Ga0395901_0667355 | 3300038443 | Bacteria | 1041 |
| 649 | Ga0395901_0745974 | 3300038443 | Bacteria | 972 |
| 650 | Ga0395901_0817566 | 3300038443 | Bacteria | 919 |
| 651 | Ga0395901_1223430 | 3300038443 | Bacteria | 716 |
| 652 | Ga0436365_1553456 | 3300039437 | Bacteria | 1073 |
| 653 | Ga0436360_0506477 | 3300039438 | Bacteria | 5147 |
| 654 | Ga0436360_0511686 | 3300039438 | Bacteria | 594 |
| 655 | Ga0436363_0668989 | 3300039450 | Bacteria | 616 |
| 656 | Ga0436363_1348640 | 3300039450 | Bacteria | 678 |
| 657 | Ga0436362_0327669 | 3300039453 | Bacteria | 2618 |
| 658 | Ga0439438_045069 | 3300041405 | Bacteria | 1135 |
| 659 | Ga0439438_120893 | 3300041405 | Bacteria | 630 |
| 660 | Ga0439461_0003605 | 3300041410 | Bacteria | 2553 |
| 661 | Ga0439465_0098857 | 3300041413 | Bacteria | 1006 |
| 662 | Ga0451835_0827407 | 3300041492 | Bacteria | 906 |
| 663 | Ga0439431_0130726 | 3300041997 | Bacteria | 705 |
| 664 | Ga0439441_012332 | 3300042001 | Bacteria | 1465 |
| 665 | Ga0439445_0242928 | 3300042004 | Bacteria | 537 |
| 666 | Ga0439463_043686 | 3300042016 | Bacteria | 1141 |
| 667 | Ga0450917_008674 | 3300042120 | Bacteria | 790 |
| 668 | Ga0450906_055882 | 3300042145 | Bacteria | 699 |
| 669 | Ga0450907_011944 | 3300042146 | Bacteria | 1443 |
| 670 | Ga0439446_0361271 | 3300042156 | Bacteria | 519 |
| 671 | Ga0450908_042915 | 3300042184 | Bacteria | 784 |
| 672 | Ga0439434_0015538 | 3300042435 | Bacteria | 2271 |
| 673 | Ga0466969_0103243 | 3300044656 | Bacteria | 1340 |
| 674 | Ga0466972_0455956 | 3300044658 | Bacteria | 601 |
| 675 | Ga0466966_0013321 | 3300044684 | Bacteria | 5444 |
| 676 | Ga0466966_0055786 | 3300044684 | Bacteria | 2500 |
| 677 | Ga0466966_0103961 | 3300044684 | Bacteria | 1755 |
| 678 | Ga0466966_0128302 | 3300044684 | Bacteria | 1554 |
| 679 | Ga0466966_0296909 | 3300044684 | Bacteria | 971 |
| 680 | Ga0466961_0001805 | 3300044693 | Bacteria | 13266 |
| 681 | Ga0466963_0003083 | 3300044694 | Bacteria | 9444 |
| 682 | Ga0466963_0041038 | 3300044694 | Bacteria | 3034 |
| 683 | Ga0466964_0003275 | 3300044706 | Bacteria | 5892 |
| 684 | Ga0466964_0004021 | 3300044706 | Bacteria | 5405 |
| 685 | Ga0466964_0006266 | 3300044706 | Bacteria | 4432 |
| 686 | Ga0466964_0007545 | 3300044706 | Bacteria | 4070 |
| 687 | Ga0466964_0125030 | 3300044706 | Bacteria | 1164 |
| 688 | Ga0466971_0026732 | 3300044719 | Bacteria | 2581 |
| 689 | Ga0466968_0026293 | 3300044735 | Bacteria | 2387 |
| 690 | Ga0466968_0265340 | 3300044735 | Bacteria | 818 |
| 691 | Ga0466957_0035461 | 3300044842 | Bacteria | 2993 |
| 692 | Ga0466957_0045276 | 3300044842 | Bacteria | 2669 |
| 693 | Ga0466957_0102563 | 3300044842 | Bacteria | 1805 |
| 694 | Ga0466957_0199451 | 3300044842 | Bacteria | 1314 |
| 695 | Ga0466957_0603646 | 3300044842 | Bacteria | 768 |
| 696 | Ga0466960_0026703 | 3300044901 | Bacteria | 2626 |
| 697 | Ga0466959_0059584 | 3300045049 | Bacteria | 2780 |
| 698 | Ga0466959_0138653 | 3300045049 | Bacteria | 1720 |
| 699 | Ga0466959_0148827 | 3300045049 | Bacteria | 1651 |
| 700 | Ga0466958_0007711 | 3300045836 | Bacteria | 5937 |
| 701 | Ga0466958_0066985 | 3300045836 | Bacteria | 2193 |
| 702 | Ga0466958_0214086 | 3300045836 | Bacteria | 1228 |
| 703 | Ga0466958_0220499 | 3300045836 | Bacteria | 1210 |
| 704 | Ga0466958_0853854 | 3300045836 | Bacteria | 594 |
| 705 | Ga0466967_0001914 | 3300045976 | Bacteria | 12584 |
| 706 | Ga0466967_0003262 | 3300045976 | Bacteria | 10507 |
| 707 | Ga0466967_0011854 | 3300045976 | Bacteria | 6631 |
| 708 | Ga0466967_0015468 | 3300045976 | Bacteria | 5982 |
| 709 | Ga0466967_0025617 | 3300045976 | Bacteria | 4867 |
| 710 | Ga0466967_0054908 | 3300045976 | Bacteria | 3508 |
| 711 | Ga0466967_0084997 | 3300045976 | Bacteria | 2864 |
| 712 | Ga0466967_0087121 | 3300045976 | Bacteria | 2830 |
| 713 | Ga0466967_0094124 | 3300045976 | Bacteria | 2727 |
| 714 | Ga0466967_0115898 | 3300045976 | Bacteria | 2468 |
| 715 | Ga0466967_0137708 | 3300045976 | Bacteria | 2271 |
| 716 | Ga0466967_0160751 | 3300045976 | Bacteria | 2108 |
| 717 | Ga0466967_0179667 | 3300045976 | Bacteria | 1995 |
| 718 | Ga0466967_0213864 | 3300045976 | Bacteria | 1829 |
| 719 | Ga0466967_0237608 | 3300045976 | Bacteria | 1737 |
| 720 | Ga0466967_0433146 | 3300045976 | Bacteria | 1283 |
| 721 | Ga0466967_0551817 | 3300045976 | Bacteria | 1134 |
| 722 | Ga0466967_0858283 | 3300045976 | Bacteria | 902 |
| 723 | Ga0466967_1476351 | 3300045976 | Bacteria | 677 |
| 724 | Ga0495592_0112947 | 3300046454 | Bacteria | 1920 |
| 725 | Ga0495592_0114033 | 3300046454 | Bacteria | 1909 |
| 726 | Ga0495592_0750564 | 3300046454 | Bacteria | 583 |
| 727 | Ga0495603_0023275 | 3300046455 | Bacteria | 3751 |
| 728 | Ga0495629_0046938 | 3300046459 | Bacteria | 3029 |
| 729 | Ga0495629_0114708 | 3300046459 | Bacteria | 1877 |
| 730 | Ga0495629_0483832 | 3300046459 | Bacteria | 836 |
| 731 | Ga0495629_0819019 | 3300046459 | Bacteria | 613 |
| 732 | Ga0495641_0001250 | 3300046461 | Bacteria | 21835 |
| 733 | Ga0495641_0023550 | 3300046461 | Bacteria | 3056 |
| 734 | Ga0495651_0012474 | 3300046462 | Bacteria | 6553 |
| 735 | Ga0495651_0040858 | 3300046462 | Bacteria | 3603 |
| 736 | Ga0495651_0248700 | 3300046462 | Bacteria | 1215 |
| 737 | Ga0495653_0061120 | 3300046463 | Bacteria | 2851 |
| 738 | Ga0495653_0587652 | 3300046463 | Bacteria | 686 |
| 739 | Ga0495582_0000397 | 3300046473 | Bacteria | 23729 |
| 740 | Ga0495582_0127741 | 3300046473 | Bacteria | 1435 |
| 741 | Ga0495605_0061489 | 3300046474 | Bacteria | 1797 |
| 742 | Ga0495605_0183141 | 3300046474 | Bacteria | 920 |
| 743 | Ga0495639_0002254 | 3300046475 | Bacteria | 8463 |
| 744 | Ga0495662_0035472 | 3300046476 | Bacteria | 2406 |
| 745 | Ga0495664_0016551 | 3300046477 | Bacteria | 4202 |
| 746 | Ga0495664_0276691 | 3300046477 | Bacteria | 1014 |
| 747 | Ga0495664_0496142 | 3300046477 | Bacteria | 729 |
| 748 | Ga0495584_0084022 | 3300046491 | Bacteria | 1603 |
| 749 | Ga0495584_0105889 | 3300046491 | Bacteria | 1422 |
| 750 | Ga0495584_0108216 | 3300046491 | Bacteria | 1406 |
| 751 | Ga0495585_0266184 | 3300046492 | Bacteria | 851 |
| 752 | Ga0495596_0074630 | 3300046500 | Bacteria | 1317 |
| 753 | Ga0495596_0105199 | 3300046500 | Bacteria | 1096 |
| 754 | Ga0495596_0156887 | 3300046500 | Bacteria | 884 |
| 755 | Ga0495596_0335123 | 3300046500 | Bacteria | 589 |
| 756 | Ga0495607_0099382 | 3300046501 | Bacteria | 1561 |
| 757 | Ga0495607_0225143 | 3300046501 | Bacteria | 915 |
| 758 | Ga0495607_0245655 | 3300046501 | Bacteria | 864 |
| 759 | Ga0495608_0029157 | 3300046511 | Bacteria | 3746 |
| 760 | Ga0495608_0052486 | 3300046511 | Bacteria | 2699 |
| 761 | Ga0495616_0088845 | 3300046513 | Bacteria | 1467 |
| 762 | Ga0495616_0428307 | 3300046513 | Bacteria | 539 |
| 763 | Ga0495618_0241671 | 3300046514 | Bacteria | 1135 |
| 764 | Ga0495618_0260148 | 3300046514 | Bacteria | 1087 |
| 765 | Ga0495628_0013424 | 3300046516 | Bacteria | 6891 |
| 766 | Ga0495628_0181249 | 3300046516 | Bacteria | 1593 |
| 767 | Ga0495630_0066836 | 3300046517 | Bacteria | 2702 |
| 768 | Ga0495630_0075867 | 3300046517 | Bacteria | 2532 |
| 769 | Ga0495630_0135334 | 3300046517 | Bacteria | 1872 |
| 770 | Ga0495630_0228121 | 3300046517 | Bacteria | 1422 |
| 771 | Ga0495630_0398463 | 3300046517 | Bacteria | 1054 |
| 772 | Ga0495630_0538046 | 3300046517 | Bacteria | 896 |
| 773 | Ga0495631_0325870 | 3300046518 | Bacteria | 654 |
| 774 | Ga0495637_0028523 | 3300046520 | Bacteria | 2493 |
| 775 | Ga0495644_0128343 | 3300046523 | Bacteria | 966 |
| 776 | Ga0495663_0154082 | 3300046525 | Bacteria | 786 |
| 777 | Ga0495663_0268888 | 3300046525 | Bacteria | 609 |
| 778 | Ga0495666_0019709 | 3300046526 | Bacteria | 3345 |
| 779 | Ga0495666_0100536 | 3300046526 | Bacteria | 1363 |
| 780 | Ga0495642_0235976 | 3300046528 | Bacteria | 799 |
| 781 | Ga0495652_0012598 | 3300046529 | Bacteria | 7623 |
| 782 | Ga0495652_0189526 | 3300046529 | Bacteria | 1570 |
| 783 | Ga0495652_0402912 | 3300046529 | Bacteria | 968 |
| 784 | Ga0495665_0026888 | 3300046531 | Bacteria | 3089 |
| 785 | Ga0495640_0035402 | 3300046533 | Bacteria | 3533 |
| 786 | Ga0495640_0044499 | 3300046533 | Bacteria | 3086 |
| 787 | Ga0495586_0103308 | 3300046535 | Bacteria | 1583 |
| 788 | Ga0495587_0022577 | 3300046536 | Bacteria | 3874 |
| 789 | Ga0495587_0048446 | 3300046536 | Bacteria | 2516 |
| 790 | Ga0495598_0102770 | 3300046537 | Bacteria | 948 |
| 791 | Ga0495598_0131980 | 3300046537 | Bacteria | 857 |
| 792 | Ga0495645_0060684 | 3300046543 | Bacteria | 2741 |
| 793 | Ga0495645_0096890 | 3300046543 | Bacteria | 2101 |
| 794 | Ga0495645_0180645 | 3300046543 | Bacteria | 1446 |
| 795 | Ga0495645_0626745 | 3300046543 | Bacteria | 659 |
| 796 | Ga0495667_0041845 | 3300046559 | Bacteria | 3037 |
| 797 | Ga0495667_0050247 | 3300046559 | Bacteria | 2753 |
| 798 | Ga0495667_0478577 | 3300046559 | Bacteria | 781 |
| 799 | Ga0495667_0502674 | 3300046559 | Bacteria | 759 |
| 800 | Ga0495656_0036803 | 3300046615 | Bacteria | 2018 |
| 801 | Ga0495656_0196125 | 3300046615 | Bacteria | 1000 |
| 802 | Ga0495634_0076063 | 3300046642 | Bacteria | 2204 |
| 803 | Ga0495634_0120097 | 3300046642 | Bacteria | 1683 |
| 804 | Ga0495611_0094636 | 3300046648 | Bacteria | 1382 |
| 805 | Ga0495635_0013378 | 3300046663 | Bacteria | 5743 |
| 806 | Ga0495635_0015938 | 3300046663 | Bacteria | 5250 |
| 807 | Ga0495659_0171023 | 3300046664 | Bacteria | 881 |
| 808 | Ga0495661_0370205 | 3300046665 | Bacteria | 702 |
| 809 | Ga0495661_0420876 | 3300046665 | Bacteria | 647 |
| 810 | Ga0495588_0059077 | 3300046674 | Bacteria | 1983 |
| 811 | Ga0495657_0038175 | 3300046675 | Bacteria | 3307 |
| 812 | Ga0495657_0116590 | 3300046675 | Bacteria | 1686 |
| 813 | Ga0495657_0175077 | 3300046675 | Bacteria | 1319 |
| 814 | Ga0495657_0390097 | 3300046675 | Bacteria | 820 |
| 815 | Ga0495657_0562755 | 3300046675 | Bacteria | 661 |
| 816 | Ga0495599_0101990 | 3300046678 | Bacteria | 1788 |
| 817 | Ga0495599_0317149 | 3300046678 | Bacteria | 939 |
| 818 | Ga0495599_0727878 | 3300046678 | Bacteria | 570 |
| 819 | Ga0495623_0041457 | 3300046679 | Bacteria | 2935 |
| 820 | Ga0495623_0118047 | 3300046679 | Bacteria | 1601 |
| 821 | Ga0495646_0101109 | 3300046680 | Bacteria | 1653 |
| 822 | Ga0495646_0105173 | 3300046680 | Bacteria | 1613 |
| 823 | Ga0495647_0001542 | 3300046681 | Bacteria | 7117 |
| 824 | Ga0495658_0001563 | 3300046683 | Bacteria | 11965 |
| 825 | Ga0495669_0300484 | 3300046684 | Bacteria | 774 |
| 826 | Ga0495613_0001506 | 3300046689 | Bacteria | 17725 |
| 827 | Ga0495613_0319079 | 3300046689 | Bacteria | 1073 |
| 828 | Ga0495613_0736123 | 3300046689 | Bacteria | 647 |
| 829 | Ga0495624_0494701 | 3300046690 | Bacteria | 732 |
| 830 | Ga0495649_0564922 | 3300046694 | Bacteria | 563 |
| 831 | Ga0495589_0107891 | 3300046794 | Bacteria | 1345 |
| 832 | Ga0495589_0426537 | 3300046794 | Bacteria | 608 |
| 833 | Ga0495600_0057459 | 3300046809 | Bacteria | 2541 |
| 834 | Ga0495600_0133015 | 3300046809 | Bacteria | 1616 |
| 835 | Ga0495581_0002960 | 3300047315 | Bacteria | 9722 |
| 836 | Ga0495581_0412987 | 3300047315 | Bacteria | 787 |
| 837 | Ga0495604_0003309 | 3300047317 | Bacteria | 12857 |
| 838 | Ga0495604_0163609 | 3300047317 | Bacteria | 1570 |
| 839 | Ga0495604_0166394 | 3300047317 | Bacteria | 1554 |
| 840 | Ga0495636_0246872 | 3300047318 | Bacteria | 825 |
| 841 | Ga0495674_0038374 | 3300047319 | Bacteria | 4300 |
| 842 | Ga0495674_0046005 | 3300047319 | Bacteria | 3875 |
| 843 | Ga0495674_0055190 | 3300047319 | Bacteria | 3485 |
| 844 | Ga0495674_0066253 | 3300047319 | Bacteria | 3134 |
| 845 | Ga0495676_0087650 | 3300047321 | Bacteria | 2338 |
| 846 | Ga0495680_0006197 | 3300047322 | Bacteria | 11149 |
| 847 | Ga0495680_0006671 | 3300047322 | Bacteria | 10691 |
| 848 | Ga0495680_0080049 | 3300047322 | Bacteria | 2469 |
| 849 | Ga0495680_0095433 | 3300047322 | Bacteria | 2223 |
| 850 | Ga0495680_0374265 | 3300047322 | Bacteria | 988 |
| 851 | Ga0495683_0432331 | 3300047323 | Bacteria | 543 |
| 852 | Ga0495675_0054671 | 3300047444 | Bacteria | 2533 |
| 853 | Ga0495684_0019345 | 3300047471 | Bacteria | 5242 |
| 854 | Ga0495684_0029105 | 3300047471 | Bacteria | 4239 |
| 855 | Ga0495593_0004029 | 3300047673 | Bacteria | 8758 |
| 856 | Ga0495602_0006483 | 3300048088 | Bacteria | 12277 |
| 857 | Ga0495602_0087030 | 3300048088 | Bacteria | 2606 |
| 858 | Ga0495602_0132184 | 3300048088 | Bacteria | 1988 |
| 859 | Ga0495602_0157092 | 3300048088 | Bacteria | 1780 |
| 860 | Ga0495614_0197046 | 3300048089 | Bacteria | 910 |
| 861 | Ga0496100_0008217 | 3300048903 | Bacteria | 5813 |
| 862 | Ga0496100_0013049 | 3300048903 | Bacteria | 4781 |
| 863 | Ga0496100_0017810 | 3300048903 | Bacteria | 4202 |
| 864 | Ga0496100_0082161 | 3300048903 | Bacteria | 2178 |
| 865 | Ga0496100_0287704 | 3300048903 | Bacteria | 1227 |
| 866 | Ga0496100_0426778 | 3300048903 | Bacteria | 1013 |
| 867 | Ga0496100_0679569 | 3300048903 | Bacteria | 803 |
| 868 | Ga0496100_0694590 | 3300048903 | Bacteria | 794 |
| 869 | Ga0496101_0001675 | 3300048904 | Bacteria | 13292 |
| 870 | Ga0496101_0003097 | 3300048904 | Bacteria | 10285 |
| 871 | Ga0496101_0088309 | 3300048904 | Bacteria | 2302 |
| 872 | Ga0496101_0159668 | 3300048904 | Bacteria | 1728 |
| 873 | Ga0496101_0167196 | 3300048904 | Bacteria | 1689 |
| 874 | Ga0496101_0285496 | 3300048904 | Bacteria | 1291 |
| 875 | Ga0496101_0465055 | 3300048904 | Bacteria | 998 |
| 876 | Ga0496102_0007218 | 3300048905 | Bacteria | 9482 |
| 877 | Ga0496102_0010358 | 3300048905 | Bacteria | 8019 |
| 878 | Ga0496102_0040337 | 3300048905 | Bacteria | 4222 |
| 879 | Ga0496102_0066040 | 3300048905 | Bacteria | 3316 |
| 880 | Ga0496102_0327479 | 3300048905 | Bacteria | 1443 |
| 881 | Ga0496102_0525111 | 3300048905 | Bacteria | 1106 |
| 882 | Ga0496102_0574841 | 3300048905 | Bacteria | 1050 |
| 883 | Ga0496103_0011909 | 3300048906 | Bacteria | 5163 |
| 884 | Ga0496103_0124345 | 3300048906 | Bacteria | 1644 |
| 885 | Ga0496103_0194786 | 3300048906 | Bacteria | 1303 |
| 886 | Ga0496103_0244348 | 3300048906 | Bacteria | 1155 |
| 887 | Ga0496103_0345080 | 3300048906 | Bacteria | 957 |
| 888 | Ga0496104_0000134 | 3300048907 | Bacteria | 68737 |
| 889 | Ga0496104_0002226 | 3300048907 | Bacteria | 16741 |
| 890 | Ga0496104_0009373 | 3300048907 | Bacteria | 8706 |
| 891 | Ga0496104_0079872 | 3300048907 | Bacteria | 3118 |
| 892 | Ga0496104_0124098 | 3300048907 | Bacteria | 2479 |
| 893 | Ga0496104_0143093 | 3300048907 | Bacteria | 2297 |
| 894 | Ga0496104_0298791 | 3300048907 | Bacteria | 1522 |
| 895 | Ga0496104_0903148 | 3300048907 | Bacteria | 788 |
| 896 | Ga0496104_1156832 | 3300048907 | Bacteria | 677 |
| 897 | Ga0496105_0000334 | 3300048908 | Bacteria | 30835 |
| 898 | Ga0496105_0000429 | 3300048908 | Bacteria | 27568 |
| 899 | Ga0496105_0003332 | 3300048908 | Bacteria | 11871 |
| 900 | Ga0496105_0072352 | 3300048908 | Bacteria | 2849 |
| 901 | Ga0496105_0129599 | 3300048908 | Bacteria | 2080 |
| 902 | Ga0496105_0695540 | 3300048908 | Bacteria | 781 |
| 903 | Ga0496106_0009788 | 3300048909 | Bacteria | 7082 |
| 904 | Ga0496106_0115864 | 3300048909 | Bacteria | 2090 |
| 905 | Ga0496106_0207466 | 3300048909 | Bacteria | 1560 |
| 906 | Ga0496106_0284268 | 3300048909 | Bacteria | 1325 |
| 907 | Ga0496106_0309841 | 3300048909 | Bacteria | 1266 |
| 908 | Ga0496107_0033042 | 3300048910 | Bacteria | 3700 |
| 909 | Ga0496107_0050773 | 3300048910 | Bacteria | 2991 |
| 910 | Ga0496107_0055898 | 3300048910 | Bacteria | 2850 |
| 911 | Ga0496107_0233644 | 3300048910 | Bacteria | 1368 |
| 912 | Ga0496107_0235471 | 3300048910 | Bacteria | 1362 |
| 913 | Ga0496107_0503341 | 3300048910 | Bacteria | 898 |
| 914 | Ga0496108_0003536 | 3300048911 | Bacteria | 12533 |
| 915 | Ga0496108_0017704 | 3300048911 | Bacteria | 5829 |
| 916 | Ga0496108_0033079 | 3300048911 | Bacteria | 4295 |
| 917 | Ga0496108_0129163 | 3300048911 | Bacteria | 2172 |
| 918 | Ga0496108_0138388 | 3300048911 | Bacteria | 2097 |
| 919 | Ga0496108_0466152 | 3300048911 | Bacteria | 1104 |
| 920 | Ga0496108_1372233 | 3300048911 | Bacteria | 592 |
| 921 | Ga0496108_1380347 | 3300048911 | Bacteria | 590 |
| 922 | Ga0496108_1534265 | 3300048911 | Bacteria | 553 |
| 923 | Ga0496109_0000898 | 3300048912 | Bacteria | 24813 |
| 924 | Ga0496109_0004403 | 3300048912 | Bacteria | 11769 |
| 925 | Ga0496109_0023182 | 3300048912 | Bacteria | 5507 |
| 926 | Ga0496109_0042839 | 3300048912 | Bacteria | 4102 |
| 927 | Ga0496109_0070787 | 3300048912 | Bacteria | 3201 |
| 928 | Ga0496109_0078645 | 3300048912 | Bacteria | 3037 |
| 929 | Ga0496109_0112373 | 3300048912 | Bacteria | 2533 |
| 930 | Ga0496109_0187673 | 3300048912 | Bacteria | 1942 |
| 931 | Ga0496109_0213280 | 3300048912 | Bacteria | 1816 |
| 932 | Ga0496109_0252758 | 3300048912 | Bacteria | 1660 |
| 933 | Ga0496110_0000164 | 3300048913 | Bacteria | 40268 |
| 934 | Ga0496110_0006694 | 3300048913 | Bacteria | 9159 |
| 935 | Ga0496110_0014588 | 3300048913 | Bacteria | 6528 |
| 936 | Ga0496110_0015943 | 3300048913 | Bacteria | 6266 |
| 937 | Ga0496110_0108442 | 3300048913 | Bacteria | 2493 |
| 938 | Ga0496110_0117827 | 3300048913 | Bacteria | 2391 |
| 939 | Ga0496110_0139077 | 3300048913 | Bacteria | 2195 |
| 940 | Ga0496110_0198647 | 3300048913 | Bacteria | 1822 |
| 941 | Ga0496110_1237352 | 3300048913 | Bacteria | 655 |
| 942 | Ga0496111_0000228 | 3300048914 | Bacteria | 26792 |
| 943 | Ga0496111_0000295 | 3300048914 | Bacteria | 24339 |
| 944 | Ga0496111_0002679 | 3300048914 | Bacteria | 10821 |
| 945 | Ga0496111_0015328 | 3300048914 | Bacteria | 5259 |
| 946 | Ga0496111_0031537 | 3300048914 | Bacteria | 3776 |
| 947 | Ga0496111_0032440 | 3300048914 | Bacteria | 3724 |
| 948 | Ga0496111_0048024 | 3300048914 | Bacteria | 3074 |
| 949 | Ga0496111_0067212 | 3300048914 | Bacteria | 2604 |
| 950 | Ga0496111_0089012 | 3300048914 | Bacteria | 2261 |
| 951 | Ga0496111_0162974 | 3300048914 | Bacteria | 1656 |
| 952 | Ga0496112_0000291 | 3300048915 | Bacteria | 32578 |
| 953 | Ga0496112_0000443 | 3300048915 | Bacteria | 27533 |
| 954 | Ga0496112_0012008 | 3300048915 | Bacteria | 7943 |
| 955 | Ga0496112_0027889 | 3300048915 | Bacteria | 5447 |
| 956 | Ga0496112_0175579 | 3300048915 | Bacteria | 2107 |
| 957 | Ga0496112_0825665 | 3300048915 | Bacteria | 851 |
| 958 | Ga0496112_1218375 | 3300048915 | Bacteria | 669 |
| 959 | Ga0496113_0001618 | 3300048916 | Bacteria | 12672 |
| 960 | Ga0496113_0158435 | 3300048916 | Bacteria | 1789 |
| 961 | Ga0496113_0263470 | 3300048916 | Bacteria | 1377 |
| 962 | Ga0496113_0307251 | 3300048916 | Bacteria | 1270 |
| 963 | Ga0496113_0335155 | 3300048916 | Bacteria | 1213 |
| 964 | Ga0496113_0569826 | 3300048916 | Bacteria | 908 |
| 965 | Ga0496114_0000281 | 3300048917 | Bacteria | 37054 |
| 966 | Ga0496114_0002188 | 3300048917 | Bacteria | 14888 |
| 967 | Ga0496114_0003176 | 3300048917 | Bacteria | 12601 |
| 968 | Ga0496114_0026662 | 3300048917 | Bacteria | 4733 |
| 969 | Ga0496114_0055144 | 3300048917 | Bacteria | 3315 |
| 970 | Ga0496114_0354314 | 3300048917 | Bacteria | 1298 |
| 971 | Ga0496114_0371130 | 3300048917 | Bacteria | 1266 |
| 972 | Ga0496114_0438328 | 3300048917 | Bacteria | 1157 |
| 973 | Ga0496114_0584784 | 3300048917 | Bacteria | 985 |
| 974 | Ga0496114_0985169 | 3300048917 | Bacteria | 726 |
| 975 | Ga0496115_0015385 | 3300048918 | Bacteria | 5803 |
| 976 | Ga0496115_0022334 | 3300048918 | Bacteria | 4900 |
| 977 | Ga0496115_0027454 | 3300048918 | Bacteria | 4452 |
| 978 | Ga0496115_0057152 | 3300048918 | Bacteria | 3137 |
| 979 | Ga0496115_0060452 | 3300048918 | Bacteria | 3053 |
| 980 | Ga0496115_0231042 | 3300048918 | Bacteria | 1525 |
| 981 | Ga0496115_0380090 | 3300048918 | Bacteria | 1149 |
| 982 | Ga0501031_0005532 | 3300049568 | Bacteria | 8224 |
| 983 | Ga0501031_0104493 | 3300049568 | Bacteria | 1848 |
| 984 | Ga0501031_0342915 | 3300049568 | Bacteria | 967 |
| 985 | Ga0501032_0063899 | 3300049569 | Bacteria | 2464 |
| 986 | Ga0501033_0002824 | 3300049570 | Bacteria | 14539 |
| 987 | Ga0501033_0048171 | 3300049570 | Bacteria | 3166 |
| 988 | Ga0501034_1528207 | 3300049571 | Bacteria | 541 |
| 989 | Ga0501036_0004455 | 3300049572 | Bacteria | 11320 |
| 990 | Ga0501036_0075063 | 3300049572 | Bacteria | 2859 |
| 991 | Ga0501037_0000851 | 3300049573 | Bacteria | 22750 |
| 992 | Ga0501037_0137364 | 3300049573 | Bacteria | 1751 |
| 993 | Ga0501038_0000817 | 3300049574 | Bacteria | 27664 |
| 994 | Ga0501038_0072163 | 3300049574 | Bacteria | 2926 |
| 995 | Ga0501039_0009773 | 3300049575 | Bacteria | 7309 |
| 996 | Ga0501039_0018588 | 3300049575 | Bacteria | 5335 |
| 997 | Ga0501040_0028879 | 3300049576 | Bacteria | 3740 |
| 998 | Ga0501040_0166336 | 3300049576 | Bacteria | 1560 |
| 999 | Ga0501041_0001581 | 3300049577 | Bacteria | 12684 |
| 1000 | Ga0501041_0001675 | 3300049577 | Bacteria | 12408 |
| 1001 | Ga0501042_0013943 | 3300049578 | Bacteria | 5476 |
| 1002 | Ga0501042_0096600 | 3300049578 | Bacteria | 2123 |
| 1003 | Ga0501042_0282203 | 3300049578 | Bacteria | 1199 |
| 1004 | Ga0501043_0016623 | 3300049579 | Bacteria | 5767 |
| 1005 | Ga0501043_0059002 | 3300049579 | Bacteria | 3011 |
| 1006 | Ga0501046_0015550 | 3300049580 | Bacteria | 6391 |
| 1007 | Ga0501046_0017207 | 3300049580 | Bacteria | 6040 |
| 1008 | Ga0501047_0269834 | 3300049581 | Bacteria | 1548 |
| 1009 | Ga0501047_0503782 | 3300049581 | Bacteria | 1037 |
| 1010 | Ga0501048_0054653 | 3300049582 | Bacteria | 2836 |
| 1011 | Ga0501048_0092101 | 3300049582 | Bacteria | 2137 |
| 1012 | Ga0501067_0000154 | 3300049583 | Bacteria | 38151 |
| 1013 | Ga0501067_0018163 | 3300049583 | Bacteria | 3895 |
| 1014 | Ga0501068_0037044 | 3300049584 | Bacteria | 2919 |
| 1015 | Ga0501068_0114948 | 3300049584 | Bacteria | 1675 |
| 1016 | Ga0501069_0006471 | 3300049585 | Bacteria | 6125 |
| 1017 | Ga0501069_0008732 | 3300049585 | Bacteria | 5336 |
| 1018 | Ga0501069_0045665 | 3300049585 | Bacteria | 2427 |
| 1019 | Ga0501069_0136062 | 3300049585 | Bacteria | 1408 |
| 1020 | Ga0501069_0264669 | 3300049585 | Bacteria | 1004 |
| 1021 | Ga0501070_0000243 | 3300049586 | Bacteria | 51201 |
| 1022 | Ga0501070_0029959 | 3300049586 | Bacteria | 4559 |
| 1023 | Ga0501070_0040388 | 3300049586 | Bacteria | 3890 |
| 1024 | Ga0501070_0084234 | 3300049586 | Bacteria | 2632 |
| 1025 | Ga0501070_0478804 | 3300049586 | Bacteria | 1001 |
| 1026 | Ga0501071_0001272 | 3300049587 | Bacteria | 14323 |
| 1027 | Ga0501071_0340956 | 3300049587 | Bacteria | 1139 |
| 1028 | Ga0501072_0106992 | 3300049588 | Bacteria | 2224 |
| 1029 | Ga0501072_0116752 | 3300049588 | Bacteria | 2125 |
| 1030 | Ga0501073_0004374 | 3300049589 | Bacteria | 10610 |
| 1031 | Ga0501074_0012526 | 3300049590 | Bacteria | 6166 |
| 1032 | Ga0501074_0018826 | 3300049590 | Bacteria | 5015 |
| 1033 | Ga0501074_0040111 | 3300049590 | Bacteria | 3391 |
| 1034 | Ga0501074_0165560 | 3300049590 | Bacteria | 1578 |
| 1035 | Ga0501074_0326934 | 3300049590 | Bacteria | 1089 |
| 1036 | Ga0501074_1011591 | 3300049590 | Bacteria | 584 |
| 1037 | Ga0501074_1137081 | 3300049590 | Bacteria | 548 |
| 1038 | Ga0501075_0028059 | 3300049591 | Bacteria | 4152 |
| 1039 | Ga0501076_0009936 | 3300049592 | Bacteria | 7035 |
| 1040 | Ga0501076_0099117 | 3300049592 | Bacteria | 2347 |
| 1041 | Ga0501077_0002323 | 3300049593 | Bacteria | 11449 |
| 1042 | Ga0501077_0002523 | 3300049593 | Bacteria | 10961 |
| 1043 | Ga0501077_0014680 | 3300049593 | Bacteria | 4922 |
| 1044 | Ga0501079_0004378 | 3300049741 | Bacteria | 10459 |
| 1045 | Ga0501079_0178252 | 3300049741 | Bacteria | 1658 |
| 1046 | Ga0501079_0179793 | 3300049741 | Bacteria | 1650 |
| 1047 | Ga0501079_0929063 | 3300049741 | Bacteria | 685 |
| 1048 | Ga0501080_0001996 | 3300049742 | Bacteria | 17609 |
| 1049 | Ga0501080_0153899 | 3300049742 | Bacteria | 2124 |
| 1050 | Ga0501080_0160365 | 3300049742 | Bacteria | 2077 |
| 1051 | Ga0501080_0222874 | 3300049742 | Bacteria | 1725 |
| 1052 | Ga0501080_0252296 | 3300049742 | Bacteria | 1609 |
| 1053 | Ga0501080_0400347 | 3300049742 | Bacteria | 1235 |
| 1054 | Ga0501081_0001229 | 3300049743 | Bacteria | 15580 |
| 1055 | Ga0501083_0083099 | 3300049744 | Bacteria | 2121 |
| 1056 | Ga0501035_0002330 | 3300049822 | Bacteria | 18722 |
| 1057 | Ga0501035_0127654 | 3300049822 | Bacteria | 2219 |
| 1058 | Ga0501035_1171300 | 3300049822 | Bacteria | 597 |
| 1059 | Ga0501044_0103343 | 3300049823 | Bacteria | 2864 |
| 1060 | Ga0501045_0002724 | 3300049824 | Bacteria | 12060 |
| 1061 | Ga0501045_0168652 | 3300049824 | Bacteria | 1630 |
| 1062 | nmdc:mga05p37_105308_c1 | 3300050507 | Bacteria | 3470 |
| 1063 | nmdc:mga05p37_23411_c1 | 3300050507 | Bacteria | 7494 |
| 1064 | nmdc:mga05p37_30852_c1 | 3300050507 | Bacteria | 6543 |
| 1065 | nmdc:mga05p37_374784_c1 | 3300050507 | Bacteria | 1669 |
| 1066 | nmdc:mga06r32_14701_c1 | 3300050510 | Bacteria | 7104 |
| 1067 | nmdc:mga06r32_729328_c1 | 3300050510 | Bacteria | 955 |
| 1068 | nmdc:mga08y16_1054378_c1 | 3300050511 | Bacteria | 790 |
| 1069 | nmdc:mga08y16_1695176_c1 | 3300050511 | Bacteria | 587 |
| 1070 | nmdc:mga08y16_242066_c1 | 3300050511 | Bacteria | 1865 |
| 1071 | nmdc:mga08y16_325712_c1 | 3300050511 | Bacteria | 1581 |
| 1072 | nmdc:mga08y16_95124_c1 | 3300050511 | Bacteria | 3103 |
| 1073 | nmdc:mga0n895_11292_c1 | 3300050512 | Bacteria | 7960 |
| 1074 | nmdc:mga0n895_1345301_c1 | 3300050512 | Bacteria | 684 |
| 1075 | nmdc:mga0n895_2045985_c1 | 3300050512 | Bacteria | 530 |
| 1076 | nmdc:mga0n895_304032_c1 | 3300050512 | Bacteria | 1617 |
| 1077 | nmdc:mga0n895_58476_c1 | 3300050512 | Bacteria | 3801 |
| 1078 | nmdc:mga0n895_8613_c1 | 3300050512 | Bacteria | 8850 |
| 1079 | nmdc:mga0rr50_10287_c1 | 3300050513 | Bacteria | 5930 |
| 1080 | nmdc:mga0rr50_214893_c1 | 3300050513 | Bacteria | 1586 |
| 1081 | nmdc:mga0rr50_225_c1 | 3300050513 | Bacteria | 30540 |
| 1082 | nmdc:mga0rr50_878172_c1 | 3300050513 | Bacteria | 765 |
| 1083 | nmdc:mga08x19_10123_c1 | 3300050514 | Bacteria | 5657 |
| 1084 | nmdc:mga08x19_39705_c1 | 3300050514 | Bacteria | 2993 |
| 1085 | nmdc:mga0a205_181837_c1 | 3300050515 | Bacteria | 1997 |
| 1086 | nmdc:mga0a205_3153_c1 | 3300050515 | Bacteria | 14634 |
| 1087 | nmdc:mga0a205_553517_c1 | 3300050515 | Bacteria | 1005 |
| 1088 | Ga0495601_0073913 | 3300053077 | Bacteria | 2180 |
| 1089 | Ga0495601_0276367 | 3300053077 | Bacteria | 1095 |
| 1090 | Ga0495601_0392264 | 3300053077 | Bacteria | 900 |
| 1091 | Ga0495601_0476578 | 3300053077 | Bacteria | 806 |
| 1092 | Ga0495612_0021233 | 3300053078 | Bacteria | 2605 |
| 1093 | Ga0495612_0202884 | 3300053078 | Bacteria | 875 |
| 1094 | Ga0495655_0017692 | 3300053083 | Bacteria | 1556 |
| 1095 | Ga0495655_0131140 | 3300053083 | Bacteria | 772 |
| 1096 | Ga0495619_0002264 | 3300053085 | Bacteria | 12718 |
| 1097 | Ga0495619_0060049 | 3300053085 | Bacteria | 2526 |
| 1098 | Ga0495619_0664531 | 3300053085 | Bacteria | 710 |
| 1099 | Ga0501084_0000859 | 3300054114 | Bacteria | 23456 |
| 1100 | Ga0501084_0761815 | 3300054114 | Bacteria | 815 |
| 1101 | Ga0590077_129034 | 3300059426 | Bacteria | 600 |
| 1102 | Ga0501082_0008383 | 3300060353 | Bacteria | 8916 |
| 1103 | Ga0501082_0375404 | 3300060353 | Bacteria | 1240 |
| 1104 | Ga0501082_0568272 | 3300060353 | Bacteria | 992 |
| 1105 | Ga0466962_0188099 | 3300061719 | Bacteria | 1007 |
| 1106 | Ga0530510_0022663 | 3300061734 | Bacteria | 4474 |
| 1107 | Ga0530510_0055552 | 3300061734 | Bacteria | 2860 |
| 1108 | Ga0530510_0135001 | 3300061734 | Bacteria | 1816 |
| 1109 | Ga0530510_0248814 | 3300061734 | Bacteria | 1324 |
| 1110 | Ga0530510_0313558 | 3300061734 | Bacteria | 1175 |
| 1111 | Ga0530510_0683490 | 3300061734 | Bacteria | 782 |
| 1112 | Ga0530510_1367719 | 3300061734 | Bacteria | 543 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049590 | Ga0501074_1011591 | Ga0501074_1011591_12_440 | 141 |
| 2 | 3300048905 | Ga0496102_0574841 | Ga0496102_0574841_369_809 | 145 |
| 3 | 3300048913 | Ga0496110_0015943 | Ga0496110_0015943_1896_2336 | 145 |
| 4 | 3300048914 | Ga0496111_0031537 | Ga0496111_0031537_845_1285 | 145 |
| 5 | 3300005354 | Ga0070675_101283618 | Ga0070675_1012836182 | 146 |
| 6 | 3300006163 | Ga0070715_10692049 | Ga0070715_106920491 | 146 |
| 7 | 3300015261 | Ga0182006_1141934 | Ga0182006_11419342 | 146 |
| 8 | 3300015262 | Ga0182007_10231938 | Ga0182007_102319382 | 146 |
| 9 | 3300025905 | Ga0207685_10487818 | Ga0207685_104878182 | 146 |
| 10 | 3300025916 | Ga0207663_10226444 | Ga0207663_102264442 | 146 |
| 11 | 3300005435 | Ga0070714_100453245 | Ga0070714_1004532452 | 147 |
| 12 | 3300005455 | Ga0070663_101685491 | Ga0070663_1016854911 | 147 |
| 13 | 3300005518 | Ga0070699_100158173 | Ga0070699_1001581732 | 147 |
| 14 | 3300025922 | Ga0207646_10956458 | Ga0207646_109564582 | 147 |
| 15 | 3300025929 | Ga0207664_10116950 | Ga0207664_101169503 | 147 |
| 16 | 3300028573 | Ga0265334_10015319 | Ga0265334_100153193 | 147 |
| 17 | 3300028577 | Ga0265318_10010160 | Ga0265318_100101603 | 147 |
| 18 | 3300028654 | Ga0265322_10015344 | Ga0265322_100153443 | 147 |
| 19 | 3300028800 | Ga0265338_10028139 | Ga0265338_100281392 | 147 |
| 20 | 3300031239 | Ga0265328_10044387 | Ga0265328_100443872 | 147 |
| 21 | 3300031241 | Ga0265325_10029899 | Ga0265325_100298992 | 147 |
| 22 | 3300031251 | Ga0265327_10413925 | Ga0265327_104139252 | 147 |
| 23 | 3300031344 | Ga0265316_10761147 | Ga0265316_107611472 | 147 |
| 24 | 3300031595 | Ga0265313_10055786 | Ga0265313_100557861 | 147 |
| 25 | 3300031711 | Ga0265314_10012245 | Ga0265314_100122452 | 147 |
| 26 | 3300031712 | Ga0265342_10150680 | Ga0265342_101506802 | 147 |
| 27 | 3300031712 | Ga0265342_10332060 | Ga0265342_103320602 | 147 |
| 28 | 3300005435 | Ga0070714_100053368 | Ga0070714_1000533682 | 148 |
| 29 | 3300005435 | Ga0070714_100691547 | Ga0070714_1006915472 | 148 |
| 30 | 3300005436 | Ga0070713_100094513 | Ga0070713_1000945132 | 148 |
| 31 | 3300005436 | Ga0070713_101237419 | Ga0070713_1012374192 | 148 |
| 32 | 3300005440 | Ga0070705_101101782 | Ga0070705_1011017822 | 148 |
| 33 | 3300005467 | Ga0070706_100258145 | Ga0070706_1002581452 | 148 |
| 34 | 3300005471 | Ga0070698_100073605 | Ga0070698_1000736053 | 148 |
| 35 | 3300005471 | Ga0070698_100128875 | Ga0070698_1001288753 | 148 |
| 36 | 3300009093 | Ga0105240_11069326 | Ga0105240_110693262 | 148 |
| 37 | 3300009093 | Ga0105240_11110382 | Ga0105240_111103822 | 148 |
| 38 | 3300021358 | Ga0213873_10039551 | Ga0213873_100395512 | 148 |
| 39 | 3300021441 | Ga0213871_10077264 | Ga0213871_100772641 | 148 |
| 40 | 3300025910 | Ga0207684_10039896 | Ga0207684_100398962 | 148 |
| 41 | 3300025920 | Ga0207649_10517658 | Ga0207649_105176582 | 148 |
| 42 | 3300025929 | Ga0207664_10002557 | Ga0207664_1000255712 | 148 |
| 43 | 3300025929 | Ga0207664_11029652 | Ga0207664_110296522 | 148 |
| 44 | 3300025939 | Ga0207665_10502673 | Ga0207665_105026732 | 148 |
| 45 | 3300031240 | Ga0265320_10226574 | Ga0265320_102265742 | 148 |
| 46 | 3300044706 | Ga0466964_0006266 | Ga0466964_0006266_662_1108 | 148 |
| 47 | 3300045976 | Ga0466967_0011854 | Ga0466967_0011854_3574_4020 | 148 |
| 48 | 3300045976 | Ga0466967_0433146 | Ga0466967_0433146_814_1260 | 148 |
| 49 | 3300046474 | Ga0495605_0061489 | Ga0495605_0061489_14_460 | 148 |
| 50 | 3300048911 | Ga0496108_0466152 | Ga0496108_0466152_572_1018 | 148 |
| 51 | 3300035725 | Ga0373947_0760366 | Ga0373947_0760366_99_548 | 149 |
| 52 | 3300046459 | Ga0495629_0483832 | Ga0495629_0483832_19_468 | 149 |
| 53 | 3300049573 | Ga0501037_0137364 | Ga0501037_0137364_1068_1538 | 149 |
| 54 | 3300005467 | Ga0070706_100864650 | Ga0070706_1008646501 | 150 |
| 55 | 3300005468 | Ga0070707_101046201 | Ga0070707_1010462012 | 150 |
| 56 | 3300005937 | Ga0081455_10011450 | Ga0081455_100114503 | 150 |
| 57 | 3300005937 | Ga0081455_10363616 | Ga0081455_103636162 | 150 |
| 58 | 3300006852 | Ga0075433_10004384 | Ga0075433_100043842 | 150 |
| 59 | 3300006852 | Ga0075433_10024478 | Ga0075433_100244786 | 150 |
| 60 | 3300006852 | Ga0075433_11051538 | Ga0075433_110515381 | 150 |
| 61 | 3300006871 | Ga0075434_100023021 | Ga0075434_1000230212 | 150 |
| 62 | 3300006871 | Ga0075434_101554258 | Ga0075434_1015542582 | 150 |
| 63 | 3300006871 | Ga0075434_101591479 | Ga0075434_1015914792 | 150 |
| 64 | 3300006880 | Ga0075429_100742484 | Ga0075429_1007424841 | 150 |
| 65 | 3300006914 | Ga0075436_100009853 | Ga0075436_1000098532 | 150 |
| 66 | 3300007076 | Ga0075435_100000140 | Ga0075435_10000014013 | 150 |
| 67 | 3300007076 | Ga0075435_100024269 | Ga0075435_1000242694 | 150 |
| 68 | 3300007076 | Ga0075435_100806250 | Ga0075435_1008062501 | 150 |
| 69 | 3300009147 | Ga0114129_10009001 | Ga0114129_1000900118 | 150 |
| 70 | 3300009147 | Ga0114129_10048698 | Ga0114129_100486987 | 150 |
| 71 | 3300009147 | Ga0114129_10056182 | Ga0114129_100561826 | 150 |
| 72 | 3300009147 | Ga0114129_10385876 | Ga0114129_103858762 | 150 |
| 73 | 3300014326 | Ga0157380_10692548 | Ga0157380_106925482 | 150 |
| 74 | 3300015262 | Ga0182007_10367363 | Ga0182007_103673631 | 150 |
| 75 | 3300025898 | Ga0207692_10113744 | Ga0207692_101137442 | 150 |
| 76 | 3300025910 | Ga0207684_10702501 | Ga0207684_107025012 | 150 |
| 77 | 3300025915 | Ga0207693_10302964 | Ga0207693_103029642 | 150 |
| 78 | 3300025921 | Ga0207652_11106148 | Ga0207652_111061482 | 150 |
| 79 | 3300025922 | Ga0207646_11371729 | Ga0207646_113717292 | 150 |
| 80 | 3300027907 | Ga0207428_10297768 | Ga0207428_102977682 | 150 |
| 81 | 3300031731 | Ga0307405_11088093 | Ga0307405_110880932 | 150 |
| 82 | 3300031901 | Ga0307406_11130915 | Ga0307406_111309151 | 150 |
| 83 | 3300031911 | Ga0307412_10560373 | Ga0307412_105603732 | 150 |
| 84 | 3300035086 | Ga0373934_0137215 | Ga0373934_0137215_89_541 | 150 |
| 85 | 3300035117 | Ga0373953_0032746 | Ga0373953_0032746_1252_1704 | 150 |
| 86 | 3300035117 | Ga0373953_0330680 | Ga0373953_0330680_56_508 | 150 |
| 87 | 3300035120 | Ga0373957_0025026 | Ga0373957_0025026_520_972 | 150 |
| 88 | 3300035170 | Ga0373943_0000899 | Ga0373943_0000899_3396_3848 | 150 |
| 89 | 3300035172 | Ga0373955_0008799 | Ga0373955_0008799_2902_3354 | 150 |
| 90 | 3300035410 | Ga0373924_0079925 | Ga0373924_0079925_818_1270 | 150 |
| 91 | 3300035695 | Ga0373927_0135226 | Ga0373927_0135226_80_532 | 150 |
| 92 | 3300035725 | Ga0373947_0003187 | Ga0373947_0003187_6964_7416 | 150 |
| 93 | 3300036401 | Ga0373937_0076296 | Ga0373937_0076296_1351_1803 | 150 |
| 94 | 3300037312 | Ga0395899_0212186 | Ga0395899_0212186_798_1250 | 150 |
| 95 | 3300037418 | Ga0395900_0004700 | Ga0395900_0004700_2544_2996 | 150 |
| 96 | 3300037466 | Ga0395898_0004894 | Ga0395898_0004894_9774_10226 | 150 |
| 97 | 3300037466 | Ga0395898_0119682 | Ga0395898_0119682_1981_2433 | 150 |
| 98 | 3300037466 | Ga0395898_0244556 | Ga0395898_0244556_571_1023 | 150 |
| 99 | 3300037471 | Ga0395905_0818853 | Ga0395905_0818853_191_643 | 150 |
| 100 | 3300038443 | Ga0395901_0036111 | Ga0395901_0036111_2452_2904 | 150 |
| 101 | 3300038443 | Ga0395901_0181430 | Ga0395901_0181430_146_598 | 150 |
| 102 | 3300042004 | Ga0439445_0242928 | Ga0439445_0242928_25_477 | 150 |
| 103 | 3300045976 | Ga0466967_0237608 | Ga0466967_0237608_884_1336 | 150 |
| 104 | 3300045976 | Ga0466967_0551817 | Ga0466967_0551817_666_1118 | 150 |
| 105 | 3300046454 | Ga0495592_0114033 | Ga0495592_0114033_785_1237 | 150 |
| 106 | 3300046455 | Ga0495603_0023275 | Ga0495603_0023275_2182_2634 | 150 |
| 107 | 3300046459 | Ga0495629_0114708 | Ga0495629_0114708_896_1348 | 150 |
| 108 | 3300046461 | Ga0495641_0001250 | Ga0495641_0001250_12694_13146 | 150 |
| 109 | 3300046462 | Ga0495651_0012474 | Ga0495651_0012474_4429_4881 | 150 |
| 110 | 3300046462 | Ga0495651_0040858 | Ga0495651_0040858_2454_2906 | 150 |
| 111 | 3300046463 | Ga0495653_0061120 | Ga0495653_0061120_2303_2755 | 150 |
| 112 | 3300046473 | Ga0495582_0000397 | Ga0495582_0000397_17948_18400 | 150 |
| 113 | 3300046475 | Ga0495639_0002254 | Ga0495639_0002254_1886_2338 | 150 |
| 114 | 3300046477 | Ga0495664_0016551 | Ga0495664_0016551_458_910 | 150 |
| 115 | 3300046477 | Ga0495664_0276691 | Ga0495664_0276691_94_546 | 150 |
| 116 | 3300046501 | Ga0495607_0245655 | Ga0495607_0245655_356_811 | 150 |
| 117 | 3300046511 | Ga0495608_0029157 | Ga0495608_0029157_1943_2395 | 150 |
| 118 | 3300046514 | Ga0495618_0241671 | Ga0495618_0241671_270_722 | 150 |
| 119 | 3300046516 | Ga0495628_0013424 | Ga0495628_0013424_5030_5482 | 150 |
| 120 | 3300046517 | Ga0495630_0066836 | Ga0495630_0066836_2159_2611 | 150 |
| 121 | 3300046517 | Ga0495630_0075867 | Ga0495630_0075867_722_1174 | 150 |
| 122 | 3300046518 | Ga0495631_0325870 | Ga0495631_0325870_187_639 | 150 |
| 123 | 3300046526 | Ga0495666_0019709 | Ga0495666_0019709_1041_1493 | 150 |
| 124 | 3300046529 | Ga0495652_0012598 | Ga0495652_0012598_5366_5818 | 150 |
| 125 | 3300046529 | Ga0495652_0189526 | Ga0495652_0189526_766_1218 | 150 |
| 126 | 3300046531 | Ga0495665_0026888 | Ga0495665_0026888_1523_1975 | 150 |
| 127 | 3300046533 | Ga0495640_0035402 | Ga0495640_0035402_651_1103 | 150 |
| 128 | 3300046535 | Ga0495586_0103308 | Ga0495586_0103308_139_591 | 150 |
| 129 | 3300046536 | Ga0495587_0022577 | Ga0495587_0022577_1710_2162 | 150 |
| 130 | 3300046536 | Ga0495587_0048446 | Ga0495587_0048446_304_756 | 150 |
| 131 | 3300046543 | Ga0495645_0060684 | Ga0495645_0060684_1351_1803 | 150 |
| 132 | 3300046543 | Ga0495645_0096890 | Ga0495645_0096890_589_1041 | 150 |
| 133 | 3300046559 | Ga0495667_0041845 | Ga0495667_0041845_825_1277 | 150 |
| 134 | 3300046642 | Ga0495634_0120097 | Ga0495634_0120097_640_1092 | 150 |
| 135 | 3300046663 | Ga0495635_0013378 | Ga0495635_0013378_3054_3506 | 150 |
| 136 | 3300046663 | Ga0495635_0015938 | Ga0495635_0015938_4067_4519 | 150 |
| 137 | 3300046665 | Ga0495661_0370205 | Ga0495661_0370205_19_471 | 150 |
| 138 | 3300046674 | Ga0495588_0059077 | Ga0495588_0059077_636_1088 | 150 |
| 139 | 3300046675 | Ga0495657_0116590 | Ga0495657_0116590_56_508 | 150 |
| 140 | 3300046675 | Ga0495657_0175077 | Ga0495657_0175077_418_870 | 150 |
| 141 | 3300046678 | Ga0495599_0101990 | Ga0495599_0101990_253_705 | 150 |
| 142 | 3300046679 | Ga0495623_0041457 | Ga0495623_0041457_2043_2495 | 150 |
| 143 | 3300046679 | Ga0495623_0118047 | Ga0495623_0118047_469_921 | 150 |
| 144 | 3300046680 | Ga0495646_0101109 | Ga0495646_0101109_358_810 | 150 |
| 145 | 3300046680 | Ga0495646_0105173 | Ga0495646_0105173_1138_1590 | 150 |
| 146 | 3300046681 | Ga0495647_0001542 | Ga0495647_0001542_4576_5028 | 150 |
| 147 | 3300046683 | Ga0495658_0001563 | Ga0495658_0001563_11227_11679 | 150 |
| 148 | 3300046689 | Ga0495613_0001506 | Ga0495613_0001506_10309_10761 | 150 |
| 149 | 3300046809 | Ga0495600_0057459 | Ga0495600_0057459_265_717 | 150 |
| 150 | 3300046809 | Ga0495600_0133015 | Ga0495600_0133015_756_1208 | 150 |
| 151 | 3300047315 | Ga0495581_0002960 | Ga0495581_0002960_615_1067 | 150 |
| 152 | 3300047317 | Ga0495604_0003309 | Ga0495604_0003309_3711_4163 | 150 |
| 153 | 3300047317 | Ga0495604_0166394 | Ga0495604_0166394_1003_1455 | 150 |
| 154 | 3300047319 | Ga0495674_0066253 | Ga0495674_0066253_1962_2414 | 150 |
| 155 | 3300047322 | Ga0495680_0006197 | Ga0495680_0006197_7500_7952 | 150 |
| 156 | 3300047322 | Ga0495680_0080049 | Ga0495680_0080049_363_815 | 150 |
| 157 | 3300047444 | Ga0495675_0054671 | Ga0495675_0054671_1996_2448 | 150 |
| 158 | 3300047471 | Ga0495684_0019345 | Ga0495684_0019345_1956_2408 | 150 |
| 159 | 3300047471 | Ga0495684_0029105 | Ga0495684_0029105_708_1160 | 150 |
| 160 | 3300047673 | Ga0495593_0004029 | Ga0495593_0004029_1043_1495 | 150 |
| 161 | 3300048088 | Ga0495602_0006483 | Ga0495602_0006483_10145_10597 | 150 |
| 162 | 3300048088 | Ga0495602_0132184 | Ga0495602_0132184_707_1159 | 150 |
| 163 | 3300048904 | Ga0496101_0285496 | Ga0496101_0285496_763_1215 | 150 |
| 164 | 3300048904 | Ga0496101_0465055 | Ga0496101_0465055_172_624 | 150 |
| 165 | 3300048905 | Ga0496102_0007218 | Ga0496102_0007218_4136_4588 | 150 |
| 166 | 3300048906 | Ga0496103_0194786 | Ga0496103_0194786_88_540 | 150 |
| 167 | 3300048907 | Ga0496104_0298791 | Ga0496104_0298791_79_531 | 150 |
| 168 | 3300048909 | Ga0496106_0115864 | Ga0496106_0115864_1503_1955 | 150 |
| 169 | 3300048911 | Ga0496108_0138388 | Ga0496108_0138388_948_1400 | 150 |
| 170 | 3300048912 | Ga0496109_0070787 | Ga0496109_0070787_361_813 | 150 |
| 171 | 3300048912 | Ga0496109_0252758 | Ga0496109_0252758_250_702 | 150 |
| 172 | 3300048913 | Ga0496110_0139077 | Ga0496110_0139077_61_513 | 150 |
| 173 | 3300048914 | Ga0496111_0032440 | Ga0496111_0032440_375_827 | 150 |
| 174 | 3300048915 | Ga0496112_1218375 | Ga0496112_1218375_40_492 | 150 |
| 175 | 3300048916 | Ga0496113_0307251 | Ga0496113_0307251_615_1067 | 150 |
| 176 | 3300048917 | Ga0496114_0026662 | Ga0496114_0026662_2891_3343 | 150 |
| 177 | 3300048917 | Ga0496114_0985169 | Ga0496114_0985169_154_606 | 150 |
| 178 | 3300048918 | Ga0496115_0022334 | Ga0496115_0022334_1925_2377 | 150 |
| 179 | 3300048918 | Ga0496115_0060452 | Ga0496115_0060452_2033_2485 | 150 |
| 180 | 3300049568 | Ga0501031_0342915 | Ga0501031_0342915_378_830 | 150 |
| 181 | 3300049590 | Ga0501074_0326934 | Ga0501074_0326934_229_681 | 150 |
| 182 | 3300050507 | nmdc:mga05p37_105308_c1 | nmdc:mga05p37_105308_c1_1691_2143 | 150 |
| 183 | 3300050507 | nmdc:mga05p37_23411_c1 | nmdc:mga05p37_23411_c1_6236_6688 | 150 |
| 184 | 3300050507 | nmdc:mga05p37_30852_c1 | nmdc:mga05p37_30852_c1_907_1359 | 150 |
| 185 | 3300050510 | nmdc:mga06r32_14701_c1 | nmdc:mga06r32_14701_c1_4658_5110 | 150 |
| 186 | 3300050510 | nmdc:mga06r32_729328_c1 | nmdc:mga06r32_729328_c1_218_670 | 150 |
| 187 | 3300050511 | nmdc:mga08y16_242066_c1 | nmdc:mga08y16_242066_c1_55_507 | 150 |
| 188 | 3300050512 | nmdc:mga0n895_11292_c1 | nmdc:mga0n895_11292_c1_4190_4642 | 150 |
| 189 | 3300050512 | nmdc:mga0n895_1345301_c1 | nmdc:mga0n895_1345301_c1_98_550 | 150 |
| 190 | 3300050512 | nmdc:mga0n895_8613_c1 | nmdc:mga0n895_8613_c1_1467_1919 | 150 |
| 191 | 3300050513 | nmdc:mga0rr50_225_c1 | nmdc:mga0rr50_225_c1_23265_23717 | 150 |
| 192 | 3300050513 | nmdc:mga0rr50_878172_c1 | nmdc:mga0rr50_878172_c1_130_582 | 150 |
| 193 | 3300050514 | nmdc:mga08x19_10123_c1 | nmdc:mga08x19_10123_c1_797_1249 | 150 |
| 194 | 3300050514 | nmdc:mga08x19_39705_c1 | nmdc:mga08x19_39705_c1_1176_1628 | 150 |
| 195 | 3300050515 | nmdc:mga0a205_181837_c1 | nmdc:mga0a205_181837_c1_1479_1931 | 150 |
| 196 | 3300050515 | nmdc:mga0a205_3153_c1 | nmdc:mga0a205_3153_c1_2398_2850 | 150 |
| 197 | 3300053077 | Ga0495601_0073913 | Ga0495601_0073913_100_552 | 150 |
| 198 | 3300053078 | Ga0495612_0021233 | Ga0495612_0021233_2073_2525 | 150 |
| 199 | 3300053078 | Ga0495612_0202884 | Ga0495612_0202884_85_537 | 150 |
| 200 | 3300053085 | Ga0495619_0002264 | Ga0495619_0002264_8835_9287 | 150 |
| 201 | 3300053085 | Ga0495619_0060049 | Ga0495619_0060049_1926_2378 | 150 |
| 202 | 3300005327 | Ga0070658_10092060 | Ga0070658_100920602 | 151 |
| 203 | 3300005327 | Ga0070658_10124746 | Ga0070658_101247462 | 151 |
| 204 | 3300005327 | Ga0070658_10482896 | Ga0070658_104828962 | 151 |
| 205 | 3300005329 | Ga0070683_100050130 | Ga0070683_1000501302 | 151 |
| 206 | 3300005329 | Ga0070683_100272919 | Ga0070683_1002729191 | 151 |
| 207 | 3300005329 | Ga0070683_100495927 | Ga0070683_1004959272 | 151 |
| 208 | 3300005329 | Ga0070683_101564350 | Ga0070683_1015643501 | 151 |
| 209 | 3300005330 | Ga0070690_100859593 | Ga0070690_1008595931 | 151 |
| 210 | 3300005336 | Ga0070680_100053848 | Ga0070680_1000538483 | 151 |
| 211 | 3300005336 | Ga0070680_100101092 | Ga0070680_1001010922 | 151 |
| 212 | 3300005336 | Ga0070680_100108456 | Ga0070680_1001084563 | 151 |
| 213 | 3300005337 | Ga0070682_100152865 | Ga0070682_1001528652 | 151 |
| 214 | 3300005339 | Ga0070660_100110092 | Ga0070660_1001100922 | 151 |
| 215 | 3300005339 | Ga0070660_100165585 | Ga0070660_1001655852 | 151 |
| 216 | 3300005339 | Ga0070660_100599982 | Ga0070660_1005999822 | 151 |
| 217 | 3300005339 | Ga0070660_100745219 | Ga0070660_1007452191 | 151 |
| 218 | 3300005341 | Ga0070691_10078192 | Ga0070691_100781922 | 151 |
| 219 | 3300005341 | Ga0070691_10528816 | Ga0070691_105288162 | 151 |
| 220 | 3300005343 | Ga0070687_100245886 | Ga0070687_1002458862 | 151 |
| 221 | 3300005344 | Ga0070661_100033510 | Ga0070661_1000335103 | 151 |
| 222 | 3300005344 | Ga0070661_100061585 | Ga0070661_1000615852 | 151 |
| 223 | 3300005345 | Ga0070692_10099802 | Ga0070692_100998022 | 151 |
| 224 | 3300005354 | Ga0070675_100071216 | Ga0070675_1000712163 | 151 |
| 225 | 3300005355 | Ga0070671_100748029 | Ga0070671_1007480292 | 151 |
| 226 | 3300005366 | Ga0070659_100219681 | Ga0070659_1002196812 | 151 |
| 227 | 3300005366 | Ga0070659_100241014 | Ga0070659_1002410142 | 151 |
| 228 | 3300005366 | Ga0070659_100475469 | Ga0070659_1004754691 | 151 |
| 229 | 3300005366 | Ga0070659_100962857 | Ga0070659_1009628571 | 151 |
| 230 | 3300005366 | Ga0070659_101325316 | Ga0070659_1013253161 | 151 |
| 231 | 3300005435 | Ga0070714_100429276 | Ga0070714_1004292761 | 151 |
| 232 | 3300005435 | Ga0070714_101747024 | Ga0070714_1017470241 | 151 |
| 233 | 3300005436 | Ga0070713_100505707 | Ga0070713_1005057071 | 151 |
| 234 | 3300005436 | Ga0070713_100938597 | Ga0070713_1009385972 | 151 |
| 235 | 3300005440 | Ga0070705_100072942 | Ga0070705_1000729422 | 151 |
| 236 | 3300005440 | Ga0070705_100894461 | Ga0070705_1008944611 | 151 |
| 237 | 3300005440 | Ga0070705_101107289 | Ga0070705_1011072891 | 151 |
| 238 | 3300005445 | Ga0070708_100132367 | Ga0070708_1001323672 | 151 |
| 239 | 3300005445 | Ga0070708_100675518 | Ga0070708_1006755182 | 151 |
| 240 | 3300005455 | Ga0070663_100854919 | Ga0070663_1008549192 | 151 |
| 241 | 3300005456 | Ga0070678_100118341 | Ga0070678_1001183412 | 151 |
| 242 | 3300005456 | Ga0070678_100513407 | Ga0070678_1005134072 | 151 |
| 243 | 3300005458 | Ga0070681_10001129 | Ga0070681_100011293 | 151 |
| 244 | 3300005458 | Ga0070681_10598725 | Ga0070681_105987252 | 151 |
| 245 | 3300005458 | Ga0070681_10741668 | Ga0070681_107416682 | 151 |
| 246 | 3300005458 | Ga0070681_10778623 | Ga0070681_107786232 | 151 |
| 247 | 3300005459 | Ga0068867_100244804 | Ga0068867_1002448042 | 151 |
| 248 | 3300005466 | Ga0070685_10551013 | Ga0070685_105510132 | 151 |
| 249 | 3300005468 | Ga0070707_100190723 | Ga0070707_1001907232 | 151 |
| 250 | 3300005530 | Ga0070679_100160109 | Ga0070679_1001601092 | 151 |
| 251 | 3300005530 | Ga0070679_100199276 | Ga0070679_1001992762 | 151 |
| 252 | 3300005535 | Ga0070684_100057188 | Ga0070684_1000571883 | 151 |
| 253 | 3300005535 | Ga0070684_100057250 | Ga0070684_1000572502 | 151 |
| 254 | 3300005535 | Ga0070684_100089966 | Ga0070684_1000899663 | 151 |
| 255 | 3300005535 | Ga0070684_100293223 | Ga0070684_1002932231 | 151 |
| 256 | 3300005535 | Ga0070684_100444650 | Ga0070684_1004446502 | 151 |
| 257 | 3300005535 | Ga0070684_100801332 | Ga0070684_1008013322 | 151 |
| 258 | 3300005536 | Ga0070697_100102146 | Ga0070697_1001021462 | 151 |
| 259 | 3300005536 | Ga0070697_100109749 | Ga0070697_1001097492 | 151 |
| 260 | 3300005536 | Ga0070697_101074971 | Ga0070697_1010749712 | 151 |
| 261 | 3300005545 | Ga0070695_100089217 | Ga0070695_1000892172 | 151 |
| 262 | 3300005546 | Ga0070696_100048066 | Ga0070696_1000480662 | 151 |
| 263 | 3300005547 | Ga0070693_100604571 | Ga0070693_1006045712 | 151 |
| 264 | 3300005548 | Ga0070665_100870746 | Ga0070665_1008707461 | 151 |
| 265 | 3300005548 | Ga0070665_100986248 | Ga0070665_1009862482 | 151 |
| 266 | 3300005563 | Ga0068855_100072684 | Ga0068855_1000726842 | 151 |
| 267 | 3300005563 | Ga0068855_100108078 | Ga0068855_1001080781 | 151 |
| 268 | 3300005563 | Ga0068855_100233752 | Ga0068855_1002337522 | 151 |
| 269 | 3300005563 | Ga0068855_100302014 | Ga0068855_1003020142 | 151 |
| 270 | 3300005564 | Ga0070664_100165065 | Ga0070664_1001650653 | 151 |
| 271 | 3300005564 | Ga0070664_100716366 | Ga0070664_1007163662 | 151 |
| 272 | 3300005577 | Ga0068857_100019391 | Ga0068857_1000193913 | 151 |
| 273 | 3300005577 | Ga0068857_100033041 | Ga0068857_1000330414 | 151 |
| 274 | 3300005577 | Ga0068857_100059894 | Ga0068857_1000598943 | 151 |
| 275 | 3300005577 | Ga0068857_100300411 | Ga0068857_1003004112 | 151 |
| 276 | 3300005578 | Ga0068854_100658541 | Ga0068854_1006585411 | 151 |
| 277 | 3300005614 | Ga0068856_100062119 | Ga0068856_1000621193 | 151 |
| 278 | 3300005614 | Ga0068856_100134039 | Ga0068856_1001340393 | 151 |
| 279 | 3300005614 | Ga0068856_100512191 | Ga0068856_1005121911 | 151 |
| 280 | 3300005615 | Ga0070702_100170582 | Ga0070702_1001705822 | 151 |
| 281 | 3300005615 | Ga0070702_100747294 | Ga0070702_1007472941 | 151 |
| 282 | 3300005616 | Ga0068852_100018025 | Ga0068852_1000180253 | 151 |
| 283 | 3300005616 | Ga0068852_100294898 | Ga0068852_1002948982 | 151 |
| 284 | 3300005617 | Ga0068859_101247572 | Ga0068859_1012475722 | 151 |
| 285 | 3300005618 | Ga0068864_100129295 | Ga0068864_1001292952 | 151 |
| 286 | 3300005618 | Ga0068864_100669633 | Ga0068864_1006696332 | 151 |
| 287 | 3300005718 | Ga0068866_10045370 | Ga0068866_100453703 | 151 |
| 288 | 3300005719 | Ga0068861_100572329 | Ga0068861_1005723292 | 151 |
| 289 | 3300005844 | Ga0068862_100986186 | Ga0068862_1009861862 | 151 |
| 290 | 3300005937 | Ga0081455_10012609 | Ga0081455_100126096 | 151 |
| 291 | 3300005937 | Ga0081455_10243025 | Ga0081455_102430252 | 151 |
| 292 | 3300005981 | Ga0081538_10051296 | Ga0081538_100512962 | 151 |
| 293 | 3300005985 | Ga0081539_10018622 | Ga0081539_100186223 | 151 |
| 294 | 3300006028 | Ga0070717_10014276 | Ga0070717_100142764 | 151 |
| 295 | 3300006028 | Ga0070717_10521603 | Ga0070717_105216032 | 151 |
| 296 | 3300006175 | Ga0070712_100030457 | Ga0070712_1000304574 | 151 |
| 297 | 3300006175 | Ga0070712_100211056 | Ga0070712_1002110561 | 151 |
| 298 | 3300006237 | Ga0097621_100870685 | Ga0097621_1008706852 | 151 |
| 299 | 3300006852 | Ga0075433_10456585 | Ga0075433_104565852 | 151 |
| 300 | 3300006931 | Ga0097620_101247658 | Ga0097620_1012476582 | 151 |
| 301 | 3300009093 | Ga0105240_10222720 | Ga0105240_102227203 | 151 |
| 302 | 3300009094 | Ga0111539_10031415 | Ga0111539_100314152 | 151 |
| 303 | 3300009094 | Ga0111539_10867885 | Ga0111539_108678852 | 151 |
| 304 | 3300009098 | Ga0105245_10119636 | Ga0105245_101196362 | 151 |
| 305 | 3300009098 | Ga0105245_10431456 | Ga0105245_104314562 | 151 |
| 306 | 3300009098 | Ga0105245_10746476 | Ga0105245_107464762 | 151 |
| 307 | 3300009098 | Ga0105245_10864972 | Ga0105245_108649722 | 151 |
| 308 | 3300009147 | Ga0114129_12821085 | Ga0114129_128210851 | 151 |
| 309 | 3300009148 | Ga0105243_10080853 | Ga0105243_100808534 | 151 |
| 310 | 3300009148 | Ga0105243_10513992 | Ga0105243_105139922 | 151 |
| 311 | 3300009148 | Ga0105243_10581757 | Ga0105243_105817572 | 151 |
| 312 | 3300009174 | Ga0105241_10268096 | Ga0105241_102680962 | 151 |
| 313 | 3300009176 | Ga0105242_11961248 | Ga0105242_119612481 | 151 |
| 314 | 3300009176 | Ga0105242_12274041 | Ga0105242_122740412 | 151 |
| 315 | 3300009177 | Ga0105248_10056872 | Ga0105248_100568725 | 151 |
| 316 | 3300009177 | Ga0105248_10194172 | Ga0105248_101941723 | 151 |
| 317 | 3300009177 | Ga0105248_10951507 | Ga0105248_109515072 | 151 |
| 318 | 3300009545 | Ga0105237_10492868 | Ga0105237_104928682 | 151 |
| 319 | 3300009551 | Ga0105238_10023360 | Ga0105238_100233607 | 151 |
| 320 | 3300009553 | Ga0105249_10686243 | Ga0105249_106862432 | 151 |
| 321 | 3300009553 | Ga0105249_11153319 | Ga0105249_111533192 | 151 |
| 322 | 3300009553 | Ga0105249_12218630 | Ga0105249_122186302 | 151 |
| 323 | 3300010375 | Ga0105239_10096721 | Ga0105239_100967212 | 151 |
| 324 | 3300010375 | Ga0105239_10515853 | Ga0105239_105158532 | 151 |
| 325 | 3300010375 | Ga0105239_11824757 | Ga0105239_118247572 | 151 |
| 326 | 3300011119 | Ga0105246_10322712 | Ga0105246_103227122 | 151 |
| 327 | 3300013102 | Ga0157371_11027283 | Ga0157371_110272832 | 151 |
| 328 | 3300013104 | Ga0157370_10008306 | Ga0157370_1000830613 | 151 |
| 329 | 3300013104 | Ga0157370_10300734 | Ga0157370_103007342 | 151 |
| 330 | 3300013104 | Ga0157370_10347658 | Ga0157370_103476582 | 151 |
| 331 | 3300013104 | Ga0157370_10833691 | Ga0157370_108336912 | 151 |
| 332 | 3300013105 | Ga0157369_10046810 | Ga0157369_100468103 | 151 |
| 333 | 3300013105 | Ga0157369_10336345 | Ga0157369_103363451 | 151 |
| 334 | 3300013105 | Ga0157369_10382575 | Ga0157369_103825753 | 151 |
| 335 | 3300013105 | Ga0157369_10462735 | Ga0157369_104627352 | 151 |
| 336 | 3300013105 | Ga0157369_11585855 | Ga0157369_115858552 | 151 |
| 337 | 3300013297 | Ga0157378_10345069 | Ga0157378_103450692 | 151 |
| 338 | 3300013297 | Ga0157378_11503761 | Ga0157378_115037611 | 151 |
| 339 | 3300013306 | Ga0163162_10263641 | Ga0163162_102636412 | 151 |
| 340 | 3300013306 | Ga0163162_10736469 | Ga0163162_107364692 | 151 |
| 341 | 3300013307 | Ga0157372_10029001 | Ga0157372_100290013 | 151 |
| 342 | 3300013307 | Ga0157372_10140215 | Ga0157372_101402152 | 151 |
| 343 | 3300013307 | Ga0157372_10304928 | Ga0157372_103049281 | 151 |
| 344 | 3300013307 | Ga0157372_10741397 | Ga0157372_107413972 | 151 |
| 345 | 3300013308 | Ga0157375_10263695 | Ga0157375_102636952 | 151 |
| 346 | 3300013308 | Ga0157375_10510413 | Ga0157375_105104132 | 151 |
| 347 | 3300014325 | Ga0163163_10208813 | Ga0163163_102088132 | 151 |
| 348 | 3300014325 | Ga0163163_10351850 | Ga0163163_103518501 | 151 |
| 349 | 3300014497 | Ga0182008_10413879 | Ga0182008_104138792 | 151 |
| 350 | 3300014968 | Ga0157379_10097916 | Ga0157379_100979163 | 151 |
| 351 | 3300020069 | Ga0197907_11047046 | Ga0197907_110470462 | 151 |
| 352 | 3300020069 | Ga0197907_11349487 | Ga0197907_113494872 | 151 |
| 353 | 3300020081 | Ga0206354_10741990 | Ga0206354_107419902 | 151 |
| 354 | 3300020082 | Ga0206353_10780697 | Ga0206353_107806972 | 151 |
| 355 | 3300020082 | Ga0206353_11751382 | Ga0206353_117513822 | 151 |
| 356 | 3300020082 | Ga0206353_11789119 | Ga0206353_117891193 | 151 |
| 357 | 3300021377 | Ga0213874_10142815 | Ga0213874_101428152 | 151 |
| 358 | 3300021384 | Ga0213876_10273908 | Ga0213876_102739082 | 151 |
| 359 | 3300025900 | Ga0207710_10343985 | Ga0207710_103439851 | 151 |
| 360 | 3300025901 | Ga0207688_10072754 | Ga0207688_100727543 | 151 |
| 361 | 3300025901 | Ga0207688_10143079 | Ga0207688_101430792 | 151 |
| 362 | 3300025901 | Ga0207688_10228445 | Ga0207688_102284452 | 151 |
| 363 | 3300025901 | Ga0207688_10639295 | Ga0207688_106392951 | 151 |
| 364 | 3300025901 | Ga0207688_10839980 | Ga0207688_108399802 | 151 |
| 365 | 3300025912 | Ga0207707_10014838 | Ga0207707_100148387 | 151 |
| 366 | 3300025912 | Ga0207707_10111137 | Ga0207707_101111371 | 151 |
| 367 | 3300025912 | Ga0207707_10198241 | Ga0207707_101982412 | 151 |
| 368 | 3300025912 | Ga0207707_10584770 | Ga0207707_105847702 | 151 |
| 369 | 3300025913 | Ga0207695_10543070 | Ga0207695_105430702 | 151 |
| 370 | 3300025914 | Ga0207671_10044114 | Ga0207671_100441143 | 151 |
| 371 | 3300025915 | Ga0207693_10019938 | Ga0207693_100199384 | 151 |
| 372 | 3300025915 | Ga0207693_10086334 | Ga0207693_100863342 | 151 |
| 373 | 3300025915 | Ga0207693_10422443 | Ga0207693_104224432 | 151 |
| 374 | 3300025917 | Ga0207660_10009367 | Ga0207660_100093674 | 151 |
| 375 | 3300025917 | Ga0207660_10185704 | Ga0207660_101857042 | 151 |
| 376 | 3300025917 | Ga0207660_10444825 | Ga0207660_104448253 | 151 |
| 377 | 3300025918 | Ga0207662_10269070 | Ga0207662_102690701 | 151 |
| 378 | 3300025919 | Ga0207657_10000416 | Ga0207657_1000041641 | 151 |
| 379 | 3300025919 | Ga0207657_10000610 | Ga0207657_1000061016 | 151 |
| 380 | 3300025919 | Ga0207657_10004617 | Ga0207657_100046172 | 151 |
| 381 | 3300025919 | Ga0207657_10151254 | Ga0207657_101512542 | 151 |
| 382 | 3300025919 | Ga0207657_10154164 | Ga0207657_101541643 | 151 |
| 383 | 3300025920 | Ga0207649_10034017 | Ga0207649_100340172 | 151 |
| 384 | 3300025920 | Ga0207649_10261521 | Ga0207649_102615212 | 151 |
| 385 | 3300025921 | Ga0207652_10003206 | Ga0207652_1000320615 | 151 |
| 386 | 3300025921 | Ga0207652_10017952 | Ga0207652_100179522 | 151 |
| 387 | 3300025921 | Ga0207652_10213248 | Ga0207652_102132482 | 151 |
| 388 | 3300025922 | Ga0207646_10140658 | Ga0207646_101406583 | 151 |
| 389 | 3300025926 | Ga0207659_10032822 | Ga0207659_100328223 | 151 |
| 390 | 3300025927 | Ga0207687_10403443 | Ga0207687_104034432 | 151 |
| 391 | 3300025928 | Ga0207700_10000004 | Ga0207700_10000004253 | 151 |
| 392 | 3300025928 | Ga0207700_10126938 | Ga0207700_101269382 | 151 |
| 393 | 3300025928 | Ga0207700_10223947 | Ga0207700_102239472 | 151 |
| 394 | 3300025929 | Ga0207664_10152546 | Ga0207664_101525463 | 151 |
| 395 | 3300025929 | Ga0207664_10176820 | Ga0207664_101768202 | 151 |
| 396 | 3300025931 | Ga0207644_10178931 | Ga0207644_101789312 | 151 |
| 397 | 3300025931 | Ga0207644_10423624 | Ga0207644_104236242 | 151 |
| 398 | 3300025932 | Ga0207690_10034236 | Ga0207690_100342363 | 151 |
| 399 | 3300025932 | Ga0207690_10155708 | Ga0207690_101557083 | 151 |
| 400 | 3300025932 | Ga0207690_10180276 | Ga0207690_101802762 | 151 |
| 401 | 3300025932 | Ga0207690_10321389 | Ga0207690_103213892 | 151 |
| 402 | 3300025933 | Ga0207706_10031346 | Ga0207706_100313462 | 151 |
| 403 | 3300025934 | Ga0207686_10895129 | Ga0207686_108951292 | 151 |
| 404 | 3300025935 | Ga0207709_10496246 | Ga0207709_104962462 | 151 |
| 405 | 3300025937 | Ga0207669_10075065 | Ga0207669_100750653 | 151 |
| 406 | 3300025937 | Ga0207669_10292088 | Ga0207669_102920882 | 151 |
| 407 | 3300025937 | Ga0207669_10968653 | Ga0207669_109686531 | 151 |
| 408 | 3300025939 | Ga0207665_10070955 | Ga0207665_100709552 | 151 |
| 409 | 3300025940 | Ga0207691_10539009 | Ga0207691_105390092 | 151 |
| 410 | 3300025941 | Ga0207711_10090389 | Ga0207711_100903892 | 151 |
| 411 | 3300025944 | Ga0207661_10023738 | Ga0207661_100237383 | 151 |
| 412 | 3300025944 | Ga0207661_10263049 | Ga0207661_102630492 | 151 |
| 413 | 3300025944 | Ga0207661_10768524 | Ga0207661_107685242 | 151 |
| 414 | 3300025944 | Ga0207661_10837006 | Ga0207661_108370062 | 151 |
| 415 | 3300025949 | Ga0207667_10099837 | Ga0207667_100998373 | 151 |
| 416 | 3300025949 | Ga0207667_10136696 | Ga0207667_101366963 | 151 |
| 417 | 3300025949 | Ga0207667_10143680 | Ga0207667_101436802 | 151 |
| 418 | 3300025949 | Ga0207667_10253165 | Ga0207667_102531652 | 151 |
| 419 | 3300025949 | Ga0207667_10594592 | Ga0207667_105945922 | 151 |
| 420 | 3300025949 | Ga0207667_11168952 | Ga0207667_111689522 | 151 |
| 421 | 3300025961 | Ga0207712_10863529 | Ga0207712_108635292 | 151 |
| 422 | 3300025981 | Ga0207640_10812205 | Ga0207640_108122051 | 151 |
| 423 | 3300025981 | Ga0207640_10939913 | Ga0207640_109399132 | 151 |
| 424 | 3300026023 | Ga0207677_10568347 | Ga0207677_105683472 | 151 |
| 425 | 3300026023 | Ga0207677_10891209 | Ga0207677_108912092 | 151 |
| 426 | 3300026067 | Ga0207678_10194806 | Ga0207678_101948062 | 151 |
| 427 | 3300026075 | Ga0207708_10024328 | Ga0207708_100243282 | 151 |
| 428 | 3300026078 | Ga0207702_10022866 | Ga0207702_100228664 | 151 |
| 429 | 3300026078 | Ga0207702_10199303 | Ga0207702_101993032 | 151 |
| 430 | 3300026078 | Ga0207702_10307064 | Ga0207702_103070642 | 151 |
| 431 | 3300026078 | Ga0207702_11335426 | Ga0207702_113354261 | 151 |
| 432 | 3300026088 | Ga0207641_10704317 | Ga0207641_107043172 | 151 |
| 433 | 3300026088 | Ga0207641_10820819 | Ga0207641_108208192 | 151 |
| 434 | 3300026089 | Ga0207648_10049380 | Ga0207648_100493805 | 151 |
| 435 | 3300026089 | Ga0207648_10373785 | Ga0207648_103737852 | 151 |
| 436 | 3300026095 | Ga0207676_10477664 | Ga0207676_104776642 | 151 |
| 437 | 3300026116 | Ga0207674_10009649 | Ga0207674_1000964912 | 151 |
| 438 | 3300026116 | Ga0207674_10015268 | Ga0207674_100152688 | 151 |
| 439 | 3300026116 | Ga0207674_10033571 | Ga0207674_100335712 | 151 |
| 440 | 3300026116 | Ga0207674_10034595 | Ga0207674_100345955 | 151 |
| 441 | 3300026118 | Ga0207675_101862906 | Ga0207675_1018629061 | 151 |
| 442 | 3300026121 | Ga0207683_10105840 | Ga0207683_101058402 | 151 |
| 443 | 3300026121 | Ga0207683_10206846 | Ga0207683_102068462 | 151 |
| 444 | 3300026142 | Ga0207698_10013668 | Ga0207698_100136683 | 151 |
| 445 | 3300026142 | Ga0207698_10147953 | Ga0207698_101479531 | 151 |
| 446 | 3300026142 | Ga0207698_10329570 | Ga0207698_103295702 | 151 |
| 447 | 3300028379 | Ga0268266_10048959 | Ga0268266_100489591 | 151 |
| 448 | 3300028379 | Ga0268266_10938016 | Ga0268266_109380162 | 151 |
| 449 | 3300028573 | Ga0265334_10114416 | Ga0265334_101144162 | 151 |
| 450 | 3300028573 | Ga0265334_10142860 | Ga0265334_101428601 | 151 |
| 451 | 3300028577 | Ga0265318_10266915 | Ga0265318_102669151 | 151 |
| 452 | 3300031251 | Ga0265327_10097793 | Ga0265327_100977932 | 151 |
| 453 | 3300031548 | Ga0307408_100015573 | Ga0307408_1000155732 | 151 |
| 454 | 3300031548 | Ga0307408_100287868 | Ga0307408_1002878682 | 151 |
| 455 | 3300031548 | Ga0307408_100384526 | Ga0307408_1003845261 | 151 |
| 456 | 3300031731 | Ga0307405_10004812 | Ga0307405_100048127 | 151 |
| 457 | 3300031731 | Ga0307405_10435309 | Ga0307405_104353092 | 151 |
| 458 | 3300031824 | Ga0307413_10597116 | Ga0307413_105971162 | 151 |
| 459 | 3300031852 | Ga0307410_10417627 | Ga0307410_104176272 | 151 |
| 460 | 3300031901 | Ga0307406_10182313 | Ga0307406_101823132 | 151 |
| 461 | 3300031903 | Ga0307407_10031785 | Ga0307407_100317852 | 151 |
| 462 | 3300031903 | Ga0307407_10502923 | Ga0307407_105029232 | 151 |
| 463 | 3300031911 | Ga0307412_10940949 | Ga0307412_109409492 | 151 |
| 464 | 3300031911 | Ga0307412_11086437 | Ga0307412_110864371 | 151 |
| 465 | 3300031995 | Ga0307409_100025747 | Ga0307409_1000257476 | 151 |
| 466 | 3300031995 | Ga0307409_100061797 | Ga0307409_1000617971 | 151 |
| 467 | 3300032002 | Ga0307416_100040131 | Ga0307416_1000401312 | 151 |
| 468 | 3300032002 | Ga0307416_100118391 | Ga0307416_1001183912 | 151 |
| 469 | 3300032002 | Ga0307416_100360839 | Ga0307416_1003608392 | 151 |
| 470 | 3300032004 | Ga0307414_10243475 | Ga0307414_102434752 | 151 |
| 471 | 3300032005 | Ga0307411_10153998 | Ga0307411_101539982 | 151 |
| 472 | 3300032126 | Ga0307415_100832037 | Ga0307415_1008320372 | 151 |
| 473 | 3300032126 | Ga0307415_101273243 | Ga0307415_1012732431 | 151 |
| 474 | 3300035083 | Ga0373926_0095199 | Ga0373926_0095199_131_586 | 151 |
| 475 | 3300035086 | Ga0373934_0430607 | Ga0373934_0430607_36_491 | 151 |
| 476 | 3300035089 | Ga0373944_0072406 | Ga0373944_0072406_657_1112 | 151 |
| 477 | 3300035113 | Ga0373936_0020681 | Ga0373936_0020681_1008_1463 | 151 |
| 478 | 3300035170 | Ga0373943_0039717 | Ga0373943_0039717_858_1313 | 151 |
| 479 | 3300035170 | Ga0373943_0087086 | Ga0373943_0087086_12_467 | 151 |
| 480 | 3300035171 | Ga0373946_0044796 | Ga0373946_0044796_794_1249 | 151 |
| 481 | 3300035691 | Ga0373931_0039207 | Ga0373931_0039207_793_1248 | 151 |
| 482 | 3300035695 | Ga0373927_0281848 | Ga0373927_0281848_65_520 | 151 |
| 483 | 3300035724 | Ga0373933_0297194 | Ga0373933_0297194_216_671 | 151 |
| 484 | 3300035725 | Ga0373947_0033686 | Ga0373947_0033686_1734_2189 | 151 |
| 485 | 3300035725 | Ga0373947_0060207 | Ga0373947_0060207_1514_1969 | 151 |
| 486 | 3300036401 | Ga0373937_0193836 | Ga0373937_0193836_1197_1652 | 151 |
| 487 | 3300037312 | Ga0395899_0001001 | Ga0395899_0001001_23055_23510 | 151 |
| 488 | 3300037312 | Ga0395899_0015657 | Ga0395899_0015657_1747_2214 | 151 |
| 489 | 3300037312 | Ga0395899_0018455 | Ga0395899_0018455_1370_1828 | 151 |
| 490 | 3300037312 | Ga0395899_0032687 | Ga0395899_0032687_1179_1634 | 151 |
| 491 | 3300037312 | Ga0395899_0041054 | Ga0395899_0041054_786_1241 | 151 |
| 492 | 3300037312 | Ga0395899_0081807 | Ga0395899_0081807_850_1305 | 151 |
| 493 | 3300037312 | Ga0395899_0094300 | Ga0395899_0094300_203_670 | 151 |
| 494 | 3300037312 | Ga0395899_0272526 | Ga0395899_0272526_22_480 | 151 |
| 495 | 3300037312 | Ga0395899_0650435 | Ga0395899_0650435_187_642 | 151 |
| 496 | 3300037418 | Ga0395900_0004233 | Ga0395900_0004233_2234_2701 | 151 |
| 497 | 3300037418 | Ga0395900_0004724 | Ga0395900_0004724_3614_4069 | 151 |
| 498 | 3300037418 | Ga0395900_0014519 | Ga0395900_0014519_1105_1560 | 151 |
| 499 | 3300037418 | Ga0395900_0015755 | Ga0395900_0015755_3855_4313 | 151 |
| 500 | 3300037418 | Ga0395900_0025692 | Ga0395900_0025692_2259_2714 | 151 |
| 501 | 3300037418 | Ga0395900_0032992 | Ga0395900_0032992_1461_1928 | 151 |
| 502 | 3300037418 | Ga0395900_0173719 | Ga0395900_0173719_882_1337 | 151 |
| 503 | 3300037418 | Ga0395900_0187989 | Ga0395900_0187989_1625_2083 | 151 |
| 504 | 3300037418 | Ga0395900_0229164 | Ga0395900_0229164_957_1412 | 151 |
| 505 | 3300037418 | Ga0395900_0424851 | Ga0395900_0424851_661_1116 | 151 |
| 506 | 3300037418 | Ga0395900_0654618 | Ga0395900_0654618_346_801 | 151 |
| 507 | 3300037466 | Ga0395898_0008982 | Ga0395898_0008982_6627_7082 | 151 |
| 508 | 3300037466 | Ga0395898_0016102 | Ga0395898_0016102_5823_6281 | 151 |
| 509 | 3300037466 | Ga0395898_0021780 | Ga0395898_0021780_2814_3281 | 151 |
| 510 | 3300037466 | Ga0395898_0031400 | Ga0395898_0031400_2775_3230 | 151 |
| 511 | 3300037466 | Ga0395898_0039643 | Ga0395898_0039643_1692_2147 | 151 |
| 512 | 3300037466 | Ga0395898_0285893 | Ga0395898_0285893_480_935 | 151 |
| 513 | 3300037466 | Ga0395898_0506784 | Ga0395898_0506784_674_1132 | 151 |
| 514 | 3300037471 | Ga0395905_0005063 | Ga0395905_0005063_10177_10632 | 151 |
| 515 | 3300037471 | Ga0395905_0005451 | Ga0395905_0005451_6506_6961 | 151 |
| 516 | 3300037471 | Ga0395905_0014689 | Ga0395905_0014689_5950_6408 | 151 |
| 517 | 3300037471 | Ga0395905_0023069 | Ga0395905_0023069_3201_3656 | 151 |
| 518 | 3300037471 | Ga0395905_0028306 | Ga0395905_0028306_3239_3706 | 151 |
| 519 | 3300037471 | Ga0395905_0064605 | Ga0395905_0064605_1374_1841 | 151 |
| 520 | 3300037471 | Ga0395905_0104764 | Ga0395905_0104764_1530_1985 | 151 |
| 521 | 3300037471 | Ga0395905_0301032 | Ga0395905_0301032_538_993 | 151 |
| 522 | 3300037471 | Ga0395905_0491959 | Ga0395905_0491959_362_817 | 151 |
| 523 | 3300037471 | Ga0395905_0560368 | Ga0395905_0560368_412_867 | 151 |
| 524 | 3300037471 | Ga0395905_1026758 | Ga0395905_1026758_43_498 | 151 |
| 525 | 3300038443 | Ga0395901_0002221 | Ga0395901_0002221_17232_17699 | 151 |
| 526 | 3300038443 | Ga0395901_0002468 | Ga0395901_0002468_10150_10605 | 151 |
| 527 | 3300038443 | Ga0395901_0029987 | Ga0395901_0029987_1132_1599 | 151 |
| 528 | 3300038443 | Ga0395901_0049122 | Ga0395901_0049122_2736_3194 | 151 |
| 529 | 3300038443 | Ga0395901_0053242 | Ga0395901_0053242_621_1076 | 151 |
| 530 | 3300038443 | Ga0395901_0095541 | Ga0395901_0095541_2511_2966 | 151 |
| 531 | 3300038443 | Ga0395901_0284494 | Ga0395901_0284494_181_639 | 151 |
| 532 | 3300038443 | Ga0395901_0291567 | Ga0395901_0291567_649_1104 | 151 |
| 533 | 3300038443 | Ga0395901_0475947 | Ga0395901_0475947_585_1040 | 151 |
| 534 | 3300038443 | Ga0395901_0667355 | Ga0395901_0667355_26_481 | 151 |
| 535 | 3300038443 | Ga0395901_1223430 | Ga0395901_1223430_78_533 | 151 |
| 536 | 3300039437 | Ga0436365_1553456 | Ga0436365_1553456_274_729 | 151 |
| 537 | 3300039450 | Ga0436363_0668989 | Ga0436363_0668989_141_596 | 151 |
| 538 | 3300039450 | Ga0436363_1348640 | Ga0436363_1348640_10_465 | 151 |
| 539 | 3300041405 | Ga0439438_045069 | Ga0439438_045069_68_523 | 151 |
| 540 | 3300041405 | Ga0439438_120893 | Ga0439438_120893_56_511 | 151 |
| 541 | 3300041410 | Ga0439461_0003605 | Ga0439461_0003605_1803_2258 | 151 |
| 542 | 3300041413 | Ga0439465_0098857 | Ga0439465_0098857_384_839 | 151 |
| 543 | 3300041492 | Ga0451835_0827407 | Ga0451835_0827407_347_805 | 151 |
| 544 | 3300041997 | Ga0439431_0130726 | Ga0439431_0130726_108_563 | 151 |
| 545 | 3300042001 | Ga0439441_012332 | Ga0439441_012332_61_516 | 151 |
| 546 | 3300042016 | Ga0439463_043686 | Ga0439463_043686_568_1032 | 151 |
| 547 | 3300042120 | Ga0450917_008674 | Ga0450917_008674_320_775 | 151 |
| 548 | 3300042146 | Ga0450907_011944 | Ga0450907_011944_795_1253 | 151 |
| 549 | 3300042435 | Ga0439434_0015538 | Ga0439434_0015538_290_745 | 151 |
| 550 | 3300044656 | Ga0466969_0103243 | Ga0466969_0103243_516_974 | 151 |
| 551 | 3300044658 | Ga0466972_0455956 | Ga0466972_0455956_101_556 | 151 |
| 552 | 3300044684 | Ga0466966_0128302 | Ga0466966_0128302_175_633 | 151 |
| 553 | 3300044694 | Ga0466963_0003083 | Ga0466963_0003083_988_1443 | 151 |
| 554 | 3300044706 | Ga0466964_0007545 | Ga0466964_0007545_3541_3996 | 151 |
| 555 | 3300044842 | Ga0466957_0035461 | Ga0466957_0035461_1893_2348 | 151 |
| 556 | 3300044842 | Ga0466957_0603646 | Ga0466957_0603646_262_720 | 151 |
| 557 | 3300045049 | Ga0466959_0148827 | Ga0466959_0148827_1106_1564 | 151 |
| 558 | 3300045836 | Ga0466958_0214086 | Ga0466958_0214086_373_828 | 151 |
| 559 | 3300045976 | Ga0466967_0001914 | Ga0466967_0001914_7080_7535 | 151 |
| 560 | 3300045976 | Ga0466967_0003262 | Ga0466967_0003262_9700_10155 | 151 |
| 561 | 3300045976 | Ga0466967_0015468 | Ga0466967_0015468_1798_2253 | 151 |
| 562 | 3300045976 | Ga0466967_0054908 | Ga0466967_0054908_1901_2356 | 151 |
| 563 | 3300045976 | Ga0466967_0137708 | Ga0466967_0137708_127_582 | 151 |
| 564 | 3300045976 | Ga0466967_0858283 | Ga0466967_0858283_65_520 | 151 |
| 565 | 3300045976 | Ga0466967_1476351 | Ga0466967_1476351_199_657 | 151 |
| 566 | 3300046454 | Ga0495592_0112947 | Ga0495592_0112947_1336_1791 | 151 |
| 567 | 3300046454 | Ga0495592_0750564 | Ga0495592_0750564_108_563 | 151 |
| 568 | 3300046459 | Ga0495629_0046938 | Ga0495629_0046938_1145_1600 | 151 |
| 569 | 3300046459 | Ga0495629_0819019 | Ga0495629_0819019_53_508 | 151 |
| 570 | 3300046461 | Ga0495641_0023550 | Ga0495641_0023550_2241_2696 | 151 |
| 571 | 3300046462 | Ga0495651_0248700 | Ga0495651_0248700_99_554 | 151 |
| 572 | 3300046463 | Ga0495653_0587652 | Ga0495653_0587652_19_474 | 151 |
| 573 | 3300046473 | Ga0495582_0127741 | Ga0495582_0127741_26_481 | 151 |
| 574 | 3300046474 | Ga0495605_0183141 | Ga0495605_0183141_422_877 | 151 |
| 575 | 3300046476 | Ga0495662_0035472 | Ga0495662_0035472_1567_2022 | 151 |
| 576 | 3300046491 | Ga0495584_0108216 | Ga0495584_0108216_140_598 | 151 |
| 577 | 3300046492 | Ga0495585_0266184 | Ga0495585_0266184_190_654 | 151 |
| 578 | 3300046500 | Ga0495596_0074630 | Ga0495596_0074630_817_1275 | 151 |
| 579 | 3300046500 | Ga0495596_0156887 | Ga0495596_0156887_79_534 | 151 |
| 580 | 3300046500 | Ga0495596_0335123 | Ga0495596_0335123_85_561 | 151 |
| 581 | 3300046501 | Ga0495607_0225143 | Ga0495607_0225143_374_838 | 151 |
| 582 | 3300046511 | Ga0495608_0052486 | Ga0495608_0052486_1348_1803 | 151 |
| 583 | 3300046513 | Ga0495616_0428307 | Ga0495616_0428307_68_523 | 151 |
| 584 | 3300046514 | Ga0495618_0260148 | Ga0495618_0260148_416_871 | 151 |
| 585 | 3300046516 | Ga0495628_0181249 | Ga0495628_0181249_765_1220 | 151 |
| 586 | 3300046517 | Ga0495630_0135334 | Ga0495630_0135334_1241_1696 | 151 |
| 587 | 3300046517 | Ga0495630_0228121 | Ga0495630_0228121_211_666 | 151 |
| 588 | 3300046517 | Ga0495630_0398463 | Ga0495630_0398463_348_803 | 151 |
| 589 | 3300046517 | Ga0495630_0538046 | Ga0495630_0538046_96_551 | 151 |
| 590 | 3300046520 | Ga0495637_0028523 | Ga0495637_0028523_328_792 | 151 |
| 591 | 3300046523 | Ga0495644_0128343 | Ga0495644_0128343_369_833 | 151 |
| 592 | 3300046525 | Ga0495663_0154082 | Ga0495663_0154082_201_656 | 151 |
| 593 | 3300046525 | Ga0495663_0268888 | Ga0495663_0268888_43_498 | 151 |
| 594 | 3300046528 | Ga0495642_0235976 | Ga0495642_0235976_301_756 | 151 |
| 595 | 3300046533 | Ga0495640_0044499 | Ga0495640_0044499_1060_1515 | 151 |
| 596 | 3300046537 | Ga0495598_0102770 | Ga0495598_0102770_59_523 | 151 |
| 597 | 3300046537 | Ga0495598_0131980 | Ga0495598_0131980_260_718 | 151 |
| 598 | 3300046543 | Ga0495645_0180645 | Ga0495645_0180645_591_1046 | 151 |
| 599 | 3300046543 | Ga0495645_0626745 | Ga0495645_0626745_186_641 | 151 |
| 600 | 3300046559 | Ga0495667_0050247 | Ga0495667_0050247_343_798 | 151 |
| 601 | 3300046559 | Ga0495667_0478577 | Ga0495667_0478577_129_584 | 151 |
| 602 | 3300046615 | Ga0495656_0196125 | Ga0495656_0196125_475_930 | 151 |
| 603 | 3300046642 | Ga0495634_0076063 | Ga0495634_0076063_1658_2113 | 151 |
| 604 | 3300046648 | Ga0495611_0094636 | Ga0495611_0094636_503_967 | 151 |
| 605 | 3300046664 | Ga0495659_0171023 | Ga0495659_0171023_399_854 | 151 |
| 606 | 3300046665 | Ga0495661_0420876 | Ga0495661_0420876_50_505 | 151 |
| 607 | 3300046675 | Ga0495657_0390097 | Ga0495657_0390097_153_608 | 151 |
| 608 | 3300046675 | Ga0495657_0562755 | Ga0495657_0562755_69_524 | 151 |
| 609 | 3300046678 | Ga0495599_0317149 | Ga0495599_0317149_258_713 | 151 |
| 610 | 3300046678 | Ga0495599_0727878 | Ga0495599_0727878_10_465 | 151 |
| 611 | 3300046684 | Ga0495669_0300484 | Ga0495669_0300484_175_639 | 151 |
| 612 | 3300046689 | Ga0495613_0319079 | Ga0495613_0319079_267_722 | 151 |
| 613 | 3300046689 | Ga0495613_0736123 | Ga0495613_0736123_42_497 | 151 |
| 614 | 3300046690 | Ga0495624_0494701 | Ga0495624_0494701_168_623 | 151 |
| 615 | 3300046694 | Ga0495649_0564922 | Ga0495649_0564922_46_510 | 151 |
| 616 | 3300046794 | Ga0495589_0426537 | Ga0495589_0426537_17_472 | 151 |
| 617 | 3300047315 | Ga0495581_0412987 | Ga0495581_0412987_68_526 | 151 |
| 618 | 3300047318 | Ga0495636_0246872 | Ga0495636_0246872_179_643 | 151 |
| 619 | 3300047319 | Ga0495674_0038374 | Ga0495674_0038374_2355_2810 | 151 |
| 620 | 3300047319 | Ga0495674_0055190 | Ga0495674_0055190_1348_1803 | 151 |
| 621 | 3300047321 | Ga0495676_0087650 | Ga0495676_0087650_735_1190 | 151 |
| 622 | 3300047322 | Ga0495680_0006671 | Ga0495680_0006671_8869_9324 | 151 |
| 623 | 3300047322 | Ga0495680_0374265 | Ga0495680_0374265_226_681 | 151 |
| 624 | 3300047323 | Ga0495683_0432331 | Ga0495683_0432331_33_488 | 151 |
| 625 | 3300048088 | Ga0495602_0157092 | Ga0495602_0157092_449_904 | 151 |
| 626 | 3300048903 | Ga0496100_0013049 | Ga0496100_0013049_2611_3066 | 151 |
| 627 | 3300048903 | Ga0496100_0017810 | Ga0496100_0017810_2338_2793 | 151 |
| 628 | 3300048903 | Ga0496100_0287704 | Ga0496100_0287704_738_1193 | 151 |
| 629 | 3300048903 | Ga0496100_0679569 | Ga0496100_0679569_27_491 | 151 |
| 630 | 3300048903 | Ga0496100_0694590 | Ga0496100_0694590_314_769 | 151 |
| 631 | 3300048904 | Ga0496101_0003097 | Ga0496101_0003097_2968_3423 | 151 |
| 632 | 3300048904 | Ga0496101_0088309 | Ga0496101_0088309_168_623 | 151 |
| 633 | 3300048904 | Ga0496101_0167196 | Ga0496101_0167196_798_1253 | 151 |
| 634 | 3300048905 | Ga0496102_0010358 | Ga0496102_0010358_6434_6889 | 151 |
| 635 | 3300048905 | Ga0496102_0327479 | Ga0496102_0327479_164_619 | 151 |
| 636 | 3300048906 | Ga0496103_0124345 | Ga0496103_0124345_834_1289 | 151 |
| 637 | 3300048906 | Ga0496103_0345080 | Ga0496103_0345080_466_921 | 151 |
| 638 | 3300048907 | Ga0496104_0000134 | Ga0496104_0000134_37034_37489 | 151 |
| 639 | 3300048907 | Ga0496104_0002226 | Ga0496104_0002226_3648_4103 | 151 |
| 640 | 3300048907 | Ga0496104_0009373 | Ga0496104_0009373_7140_7595 | 151 |
| 641 | 3300048907 | Ga0496104_0079872 | Ga0496104_0079872_408_863 | 151 |
| 642 | 3300048907 | Ga0496104_0124098 | Ga0496104_0124098_205_660 | 151 |
| 643 | 3300048907 | Ga0496104_1156832 | Ga0496104_1156832_94_549 | 151 |
| 644 | 3300048908 | Ga0496105_0000334 | Ga0496105_0000334_11867_12322 | 151 |
| 645 | 3300048908 | Ga0496105_0000429 | Ga0496105_0000429_1685_2140 | 151 |
| 646 | 3300048908 | Ga0496105_0003332 | Ga0496105_0003332_10578_11033 | 151 |
| 647 | 3300048909 | Ga0496106_0009788 | Ga0496106_0009788_6555_7010 | 151 |
| 648 | 3300048909 | Ga0496106_0207466 | Ga0496106_0207466_444_899 | 151 |
| 649 | 3300048909 | Ga0496106_0284268 | Ga0496106_0284268_195_650 | 151 |
| 650 | 3300048910 | Ga0496107_0050773 | Ga0496107_0050773_1742_2197 | 151 |
| 651 | 3300048910 | Ga0496107_0055898 | Ga0496107_0055898_2080_2535 | 151 |
| 652 | 3300048910 | Ga0496107_0503341 | Ga0496107_0503341_407_862 | 151 |
| 653 | 3300048911 | Ga0496108_0003536 | Ga0496108_0003536_3648_4103 | 151 |
| 654 | 3300048911 | Ga0496108_0017704 | Ga0496108_0017704_3289_3744 | 151 |
| 655 | 3300048911 | Ga0496108_0033079 | Ga0496108_0033079_2328_2783 | 151 |
| 656 | 3300048911 | Ga0496108_1372233 | Ga0496108_1372233_41_496 | 151 |
| 657 | 3300048911 | Ga0496108_1380347 | Ga0496108_1380347_101_556 | 151 |
| 658 | 3300048911 | Ga0496108_1534265 | Ga0496108_1534265_70_525 | 151 |
| 659 | 3300048912 | Ga0496109_0000898 | Ga0496109_0000898_21612_22067 | 151 |
| 660 | 3300048912 | Ga0496109_0004403 | Ga0496109_0004403_4253_4708 | 151 |
| 661 | 3300048912 | Ga0496109_0023182 | Ga0496109_0023182_2114_2569 | 151 |
| 662 | 3300048912 | Ga0496109_0042839 | Ga0496109_0042839_2414_2869 | 151 |
| 663 | 3300048912 | Ga0496109_0112373 | Ga0496109_0112373_1438_1902 | 151 |
| 664 | 3300048913 | Ga0496110_0000164 | Ga0496110_0000164_36841_37296 | 151 |
| 665 | 3300048913 | Ga0496110_0006694 | Ga0496110_0006694_4620_5075 | 151 |
| 666 | 3300048913 | Ga0496110_0014588 | Ga0496110_0014588_1821_2276 | 151 |
| 667 | 3300048913 | Ga0496110_0108442 | Ga0496110_0108442_75_530 | 151 |
| 668 | 3300048913 | Ga0496110_0117827 | Ga0496110_0117827_1025_1489 | 151 |
| 669 | 3300048914 | Ga0496111_0000228 | Ga0496111_0000228_10820_11275 | 151 |
| 670 | 3300048914 | Ga0496111_0000295 | Ga0496111_0000295_20127_20582 | 151 |
| 671 | 3300048914 | Ga0496111_0002679 | Ga0496111_0002679_6191_6646 | 151 |
| 672 | 3300048914 | Ga0496111_0015328 | Ga0496111_0015328_3595_4050 | 151 |
| 673 | 3300048914 | Ga0496111_0048024 | Ga0496111_0048024_1367_1831 | 151 |
| 674 | 3300048914 | Ga0496111_0089012 | Ga0496111_0089012_1576_2031 | 151 |
| 675 | 3300048914 | Ga0496111_0162974 | Ga0496111_0162974_925_1380 | 151 |
| 676 | 3300048915 | Ga0496112_0000291 | Ga0496112_0000291_28348_28803 | 151 |
| 677 | 3300048915 | Ga0496112_0000443 | Ga0496112_0000443_6148_6603 | 151 |
| 678 | 3300048915 | Ga0496112_0825665 | Ga0496112_0825665_366_821 | 151 |
| 679 | 3300048916 | Ga0496113_0001618 | Ga0496113_0001618_5233_5688 | 151 |
| 680 | 3300048916 | Ga0496113_0158435 | Ga0496113_0158435_65_523 | 151 |
| 681 | 3300048916 | Ga0496113_0263470 | Ga0496113_0263470_287_751 | 151 |
| 682 | 3300048916 | Ga0496113_0569826 | Ga0496113_0569826_259_714 | 151 |
| 683 | 3300048917 | Ga0496114_0000281 | Ga0496114_0000281_34772_35227 | 151 |
| 684 | 3300048917 | Ga0496114_0003176 | Ga0496114_0003176_3384_3839 | 151 |
| 685 | 3300048917 | Ga0496114_0371130 | Ga0496114_0371130_668_1123 | 151 |
| 686 | 3300048917 | Ga0496114_0438328 | Ga0496114_0438328_318_773 | 151 |
| 687 | 3300048918 | Ga0496115_0015385 | Ga0496115_0015385_1074_1529 | 151 |
| 688 | 3300048918 | Ga0496115_0057152 | Ga0496115_0057152_1158_1613 | 151 |
| 689 | 3300048918 | Ga0496115_0231042 | Ga0496115_0231042_258_713 | 151 |
| 690 | 3300048918 | Ga0496115_0380090 | Ga0496115_0380090_94_549 | 151 |
| 691 | 3300049568 | Ga0501031_0104493 | Ga0501031_0104493_402_860 | 151 |
| 692 | 3300049570 | Ga0501033_0048171 | Ga0501033_0048171_1416_1874 | 151 |
| 693 | 3300049571 | Ga0501034_1528207 | Ga0501034_1528207_29_484 | 151 |
| 694 | 3300049572 | Ga0501036_0004455 | Ga0501036_0004455_9441_9899 | 151 |
| 695 | 3300049574 | Ga0501038_0072163 | Ga0501038_0072163_1029_1487 | 151 |
| 696 | 3300049575 | Ga0501039_0009773 | Ga0501039_0009773_4845_5303 | 151 |
| 697 | 3300049576 | Ga0501040_0028879 | Ga0501040_0028879_2962_3420 | 151 |
| 698 | 3300049577 | Ga0501041_0001675 | Ga0501041_0001675_3634_4092 | 151 |
| 699 | 3300049578 | Ga0501042_0013943 | Ga0501042_0013943_1023_1481 | 151 |
| 700 | 3300049578 | Ga0501042_0096600 | Ga0501042_0096600_730_1188 | 151 |
| 701 | 3300049579 | Ga0501043_0059002 | Ga0501043_0059002_1892_2350 | 151 |
| 702 | 3300049580 | Ga0501046_0015550 | Ga0501046_0015550_4694_5152 | 151 |
| 703 | 3300049582 | Ga0501048_0054653 | Ga0501048_0054653_2322_2780 | 151 |
| 704 | 3300049583 | Ga0501067_0000154 | Ga0501067_0000154_12096_12551 | 151 |
| 705 | 3300049583 | Ga0501067_0018163 | Ga0501067_0018163_344_799 | 151 |
| 706 | 3300049584 | Ga0501068_0114948 | Ga0501068_0114948_266_721 | 151 |
| 707 | 3300049585 | Ga0501069_0006471 | Ga0501069_0006471_1816_2271 | 151 |
| 708 | 3300049586 | Ga0501070_0084234 | Ga0501070_0084234_731_1189 | 151 |
| 709 | 3300049587 | Ga0501071_0001272 | Ga0501071_0001272_4403_4861 | 151 |
| 710 | 3300049588 | Ga0501072_0106992 | Ga0501072_0106992_295_753 | 151 |
| 711 | 3300049590 | Ga0501074_0012526 | Ga0501074_0012526_2543_2998 | 151 |
| 712 | 3300049590 | Ga0501074_0018826 | Ga0501074_0018826_3338_3796 | 151 |
| 713 | 3300049592 | Ga0501076_0009936 | Ga0501076_0009936_5822_6280 | 151 |
| 714 | 3300049593 | Ga0501077_0002323 | Ga0501077_0002323_9754_10212 | 151 |
| 715 | 3300049741 | Ga0501079_0004378 | Ga0501079_0004378_608_1066 | 151 |
| 716 | 3300049742 | Ga0501080_0160365 | Ga0501080_0160365_203_661 | 151 |
| 717 | 3300049742 | Ga0501080_0252296 | Ga0501080_0252296_148_603 | 151 |
| 718 | 3300049743 | Ga0501081_0001229 | Ga0501081_0001229_9559_10017 | 151 |
| 719 | 3300049822 | Ga0501035_0127654 | Ga0501035_0127654_666_1124 | 151 |
| 720 | 3300049822 | Ga0501035_1171300 | Ga0501035_1171300_122_580 | 151 |
| 721 | 3300049824 | Ga0501045_0002724 | Ga0501045_0002724_1398_1856 | 151 |
| 722 | 3300050511 | nmdc:mga08y16_1054378_c1 | nmdc:mga08y16_1054378_c1_198_653 | 151 |
| 723 | 3300050511 | nmdc:mga08y16_1695176_c1 | nmdc:mga08y16_1695176_c1_109_564 | 151 |
| 724 | 3300050515 | nmdc:mga0a205_553517_c1 | nmdc:mga0a205_553517_c1_17_472 | 151 |
| 725 | 3300053077 | Ga0495601_0276367 | Ga0495601_0276367_432_887 | 151 |
| 726 | 3300053077 | Ga0495601_0476578 | Ga0495601_0476578_270_725 | 151 |
| 727 | 3300053083 | Ga0495655_0131140 | Ga0495655_0131140_44_499 | 151 |
| 728 | 3300054114 | Ga0501084_0000859 | Ga0501084_0000859_10554_11012 | 151 |
| 729 | 3300059426 | Ga0590077_129034 | Ga0590077_129034_39_494 | 151 |
| 730 | 3300060353 | Ga0501082_0008383 | Ga0501082_0008383_1384_1842 | 151 |
| 731 | 3300060353 | Ga0501082_0568272 | Ga0501082_0568272_88_543 | 151 |
| 732 | 3300061734 | Ga0530510_0022663 | Ga0530510_0022663_2100_2555 | 151 |
| 733 | 3300061734 | Ga0530510_0055552 | Ga0530510_0055552_320_778 | 151 |
| 734 | 3300061734 | Ga0530510_0683490 | Ga0530510_0683490_192_647 | 151 |
| 735 | 3300003373 | JGI25407J50210_10007085 | JGI25407J50210_100070853 | 152 |
| 736 | 3300005327 | Ga0070658_10118883 | Ga0070658_101188832 | 152 |
| 737 | 3300005336 | Ga0070680_100508824 | Ga0070680_1005088241 | 152 |
| 738 | 3300005338 | Ga0068868_100036832 | Ga0068868_1000368324 | 152 |
| 739 | 3300005339 | Ga0070660_100330820 | Ga0070660_1003308202 | 152 |
| 740 | 3300005340 | Ga0070689_100136273 | Ga0070689_1001362732 | 152 |
| 741 | 3300005343 | Ga0070687_100057362 | Ga0070687_1000573621 | 152 |
| 742 | 3300005345 | Ga0070692_10015268 | Ga0070692_100152682 | 152 |
| 743 | 3300005347 | Ga0070668_100091137 | Ga0070668_1000911372 | 152 |
| 744 | 3300005355 | Ga0070671_100242954 | Ga0070671_1002429541 | 152 |
| 745 | 3300005356 | Ga0070674_100001639 | Ga0070674_1000016392 | 152 |
| 746 | 3300005365 | Ga0070688_100012006 | Ga0070688_1000120062 | 152 |
| 747 | 3300005434 | Ga0070709_10024012 | Ga0070709_100240123 | 152 |
| 748 | 3300005435 | Ga0070714_100092282 | Ga0070714_1000922823 | 152 |
| 749 | 3300005435 | Ga0070714_100361204 | Ga0070714_1003612042 | 152 |
| 750 | 3300005435 | Ga0070714_100794008 | Ga0070714_1007940081 | 152 |
| 751 | 3300005436 | Ga0070713_100088433 | Ga0070713_1000884332 | 152 |
| 752 | 3300005437 | Ga0070710_10005124 | Ga0070710_100051247 | 152 |
| 753 | 3300005437 | Ga0070710_10025539 | Ga0070710_100255392 | 152 |
| 754 | 3300005439 | Ga0070711_100896904 | Ga0070711_1008969042 | 152 |
| 755 | 3300005440 | Ga0070705_100117914 | Ga0070705_1001179142 | 152 |
| 756 | 3300005440 | Ga0070705_100347908 | Ga0070705_1003479081 | 152 |
| 757 | 3300005441 | Ga0070700_100063569 | Ga0070700_1000635692 | 152 |
| 758 | 3300005444 | Ga0070694_100156515 | Ga0070694_1001565153 | 152 |
| 759 | 3300005444 | Ga0070694_100443972 | Ga0070694_1004439722 | 152 |
| 760 | 3300005445 | Ga0070708_100179564 | Ga0070708_1001795642 | 152 |
| 761 | 3300005455 | Ga0070663_100670482 | Ga0070663_1006704821 | 152 |
| 762 | 3300005456 | Ga0070678_100020686 | Ga0070678_1000206865 | 152 |
| 763 | 3300005458 | Ga0070681_10109636 | Ga0070681_101096362 | 152 |
| 764 | 3300005458 | Ga0070681_10140248 | Ga0070681_101402483 | 152 |
| 765 | 3300005458 | Ga0070681_10152188 | Ga0070681_101521882 | 152 |
| 766 | 3300005459 | Ga0068867_100030890 | Ga0068867_1000308903 | 152 |
| 767 | 3300005466 | Ga0070685_10223648 | Ga0070685_102236481 | 152 |
| 768 | 3300005467 | Ga0070706_100049868 | Ga0070706_1000498684 | 152 |
| 769 | 3300005467 | Ga0070706_100405326 | Ga0070706_1004053262 | 152 |
| 770 | 3300005468 | Ga0070707_100754205 | Ga0070707_1007542052 | 152 |
| 771 | 3300005468 | Ga0070707_101548580 | Ga0070707_1015485801 | 152 |
| 772 | 3300005518 | Ga0070699_100622265 | Ga0070699_1006222651 | 152 |
| 773 | 3300005518 | Ga0070699_100880570 | Ga0070699_1008805701 | 152 |
| 774 | 3300005530 | Ga0070679_100305321 | Ga0070679_1003053212 | 152 |
| 775 | 3300005530 | Ga0070679_100792900 | Ga0070679_1007929002 | 152 |
| 776 | 3300005535 | Ga0070684_100317442 | Ga0070684_1003174422 | 152 |
| 777 | 3300005536 | Ga0070697_100385011 | Ga0070697_1003850112 | 152 |
| 778 | 3300005536 | Ga0070697_100829415 | Ga0070697_1008294151 | 152 |
| 779 | 3300005539 | Ga0068853_100306811 | Ga0068853_1003068112 | 152 |
| 780 | 3300005543 | Ga0070672_101034147 | Ga0070672_1010341472 | 152 |
| 781 | 3300005544 | Ga0070686_100032900 | Ga0070686_1000329003 | 152 |
| 782 | 3300005545 | Ga0070695_100159593 | Ga0070695_1001595932 | 152 |
| 783 | 3300005545 | Ga0070695_100192979 | Ga0070695_1001929792 | 152 |
| 784 | 3300005546 | Ga0070696_100056669 | Ga0070696_1000566692 | 152 |
| 785 | 3300005546 | Ga0070696_100581900 | Ga0070696_1005819002 | 152 |
| 786 | 3300005547 | Ga0070693_100845452 | Ga0070693_1008454521 | 152 |
| 787 | 3300005548 | Ga0070665_100053631 | Ga0070665_1000536313 | 152 |
| 788 | 3300005549 | Ga0070704_100002938 | Ga0070704_1000029382 | 152 |
| 789 | 3300005563 | Ga0068855_100351765 | Ga0068855_1003517652 | 152 |
| 790 | 3300005563 | Ga0068855_100425009 | Ga0068855_1004250091 | 152 |
| 791 | 3300005615 | Ga0070702_100069911 | Ga0070702_1000699112 | 152 |
| 792 | 3300005616 | Ga0068852_100045532 | Ga0068852_1000455323 | 152 |
| 793 | 3300005617 | Ga0068859_100331513 | Ga0068859_1003315132 | 152 |
| 794 | 3300005718 | Ga0068866_10104869 | Ga0068866_101048692 | 152 |
| 795 | 3300005719 | Ga0068861_100222240 | Ga0068861_1002222402 | 152 |
| 796 | 3300005842 | Ga0068858_100832431 | Ga0068858_1008324312 | 152 |
| 797 | 3300005844 | Ga0068862_101099680 | Ga0068862_1010996802 | 152 |
| 798 | 3300005937 | Ga0081455_10010251 | Ga0081455_100102519 | 152 |
| 799 | 3300005937 | Ga0081455_10564750 | Ga0081455_105647502 | 152 |
| 800 | 3300005981 | Ga0081538_10000518 | Ga0081538_1000051836 | 152 |
| 801 | 3300005981 | Ga0081538_10173146 | Ga0081538_101731462 | 152 |
| 802 | 3300005981 | Ga0081538_10174882 | Ga0081538_101748822 | 152 |
| 803 | 3300006163 | Ga0070715_10011644 | Ga0070715_100116443 | 152 |
| 804 | 3300006163 | Ga0070715_10510508 | Ga0070715_105105082 | 152 |
| 805 | 3300006175 | Ga0070712_100110168 | Ga0070712_1001101682 | 152 |
| 806 | 3300006175 | Ga0070712_100177212 | Ga0070712_1001772122 | 152 |
| 807 | 3300006175 | Ga0070712_101030674 | Ga0070712_1010306741 | 152 |
| 808 | 3300006358 | Ga0068871_100026449 | Ga0068871_1000264494 | 152 |
| 809 | 3300006871 | Ga0075434_100005135 | Ga0075434_1000051359 | 152 |
| 810 | 3300006871 | Ga0075434_100529470 | Ga0075434_1005294702 | 152 |
| 811 | 3300006881 | Ga0068865_100017722 | Ga0068865_1000177224 | 152 |
| 812 | 3300006931 | Ga0097620_100331517 | Ga0097620_1003315172 | 152 |
| 813 | 3300007076 | Ga0075435_100020149 | Ga0075435_1000201497 | 152 |
| 814 | 3300007076 | Ga0075435_100045328 | Ga0075435_1000453283 | 152 |
| 815 | 3300009036 | Ga0105244_10238047 | Ga0105244_102380472 | 152 |
| 816 | 3300009093 | Ga0105240_10439215 | Ga0105240_104392152 | 152 |
| 817 | 3300009093 | Ga0105240_10637414 | Ga0105240_106374142 | 152 |
| 818 | 3300009093 | Ga0105240_10708309 | Ga0105240_107083092 | 152 |
| 819 | 3300009094 | Ga0111539_10089729 | Ga0111539_100897293 | 152 |
| 820 | 3300009098 | Ga0105245_10011977 | Ga0105245_100119776 | 152 |
| 821 | 3300009098 | Ga0105245_11650211 | Ga0105245_116502112 | 152 |
| 822 | 3300009101 | Ga0105247_10203629 | Ga0105247_102036292 | 152 |
| 823 | 3300009147 | Ga0114129_11103449 | Ga0114129_111034492 | 152 |
| 824 | 3300009148 | Ga0105243_10032733 | Ga0105243_100327332 | 152 |
| 825 | 3300009174 | Ga0105241_10043494 | Ga0105241_100434942 | 152 |
| 826 | 3300009174 | Ga0105241_10405328 | Ga0105241_104053281 | 152 |
| 827 | 3300009174 | Ga0105241_10816530 | Ga0105241_108165302 | 152 |
| 828 | 3300009176 | Ga0105242_10006264 | Ga0105242_1000626411 | 152 |
| 829 | 3300009177 | Ga0105248_10008130 | Ga0105248_100081303 | 152 |
| 830 | 3300009177 | Ga0105248_11117168 | Ga0105248_111171682 | 152 |
| 831 | 3300009553 | Ga0105249_10017957 | Ga0105249_100179576 | 152 |
| 832 | 3300013100 | Ga0157373_10164163 | Ga0157373_101641631 | 152 |
| 833 | 3300013104 | Ga0157370_10932051 | Ga0157370_109320512 | 152 |
| 834 | 3300013105 | Ga0157369_10004499 | Ga0157369_1000449916 | 152 |
| 835 | 3300013105 | Ga0157369_10032180 | Ga0157369_100321802 | 152 |
| 836 | 3300013105 | Ga0157369_10045279 | Ga0157369_100452794 | 152 |
| 837 | 3300013296 | Ga0157374_10033180 | Ga0157374_100331802 | 152 |
| 838 | 3300013297 | Ga0157378_10018799 | Ga0157378_100187994 | 152 |
| 839 | 3300013306 | Ga0163162_10030463 | Ga0163162_100304632 | 152 |
| 840 | 3300013307 | Ga0157372_10524982 | Ga0157372_105249822 | 152 |
| 841 | 3300013308 | Ga0157375_10064197 | Ga0157375_100641974 | 152 |
| 842 | 3300013308 | Ga0157375_10569078 | Ga0157375_105690782 | 152 |
| 843 | 3300013308 | Ga0157375_10839944 | Ga0157375_108399442 | 152 |
| 844 | 3300014326 | Ga0157380_10134754 | Ga0157380_101347543 | 152 |
| 845 | 3300014745 | Ga0157377_10003323 | Ga0157377_100033239 | 152 |
| 846 | 3300014745 | Ga0157377_10562207 | Ga0157377_105622071 | 152 |
| 847 | 3300014969 | Ga0157376_10013033 | Ga0157376_100130332 | 152 |
| 848 | 3300014969 | Ga0157376_10077981 | Ga0157376_100779813 | 152 |
| 849 | 3300020070 | Ga0206356_10777109 | Ga0206356_107771092 | 152 |
| 850 | 3300020082 | Ga0206353_11185381 | Ga0206353_111853812 | 152 |
| 851 | 3300020082 | Ga0206353_11283255 | Ga0206353_112832552 | 152 |
| 852 | 3300025898 | Ga0207692_10064075 | Ga0207692_100640753 | 152 |
| 853 | 3300025905 | Ga0207685_10003453 | Ga0207685_100034532 | 152 |
| 854 | 3300025905 | Ga0207685_10042480 | Ga0207685_100424802 | 152 |
| 855 | 3300025905 | Ga0207685_10429030 | Ga0207685_104290302 | 152 |
| 856 | 3300025906 | Ga0207699_10612734 | Ga0207699_106127342 | 152 |
| 857 | 3300025910 | Ga0207684_10308549 | Ga0207684_103085492 | 152 |
| 858 | 3300025912 | Ga0207707_10146159 | Ga0207707_101461592 | 152 |
| 859 | 3300025913 | Ga0207695_11223259 | Ga0207695_112232591 | 152 |
| 860 | 3300025913 | Ga0207695_11391233 | Ga0207695_113912331 | 152 |
| 861 | 3300025915 | Ga0207693_10003565 | Ga0207693_100035653 | 152 |
| 862 | 3300025915 | Ga0207693_10018792 | Ga0207693_100187925 | 152 |
| 863 | 3300025915 | Ga0207693_10452898 | Ga0207693_104528982 | 152 |
| 864 | 3300025915 | Ga0207693_10651909 | Ga0207693_106519091 | 152 |
| 865 | 3300025915 | Ga0207693_11210892 | Ga0207693_112108921 | 152 |
| 866 | 3300025916 | Ga0207663_10007094 | Ga0207663_100070943 | 152 |
| 867 | 3300025916 | Ga0207663_10381228 | Ga0207663_103812282 | 152 |
| 868 | 3300025917 | Ga0207660_10028394 | Ga0207660_100283942 | 152 |
| 869 | 3300025917 | Ga0207660_10183140 | Ga0207660_101831402 | 152 |
| 870 | 3300025917 | Ga0207660_10193902 | Ga0207660_101939022 | 152 |
| 871 | 3300025919 | Ga0207657_10022825 | Ga0207657_100228252 | 152 |
| 872 | 3300025919 | Ga0207657_10296287 | Ga0207657_102962872 | 152 |
| 873 | 3300025919 | Ga0207657_10463485 | Ga0207657_104634852 | 152 |
| 874 | 3300025920 | Ga0207649_10058915 | Ga0207649_100589152 | 152 |
| 875 | 3300025921 | Ga0207652_10315648 | Ga0207652_103156482 | 152 |
| 876 | 3300025922 | Ga0207646_10116678 | Ga0207646_101166782 | 152 |
| 877 | 3300025922 | Ga0207646_10480907 | Ga0207646_104809072 | 152 |
| 878 | 3300025922 | Ga0207646_11341739 | Ga0207646_113417391 | 152 |
| 879 | 3300025922 | Ga0207646_11774333 | Ga0207646_117743331 | 152 |
| 880 | 3300025926 | Ga0207659_10350236 | Ga0207659_103502362 | 152 |
| 881 | 3300025927 | Ga0207687_10016945 | Ga0207687_100169454 | 152 |
| 882 | 3300025928 | Ga0207700_10205214 | Ga0207700_102052142 | 152 |
| 883 | 3300025928 | Ga0207700_11029053 | Ga0207700_110290532 | 152 |
| 884 | 3300025929 | Ga0207664_10178321 | Ga0207664_101783212 | 152 |
| 885 | 3300025929 | Ga0207664_10180407 | Ga0207664_101804072 | 152 |
| 886 | 3300025931 | Ga0207644_11057209 | Ga0207644_110572092 | 152 |
| 887 | 3300025932 | Ga0207690_10047168 | Ga0207690_100471682 | 152 |
| 888 | 3300025933 | Ga0207706_10390263 | Ga0207706_103902632 | 152 |
| 889 | 3300025934 | Ga0207686_10048195 | Ga0207686_100481953 | 152 |
| 890 | 3300025938 | Ga0207704_10004032 | Ga0207704_100040323 | 152 |
| 891 | 3300025940 | Ga0207691_10013728 | Ga0207691_100137282 | 152 |
| 892 | 3300025941 | Ga0207711_10096344 | Ga0207711_100963442 | 152 |
| 893 | 3300025941 | Ga0207711_11140097 | Ga0207711_111400972 | 152 |
| 894 | 3300025944 | Ga0207661_10209783 | Ga0207661_102097833 | 152 |
| 895 | 3300025949 | Ga0207667_10194294 | Ga0207667_101942943 | 152 |
| 896 | 3300025949 | Ga0207667_10239947 | Ga0207667_102399473 | 152 |
| 897 | 3300025949 | Ga0207667_10884102 | Ga0207667_108841022 | 152 |
| 898 | 3300025960 | Ga0207651_10159469 | Ga0207651_101594693 | 152 |
| 899 | 3300025961 | Ga0207712_10032434 | Ga0207712_100324343 | 152 |
| 900 | 3300025972 | Ga0207668_10197019 | Ga0207668_101970192 | 152 |
| 901 | 3300025981 | Ga0207640_11179175 | Ga0207640_111791751 | 152 |
| 902 | 3300026023 | Ga0207677_10094427 | Ga0207677_100944273 | 152 |
| 903 | 3300026035 | Ga0207703_10355749 | Ga0207703_103557492 | 152 |
| 904 | 3300026041 | Ga0207639_10068169 | Ga0207639_100681692 | 152 |
| 905 | 3300026067 | Ga0207678_10018270 | Ga0207678_100182702 | 152 |
| 906 | 3300026075 | Ga0207708_10022143 | Ga0207708_100221432 | 152 |
| 907 | 3300026089 | Ga0207648_10004050 | Ga0207648_1000405013 | 152 |
| 908 | 3300026095 | Ga0207676_10466005 | Ga0207676_104660052 | 152 |
| 909 | 3300026118 | Ga0207675_100138731 | Ga0207675_1001387313 | 152 |
| 910 | 3300026121 | Ga0207683_10002338 | Ga0207683_1000233811 | 152 |
| 911 | 3300026121 | Ga0207683_10703252 | Ga0207683_107032522 | 152 |
| 912 | 3300026142 | Ga0207698_10125784 | Ga0207698_101257842 | 152 |
| 913 | 3300026142 | Ga0207698_10457688 | Ga0207698_104576882 | 152 |
| 914 | 3300027907 | Ga0207428_10336607 | Ga0207428_103366072 | 152 |
| 915 | 3300028379 | Ga0268266_10815941 | Ga0268266_108159411 | 152 |
| 916 | 3300028563 | Ga0265319_1120671 | Ga0265319_11206712 | 152 |
| 917 | 3300028573 | Ga0265334_10033057 | Ga0265334_100330572 | 152 |
| 918 | 3300028577 | Ga0265318_10025573 | Ga0265318_100255732 | 152 |
| 919 | 3300031344 | Ga0265316_10181661 | Ga0265316_101816612 | 152 |
| 920 | 3300031548 | Ga0307408_100533329 | Ga0307408_1005333292 | 152 |
| 921 | 3300032002 | Ga0307416_100222007 | Ga0307416_1002220074 | 152 |
| 922 | 3300032002 | Ga0307416_101218764 | Ga0307416_1012187642 | 152 |
| 923 | 3300034820 | Ga0373959_0019332 | Ga0373959_0019332_769_1227 | 152 |
| 924 | 3300035207 | Ga0373942_0049779 | Ga0373942_0049779_345_803 | 152 |
| 925 | 3300037068 | Ga0373925_0744518 | Ga0373925_0744518_274_738 | 152 |
| 926 | 3300037312 | Ga0395899_0035364 | Ga0395899_0035364_255_722 | 152 |
| 927 | 3300037312 | Ga0395899_0090882 | Ga0395899_0090882_141_599 | 152 |
| 928 | 3300037312 | Ga0395899_0091878 | Ga0395899_0091878_37_498 | 152 |
| 929 | 3300037312 | Ga0395899_0146113 | Ga0395899_0146113_435_893 | 152 |
| 930 | 3300037312 | Ga0395899_0948472 | Ga0395899_0948472_25_483 | 152 |
| 931 | 3300037418 | Ga0395900_0015897 | Ga0395900_0015897_1089_1547 | 152 |
| 932 | 3300037418 | Ga0395900_0028300 | Ga0395900_0028300_4120_4578 | 152 |
| 933 | 3300037418 | Ga0395900_0029582 | Ga0395900_0029582_2319_2780 | 152 |
| 934 | 3300037418 | Ga0395900_0086108 | Ga0395900_0086108_993_1451 | 152 |
| 935 | 3300037418 | Ga0395900_0109879 | Ga0395900_0109879_1317_1775 | 152 |
| 936 | 3300037418 | Ga0395900_0116756 | Ga0395900_0116756_1407_1874 | 152 |
| 937 | 3300037418 | Ga0395900_0172876 | Ga0395900_0172876_1529_1996 | 152 |
| 938 | 3300037418 | Ga0395900_0201725 | Ga0395900_0201725_32_490 | 152 |
| 939 | 3300037418 | Ga0395900_0315526 | Ga0395900_0315526_678_1136 | 152 |
| 940 | 3300037466 | Ga0395898_0006542 | Ga0395898_0006542_7423_7881 | 152 |
| 941 | 3300037466 | Ga0395898_0053413 | Ga0395898_0053413_1407_1868 | 152 |
| 942 | 3300037466 | Ga0395898_0076712 | Ga0395898_0076712_1591_2049 | 152 |
| 943 | 3300037466 | Ga0395898_0155740 | Ga0395898_0155740_1698_2165 | 152 |
| 944 | 3300037466 | Ga0395898_0171390 | Ga0395898_0171390_186_644 | 152 |
| 945 | 3300037466 | Ga0395898_0196487 | Ga0395898_0196487_512_979 | 152 |
| 946 | 3300037466 | Ga0395898_0832280 | Ga0395898_0832280_53_520 | 152 |
| 947 | 3300037466 | Ga0395898_1158190 | Ga0395898_1158190_182_640 | 152 |
| 948 | 3300037471 | Ga0395905_0010082 | Ga0395905_0010082_6430_6891 | 152 |
| 949 | 3300037471 | Ga0395905_0079795 | Ga0395905_0079795_1641_2108 | 152 |
| 950 | 3300037471 | Ga0395905_0103737 | Ga0395905_0103737_948_1406 | 152 |
| 951 | 3300037471 | Ga0395905_0108622 | Ga0395905_0108622_1883_2350 | 152 |
| 952 | 3300037471 | Ga0395905_0491894 | Ga0395905_0491894_624_1082 | 152 |
| 953 | 3300038443 | Ga0395901_0016661 | Ga0395901_0016661_4875_5333 | 152 |
| 954 | 3300038443 | Ga0395901_0017935 | Ga0395901_0017935_2972_3430 | 152 |
| 955 | 3300038443 | Ga0395901_0018242 | Ga0395901_0018242_4657_5115 | 152 |
| 956 | 3300038443 | Ga0395901_0052058 | Ga0395901_0052058_1655_2113 | 152 |
| 957 | 3300038443 | Ga0395901_0115220 | Ga0395901_0115220_26_484 | 152 |
| 958 | 3300038443 | Ga0395901_0168721 | Ga0395901_0168721_450_908 | 152 |
| 959 | 3300038443 | Ga0395901_0408991 | Ga0395901_0408991_534_992 | 152 |
| 960 | 3300038443 | Ga0395901_0745974 | Ga0395901_0745974_37_498 | 152 |
| 961 | 3300038443 | Ga0395901_0817566 | Ga0395901_0817566_21_488 | 152 |
| 962 | 3300039438 | Ga0436360_0506477 | Ga0436360_0506477_4078_4542 | 152 |
| 963 | 3300039438 | Ga0436360_0511686 | Ga0436360_0511686_122_580 | 152 |
| 964 | 3300039453 | Ga0436362_0327669 | Ga0436362_0327669_691_1155 | 152 |
| 965 | 3300042145 | Ga0450906_055882 | Ga0450906_055882_179_640 | 152 |
| 966 | 3300042156 | Ga0439446_0361271 | Ga0439446_0361271_19_483 | 152 |
| 967 | 3300042184 | Ga0450908_042915 | Ga0450908_042915_240_701 | 152 |
| 968 | 3300044684 | Ga0466966_0013321 | Ga0466966_0013321_4446_4904 | 152 |
| 969 | 3300044684 | Ga0466966_0055786 | Ga0466966_0055786_1444_1905 | 152 |
| 970 | 3300044684 | Ga0466966_0103961 | Ga0466966_0103961_367_825 | 152 |
| 971 | 3300044684 | Ga0466966_0296909 | Ga0466966_0296909_214_672 | 152 |
| 972 | 3300044693 | Ga0466961_0001805 | Ga0466961_0001805_385_843 | 152 |
| 973 | 3300044694 | Ga0466963_0041038 | Ga0466963_0041038_1471_1929 | 152 |
| 974 | 3300044706 | Ga0466964_0003275 | Ga0466964_0003275_5164_5622 | 152 |
| 975 | 3300044706 | Ga0466964_0004021 | Ga0466964_0004021_3947_4405 | 152 |
| 976 | 3300044706 | Ga0466964_0125030 | Ga0466964_0125030_333_791 | 152 |
| 977 | 3300044719 | Ga0466971_0026732 | Ga0466971_0026732_39_497 | 152 |
| 978 | 3300044735 | Ga0466968_0026293 | Ga0466968_0026293_613_1071 | 152 |
| 979 | 3300044735 | Ga0466968_0265340 | Ga0466968_0265340_62_520 | 152 |
| 980 | 3300044842 | Ga0466957_0045276 | Ga0466957_0045276_1520_1978 | 152 |
| 981 | 3300044842 | Ga0466957_0102563 | Ga0466957_0102563_952_1410 | 152 |
| 982 | 3300044842 | Ga0466957_0199451 | Ga0466957_0199451_801_1259 | 152 |
| 983 | 3300044901 | Ga0466960_0026703 | Ga0466960_0026703_366_824 | 152 |
| 984 | 3300045049 | Ga0466959_0059584 | Ga0466959_0059584_1489_1947 | 152 |
| 985 | 3300045049 | Ga0466959_0138653 | Ga0466959_0138653_825_1283 | 152 |
| 986 | 3300045836 | Ga0466958_0007711 | Ga0466958_0007711_3545_4003 | 152 |
| 987 | 3300045836 | Ga0466958_0066985 | Ga0466958_0066985_1337_1795 | 152 |
| 988 | 3300045836 | Ga0466958_0220499 | Ga0466958_0220499_152_610 | 152 |
| 989 | 3300045836 | Ga0466958_0853854 | Ga0466958_0853854_91_549 | 152 |
| 990 | 3300045976 | Ga0466967_0025617 | Ga0466967_0025617_4309_4767 | 152 |
| 991 | 3300045976 | Ga0466967_0084997 | Ga0466967_0084997_519_977 | 152 |
| 992 | 3300045976 | Ga0466967_0087121 | Ga0466967_0087121_515_973 | 152 |
| 993 | 3300045976 | Ga0466967_0094124 | Ga0466967_0094124_2084_2542 | 152 |
| 994 | 3300045976 | Ga0466967_0115898 | Ga0466967_0115898_1886_2344 | 152 |
| 995 | 3300045976 | Ga0466967_0160751 | Ga0466967_0160751_868_1338 | 152 |
| 996 | 3300045976 | Ga0466967_0179667 | Ga0466967_0179667_302_760 | 152 |
| 997 | 3300045976 | Ga0466967_0213864 | Ga0466967_0213864_539_997 | 152 |
| 998 | 3300046477 | Ga0495664_0496142 | Ga0495664_0496142_25_483 | 152 |
| 999 | 3300046491 | Ga0495584_0084022 | Ga0495584_0084022_696_1154 | 152 |
| 1000 | 3300046491 | Ga0495584_0105889 | Ga0495584_0105889_358_825 | 152 |
| 1001 | 3300046500 | Ga0495596_0105199 | Ga0495596_0105199_312_770 | 152 |
| 1002 | 3300046501 | Ga0495607_0099382 | Ga0495607_0099382_1062_1520 | 152 |
| 1003 | 3300046513 | Ga0495616_0088845 | Ga0495616_0088845_480_938 | 152 |
| 1004 | 3300046526 | Ga0495666_0100536 | Ga0495666_0100536_193_651 | 152 |
| 1005 | 3300046529 | Ga0495652_0402912 | Ga0495652_0402912_21_479 | 152 |
| 1006 | 3300046559 | Ga0495667_0502674 | Ga0495667_0502674_190_648 | 152 |
| 1007 | 3300046615 | Ga0495656_0036803 | Ga0495656_0036803_686_1144 | 152 |
| 1008 | 3300046675 | Ga0495657_0038175 | Ga0495657_0038175_2270_2728 | 152 |
| 1009 | 3300046794 | Ga0495589_0107891 | Ga0495589_0107891_480_938 | 152 |
| 1010 | 3300047317 | Ga0495604_0163609 | Ga0495604_0163609_250_708 | 152 |
| 1011 | 3300047319 | Ga0495674_0046005 | Ga0495674_0046005_2697_3155 | 152 |
| 1012 | 3300047322 | Ga0495680_0095433 | Ga0495680_0095433_1267_1725 | 152 |
| 1013 | 3300048088 | Ga0495602_0087030 | Ga0495602_0087030_1249_1707 | 152 |
| 1014 | 3300048089 | Ga0495614_0197046 | Ga0495614_0197046_16_474 | 152 |
| 1015 | 3300048903 | Ga0496100_0008217 | Ga0496100_0008217_3460_3918 | 152 |
| 1016 | 3300048903 | Ga0496100_0082161 | Ga0496100_0082161_577_1035 | 152 |
| 1017 | 3300048903 | Ga0496100_0426778 | Ga0496100_0426778_264_722 | 152 |
| 1018 | 3300048904 | Ga0496101_0001675 | Ga0496101_0001675_10673_11131 | 152 |
| 1019 | 3300048904 | Ga0496101_0159668 | Ga0496101_0159668_752_1210 | 152 |
| 1020 | 3300048905 | Ga0496102_0040337 | Ga0496102_0040337_2773_3231 | 152 |
| 1021 | 3300048905 | Ga0496102_0066040 | Ga0496102_0066040_716_1174 | 152 |
| 1022 | 3300048905 | Ga0496102_0525111 | Ga0496102_0525111_253_711 | 152 |
| 1023 | 3300048906 | Ga0496103_0011909 | Ga0496103_0011909_3539_3997 | 152 |
| 1024 | 3300048906 | Ga0496103_0244348 | Ga0496103_0244348_474_932 | 152 |
| 1025 | 3300048907 | Ga0496104_0143093 | Ga0496104_0143093_790_1248 | 152 |
| 1026 | 3300048907 | Ga0496104_0903148 | Ga0496104_0903148_127_585 | 152 |
| 1027 | 3300048908 | Ga0496105_0072352 | Ga0496105_0072352_765_1223 | 152 |
| 1028 | 3300048908 | Ga0496105_0129599 | Ga0496105_0129599_442_900 | 152 |
| 1029 | 3300048908 | Ga0496105_0695540 | Ga0496105_0695540_216_674 | 152 |
| 1030 | 3300048909 | Ga0496106_0309841 | Ga0496106_0309841_693_1151 | 152 |
| 1031 | 3300048910 | Ga0496107_0033042 | Ga0496107_0033042_2416_2874 | 152 |
| 1032 | 3300048910 | Ga0496107_0233644 | Ga0496107_0233644_574_1032 | 152 |
| 1033 | 3300048910 | Ga0496107_0235471 | Ga0496107_0235471_280_738 | 152 |
| 1034 | 3300048911 | Ga0496108_0129163 | Ga0496108_0129163_576_1034 | 152 |
| 1035 | 3300048912 | Ga0496109_0078645 | Ga0496109_0078645_102_560 | 152 |
| 1036 | 3300048912 | Ga0496109_0187673 | Ga0496109_0187673_256_714 | 152 |
| 1037 | 3300048912 | Ga0496109_0213280 | Ga0496109_0213280_100_558 | 152 |
| 1038 | 3300048913 | Ga0496110_0198647 | Ga0496110_0198647_1133_1591 | 152 |
| 1039 | 3300048913 | Ga0496110_1237352 | Ga0496110_1237352_20_478 | 152 |
| 1040 | 3300048914 | Ga0496111_0067212 | Ga0496111_0067212_1506_1964 | 152 |
| 1041 | 3300048915 | Ga0496112_0012008 | Ga0496112_0012008_3939_4397 | 152 |
| 1042 | 3300048915 | Ga0496112_0027889 | Ga0496112_0027889_2806_3264 | 152 |
| 1043 | 3300048915 | Ga0496112_0175579 | Ga0496112_0175579_38_496 | 152 |
| 1044 | 3300048916 | Ga0496113_0335155 | Ga0496113_0335155_233_691 | 152 |
| 1045 | 3300048917 | Ga0496114_0002188 | Ga0496114_0002188_5360_5818 | 152 |
| 1046 | 3300048917 | Ga0496114_0055144 | Ga0496114_0055144_1400_1858 | 152 |
| 1047 | 3300048917 | Ga0496114_0354314 | Ga0496114_0354314_535_993 | 152 |
| 1048 | 3300048917 | Ga0496114_0584784 | Ga0496114_0584784_175_639 | 152 |
| 1049 | 3300048918 | Ga0496115_0027454 | Ga0496115_0027454_1052_1510 | 152 |
| 1050 | 3300049568 | Ga0501031_0005532 | Ga0501031_0005532_7648_8106 | 152 |
| 1051 | 3300049569 | Ga0501032_0063899 | Ga0501032_0063899_238_696 | 152 |
| 1052 | 3300049570 | Ga0501033_0002824 | Ga0501033_0002824_8803_9261 | 152 |
| 1053 | 3300049572 | Ga0501036_0075063 | Ga0501036_0075063_495_953 | 152 |
| 1054 | 3300049573 | Ga0501037_0000851 | Ga0501037_0000851_11815_12273 | 152 |
| 1055 | 3300049574 | Ga0501038_0000817 | Ga0501038_0000817_21405_21863 | 152 |
| 1056 | 3300049575 | Ga0501039_0018588 | Ga0501039_0018588_4159_4617 | 152 |
| 1057 | 3300049576 | Ga0501040_0166336 | Ga0501040_0166336_608_1066 | 152 |
| 1058 | 3300049577 | Ga0501041_0001581 | Ga0501041_0001581_3291_3749 | 152 |
| 1059 | 3300049578 | Ga0501042_0282203 | Ga0501042_0282203_247_705 | 152 |
| 1060 | 3300049579 | Ga0501043_0016623 | Ga0501043_0016623_5264_5722 | 152 |
| 1061 | 3300049580 | Ga0501046_0017207 | Ga0501046_0017207_5080_5538 | 152 |
| 1062 | 3300049581 | Ga0501047_0269834 | Ga0501047_0269834_167_625 | 152 |
| 1063 | 3300049581 | Ga0501047_0503782 | Ga0501047_0503782_162_620 | 152 |
| 1064 | 3300049582 | Ga0501048_0092101 | Ga0501048_0092101_119_577 | 152 |
| 1065 | 3300049584 | Ga0501068_0037044 | Ga0501068_0037044_239_697 | 152 |
| 1066 | 3300049585 | Ga0501069_0008732 | Ga0501069_0008732_3585_4043 | 152 |
| 1067 | 3300049585 | Ga0501069_0045665 | Ga0501069_0045665_1656_2114 | 152 |
| 1068 | 3300049585 | Ga0501069_0136062 | Ga0501069_0136062_512_970 | 152 |
| 1069 | 3300049585 | Ga0501069_0264669 | Ga0501069_0264669_236_694 | 152 |
| 1070 | 3300049586 | Ga0501070_0000243 | Ga0501070_0000243_17968_18426 | 152 |
| 1071 | 3300049586 | Ga0501070_0029959 | Ga0501070_0029959_1770_2228 | 152 |
| 1072 | 3300049586 | Ga0501070_0040388 | Ga0501070_0040388_2744_3202 | 152 |
| 1073 | 3300049586 | Ga0501070_0478804 | Ga0501070_0478804_515_973 | 152 |
| 1074 | 3300049587 | Ga0501071_0340956 | Ga0501071_0340956_74_532 | 152 |
| 1075 | 3300049588 | Ga0501072_0116752 | Ga0501072_0116752_1421_1879 | 152 |
| 1076 | 3300049589 | Ga0501073_0004374 | Ga0501073_0004374_263_721 | 152 |
| 1077 | 3300049590 | Ga0501074_0040111 | Ga0501074_0040111_1479_1937 | 152 |
| 1078 | 3300049590 | Ga0501074_0165560 | Ga0501074_0165560_515_973 | 152 |
| 1079 | 3300049590 | Ga0501074_1137081 | Ga0501074_1137081_20_478 | 152 |
| 1080 | 3300049591 | Ga0501075_0028059 | Ga0501075_0028059_3585_4043 | 152 |
| 1081 | 3300049592 | Ga0501076_0099117 | Ga0501076_0099117_110_568 | 152 |
| 1082 | 3300049593 | Ga0501077_0002523 | Ga0501077_0002523_8724_9182 | 152 |
| 1083 | 3300049593 | Ga0501077_0014680 | Ga0501077_0014680_79_543 | 152 |
| 1084 | 3300049741 | Ga0501079_0178252 | Ga0501079_0178252_895_1359 | 152 |
| 1085 | 3300049741 | Ga0501079_0179793 | Ga0501079_0179793_259_717 | 152 |
| 1086 | 3300049741 | Ga0501079_0929063 | Ga0501079_0929063_81_539 | 152 |
| 1087 | 3300049742 | Ga0501080_0001996 | Ga0501080_0001996_11477_11935 | 152 |
| 1088 | 3300049742 | Ga0501080_0153899 | Ga0501080_0153899_177_635 | 152 |
| 1089 | 3300049742 | Ga0501080_0222874 | Ga0501080_0222874_577_1035 | 152 |
| 1090 | 3300049742 | Ga0501080_0400347 | Ga0501080_0400347_242_700 | 152 |
| 1091 | 3300049744 | Ga0501083_0083099 | Ga0501083_0083099_735_1193 | 152 |
| 1092 | 3300049822 | Ga0501035_0002330 | Ga0501035_0002330_9329_9787 | 152 |
| 1093 | 3300049823 | Ga0501044_0103343 | Ga0501044_0103343_1593_2051 | 152 |
| 1094 | 3300049824 | Ga0501045_0168652 | Ga0501045_0168652_934_1392 | 152 |
| 1095 | 3300050507 | nmdc:mga05p37_374784_c1 | nmdc:mga05p37_374784_c1_978_1436 | 152 |
| 1096 | 3300050511 | nmdc:mga08y16_325712_c1 | nmdc:mga08y16_325712_c1_828_1286 | 152 |
| 1097 | 3300050511 | nmdc:mga08y16_95124_c1 | nmdc:mga08y16_95124_c1_1674_2132 | 152 |
| 1098 | 3300050512 | nmdc:mga0n895_2045985_c1 | nmdc:mga0n895_2045985_c1_15_473 | 152 |
| 1099 | 3300050512 | nmdc:mga0n895_304032_c1 | nmdc:mga0n895_304032_c1_130_591 | 152 |
| 1100 | 3300050512 | nmdc:mga0n895_58476_c1 | nmdc:mga0n895_58476_c1_3080_3538 | 152 |
| 1101 | 3300050513 | nmdc:mga0rr50_10287_c1 | nmdc:mga0rr50_10287_c1_5089_5547 | 152 |
| 1102 | 3300050513 | nmdc:mga0rr50_214893_c1 | nmdc:mga0rr50_214893_c1_783_1244 | 152 |
| 1103 | 3300053077 | Ga0495601_0392264 | Ga0495601_0392264_363_821 | 152 |
| 1104 | 3300053083 | Ga0495655_0017692 | Ga0495655_0017692_844_1302 | 152 |
| 1105 | 3300053085 | Ga0495619_0664531 | Ga0495619_0664531_219_677 | 152 |
| 1106 | 3300054114 | Ga0501084_0761815 | Ga0501084_0761815_239_697 | 152 |
| 1107 | 3300060353 | Ga0501082_0375404 | Ga0501082_0375404_736_1194 | 152 |
| 1108 | 3300061719 | Ga0466962_0188099 | Ga0466962_0188099_508_966 | 152 |
| 1109 | 3300061734 | Ga0530510_0135001 | Ga0530510_0135001_658_1116 | 152 |
| 1110 | 3300061734 | Ga0530510_0248814 | Ga0530510_0248814_259_717 | 152 |
| 1111 | 3300061734 | Ga0530510_0313558 | Ga0530510_0313558_443_901 | 152 |
| 1112 | 3300061734 | Ga0530510_1367719 | Ga0530510_1367719_29_493 | 152 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4zoh-assembly1.cif.gz_C-2 | crystal structure of glyceraldehyde oxidoreductase | 0.9725 | 1 | 151 |
| 1n5w-assembly1.cif.gz_D | crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form | 0.9649 | 1 | 151 |
| 1ffv-assembly1.cif.gz_A | carbon monoxide dehydrogenase from hydrogenophaga pseudoflava | 0.9633 | 1 | 151 |
| 1t3q-assembly1.cif.gz_D | crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 | 0.958 | 1 | 150 |
| 4zoh-assembly1.cif.gz_C-2 | crystal structure of glyceraldehyde oxidoreductase | 0.9538 | 1 | 151 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q46801_1_79_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9833 | 1 | 73 | 3.10.20.30 |
| 5y6qA01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9752 | 1 | 75 | 3.10.20.30 |
| 1n5wA01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9705 | 1 | 75 | 3.10.20.30 |
| 1sb3C02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.9587 | 78 | 151 | 1.10.150.120 |
| 1sb3F01 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9568 | 1 | 75 | 3.10.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F2XY32-F1-model_v4 | (2Fe-2S)-binding protein | 0.9875 | 1 | 150 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A538BUE3-F1-model_v4 | (2Fe-2S)-binding protein | 0.9861 | 1 | 151 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A536R2F2-F1-model_v4 | (2Fe-2S)-binding protein | 0.9824 | 1 | 150 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A535DQ93-F1-model_v4 | (2Fe-2S)-binding protein | 0.9818 | 1 | 151 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A2V6YN69-F1-model_v4 | Ferredoxin | 0.9815 | 1 | 151 |
GO:0016903
GO:0046872 GO:0051537 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar