F490261
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1113 | 432 | 2226 | 306 |
Family's Representative Sequence
| Representative Sequence | 3300005456|Ga0070678_100004479|Ga0070678_1000044797 |
| Length | 369 |
| Sequence | VRDRVSAFGGAKTEGRDDCKRPAPVIDAIASILVNADFWSAVLRIATPLVFGTLGVLLCERAGVLNLGIEGIMVAGALAGWLVVYLGAGLWIGVLAAAATGAVFGLLHGFLTVPLALSQHVAGLGITLFATSVSYFAYRVSFPSVTSPPTITPFVEMRWLSLPVLAAQTPLTLAALLLVPLVGWFLYRTPAGLAVRMVGENPAAAEGQGLDVHRVRMAAIVAGSALMGVAGAFLTLSAFNAFFFNMVNGRGWICVALVVFAGWRPGKALAGALLFAFFDAMQLRMQQAGDSGLPYQVWLMVPYLLSILALIAVARRAAYPQALMKPYVKGERLETTGPATRTRPFSAPYLPMRDCAASVIVASASSSTI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 4 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 5 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 6 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 7 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 8 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 9 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 10 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 11 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 12 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 13 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 14 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 15 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 21 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 24 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 26 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 27 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 29 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 36 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 39 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 49 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 58 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 62 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 67 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 69 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 70 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 71 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 72 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 73 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 74 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 75 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 76 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 77 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 78 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 79 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 80 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 81 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 82 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 83 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 84 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 85 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 86 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 87 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 88 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 89 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 90 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 92 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 93 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 94 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 95 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 96 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 97 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 98 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 100 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 101 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 125 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 129 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 130 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 131 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 133 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 138 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 139 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 141 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 144 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 146 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 152 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 207 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 211 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 217 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 218 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 219 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 220 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 221 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 222 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 223 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 224 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 225 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 226 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 227 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 228 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 229 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 230 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 231 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 232 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 233 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 234 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 235 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 236 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 237 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 238 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 239 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 240 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 241 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 242 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 243 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 244 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 245 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 246 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 247 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 248 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 249 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 250 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 251 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 252 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 253 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 254 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 255 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 256 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 257 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 258 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 259 | 3300042123 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 | Metagenome | Rhizosphere |
| 260 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 261 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 262 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 263 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 264 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 265 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 266 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 267 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 302 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 303 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 304 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 305 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 306 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 307 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 308 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 309 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 310 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 311 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 312 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 313 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 314 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 315 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 316 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 317 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 318 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 319 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 320 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 321 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 322 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 323 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 324 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 325 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 326 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 327 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 328 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 329 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 330 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 337 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 338 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 340 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 341 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 342 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 343 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 344 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 345 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 346 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 347 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 348 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 349 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 350 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 351 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 352 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 353 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 354 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 355 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 356 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 357 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 358 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 359 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 360 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 361 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 362 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 363 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 364 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 365 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 366 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 367 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 368 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 369 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 370 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 371 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 372 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 373 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 374 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 375 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 376 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 377 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 378 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 379 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 380 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 381 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 382 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 383 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 384 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 385 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 386 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 387 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 388 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 389 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 390 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 391 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 392 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 393 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 394 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 395 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 396 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 397 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 398 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 399 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 400 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 401 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 402 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 403 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 404 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 405 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 406 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 407 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 408 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 409 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 410 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 411 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 412 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 413 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 414 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 415 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 416 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 417 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 418 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 419 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 420 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 421 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 422 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 423 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 424 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 425 | 2941479691 | |||
| 426 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 427 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 428 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 429 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 430 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 431 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 432 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.17 |
| Metatranscriptomes | 0 |
| Isolates | 6.83 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 20.04 |
| Nodule | 0.9 |
| Rhizoplane | 2.34 |
| Rhizosphere | 63.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.27 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070678_100004479 | 3300005456 | Bacteria | 7927 |
| 2 | SwRhRL2b_contig_2666113 | 2162886007 | Bacteria | 1415 |
| 3 | JGI24749J21850_1004017 | 3300002076 | Bacteria | 2052 |
| 4 | JGI25155J39150_1000002 | 3300002704 | Bacteria | 292156 |
| 5 | JGI25156J39149_1000003 | 3300002705 | Bacteria | 305434 |
| 6 | JGI25154J39366_1000009 | 3300002738 | Bacteria | 305408 |
| 7 | JGI25157J39369_1000002 | 3300002741 | Bacteria | 305434 |
| 8 | JGI25152J39213_1001234 | 3300002773 | Bacteria | 11687 |
| 9 | JGI25150J39212_1000784 | 3300002774 | Bacteria | 10872 |
| 10 | JGI25159J45721_1000148 | 3300002987 | Bacteria | 32592 |
| 11 | JGI25159J45721_1001075 | 3300002987 | Bacteria | 11677 |
| 12 | JGI25159J45721_1023052 | 3300002987 | Bacteria | 1138 |
| 13 | JGI25151J46595_10001070 | 3300003187 | Bacteria | 20411 |
| 14 | JGI25151J46595_10002632 | 3300003187 | Bacteria | 10571 |
| 15 | JGI25151J46595_10011867 | 3300003187 | Bacteria | 3989 |
| 16 | JGI25151J46595_10024513 | 3300003187 | Bacteria | 2467 |
| 17 | JGI25151J46595_10043128 | 3300003187 | Bacteria | 1618 |
| 18 | JGI25153J46596_10001727 | 3300003215 | Bacteria | 12962 |
| 19 | JGI25153J46596_10001768 | 3300003215 | Bacteria | 12822 |
| 20 | JGI25160J50197_1000123 | 3300003354 | Bacteria | 70031 |
| 21 | JGI25160J50197_1009409 | 3300003354 | Bacteria | 3626 |
| 22 | JGI25161J50226_1000032 | 3300003374 | Bacteria | 138440 |
| 23 | JGI25161J50226_1001050 | 3300003374 | Bacteria | 9462 |
| 24 | Ga0055542_1000021 | 3300003762 | Bacteria | 331499 |
| 25 | Ga0055526_1001458 | 3300003771 | Bacteria | 16782 |
| 26 | Ga0055526_1002300 | 3300003771 | Bacteria | 13035 |
| 27 | Ga0055526_1002744 | 3300003771 | Bacteria | 11681 |
| 28 | Ga0055526_1003550 | 3300003771 | Bacteria | 9828 |
| 29 | Ga0055526_1003943 | 3300003771 | Bacteria | 9161 |
| 30 | Ga0055526_1007340 | 3300003771 | Bacteria | 5757 |
| 31 | Ga0055526_1010696 | 3300003771 | Bacteria | 4237 |
| 32 | Ga0055537_1000079 | 3300003773 | Bacteria | 69953 |
| 33 | Ga0055537_1003026 | 3300003773 | Bacteria | 5309 |
| 34 | Ga0055524_1000012 | 3300003775 | Bacteria | 260384 |
| 35 | Ga0055524_1000097 | 3300003775 | Bacteria | 108145 |
| 36 | Ga0055524_1000987 | 3300003775 | Bacteria | 17754 |
| 37 | Ga0055524_1001542 | 3300003775 | Bacteria | 13031 |
| 38 | Ga0055524_1001822 | 3300003775 | Bacteria | 11681 |
| 39 | Ga0055536_1000657 | 3300003781 | Bacteria | 23356 |
| 40 | Ga0055536_1000861 | 3300003781 | Bacteria | 19829 |
| 41 | Ga0055536_1001022 | 3300003781 | Bacteria | 17664 |
| 42 | Ga0055536_1001230 | 3300003781 | Bacteria | 15819 |
| 43 | Ga0055536_1005409 | 3300003781 | Bacteria | 6255 |
| 44 | Ga0055536_1008299 | 3300003781 | Bacteria | 4488 |
| 45 | Ga0055536_1009066 | 3300003781 | Bacteria | 4181 |
| 46 | Ga0055534_1000092 | 3300003784 | Bacteria | 70082 |
| 47 | Ga0055534_1001022 | 3300003784 | Bacteria | 12273 |
| 48 | Ga0055534_1001081 | 3300003784 | Bacteria | 11681 |
| 49 | Ga0055534_1001381 | 3300003784 | Bacteria | 9700 |
| 50 | Ga0055534_1004666 | 3300003784 | Bacteria | 3889 |
| 51 | Ga0055528_1000956 | 3300003790 | Bacteria | 19155 |
| 52 | Ga0055528_1002291 | 3300003790 | Bacteria | 10371 |
| 53 | Ga0055528_1009159 | 3300003790 | Bacteria | 4168 |
| 54 | Ga0055530_10000453 | 3300003791 | Bacteria | 36520 |
| 55 | Ga0055530_10000793 | 3300003791 | Bacteria | 26295 |
| 56 | Ga0055530_10017436 | 3300003791 | Bacteria | 2251 |
| 57 | Ga0055540_1000012 | 3300003792 | Bacteria | 262667 |
| 58 | Ga0055540_1001467 | 3300003792 | Bacteria | 14051 |
| 59 | Ga0055540_1002293 | 3300003792 | Bacteria | 10309 |
| 60 | Ga0055531_10000653 | 3300003794 | Bacteria | 29813 |
| 61 | Ga0055531_10001541 | 3300003794 | Bacteria | 16875 |
| 62 | Ga0055543_1000294 | 3300004625 | Bacteria | 35881 |
| 63 | Ga0055543_1000696 | 3300004625 | Bacteria | 17270 |
| 64 | Ga0065165_1002228 | 3300005262 | Bacteria | 17278 |
| 65 | Ga0065165_1012757 | 3300005262 | Bacteria | 3397 |
| 66 | Ga0065165_1012901 | 3300005262 | Bacteria | 3361 |
| 67 | Ga0065704_10011989 | 3300005289 | Bacteria | 2169 |
| 68 | Ga0065712_10148324 | 3300005290 | Bacteria | 1384 |
| 69 | Ga0065715_10125828 | 3300005293 | Bacteria | 2122 |
| 70 | Ga0065715_10129220 | 3300005293 | Bacteria | 2030 |
| 71 | Ga0070676_10014907 | 3300005328 | Bacteria | 4278 |
| 72 | Ga0070676_10035845 | 3300005328 | Bacteria | 2855 |
| 73 | Ga0070676_10079487 | 3300005328 | Bacteria | 1986 |
| 74 | Ga0070676_10283737 | 3300005328 | Bacteria | 1117 |
| 75 | Ga0070683_100023735 | 3300005329 | Bacteria | 5488 |
| 76 | Ga0070690_100003489 | 3300005330 | Bacteria | 8600 |
| 77 | Ga0070690_100056744 | 3300005330 | Bacteria | 2512 |
| 78 | Ga0070690_100110902 | 3300005330 | Bacteria | 1831 |
| 79 | Ga0070670_100001483 | 3300005331 | Bacteria | 18899 |
| 80 | Ga0070670_100002742 | 3300005331 | Bacteria | 14546 |
| 81 | Ga0070670_100007028 | 3300005331 | Bacteria | 9536 |
| 82 | Ga0070670_100008068 | 3300005331 | Bacteria | 8956 |
| 83 | Ga0070670_100037126 | 3300005331 | Bacteria | 4192 |
| 84 | Ga0070670_100066159 | 3300005331 | Bacteria | 3101 |
| 85 | Ga0070670_100084979 | 3300005331 | Bacteria | 2719 |
| 86 | Ga0070670_100113866 | 3300005331 | Bacteria | 2332 |
| 87 | Ga0070677_10002129 | 3300005333 | Bacteria | 6319 |
| 88 | Ga0070677_10022565 | 3300005333 | Bacteria | 2320 |
| 89 | Ga0070677_10030335 | 3300005333 | Bacteria | 2058 |
| 90 | Ga0070677_10040639 | 3300005333 | Bacteria | 1831 |
| 91 | Ga0070677_10080223 | 3300005333 | Bacteria | 1394 |
| 92 | Ga0070677_10083395 | 3300005333 | Bacteria | 1373 |
| 93 | Ga0068869_100000178 | 3300005334 | Bacteria | 32316 |
| 94 | Ga0068869_100009675 | 3300005334 | Bacteria | 6258 |
| 95 | Ga0068869_100042331 | 3300005334 | Bacteria | 3265 |
| 96 | Ga0068869_100091902 | 3300005334 | Bacteria | 2283 |
| 97 | Ga0070666_10014344 | 3300005335 | Bacteria | 5044 |
| 98 | Ga0070666_10025971 | 3300005335 | Bacteria | 3822 |
| 99 | Ga0070666_10074039 | 3300005335 | Bacteria | 2321 |
| 100 | Ga0070666_10088379 | 3300005335 | Bacteria | 2126 |
| 101 | Ga0070666_10276568 | 3300005335 | Bacteria | 1193 |
| 102 | Ga0070680_100143639 | 3300005336 | Bacteria | 2002 |
| 103 | Ga0068868_100005608 | 3300005338 | Bacteria | 8829 |
| 104 | Ga0068868_100068148 | 3300005338 | Bacteria | 2833 |
| 105 | Ga0068868_100092542 | 3300005338 | Bacteria | 2437 |
| 106 | Ga0070687_100006353 | 3300005343 | Bacteria | 4838 |
| 107 | Ga0070661_100003091 | 3300005344 | Bacteria | 11456 |
| 108 | Ga0070661_100014055 | 3300005344 | Bacteria | 5633 |
| 109 | Ga0070661_100090249 | 3300005344 | Bacteria | 2269 |
| 110 | Ga0070661_100431373 | 3300005344 | Bacteria | 1046 |
| 111 | Ga0070692_10049561 | 3300005345 | Bacteria | 2179 |
| 112 | Ga0070668_100004619 | 3300005347 | Bacteria | 10201 |
| 113 | Ga0070668_100034232 | 3300005347 | Bacteria | 3871 |
| 114 | Ga0070668_100053700 | 3300005347 | Bacteria | 3107 |
| 115 | Ga0070668_100065909 | 3300005347 | Bacteria | 2809 |
| 116 | Ga0070668_100078177 | 3300005347 | Bacteria | 2587 |
| 117 | Ga0070668_100103436 | 3300005347 | Bacteria | 2259 |
| 118 | Ga0070668_100177094 | 3300005347 | Bacteria | 1740 |
| 119 | Ga0070669_100008927 | 3300005353 | Bacteria | 7153 |
| 120 | Ga0070669_100015579 | 3300005353 | Bacteria | 5422 |
| 121 | Ga0070669_100018890 | 3300005353 | Bacteria | 4927 |
| 122 | Ga0070669_100065009 | 3300005353 | Bacteria | 2687 |
| 123 | Ga0070669_100098538 | 3300005353 | Bacteria | 2202 |
| 124 | Ga0070669_100113582 | 3300005353 | Bacteria | 2058 |
| 125 | Ga0070669_100178562 | 3300005353 | Bacteria | 1659 |
| 126 | Ga0070675_100001733 | 3300005354 | Bacteria | 16097 |
| 127 | Ga0070675_100014191 | 3300005354 | Bacteria | 6280 |
| 128 | Ga0070675_100020917 | 3300005354 | Bacteria | 5225 |
| 129 | Ga0070675_100033094 | 3300005354 | Bacteria | 4188 |
| 130 | Ga0070675_100080936 | 3300005354 | Bacteria | 2708 |
| 131 | Ga0070675_100364892 | 3300005354 | Bacteria | 1283 |
| 132 | Ga0070671_100004476 | 3300005355 | Bacteria | 11061 |
| 133 | Ga0070671_100015093 | 3300005355 | Bacteria | 6239 |
| 134 | Ga0070671_100020848 | 3300005355 | Bacteria | 5347 |
| 135 | Ga0070671_100025674 | 3300005355 | Bacteria | 4835 |
| 136 | Ga0070671_100063486 | 3300005355 | Bacteria | 3076 |
| 137 | Ga0070671_100269750 | 3300005355 | Bacteria | 1446 |
| 138 | Ga0070674_100024203 | 3300005356 | Bacteria | 3938 |
| 139 | Ga0070674_100036087 | 3300005356 | Bacteria | 3316 |
| 140 | Ga0070674_100047128 | 3300005356 | Bacteria | 2951 |
| 141 | Ga0070674_100056035 | 3300005356 | Bacteria | 2732 |
| 142 | Ga0070674_100075904 | 3300005356 | Bacteria | 2388 |
| 143 | Ga0070674_100139183 | 3300005356 | Bacteria | 1819 |
| 144 | Ga0070674_100152914 | 3300005356 | Bacteria | 1743 |
| 145 | Ga0070673_100009444 | 3300005364 | Bacteria | 6546 |
| 146 | Ga0070673_100017776 | 3300005364 | Bacteria | 5066 |
| 147 | Ga0070673_100056382 | 3300005364 | Bacteria | 3100 |
| 148 | Ga0070673_100205263 | 3300005364 | Bacteria | 1699 |
| 149 | Ga0070688_100009048 | 3300005365 | Bacteria | 5430 |
| 150 | Ga0070688_100025675 | 3300005365 | Bacteria | 3491 |
| 151 | Ga0070659_100017155 | 3300005366 | Bacteria | 5442 |
| 152 | Ga0070659_100332341 | 3300005366 | Bacteria | 1272 |
| 153 | Ga0070667_100001198 | 3300005367 | Bacteria | 23577 |
| 154 | Ga0070667_100018482 | 3300005367 | Bacteria | 5781 |
| 155 | Ga0070667_100023441 | 3300005367 | Bacteria | 5121 |
| 156 | Ga0070667_100120129 | 3300005367 | Bacteria | 2285 |
| 157 | Ga0070667_100223216 | 3300005367 | Bacteria | 1678 |
| 158 | Ga0070667_100255016 | 3300005367 | Bacteria | 1569 |
| 159 | Ga0070705_100318140 | 3300005440 | Bacteria | 1122 |
| 160 | Ga0070700_100004393 | 3300005441 | Bacteria | 7360 |
| 161 | Ga0070700_100103998 | 3300005441 | Bacteria | 1876 |
| 162 | Ga0070694_100150561 | 3300005444 | Bacteria | 1699 |
| 163 | Ga0070663_100027541 | 3300005455 | Bacteria | 3861 |
| 164 | Ga0070678_100013926 | 3300005456 | Bacteria | 5057 |
| 165 | Ga0070678_100016709 | 3300005456 | Bacteria | 4702 |
| 166 | Ga0070678_100040672 | 3300005456 | Bacteria | 3290 |
| 167 | Ga0070678_100061942 | 3300005456 | Bacteria | 2760 |
| 168 | Ga0070678_100283497 | 3300005456 | Bacteria | 1402 |
| 169 | Ga0070662_100003994 | 3300005457 | Bacteria | 9247 |
| 170 | Ga0070662_100005238 | 3300005457 | Bacteria | 8274 |
| 171 | Ga0070662_100013360 | 3300005457 | Bacteria | 5464 |
| 172 | Ga0070662_100116545 | 3300005457 | Bacteria | 2042 |
| 173 | Ga0070681_10097261 | 3300005458 | Bacteria | 2891 |
| 174 | Ga0068867_100000273 | 3300005459 | Bacteria | 33912 |
| 175 | Ga0068867_100005155 | 3300005459 | Bacteria | 9226 |
| 176 | Ga0068867_100031942 | 3300005459 | Bacteria | 3804 |
| 177 | Ga0068867_100061662 | 3300005459 | Bacteria | 2785 |
| 178 | Ga0068867_100091081 | 3300005459 | Bacteria | 2314 |
| 179 | Ga0068867_100201226 | 3300005459 | Bacteria | 1594 |
| 180 | Ga0068867_100261268 | 3300005459 | Bacteria | 1412 |
| 181 | Ga0070685_10078150 | 3300005466 | Bacteria | 1977 |
| 182 | Ga0070699_100413942 | 3300005518 | Bacteria | 1220 |
| 183 | Ga0070679_100329255 | 3300005530 | Bacteria | 1476 |
| 184 | Ga0068853_100014373 | 3300005539 | Bacteria | 6481 |
| 185 | Ga0070672_100004667 | 3300005543 | Bacteria | 8984 |
| 186 | Ga0070672_100027843 | 3300005543 | Bacteria | 4220 |
| 187 | Ga0070672_100047555 | 3300005543 | Bacteria | 3329 |
| 188 | Ga0070672_100049824 | 3300005543 | Bacteria | 3260 |
| 189 | Ga0070672_100065484 | 3300005543 | Bacteria | 2875 |
| 190 | Ga0070672_100281148 | 3300005543 | Bacteria | 1407 |
| 191 | Ga0070672_100310324 | 3300005543 | Bacteria | 1339 |
| 192 | Ga0070686_100051186 | 3300005544 | Bacteria | 2628 |
| 193 | Ga0070686_100124845 | 3300005544 | Bacteria | 1772 |
| 194 | Ga0070665_100001639 | 3300005548 | Bacteria | 25785 |
| 195 | Ga0070665_100035254 | 3300005548 | Bacteria | 5031 |
| 196 | Ga0070665_100088396 | 3300005548 | Bacteria | 3104 |
| 197 | Ga0070665_100148512 | 3300005548 | Bacteria | 2347 |
| 198 | Ga0070665_100351009 | 3300005548 | Bacteria | 1480 |
| 199 | Ga0070704_100186982 | 3300005549 | Bacteria | 1662 |
| 200 | Ga0068855_100031834 | 3300005563 | Bacteria | 6296 |
| 201 | Ga0068855_100046637 | 3300005563 | Bacteria | 5122 |
| 202 | Ga0068855_100051726 | 3300005563 | Bacteria | 4839 |
| 203 | Ga0070664_100004590 | 3300005564 | Bacteria | 11085 |
| 204 | Ga0070664_100005648 | 3300005564 | Bacteria | 10071 |
| 205 | Ga0070664_100013082 | 3300005564 | Bacteria | 6754 |
| 206 | Ga0070664_100023188 | 3300005564 | Bacteria | 5126 |
| 207 | Ga0070664_100106699 | 3300005564 | Bacteria | 2441 |
| 208 | Ga0070664_100112024 | 3300005564 | Bacteria | 2382 |
| 209 | Ga0070664_100172815 | 3300005564 | Bacteria | 1917 |
| 210 | Ga0070664_100176528 | 3300005564 | Bacteria | 1897 |
| 211 | Ga0070664_100413950 | 3300005564 | Bacteria | 1234 |
| 212 | Ga0068857_100001689 | 3300005577 | Bacteria | 17740 |
| 213 | Ga0068857_100074298 | 3300005577 | Bacteria | 3029 |
| 214 | Ga0068857_100088217 | 3300005577 | Bacteria | 2775 |
| 215 | Ga0068857_100202659 | 3300005577 | Bacteria | 1809 |
| 216 | Ga0068854_100013238 | 3300005578 | Bacteria | 5407 |
| 217 | Ga0068854_100023805 | 3300005578 | Bacteria | 4185 |
| 218 | Ga0068854_100541336 | 3300005578 | Bacteria | 986 |
| 219 | Ga0068856_100028024 | 3300005614 | Bacteria | 5496 |
| 220 | Ga0068856_100193519 | 3300005614 | Bacteria | 2048 |
| 221 | Ga0068856_100409959 | 3300005614 | Bacteria | 1375 |
| 222 | Ga0068852_100012178 | 3300005616 | Bacteria | 6516 |
| 223 | Ga0068852_100174244 | 3300005616 | Bacteria | 2019 |
| 224 | Ga0068852_100201849 | 3300005616 | Bacteria | 1882 |
| 225 | Ga0068852_100229881 | 3300005616 | Bacteria | 1767 |
| 226 | Ga0068852_100255704 | 3300005616 | Bacteria | 1680 |
| 227 | Ga0068852_100657862 | 3300005616 | Bacteria | 1056 |
| 228 | Ga0068859_100007644 | 3300005617 | Bacteria | 10984 |
| 229 | Ga0068859_100010715 | 3300005617 | Bacteria | 9227 |
| 230 | Ga0068859_100121908 | 3300005617 | Bacteria | 2674 |
| 231 | Ga0068859_100137430 | 3300005617 | Bacteria | 2517 |
| 232 | Ga0068859_100165593 | 3300005617 | Bacteria | 2291 |
| 233 | Ga0068859_100579609 | 3300005617 | Bacteria | 1215 |
| 234 | Ga0068864_100000199 | 3300005618 | Bacteria | 54129 |
| 235 | Ga0068864_100002200 | 3300005618 | Bacteria | 16087 |
| 236 | Ga0068864_100004274 | 3300005618 | Bacteria | 11747 |
| 237 | Ga0068864_100031330 | 3300005618 | Bacteria | 4512 |
| 238 | Ga0068864_100032954 | 3300005618 | Bacteria | 4403 |
| 239 | Ga0068864_100159549 | 3300005618 | Bacteria | 2049 |
| 240 | Ga0068864_100189564 | 3300005618 | Bacteria | 1884 |
| 241 | Ga0068864_100228543 | 3300005618 | Bacteria | 1720 |
| 242 | Ga0068864_100247873 | 3300005618 | Bacteria | 1652 |
| 243 | Ga0068866_10030595 | 3300005718 | Bacteria | 2586 |
| 244 | Ga0068866_10037416 | 3300005718 | Bacteria | 2383 |
| 245 | Ga0068861_100001618 | 3300005719 | Bacteria | 14363 |
| 246 | Ga0068861_100002547 | 3300005719 | Bacteria | 11913 |
| 247 | Ga0068861_100047800 | 3300005719 | Bacteria | 3232 |
| 248 | Ga0068861_100233701 | 3300005719 | Bacteria | 1560 |
| 249 | Ga0068851_10001589 | 3300005834 | Bacteria | 9966 |
| 250 | Ga0068851_10032507 | 3300005834 | Bacteria | 2596 |
| 251 | Ga0068851_10091791 | 3300005834 | Bacteria | 1599 |
| 252 | Ga0068870_10160924 | 3300005840 | Bacteria | 1331 |
| 253 | Ga0068863_100001289 | 3300005841 | Bacteria | 25007 |
| 254 | Ga0068863_100001708 | 3300005841 | Bacteria | 21723 |
| 255 | Ga0068863_100002680 | 3300005841 | Bacteria | 17598 |
| 256 | Ga0068863_100101116 | 3300005841 | Bacteria | 2740 |
| 257 | Ga0068863_100117284 | 3300005841 | Bacteria | 2537 |
| 258 | Ga0068863_100196470 | 3300005841 | Bacteria | 1939 |
| 259 | Ga0068863_100286672 | 3300005841 | Bacteria | 1596 |
| 260 | Ga0068863_100336087 | 3300005841 | Bacteria | 1469 |
| 261 | Ga0068858_100000413 | 3300005842 | Bacteria | 44413 |
| 262 | Ga0068858_100018789 | 3300005842 | Bacteria | 6466 |
| 263 | Ga0068858_100023951 | 3300005842 | Bacteria | 5688 |
| 264 | Ga0068858_100041553 | 3300005842 | Bacteria | 4262 |
| 265 | Ga0068858_100253568 | 3300005842 | Bacteria | 1672 |
| 266 | Ga0068860_100004285 | 3300005843 | Bacteria | 14582 |
| 267 | Ga0068860_100011743 | 3300005843 | Bacteria | 8631 |
| 268 | Ga0068860_100035293 | 3300005843 | Bacteria | 4797 |
| 269 | Ga0068860_100096647 | 3300005843 | Bacteria | 2816 |
| 270 | Ga0068860_100150843 | 3300005843 | Bacteria | 2238 |
| 271 | Ga0068860_100226399 | 3300005843 | Bacteria | 1816 |
| 272 | Ga0068860_100319082 | 3300005843 | Bacteria | 1525 |
| 273 | Ga0068862_100004502 | 3300005844 | Bacteria | 11751 |
| 274 | Ga0068862_100011044 | 3300005844 | Bacteria | 7459 |
| 275 | Ga0068862_100011483 | 3300005844 | Bacteria | 7312 |
| 276 | Ga0068862_100017703 | 3300005844 | Bacteria | 5931 |
| 277 | Ga0068862_100054515 | 3300005844 | Bacteria | 3423 |
| 278 | Ga0068862_100098560 | 3300005844 | Bacteria | 2553 |
| 279 | Ga0068862_100252081 | 3300005844 | Bacteria | 1609 |
| 280 | Ga0068862_100404321 | 3300005844 | Bacteria | 1278 |
| 281 | Ga0075365_10003595 | 3300006038 | Bacteria | 8023 |
| 282 | Ga0075365_10127344 | 3300006038 | Bacteria | 1760 |
| 283 | Ga0075368_10050796 | 3300006042 | Bacteria | 1648 |
| 284 | Ga0075363_100028997 | 3300006048 | Bacteria | 2853 |
| 285 | Ga0075364_10049617 | 3300006051 | Bacteria | 2738 |
| 286 | Ga0075362_10008388 | 3300006177 | Bacteria | 3949 |
| 287 | Ga0075362_10031282 | 3300006177 | Bacteria | 2302 |
| 288 | Ga0075362_10086289 | 3300006177 | Bacteria | 1452 |
| 289 | Ga0075362_10090512 | 3300006177 | Bacteria | 1420 |
| 290 | Ga0075367_10059581 | 3300006178 | Bacteria | 2273 |
| 291 | Ga0075367_10096874 | 3300006178 | Bacteria | 1799 |
| 292 | Ga0075369_10050690 | 3300006186 | Bacteria | 1796 |
| 293 | Ga0075369_10091043 | 3300006186 | Bacteria | 1361 |
| 294 | Ga0075366_10010337 | 3300006195 | Bacteria | 5239 |
| 295 | Ga0075366_10015004 | 3300006195 | Bacteria | 4430 |
| 296 | Ga0075366_10031279 | 3300006195 | Bacteria | 3131 |
| 297 | Ga0075366_10047615 | 3300006195 | Bacteria | 2542 |
| 298 | Ga0075366_10076667 | 3300006195 | Bacteria | 1995 |
| 299 | Ga0075366_10091349 | 3300006195 | Bacteria | 1824 |
| 300 | Ga0075366_10186449 | 3300006195 | Bacteria | 1260 |
| 301 | Ga0097621_100034225 | 3300006237 | Bacteria | 4052 |
| 302 | Ga0097621_100048219 | 3300006237 | Bacteria | 3455 |
| 303 | Ga0097621_100051615 | 3300006237 | Bacteria | 3347 |
| 304 | Ga0097621_100054844 | 3300006237 | Bacteria | 3253 |
| 305 | Ga0097621_100130979 | 3300006237 | Bacteria | 2135 |
| 306 | Ga0097621_100318597 | 3300006237 | Bacteria | 1377 |
| 307 | Ga0075370_10000555 | 3300006353 | Bacteria | 14308 |
| 308 | Ga0075370_10024221 | 3300006353 | Bacteria | 3351 |
| 309 | Ga0075370_10026443 | 3300006353 | Bacteria | 3215 |
| 310 | Ga0075370_10036658 | 3300006353 | Bacteria | 2755 |
| 311 | Ga0075370_10049636 | 3300006353 | Bacteria | 2379 |
| 312 | Ga0075370_10052918 | 3300006353 | Bacteria | 2304 |
| 313 | Ga0075370_10201756 | 3300006353 | Bacteria | 1173 |
| 314 | Ga0068871_100011783 | 3300006358 | Bacteria | 6425 |
| 315 | Ga0068871_100028695 | 3300006358 | Bacteria | 4366 |
| 316 | Ga0068871_100102571 | 3300006358 | Bacteria | 2398 |
| 317 | Ga0068871_100157237 | 3300006358 | Bacteria | 1942 |
| 318 | Ga0068871_100215272 | 3300006358 | Bacteria | 1663 |
| 319 | Ga0075428_100116147 | 3300006844 | Unclassified | 2915 |
| 320 | Ga0075428_100116379 | 3300006844 | Bacteria | 2912 |
| 321 | Ga0075430_100262382 | 3300006846 | Bacteria | 1431 |
| 322 | Ga0075434_100124212 | 3300006871 | Bacteria | 2597 |
| 323 | Ga0075429_100277178 | 3300006880 | Unclassified | 1468 |
| 324 | Ga0075429_100365368 | 3300006880 | Bacteria | 1264 |
| 325 | Ga0068865_100028724 | 3300006881 | Bacteria | 3683 |
| 326 | Ga0068865_100077194 | 3300006881 | Bacteria | 2380 |
| 327 | Ga0097620_100007644 | 3300006931 | Bacteria | 10984 |
| 328 | Ga0097620_100010715 | 3300006931 | Bacteria | 9227 |
| 329 | Ga0097620_100121912 | 3300006931 | Bacteria | 2674 |
| 330 | Ga0097620_100137423 | 3300006931 | Bacteria | 2517 |
| 331 | Ga0097620_100165591 | 3300006931 | Bacteria | 2291 |
| 332 | Ga0097620_100579591 | 3300006931 | Bacteria | 1215 |
| 333 | Ga0079104_1000019 | 3300006946 | Bacteria | 269313 |
| 334 | Ga0099826_10000027 | 3300006948 | Bacteria | 140533 |
| 335 | Ga0099826_10006221 | 3300006948 | Bacteria | 8671 |
| 336 | Ga0105244_10000965 | 3300009036 | Bacteria | 24157 |
| 337 | Ga0105240_10018468 | 3300009093 | Bacteria | 9363 |
| 338 | Ga0105240_10219187 | 3300009093 | Bacteria | 2218 |
| 339 | Ga0111539_10207790 | 3300009094 | Bacteria | 2282 |
| 340 | Ga0105245_10012088 | 3300009098 | Bacteria | 7507 |
| 341 | Ga0105245_10396835 | 3300009098 | Bacteria | 1377 |
| 342 | Ga0105247_10416447 | 3300009101 | Bacteria | 961 |
| 343 | Ga0114129_10032558 | 3300009147 | Bacteria | 7367 |
| 344 | Ga0114129_10457835 | 3300009147 | Bacteria | 1672 |
| 345 | Ga0105243_10001682 | 3300009148 | Bacteria | 19081 |
| 346 | Ga0105243_10004695 | 3300009148 | Bacteria | 10755 |
| 347 | Ga0105243_10043521 | 3300009148 | Bacteria | 3519 |
| 348 | Ga0105243_10141731 | 3300009148 | Bacteria | 2052 |
| 349 | Ga0105243_10145806 | 3300009148 | Bacteria | 2025 |
| 350 | Ga0105243_10147041 | 3300009148 | Bacteria | 2017 |
| 351 | Ga0105243_10281602 | 3300009148 | Bacteria | 1498 |
| 352 | Ga0105241_10190773 | 3300009174 | Bacteria | 1706 |
| 353 | Ga0105242_10019130 | 3300009176 | Bacteria | 5364 |
| 354 | Ga0105242_10026470 | 3300009176 | Bacteria | 4598 |
| 355 | Ga0105242_10122447 | 3300009176 | Bacteria | 2234 |
| 356 | Ga0105242_10571759 | 3300009176 | Bacteria | 1087 |
| 357 | Ga0105248_10003661 | 3300009177 | Bacteria | 17051 |
| 358 | Ga0105248_10006013 | 3300009177 | Bacteria | 13318 |
| 359 | Ga0105248_10074417 | 3300009177 | Bacteria | 3818 |
| 360 | Ga0105248_10152277 | 3300009177 | Bacteria | 2610 |
| 361 | Ga0105237_10001628 | 3300009545 | Bacteria | 29150 |
| 362 | Ga0105237_10097306 | 3300009545 | Bacteria | 2933 |
| 363 | Ga0105237_10106835 | 3300009545 | Bacteria | 2791 |
| 364 | Ga0105237_10295838 | 3300009545 | Bacteria | 1622 |
| 365 | Ga0105238_10093980 | 3300009551 | Bacteria | 2986 |
| 366 | Ga0105249_10029237 | 3300009553 | Bacteria | 4976 |
| 367 | Ga0105249_10099373 | 3300009553 | Bacteria | 2735 |
| 368 | Ga0105249_10203716 | 3300009553 | Bacteria | 1937 |
| 369 | Ga0105249_10269646 | 3300009553 | Bacteria | 1695 |
| 370 | Ga0105249_10296283 | 3300009553 | Bacteria | 1621 |
| 371 | Ga0105239_10001684 | 3300010375 | Bacteria | 29148 |
| 372 | Ga0105239_10605511 | 3300010375 | Bacteria | 1250 |
| 373 | Ga0105246_10107068 | 3300011119 | Bacteria | 2046 |
| 374 | Ga0157369_10016621 | 3300013105 | Bacteria | 8272 |
| 375 | Ga0157369_10181105 | 3300013105 | Bacteria | 2217 |
| 376 | Ga0157374_10010969 | 3300013296 | Bacteria | 7825 |
| 377 | Ga0157374_10294593 | 3300013296 | Bacteria | 1604 |
| 378 | Ga0157374_10297913 | 3300013296 | Bacteria | 1595 |
| 379 | Ga0157374_10497260 | 3300013296 | Bacteria | 1224 |
| 380 | Ga0157378_10004470 | 3300013297 | Bacteria | 12280 |
| 381 | Ga0157378_10039364 | 3300013297 | Bacteria | 4193 |
| 382 | Ga0157378_10081937 | 3300013297 | Bacteria | 2917 |
| 383 | Ga0157378_10193818 | 3300013297 | Bacteria | 1918 |
| 384 | Ga0163162_10008437 | 3300013306 | Bacteria | 10048 |
| 385 | Ga0163162_10045471 | 3300013306 | Bacteria | 4398 |
| 386 | Ga0163162_10106036 | 3300013306 | Bacteria | 2905 |
| 387 | Ga0163162_10141004 | 3300013306 | Bacteria | 2524 |
| 388 | Ga0163162_10682703 | 3300013306 | Bacteria | 1149 |
| 389 | Ga0157372_10076681 | 3300013307 | Bacteria | 3774 |
| 390 | Ga0157372_10204874 | 3300013307 | Bacteria | 2286 |
| 391 | Ga0157372_10225279 | 3300013307 | Unclassified | 2174 |
| 392 | Ga0157372_10757061 | 3300013307 | Bacteria | 1129 |
| 393 | Ga0157375_10032335 | 3300013308 | Bacteria | 4961 |
| 394 | Ga0157375_10050218 | 3300013308 | Bacteria | 4090 |
| 395 | Ga0157375_10067123 | 3300013308 | Bacteria | 3583 |
| 396 | Ga0157375_10094008 | 3300013308 | Bacteria | 3065 |
| 397 | Ga0157375_10234111 | 3300013308 | Bacteria | 1996 |
| 398 | Ga0157375_10250551 | 3300013308 | Bacteria | 1931 |
| 399 | Ga0157375_10305054 | 3300013308 | Bacteria | 1756 |
| 400 | Ga0157375_10492337 | 3300013308 | Bacteria | 1391 |
| 401 | Ga0163163_10001130 | 3300014325 | Bacteria | 22677 |
| 402 | Ga0163163_10009364 | 3300014325 | Bacteria | 8742 |
| 403 | Ga0163163_10073498 | 3300014325 | Bacteria | 3410 |
| 404 | Ga0163163_10079344 | 3300014325 | Bacteria | 3281 |
| 405 | Ga0163163_10107903 | 3300014325 | Bacteria | 2810 |
| 406 | Ga0157380_10026504 | 3300014326 | Bacteria | 4401 |
| 407 | Ga0157380_10033826 | 3300014326 | Bacteria | 3938 |
| 408 | Ga0157380_10034112 | 3300014326 | Bacteria | 3924 |
| 409 | Ga0157380_10112611 | 3300014326 | Bacteria | 2290 |
| 410 | Ga0157380_10134768 | 3300014326 | Bacteria | 2112 |
| 411 | Ga0157380_10163276 | 3300014326 | Bacteria | 1938 |
| 412 | Ga0182008_10009302 | 3300014497 | Bacteria | 5311 |
| 413 | Ga0182008_10019759 | 3300014497 | Bacteria | 3473 |
| 414 | Ga0182008_10047686 | 3300014497 | Bacteria | 2128 |
| 415 | Ga0157377_10013130 | 3300014745 | Bacteria | 4185 |
| 416 | Ga0157379_10010513 | 3300014968 | Bacteria | 8067 |
| 417 | Ga0157379_10025218 | 3300014968 | Bacteria | 5279 |
| 418 | Ga0157379_10037328 | 3300014968 | Bacteria | 4331 |
| 419 | Ga0157379_10045346 | 3300014968 | Bacteria | 3924 |
| 420 | Ga0157379_10078733 | 3300014968 | Bacteria | 2952 |
| 421 | Ga0157379_10094540 | 3300014968 | Bacteria | 2682 |
| 422 | Ga0157379_10246802 | 3300014968 | Bacteria | 1620 |
| 423 | Ga0157376_10008722 | 3300014969 | Bacteria | 7326 |
| 424 | Ga0157376_10068333 | 3300014969 | Bacteria | 3009 |
| 425 | Ga0157376_10158997 | 3300014969 | Bacteria | 2046 |
| 426 | Ga0157376_10200191 | 3300014969 | Bacteria | 1837 |
| 427 | Ga0157376_10206137 | 3300014969 | Bacteria | 1812 |
| 428 | Ga0182006_1001032 | 3300015261 | Bacteria | 18152 |
| 429 | Ga0182007_10000366 | 3300015262 | Bacteria | 28535 |
| 430 | Ga0182007_10011494 | 3300015262 | Bacteria | 3445 |
| 431 | Ga0183362_10001 | 3300015683 | Bacteria | 2046624 |
| 432 | Ga0163161_10001014 | 3300017792 | Bacteria | 21406 |
| 433 | Ga0163161_10018424 | 3300017792 | Bacteria | 4893 |
| 434 | Ga0163161_10038391 | 3300017792 | Bacteria | 3435 |
| 435 | Ga0163161_10133045 | 3300017792 | Bacteria | 1878 |
| 436 | Ga0209435_100001 | 3300025206 | Bacteria | 1424171 |
| 437 | Ga0209672_100665 | 3300025228 | Bacteria | 17404 |
| 438 | Ga0209147_101220 | 3300025229 | Bacteria | 10252 |
| 439 | Ga0209258_100058 | 3300025242 | Bacteria | 331567 |
| 440 | Ga0207425_1000733 | 3300025245 | Bacteria | 17320 |
| 441 | Ga0207425_1002759 | 3300025245 | Bacteria | 5968 |
| 442 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 443 | Ga0209026_1000003 | 3300025250 | Bacteria | 1060571 |
| 444 | Ga0209148_1000071 | 3300025254 | Bacteria | 331551 |
| 445 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 446 | Ga0209129_1000023 | 3300025258 | Bacteria | 420646 |
| 447 | Ga0209129_1001044 | 3300025258 | Bacteria | 16361 |
| 448 | Ga0209129_1004583 | 3300025258 | Bacteria | 5315 |
| 449 | Ga0209565_1000004 | 3300025263 | Bacteria | 983150 |
| 450 | Ga0209565_1000073 | 3300025263 | Bacteria | 164695 |
| 451 | Ga0209565_1000187 | 3300025263 | Bacteria | 76001 |
| 452 | Ga0209565_1000912 | 3300025263 | Bacteria | 15923 |
| 453 | Ga0209565_1005208 | 3300025263 | Bacteria | 3816 |
| 454 | Ga0209673_1000066 | 3300025273 | Bacteria | 250037 |
| 455 | Ga0209673_1000074 | 3300025273 | Bacteria | 233552 |
| 456 | Ga0209673_1000127 | 3300025273 | Bacteria | 164695 |
| 457 | Ga0209673_1000389 | 3300025273 | Bacteria | 79243 |
| 458 | Ga0209673_1002877 | 3300025273 | Bacteria | 10944 |
| 459 | Ga0209130_1000050 | 3300025284 | Bacteria | 222092 |
| 460 | Ga0209130_1000069 | 3300025284 | Bacteria | 179177 |
| 461 | Ga0209130_1000082 | 3300025284 | Bacteria | 164441 |
| 462 | Ga0209675_1000029 | 3300025291 | Bacteria | 281053 |
| 463 | Ga0209675_1000044 | 3300025291 | Bacteria | 230392 |
| 464 | Ga0209675_1000226 | 3300025291 | Bacteria | 57689 |
| 465 | Ga0209675_1000232 | 3300025291 | Bacteria | 56301 |
| 466 | Ga0209675_1005829 | 3300025291 | Bacteria | 5063 |
| 467 | Ga0209675_1008851 | 3300025291 | Bacteria | 3635 |
| 468 | Ga0209675_1009803 | 3300025291 | Bacteria | 3343 |
| 469 | Ga0209676_1000005 | 3300025292 | Bacteria | 1076001 |
| 470 | Ga0209676_1000029 | 3300025292 | Bacteria | 520536 |
| 471 | Ga0209676_1000083 | 3300025292 | Bacteria | 279816 |
| 472 | Ga0209676_1000142 | 3300025292 | Bacteria | 175752 |
| 473 | Ga0209676_1001525 | 3300025292 | Bacteria | 21042 |
| 474 | Ga0209676_1007840 | 3300025292 | Bacteria | 4910 |
| 475 | Ga0209676_1008694 | 3300025292 | Bacteria | 4486 |
| 476 | Ga0209676_1010602 | 3300025292 | Bacteria | 3812 |
| 477 | Ga0209676_1029646 | 3300025292 | Bacteria | 1686 |
| 478 | Ga0209025_1000316 | 3300025294 | Bacteria | 107447 |
| 479 | Ga0209025_1000351 | 3300025294 | Bacteria | 99585 |
| 480 | Ga0209025_1000583 | 3300025294 | Bacteria | 66212 |
| 481 | Ga0209025_1000766 | 3300025294 | Bacteria | 53411 |
| 482 | Ga0209025_1001156 | 3300025294 | Bacteria | 37386 |
| 483 | Ga0209025_1002301 | 3300025294 | Bacteria | 20715 |
| 484 | Ga0209025_1005031 | 3300025294 | Bacteria | 11033 |
| 485 | Ga0209025_1021697 | 3300025294 | Bacteria | 3445 |
| 486 | Ga0209025_1023162 | 3300025294 | Bacteria | 3258 |
| 487 | Ga0209025_1023652 | 3300025294 | Bacteria | 3201 |
| 488 | Ga0209025_1036435 | 3300025294 | Bacteria | 2203 |
| 489 | Ga0209025_1039894 | 3300025294 | Bacteria | 2040 |
| 490 | Ga0209564_1000090 | 3300025295 | Bacteria | 249298 |
| 491 | Ga0209564_1000145 | 3300025295 | Bacteria | 175251 |
| 492 | Ga0209564_1000585 | 3300025295 | Bacteria | 57689 |
| 493 | Ga0209564_1001244 | 3300025295 | Bacteria | 28537 |
| 494 | Ga0209564_1001318 | 3300025295 | Bacteria | 26574 |
| 495 | Ga0209564_1001617 | 3300025295 | Bacteria | 21862 |
| 496 | Ga0209564_1002063 | 3300025295 | Bacteria | 17284 |
| 497 | Ga0209758_1000044 | 3300025297 | Bacteria | 398448 |
| 498 | Ga0209758_1000249 | 3300025297 | Bacteria | 110026 |
| 499 | Ga0209758_1024457 | 3300025297 | Bacteria | 2691 |
| 500 | Ga0209758_1043783 | 3300025297 | Bacteria | 1645 |
| 501 | Ga0209050_1000003 | 3300025298 | Bacteria | 1609245 |
| 502 | Ga0209050_1000007 | 3300025298 | Bacteria | 1187891 |
| 503 | Ga0209050_1001232 | 3300025298 | Bacteria | 29637 |
| 504 | Ga0209050_1002246 | 3300025298 | Bacteria | 17232 |
| 505 | Ga0209050_1013755 | 3300025298 | Bacteria | 3561 |
| 506 | Ga0209050_1014496 | 3300025298 | Bacteria | 3388 |
| 507 | Ga0209256_1000001 | 3300025299 | Bacteria | 2166974 |
| 508 | Ga0209256_1000020 | 3300025299 | Bacteria | 542402 |
| 509 | Ga0209256_1000022 | 3300025299 | Bacteria | 481843 |
| 510 | Ga0209256_1000051 | 3300025299 | Bacteria | 307241 |
| 511 | Ga0209256_1000127 | 3300025299 | Bacteria | 164393 |
| 512 | Ga0209256_1001660 | 3300025299 | Bacteria | 21630 |
| 513 | Ga0207426_1000001 | 3300025302 | Bacteria | 1341301 |
| 514 | Ga0207426_1000031 | 3300025302 | Bacteria | 460699 |
| 515 | Ga0207426_1000071 | 3300025302 | Bacteria | 329539 |
| 516 | Ga0207426_1001744 | 3300025302 | Bacteria | 16547 |
| 517 | Ga0209051_1000003 | 3300025303 | Bacteria | 1609245 |
| 518 | Ga0209051_1000036 | 3300025303 | Bacteria | 339863 |
| 519 | Ga0209051_1000416 | 3300025303 | Bacteria | 58872 |
| 520 | Ga0209051_1000500 | 3300025303 | Bacteria | 49702 |
| 521 | Ga0209051_1000542 | 3300025303 | Bacteria | 46577 |
| 522 | Ga0209051_1000735 | 3300025303 | Bacteria | 35429 |
| 523 | Ga0209051_1011957 | 3300025303 | Bacteria | 4237 |
| 524 | Ga0209051_1018109 | 3300025303 | Bacteria | 3126 |
| 525 | Ga0209051_1031523 | 3300025303 | Bacteria | 2038 |
| 526 | Ga0209257_1000011 | 3300025304 | Bacteria | 1112630 |
| 527 | Ga0209257_1000012 | 3300025304 | Bacteria | 1111138 |
| 528 | Ga0209257_1000018 | 3300025304 | Bacteria | 836016 |
| 529 | Ga0209257_1000226 | 3300025304 | Bacteria | 133836 |
| 530 | Ga0209257_1003858 | 3300025304 | Bacteria | 12252 |
| 531 | Ga0209257_1005060 | 3300025304 | Bacteria | 9573 |
| 532 | Ga0207697_10000857 | 3300025315 | Bacteria | 17209 |
| 533 | Ga0207656_10004471 | 3300025321 | Bacteria | 4887 |
| 534 | Ga0207656_10007788 | 3300025321 | Bacteria | 3920 |
| 535 | Ga0207655_1002684 | 3300025728 | Bacteria | 13976 |
| 536 | Ga0207682_10000120 | 3300025893 | Bacteria | 36172 |
| 537 | Ga0207682_10001604 | 3300025893 | Bacteria | 10396 |
| 538 | Ga0207682_10047517 | 3300025893 | Bacteria | 1767 |
| 539 | Ga0207682_10051884 | 3300025893 | Bacteria | 1699 |
| 540 | Ga0207682_10065244 | 3300025893 | Bacteria | 1532 |
| 541 | Ga0207642_10016419 | 3300025899 | Bacteria | 2788 |
| 542 | Ga0207642_10029220 | 3300025899 | Bacteria | 2280 |
| 543 | Ga0207642_10068697 | 3300025899 | Bacteria | 1677 |
| 544 | Ga0207680_10011590 | 3300025903 | Bacteria | 4459 |
| 545 | Ga0207680_10147969 | 3300025903 | Bacteria | 1563 |
| 546 | Ga0207647_10059083 | 3300025904 | Bacteria | 2347 |
| 547 | Ga0207645_10001475 | 3300025907 | Bacteria | 19229 |
| 548 | Ga0207645_10017113 | 3300025907 | Bacteria | 4789 |
| 549 | Ga0207645_10085833 | 3300025907 | Bacteria | 2021 |
| 550 | Ga0207643_10000681 | 3300025908 | Bacteria | 21214 |
| 551 | Ga0207643_10026471 | 3300025908 | Bacteria | 3211 |
| 552 | Ga0207643_10107981 | 3300025908 | Bacteria | 1637 |
| 553 | Ga0207654_10099305 | 3300025911 | Bacteria | 1790 |
| 554 | Ga0207695_10118124 | 3300025913 | Bacteria | 2623 |
| 555 | Ga0207671_10001800 | 3300025914 | Bacteria | 23963 |
| 556 | Ga0207660_10155321 | 3300025917 | Bacteria | 1761 |
| 557 | Ga0207662_10004254 | 3300025918 | Bacteria | 7509 |
| 558 | Ga0207657_10000822 | 3300025919 | Bacteria | 32803 |
| 559 | Ga0207649_10049281 | 3300025920 | Bacteria | 2600 |
| 560 | Ga0207649_10090844 | 3300025920 | Bacteria | 1999 |
| 561 | Ga0207681_10016998 | 3300025923 | Bacteria | 4563 |
| 562 | Ga0207681_10021841 | 3300025923 | Bacteria | 4074 |
| 563 | Ga0207681_10057263 | 3300025923 | Bacteria | 2663 |
| 564 | Ga0207694_10004998 | 3300025924 | Bacteria | 10260 |
| 565 | Ga0207650_10006154 | 3300025925 | Bacteria | 8179 |
| 566 | Ga0207650_10040265 | 3300025925 | Bacteria | 3419 |
| 567 | Ga0207650_10043242 | 3300025925 | Bacteria | 3306 |
| 568 | Ga0207650_10174301 | 3300025925 | Bacteria | 1711 |
| 569 | Ga0207659_10010325 | 3300025926 | Bacteria | 5864 |
| 570 | Ga0207659_10024313 | 3300025926 | Bacteria | 4057 |
| 571 | Ga0207659_10039189 | 3300025926 | Bacteria | 3302 |
| 572 | Ga0207659_10101309 | 3300025926 | Bacteria | 2172 |
| 573 | Ga0207659_10413358 | 3300025926 | Bacteria | 1130 |
| 574 | Ga0207659_10474914 | 3300025926 | Bacteria | 1056 |
| 575 | Ga0207644_10008321 | 3300025931 | Bacteria | 6797 |
| 576 | Ga0207644_10021143 | 3300025931 | Bacteria | 4429 |
| 577 | Ga0207690_10002002 | 3300025932 | Bacteria | 12484 |
| 578 | Ga0207706_10000149 | 3300025933 | Bacteria | 76532 |
| 579 | Ga0207706_10000850 | 3300025933 | Bacteria | 31426 |
| 580 | Ga0207706_10003793 | 3300025933 | Bacteria | 14408 |
| 581 | Ga0207706_10029503 | 3300025933 | Bacteria | 4896 |
| 582 | Ga0207706_10108327 | 3300025933 | Bacteria | 2445 |
| 583 | Ga0207706_10134632 | 3300025933 | Bacteria | 2173 |
| 584 | Ga0207706_10272194 | 3300025933 | Bacteria | 1478 |
| 585 | Ga0207686_10148193 | 3300025934 | Bacteria | 1630 |
| 586 | Ga0207709_10000771 | 3300025935 | Bacteria | 25177 |
| 587 | Ga0207709_10001360 | 3300025935 | Bacteria | 17193 |
| 588 | Ga0207709_10025348 | 3300025935 | Bacteria | 3394 |
| 589 | Ga0207709_10028943 | 3300025935 | Bacteria | 3207 |
| 590 | Ga0207709_10029949 | 3300025935 | Bacteria | 3162 |
| 591 | Ga0207709_10117902 | 3300025935 | Bacteria | 1787 |
| 592 | Ga0207709_10136795 | 3300025935 | Bacteria | 1678 |
| 593 | Ga0207709_10148361 | 3300025935 | Bacteria | 1621 |
| 594 | Ga0207670_10400184 | 3300025936 | Bacteria | 1098 |
| 595 | Ga0207669_10006269 | 3300025937 | Bacteria | 5419 |
| 596 | Ga0207669_10061575 | 3300025937 | Bacteria | 2307 |
| 597 | Ga0207669_10097632 | 3300025937 | Bacteria | 1932 |
| 598 | Ga0207669_10241973 | 3300025937 | Bacteria | 1338 |
| 599 | Ga0207704_10018734 | 3300025938 | Bacteria | 3621 |
| 600 | Ga0207704_10026431 | 3300025938 | Bacteria | 3185 |
| 601 | Ga0207704_10091255 | 3300025938 | Bacteria | 2001 |
| 602 | Ga0207704_10271794 | 3300025938 | Bacteria | 1284 |
| 603 | Ga0207691_10000773 | 3300025940 | Bacteria | 31657 |
| 604 | Ga0207691_10001626 | 3300025940 | Bacteria | 22311 |
| 605 | Ga0207691_10004125 | 3300025940 | Bacteria | 14115 |
| 606 | Ga0207691_10016262 | 3300025940 | Bacteria | 7064 |
| 607 | Ga0207691_10022311 | 3300025940 | Bacteria | 5971 |
| 608 | Ga0207691_10024119 | 3300025940 | Bacteria | 5721 |
| 609 | Ga0207691_10041027 | 3300025940 | Bacteria | 4275 |
| 610 | Ga0207691_10082806 | 3300025940 | Bacteria | 2881 |
| 611 | Ga0207691_10089646 | 3300025940 | Bacteria | 2757 |
| 612 | Ga0207691_10245462 | 3300025940 | Bacteria | 1547 |
| 613 | Ga0207691_10287616 | 3300025940 | Bacteria | 1414 |
| 614 | Ga0207711_10023053 | 3300025941 | Bacteria | 5212 |
| 615 | Ga0207711_10124729 | 3300025941 | Bacteria | 2302 |
| 616 | Ga0207711_10155887 | 3300025941 | Bacteria | 2064 |
| 617 | Ga0207711_10156409 | 3300025941 | Bacteria | 2060 |
| 618 | Ga0207711_10344043 | 3300025941 | Bacteria | 1381 |
| 619 | Ga0207689_10000049 | 3300025942 | Bacteria | 88948 |
| 620 | Ga0207689_10000307 | 3300025942 | Bacteria | 45007 |
| 621 | Ga0207689_10001301 | 3300025942 | Bacteria | 24043 |
| 622 | Ga0207689_10008205 | 3300025942 | Bacteria | 9100 |
| 623 | Ga0207689_10060861 | 3300025942 | Bacteria | 3105 |
| 624 | Ga0207689_10165152 | 3300025942 | Bacteria | 1824 |
| 625 | Ga0207689_10193318 | 3300025942 | Bacteria | 1679 |
| 626 | Ga0207689_10231835 | 3300025942 | Bacteria | 1526 |
| 627 | Ga0207679_10008364 | 3300025945 | Bacteria | 6589 |
| 628 | Ga0207679_10062155 | 3300025945 | Bacteria | 2782 |
| 629 | Ga0207679_10106195 | 3300025945 | Bacteria | 2207 |
| 630 | Ga0207679_10217309 | 3300025945 | Bacteria | 1606 |
| 631 | Ga0207667_10001720 | 3300025949 | Bacteria | 27567 |
| 632 | Ga0207667_10032111 | 3300025949 | Bacteria | 5660 |
| 633 | Ga0207667_10133856 | 3300025949 | Bacteria | 2553 |
| 634 | Ga0207667_10432257 | 3300025949 | Bacteria | 1339 |
| 635 | Ga0207651_10001889 | 3300025960 | Bacteria | 9820 |
| 636 | Ga0207651_10019990 | 3300025960 | Bacteria | 4029 |
| 637 | Ga0207651_10022461 | 3300025960 | Bacteria | 3858 |
| 638 | Ga0207651_10078633 | 3300025960 | Bacteria | 2366 |
| 639 | Ga0207651_10120546 | 3300025960 | Bacteria | 1988 |
| 640 | Ga0207712_10010255 | 3300025961 | Bacteria | 5944 |
| 641 | Ga0207712_10064721 | 3300025961 | Bacteria | 2608 |
| 642 | Ga0207712_10094687 | 3300025961 | Bacteria | 2207 |
| 643 | Ga0207668_10008031 | 3300025972 | Bacteria | 6282 |
| 644 | Ga0207668_10029069 | 3300025972 | Bacteria | 3620 |
| 645 | Ga0207668_10056523 | 3300025972 | Bacteria | 2733 |
| 646 | Ga0207668_10069586 | 3300025972 | Bacteria | 2506 |
| 647 | Ga0207668_10146608 | 3300025972 | Bacteria | 1822 |
| 648 | Ga0207668_10273177 | 3300025972 | Bacteria | 1383 |
| 649 | Ga0207668_10276807 | 3300025972 | Bacteria | 1374 |
| 650 | Ga0207640_10044846 | 3300025981 | Bacteria | 2836 |
| 651 | Ga0207640_10062911 | 3300025981 | Bacteria | 2464 |
| 652 | Ga0207658_10003343 | 3300025986 | Bacteria | 11381 |
| 653 | Ga0207658_10006980 | 3300025986 | Bacteria | 7688 |
| 654 | Ga0207658_10021590 | 3300025986 | Bacteria | 4473 |
| 655 | Ga0207658_10040679 | 3300025986 | Bacteria | 3362 |
| 656 | Ga0207677_10003034 | 3300026023 | Bacteria | 8873 |
| 657 | Ga0207677_10008690 | 3300026023 | Bacteria | 5686 |
| 658 | Ga0207677_10059178 | 3300026023 | Bacteria | 2642 |
| 659 | Ga0207677_10076559 | 3300026023 | Bacteria | 2382 |
| 660 | Ga0207677_10173734 | 3300026023 | Bacteria | 1688 |
| 661 | Ga0207677_10398444 | 3300026023 | Bacteria | 1167 |
| 662 | Ga0207703_10002822 | 3300026035 | Bacteria | 14826 |
| 663 | Ga0207703_10003906 | 3300026035 | Bacteria | 12376 |
| 664 | Ga0207703_10037171 | 3300026035 | Bacteria | 3879 |
| 665 | Ga0207703_10274231 | 3300026035 | Bacteria | 1529 |
| 666 | Ga0207639_10005031 | 3300026041 | Bacteria | 8906 |
| 667 | Ga0207639_10055874 | 3300026041 | Bacteria | 3023 |
| 668 | Ga0207639_10221377 | 3300026041 | Bacteria | 1635 |
| 669 | Ga0207639_10234731 | 3300026041 | Bacteria | 1592 |
| 670 | Ga0207639_10313675 | 3300026041 | Bacteria | 1390 |
| 671 | Ga0207678_10011833 | 3300026067 | Bacteria | 7661 |
| 672 | Ga0207678_10100600 | 3300026067 | Bacteria | 2469 |
| 673 | Ga0207678_10103375 | 3300026067 | Bacteria | 2432 |
| 674 | Ga0207678_10220158 | 3300026067 | Bacteria | 1625 |
| 675 | Ga0207678_10299085 | 3300026067 | Bacteria | 1383 |
| 676 | Ga0207708_10000529 | 3300026075 | Bacteria | 29463 |
| 677 | Ga0207708_10008749 | 3300026075 | Bacteria | 7489 |
| 678 | Ga0207708_10022047 | 3300026075 | Bacteria | 4808 |
| 679 | Ga0207708_10274462 | 3300026075 | Bacteria | 1364 |
| 680 | Ga0207702_10157221 | 3300026078 | Bacteria | 2073 |
| 681 | Ga0207702_10205785 | 3300026078 | Bacteria | 1827 |
| 682 | Ga0207641_10008475 | 3300026088 | Bacteria | 8497 |
| 683 | Ga0207641_10017295 | 3300026088 | Bacteria | 5902 |
| 684 | Ga0207641_10036405 | 3300026088 | Bacteria | 4108 |
| 685 | Ga0207641_10065664 | 3300026088 | Bacteria | 3104 |
| 686 | Ga0207641_10141285 | 3300026088 | Bacteria | 2172 |
| 687 | Ga0207641_10207970 | 3300026088 | Bacteria | 1808 |
| 688 | Ga0207648_10002306 | 3300026089 | Bacteria | 20605 |
| 689 | Ga0207648_10003420 | 3300026089 | Bacteria | 16668 |
| 690 | Ga0207648_10006661 | 3300026089 | Bacteria | 11462 |
| 691 | Ga0207648_10010535 | 3300026089 | Bacteria | 8755 |
| 692 | Ga0207648_10021312 | 3300026089 | Bacteria | 5826 |
| 693 | Ga0207648_10027187 | 3300026089 | Bacteria | 5081 |
| 694 | Ga0207648_10049953 | 3300026089 | Bacteria | 3658 |
| 695 | Ga0207648_10080063 | 3300026089 | Bacteria | 2850 |
| 696 | Ga0207648_10461373 | 3300026089 | Bacteria | 1158 |
| 697 | Ga0207676_10004825 | 3300026095 | Bacteria | 9564 |
| 698 | Ga0207676_10027811 | 3300026095 | Bacteria | 4217 |
| 699 | Ga0207676_10064917 | 3300026095 | Bacteria | 2905 |
| 700 | Ga0207676_10105918 | 3300026095 | Bacteria | 2342 |
| 701 | Ga0207676_10197159 | 3300026095 | Bacteria | 1776 |
| 702 | Ga0207676_10337422 | 3300026095 | Bacteria | 1389 |
| 703 | Ga0207674_10003249 | 3300026116 | Bacteria | 20002 |
| 704 | Ga0207674_10003275 | 3300026116 | Bacteria | 19914 |
| 705 | Ga0207674_10020383 | 3300026116 | Bacteria | 7164 |
| 706 | Ga0207674_10157866 | 3300026116 | Bacteria | 2223 |
| 707 | Ga0207675_100003946 | 3300026118 | Bacteria | 14398 |
| 708 | Ga0207675_100008033 | 3300026118 | Bacteria | 9941 |
| 709 | Ga0207675_100032927 | 3300026118 | Bacteria | 4829 |
| 710 | Ga0207675_100035316 | 3300026118 | Bacteria | 4662 |
| 711 | Ga0207675_100035639 | 3300026118 | Bacteria | 4641 |
| 712 | Ga0207675_100055481 | 3300026118 | Bacteria | 3696 |
| 713 | Ga0207675_100596275 | 3300026118 | Bacteria | 1107 |
| 714 | Ga0207683_10006932 | 3300026121 | Bacteria | 9705 |
| 715 | Ga0207683_10008101 | 3300026121 | Bacteria | 8986 |
| 716 | Ga0207683_10010884 | 3300026121 | Bacteria | 7760 |
| 717 | Ga0207683_10030812 | 3300026121 | Bacteria | 4651 |
| 718 | Ga0207683_10050620 | 3300026121 | Bacteria | 3639 |
| 719 | Ga0207683_10240983 | 3300026121 | Bacteria | 1650 |
| 720 | Ga0207683_10260994 | 3300026121 | Bacteria | 1582 |
| 721 | Ga0207683_10318998 | 3300026121 | Bacteria | 1423 |
| 722 | Ga0207698_10034135 | 3300026142 | Bacteria | 3705 |
| 723 | Ga0207698_10121441 | 3300026142 | Bacteria | 2212 |
| 724 | Ga0207698_10182443 | 3300026142 | Bacteria | 1861 |
| 725 | Ga0207698_10427876 | 3300026142 | Bacteria | 1272 |
| 726 | Ga0207698_10624105 | 3300026142 | Bacteria | 1065 |
| 727 | Ga0209281_1000160 | 3300027111 | Bacteria | 161071 |
| 728 | Ga0209371_1003487 | 3300027312 | Bacteria | 7604 |
| 729 | Ga0209999_1015003 | 3300027543 | Bacteria | 1408 |
| 730 | Ga0209983_1006590 | 3300027665 | Bacteria | 2383 |
| 731 | Ga0209983_1028576 | 3300027665 | Bacteria | 1183 |
| 732 | Ga0209282_1000069 | 3300027666 | Bacteria | 85661 |
| 733 | Ga0209282_1018317 | 3300027666 | Bacteria | 4444 |
| 734 | Ga0209282_1087699 | 3300027666 | Bacteria | 1640 |
| 735 | Ga0209971_1015433 | 3300027682 | Bacteria | 1810 |
| 736 | Ga0209998_10027200 | 3300027717 | Bacteria | 1252 |
| 737 | Ga0268266_10017786 | 3300028379 | Bacteria | 6057 |
| 738 | Ga0268266_10039667 | 3300028379 | Bacteria | 4011 |
| 739 | Ga0268266_10044855 | 3300028379 | Bacteria | 3780 |
| 740 | Ga0268266_10078909 | 3300028379 | Bacteria | 2866 |
| 741 | Ga0268266_10079755 | 3300028379 | Bacteria | 2851 |
| 742 | Ga0268266_10086096 | 3300028379 | Bacteria | 2747 |
| 743 | Ga0268266_10154105 | 3300028379 | Bacteria | 2074 |
| 744 | Ga0268265_10006606 | 3300028380 | Bacteria | 7850 |
| 745 | Ga0268265_10029739 | 3300028380 | Bacteria | 3927 |
| 746 | Ga0268265_10088981 | 3300028380 | Bacteria | 2461 |
| 747 | Ga0268265_10164888 | 3300028380 | Bacteria | 1887 |
| 748 | Ga0268265_10191253 | 3300028380 | Bacteria | 1767 |
| 749 | Ga0268265_10294024 | 3300028380 | Bacteria | 1459 |
| 750 | Ga0268264_10000624 | 3300028381 | Bacteria | 42120 |
| 751 | Ga0268264_10017548 | 3300028381 | Bacteria | 5862 |
| 752 | Ga0268264_10102319 | 3300028381 | Bacteria | 2492 |
| 753 | Ga0268264_10180804 | 3300028381 | Bacteria | 1915 |
| 754 | Ga0268264_10186400 | 3300028381 | Bacteria | 1888 |
| 755 | Ga0268264_10452026 | 3300028381 | Bacteria | 1245 |
| 756 | Ga0307517_10033655 | 3300028786 | Bacteria | 5873 |
| 757 | Ga0307515_10000058 | 3300028794 | Bacteria | 259680 |
| 758 | Ga0307515_10000267 | 3300028794 | Bacteria | 128554 |
| 759 | Ga0307515_10000283 | 3300028794 | Bacteria | 124822 |
| 760 | Ga0307515_10000302 | 3300028794 | Bacteria | 121875 |
| 761 | Ga0307515_10000586 | 3300028794 | Bacteria | 85517 |
| 762 | Ga0307515_10003631 | 3300028794 | Bacteria | 32412 |
| 763 | Ga0307515_10011842 | 3300028794 | Bacteria | 16497 |
| 764 | Ga0307515_10081285 | 3300028794 | Bacteria | 4211 |
| 765 | Ga0307515_10105750 | 3300028794 | Bacteria | 3347 |
| 766 | Ga0307515_10118612 | 3300028794 | Bacteria | 3018 |
| 767 | Ga0307515_10157981 | 3300028794 | Bacteria | 2329 |
| 768 | Ga0307515_10251002 | 3300028794 | Bacteria | 1522 |
| 769 | Ga0268256_1007657 | 3300030500 | Bacteria | 3816 |
| 770 | Ga0307512_10018592 | 3300030522 | Bacteria | 6347 |
| 771 | Ga0307512_10038652 | 3300030522 | Bacteria | 4012 |
| 772 | Ga0316177_1102153 | 3300030731 | Bacteria | 3157 |
| 773 | Ga0314311_1141747 | 3300030733 | Bacteria | 3965 |
| 774 | Ga0316183_1033032 | 3300030742 | Bacteria | 2810 |
| 775 | Ga0265327_10005641 | 3300031251 | Bacteria | 10362 |
| 776 | Ga0307513_10000010 | 3300031456 | Bacteria | 360812 |
| 777 | Ga0307513_10000051 | 3300031456 | Bacteria | 149733 |
| 778 | Ga0307513_10049729 | 3300031456 | Bacteria | 4538 |
| 779 | Ga0307513_10060104 | 3300031456 | Bacteria | 4030 |
| 780 | Ga0307513_10077516 | 3300031456 | Bacteria | 3441 |
| 781 | Ga0307513_10103072 | 3300031456 | Bacteria | 2871 |
| 782 | Ga0307513_10108365 | 3300031456 | Bacteria | 2779 |
| 783 | Ga0307513_10139562 | 3300031456 | Bacteria | 2352 |
| 784 | Ga0307513_10399439 | 3300031456 | Bacteria | 1109 |
| 785 | Ga0307509_10011999 | 3300031507 | Bacteria | 10407 |
| 786 | Ga0307509_10071187 | 3300031507 | Bacteria | 3628 |
| 787 | Ga0307509_10096280 | 3300031507 | Bacteria | 3012 |
| 788 | Ga0307408_100000193 | 3300031548 | Bacteria | 65882 |
| 789 | Ga0307408_100001412 | 3300031548 | Bacteria | 17856 |
| 790 | Ga0307408_100007530 | 3300031548 | Bacteria | 7197 |
| 791 | Ga0307408_100022612 | 3300031548 | Bacteria | 4274 |
| 792 | Ga0307408_100056105 | 3300031548 | Bacteria | 2855 |
| 793 | Ga0307408_100090913 | 3300031548 | Bacteria | 2304 |
| 794 | Ga0307408_100128014 | 3300031548 | Bacteria | 1977 |
| 795 | Ga0307508_10000876 | 3300031616 | Bacteria | 35008 |
| 796 | Ga0307508_10001111 | 3300031616 | Bacteria | 31133 |
| 797 | Ga0307508_10016840 | 3300031616 | Bacteria | 6650 |
| 798 | Ga0307508_10171782 | 3300031616 | Bacteria | 1771 |
| 799 | Ga0307514_10000806 | 3300031649 | Bacteria | 51095 |
| 800 | Ga0307514_10014746 | 3300031649 | Bacteria | 6462 |
| 801 | Ga0307514_10068076 | 3300031649 | Bacteria | 2685 |
| 802 | Ga0307516_10001118 | 3300031730 | Bacteria | 37358 |
| 803 | Ga0307516_10037208 | 3300031730 | Bacteria | 4866 |
| 804 | Ga0307516_10097543 | 3300031730 | Bacteria | 2759 |
| 805 | Ga0307405_10397803 | 3300031731 | Bacteria | 1077 |
| 806 | Ga0307410_10001817 | 3300031852 | Bacteria | 9908 |
| 807 | Ga0307406_10000944 | 3300031901 | Bacteria | 16257 |
| 808 | Ga0307406_10002109 | 3300031901 | Bacteria | 10838 |
| 809 | Ga0307406_10020580 | 3300031901 | Bacteria | 3888 |
| 810 | Ga0307406_10107886 | 3300031901 | Bacteria | 1910 |
| 811 | Ga0307407_10087522 | 3300031903 | Bacteria | 1901 |
| 812 | Ga0307412_10002610 | 3300031911 | Bacteria | 10008 |
| 813 | Ga0307412_10008248 | 3300031911 | Bacteria | 5939 |
| 814 | Ga0307412_10059041 | 3300031911 | Bacteria | 2569 |
| 815 | Ga0307409_100026624 | 3300031995 | Bacteria | 4082 |
| 816 | Ga0307416_100095618 | 3300032002 | Bacteria | 2566 |
| 817 | Ga0307416_100523136 | 3300032002 | Bacteria | 1255 |
| 818 | Ga0307416_100694142 | 3300032002 | Bacteria | 1106 |
| 819 | Ga0307414_10061593 | 3300032004 | Bacteria | 2659 |
| 820 | Ga0307414_10272083 | 3300032004 | Bacteria | 1419 |
| 821 | Ga0307411_10128359 | 3300032005 | Bacteria | 1848 |
| 822 | Ga0307411_10135310 | 3300032005 | Bacteria | 1808 |
| 823 | Ga0307411_10196374 | 3300032005 | Bacteria | 1545 |
| 824 | Ga0307507_10247610 | 3300033179 | Bacteria | 1156 |
| 825 | Ga0307510_10133426 | 3300033180 | Bacteria | 2148 |
| 826 | Ga0373953_0045721 | 3300035117 | Bacteria | 1756 |
| 827 | Ga0373955_0061335 | 3300035172 | Bacteria | 2077 |
| 828 | Ga0373955_0079570 | 3300035172 | Bacteria | 1849 |
| 829 | Ga0373924_0136413 | 3300035410 | Bacteria | 1069 |
| 830 | Ga0373931_0052842 | 3300035691 | Bacteria | 2167 |
| 831 | Ga0373937_0014096 | 3300036401 | Bacteria | 7050 |
| 832 | Ga0373937_0064919 | 3300036401 | Bacteria | 3359 |
| 833 | Ga0373937_0246317 | 3300036401 | Bacteria | 1684 |
| 834 | Ga0373925_0003621 | 3300037068 | Bacteria | 11900 |
| 835 | Ga0373925_0106669 | 3300037068 | Bacteria | 2160 |
| 836 | Ga0400483_058929 | 3300039062 | Bacteria | 2961 |
| 837 | Ga0400483_242388 | 3300039062 | Bacteria | 1539 |
| 838 | Ga0439436_0001073 | 3300041404 | Bacteria | 7715 |
| 839 | Ga0439436_0026058 | 3300041404 | Bacteria | 1715 |
| 840 | Ga0439436_0056618 | 3300041404 | Bacteria | 1101 |
| 841 | Ga0439447_004235 | 3300041407 | Bacteria | 4973 |
| 842 | Ga0439431_0016358 | 3300041997 | Bacteria | 1735 |
| 843 | Ga0439442_020080 | 3300042002 | Bacteria | 1384 |
| 844 | Ga0439432_001458 | 3300042006 | Bacteria | 8874 |
| 845 | Ga0439449_0000923 | 3300042007 | Bacteria | 11452 |
| 846 | Ga0439449_0005718 | 3300042007 | Bacteria | 4752 |
| 847 | Ga0439449_0040190 | 3300042007 | Bacteria | 1739 |
| 848 | Ga0439450_024941 | 3300042008 | Bacteria | 1307 |
| 849 | Ga0439452_005984 | 3300042010 | Bacteria | 3854 |
| 850 | Ga0439452_019491 | 3300042010 | Bacteria | 1793 |
| 851 | Ga0439452_027810 | 3300042010 | Bacteria | 1417 |
| 852 | Ga0439457_002549 | 3300042014 | Bacteria | 5168 |
| 853 | Ga0439462_0015908 | 3300042015 | Bacteria | 1942 |
| 854 | Ga0439462_0035634 | 3300042015 | Bacteria | 1323 |
| 855 | Ga0450911_000137 | 3300042115 | Bacteria | 29337 |
| 856 | Ga0450921_000339 | 3300042123 | Bacteria | 2107 |
| 857 | Ga0450898_006861 | 3300042134 | Bacteria | 1760 |
| 858 | Ga0439434_0002704 | 3300042435 | Bacteria | 5161 |
| 859 | Ga0450918_002201 | 3300042531 | Bacteria | 3710 |
| 860 | Ga0450893_0009504 | 3300042532 | Bacteria | 1589 |
| 861 | Ga0451577_0029841 | 3300042876 | Bacteria | 4927 |
| 862 | Ga0451577_0075805 | 3300042876 | Bacteria | 2999 |
| 863 | Ga0451577_0104665 | 3300042876 | Bacteria | 2529 |
| 864 | Ga0451577_0131994 | 3300042876 | Bacteria | 2241 |
| 865 | Ga0453684_0004147 | 3300044712 | Bacteria | 31361 |
| 866 | Ga0453684_0059476 | 3300044712 | Bacteria | 4925 |
| 867 | Ga0453684_0150918 | 3300044712 | Bacteria | 2762 |
| 868 | Ga0451576_0009619 | 3300045051 | Bacteria | 11183 |
| 869 | Ga0451576_0116563 | 3300045051 | Bacteria | 2781 |
| 870 | Ga0495627_006938 | 3300046453 | Bacteria | 4397 |
| 871 | Ga0495627_020194 | 3300046453 | Bacteria | 2223 |
| 872 | Ga0495590_0014273 | 3300046457 | Bacteria | 2901 |
| 873 | Ga0495629_0243433 | 3300046459 | Bacteria | 1238 |
| 874 | Ga0495605_0004236 | 3300046474 | Bacteria | 8448 |
| 875 | Ga0495639_0015227 | 3300046475 | Bacteria | 3332 |
| 876 | Ga0495664_0015726 | 3300046477 | Bacteria | 4306 |
| 877 | Ga0495596_0000317 | 3300046500 | Bacteria | 31540 |
| 878 | Ga0495607_0000280 | 3300046501 | Bacteria | 54943 |
| 879 | Ga0495583_0063383 | 3300046506 | Bacteria | 1643 |
| 880 | Ga0495610_0000424 | 3300046512 | Bacteria | 43401 |
| 881 | Ga0495610_0018922 | 3300046512 | Bacteria | 3871 |
| 882 | Ga0495616_0006264 | 3300046513 | Bacteria | 7226 |
| 883 | Ga0495616_0044348 | 3300046513 | Bacteria | 2255 |
| 884 | Ga0495620_0052852 | 3300046515 | Bacteria | 1723 |
| 885 | Ga0495631_0001923 | 3300046518 | Bacteria | 12220 |
| 886 | Ga0495632_0048912 | 3300046519 | Bacteria | 2092 |
| 887 | Ga0495632_0051016 | 3300046519 | Bacteria | 2038 |
| 888 | Ga0495637_0007031 | 3300046520 | Bacteria | 5604 |
| 889 | Ga0495637_0013071 | 3300046520 | Bacteria | 3952 |
| 890 | Ga0495643_0093802 | 3300046522 | Bacteria | 1545 |
| 891 | Ga0495642_0111393 | 3300046528 | Bacteria | 1170 |
| 892 | Ga0495654_0008854 | 3300046530 | Bacteria | 5534 |
| 893 | Ga0495609_0009581 | 3300046538 | Bacteria | 4683 |
| 894 | Ga0495621_0095725 | 3300046539 | Bacteria | 1125 |
| 895 | Ga0495597_0020417 | 3300046542 | Bacteria | 3087 |
| 896 | Ga0495597_0022634 | 3300046542 | Bacteria | 2913 |
| 897 | Ga0495633_0006330 | 3300046558 | Bacteria | 7044 |
| 898 | Ga0495656_0002566 | 3300046615 | Bacteria | 6051 |
| 899 | Ga0495625_0000396 | 3300046660 | Bacteria | 66627 |
| 900 | Ga0495625_0000807 | 3300046660 | Bacteria | 43441 |
| 901 | Ga0495625_0038121 | 3300046660 | Bacteria | 3520 |
| 902 | Ga0495625_0081869 | 3300046660 | Bacteria | 2246 |
| 903 | Ga0495661_0068155 | 3300046665 | Bacteria | 2088 |
| 904 | Ga0495658_0006349 | 3300046683 | Bacteria | 5806 |
| 905 | Ga0495671_0001711 | 3300046692 | Bacteria | 14294 |
| 906 | Ga0495649_0175933 | 3300046694 | Bacteria | 1118 |
| 907 | Ga0495660_0035956 | 3300046810 | Bacteria | 2764 |
| 908 | Ga0495672_0005564 | 3300047320 | Bacteria | 9963 |
| 909 | Ga0495687_000196 | 3300047443 | Bacteria | 87053 |
| 910 | Ga0495687_021061 | 3300047443 | Bacteria | 3165 |
| 911 | Ga0495687_045689 | 3300047443 | Bacteria | 1894 |
| 912 | Ga0495677_0103754 | 3300047445 | Bacteria | 1078 |
| 913 | Ga0495686_0145921 | 3300047472 | Bacteria | 1393 |
| 914 | Ga0496101_0003644 | 3300048904 | Bacteria | 9612 |
| 915 | Ga0496102_0024833 | 3300048905 | Bacteria | 5330 |
| 916 | Ga0496103_0023992 | 3300048906 | Bacteria | 3680 |
| 917 | Ga0496103_0208205 | 3300048906 | Bacteria | 1258 |
| 918 | Ga0496104_0021963 | 3300048907 | Bacteria | 5862 |
| 919 | Ga0496105_0021257 | 3300048908 | Bacteria | 5251 |
| 920 | Ga0496105_0095237 | 3300048908 | Bacteria | 2459 |
| 921 | Ga0496105_0173682 | 3300048908 | Bacteria | 1766 |
| 922 | Ga0496106_0036400 | 3300048909 | Bacteria | 3682 |
| 923 | Ga0496107_0008919 | 3300048910 | Bacteria | 6949 |
| 924 | Ga0496107_0223374 | 3300048910 | Bacteria | 1401 |
| 925 | Ga0496108_0020007 | 3300048911 | Bacteria | 5500 |
| 926 | Ga0496109_0005385 | 3300048912 | Bacteria | 10697 |
| 927 | Ga0496109_0038690 | 3300048912 | Bacteria | 4313 |
| 928 | Ga0496109_0337549 | 3300048912 | Bacteria | 1423 |
| 929 | Ga0496110_0027094 | 3300048913 | Bacteria | 4910 |
| 930 | Ga0496110_0042796 | 3300048913 | Bacteria | 3953 |
| 931 | Ga0496110_0094456 | 3300048913 | Bacteria | 2678 |
| 932 | Ga0496112_0541449 | 3300048915 | Bacteria | 1098 |
| 933 | Ga0496114_0030341 | 3300048917 | Bacteria | 4448 |
| 934 | Ga0496114_0047087 | 3300048917 | Bacteria | 3585 |
| 935 | Ga0496114_0099241 | 3300048917 | Bacteria | 2484 |
| 936 | Ga0496116_0009002 | 3300048919 | Bacteria | 8579 |
| 937 | Ga0496116_0016831 | 3300048919 | Bacteria | 5703 |
| 938 | Ga0496116_0020474 | 3300048919 | Bacteria | 5022 |
| 939 | Ga0496116_0024283 | 3300048919 | Bacteria | 4488 |
| 940 | Ga0496116_0099800 | 3300048919 | Bacteria | 1737 |
| 941 | Ga0496117_0034564 | 3300048920 | Bacteria | 3806 |
| 942 | Ga0496117_0084871 | 3300048920 | Bacteria | 2064 |
| 943 | Ga0496117_0114986 | 3300048920 | Bacteria | 1666 |
| 944 | Ga0496118_0023463 | 3300048921 | Bacteria | 5357 |
| 945 | Ga0496118_0070259 | 3300048921 | Bacteria | 2529 |
| 946 | Ga0496118_0139684 | 3300048921 | Bacteria | 1538 |
| 947 | Ga0496119_0017168 | 3300048922 | Bacteria | 5461 |
| 948 | Ga0496119_0026563 | 3300048922 | Bacteria | 4011 |
| 949 | Ga0496119_0147843 | 3300048922 | Bacteria | 1262 |
| 950 | Ga0496120_0014853 | 3300048923 | Bacteria | 5164 |
| 951 | Ga0496121_0000479 | 3300048924 | Bacteria | 77608 |
| 952 | Ga0496121_0016763 | 3300048924 | Bacteria | 7537 |
| 953 | Ga0496121_0049646 | 3300048924 | Bacteria | 3555 |
| 954 | Ga0496121_0108493 | 3300048924 | Bacteria | 2123 |
| 955 | Ga0496121_0161557 | 3300048924 | Bacteria | 1637 |
| 956 | Ga0496122_0000217 | 3300048925 | Bacteria | 128502 |
| 957 | Ga0496122_0000669 | 3300048925 | Bacteria | 68904 |
| 958 | Ga0496122_0003097 | 3300048925 | Bacteria | 22353 |
| 959 | Ga0496122_0003536 | 3300048925 | Bacteria | 20449 |
| 960 | Ga0496122_0012827 | 3300048925 | Bacteria | 8288 |
| 961 | Ga0496122_0046214 | 3300048925 | Bacteria | 3374 |
| 962 | Ga0496123_0000057 | 3300048926 | Bacteria | 228608 |
| 963 | Ga0496123_0000603 | 3300048926 | Bacteria | 61111 |
| 964 | Ga0496123_0005860 | 3300048926 | Bacteria | 12169 |
| 965 | Ga0496123_0017368 | 3300048926 | Bacteria | 5791 |
| 966 | Ga0496123_0029483 | 3300048926 | Bacteria | 4038 |
| 967 | Ga0496124_0052640 | 3300048927 | Bacteria | 3457 |
| 968 | Ga0496124_0073690 | 3300048927 | Bacteria | 2824 |
| 969 | Ga0496124_0087189 | 3300048927 | Bacteria | 2553 |
| 970 | Ga0496124_0121197 | 3300048927 | Bacteria | 2090 |
| 971 | Ga0496124_0282098 | 3300048927 | Bacteria | 1210 |
| 972 | Ga0496125_0000168 | 3300048928 | Bacteria | 146364 |
| 973 | Ga0496125_0000323 | 3300048928 | Bacteria | 93243 |
| 974 | Ga0496125_0001023 | 3300048928 | Bacteria | 43458 |
| 975 | Ga0496125_0023979 | 3300048928 | Bacteria | 5620 |
| 976 | Ga0496125_0025456 | 3300048928 | Bacteria | 5417 |
| 977 | Ga0496125_0030089 | 3300048928 | Bacteria | 4863 |
| 978 | Ga0496125_0050199 | 3300048928 | Bacteria | 3456 |
| 979 | Ga0496125_0064894 | 3300048928 | Bacteria | 2897 |
| 980 | Ga0496125_0207534 | 3300048928 | Bacteria | 1276 |
| 981 | Ga0496126_0016753 | 3300048929 | Bacteria | 7319 |
| 982 | Ga0496126_0123726 | 3300048929 | Bacteria | 2240 |
| 983 | Ga0496126_0162140 | 3300048929 | Bacteria | 1910 |
| 984 | nmdc:mga03683_167353_c1 | 3300050489 | Bacteria | 998 |
| 985 | nmdc:mga03683_3206_c1 | 3300050489 | Bacteria | 5230 |
| 986 | nmdc:mga03683_42761_c1 | 3300050489 | Bacteria | 1866 |
| 987 | nmdc:mga03683_67440_c1 | 3300050489 | Bacteria | 1523 |
| 988 | nmdc:mga03683_95159_c1 | 3300050489 | Bacteria | 1303 |
| 989 | nmdc:mga03n38_54907_c1 | 3300050490 | Bacteria | 1792 |
| 990 | nmdc:mga00v17_20825_c1 | 3300050491 | Bacteria | 3762 |
| 991 | nmdc:mga0yw44_70118_c1 | 3300050492 | Bacteria | 2173 |
| 992 | nmdc:mga0k408_132207_c1 | 3300050493 | Bacteria | 1482 |
| 993 | nmdc:mga0k408_3141_c1 | 3300050493 | Bacteria | 8757 |
| 994 | nmdc:mga0k408_42063_c1 | 3300050493 | Bacteria | 2632 |
| 995 | nmdc:mga0k408_86130_c1 | 3300050493 | Bacteria | 1844 |
| 996 | nmdc:mga06z11_79686_c1 | 3300050494 | Bacteria | 1754 |
| 997 | nmdc:mga07m45_14323_c1 | 3300050496 | Bacteria | 3809 |
| 998 | nmdc:mga07m45_17804_c1 | 3300050496 | Bacteria | 3823 |
| 999 | nmdc:mga07m45_3635_c1 | 3300050496 | Bacteria | 7450 |
| 1000 | nmdc:mga07m45_50012_c1 | 3300050496 | Bacteria | 2355 |
| 1001 | nmdc:mga07m45_686_c1 | 3300050496 | Bacteria | 14388 |
| 1002 | nmdc:mga07m45_7718_c1 | 3300050496 | Bacteria | 5505 |
| 1003 | nmdc:mga05p37_228483_c1 | 3300050507 | Bacteria | 2243 |
| 1004 | nmdc:mga05p37_2709_c2 | 3300050507 | Bacteria | 16162 |
| 1005 | nmdc:mga09592_271113_c1 | 3300050508 | Bacteria | 1472 |
| 1006 | nmdc:mga09592_605991_c1 | 3300050508 | Bacteria | 938 |
| 1007 | nmdc:mga09592_9202_c1 | 3300050508 | Bacteria | 8035 |
| 1008 | nmdc:mga0qj67_417732_c1 | 3300050509 | Bacteria | 1081 |
| 1009 | nmdc:mga06r32_458823_c1 | 3300050510 | Bacteria | 1253 |
| 1010 | nmdc:mga0n895_68479_c1 | 3300050512 | Bacteria | 3516 |
| 1011 | nmdc:mga0a205_9315_c1 | 3300050515 | Bacteria | 8967 |
| 1012 | nmdc:mga0sz30_123953_c1 | 3300050516 | Bacteria | 1136 |
| 1013 | nmdc:mga0sz30_6916_c1 | 3300050516 | Bacteria | 4235 |
| 1014 | Ga0500610_0000489 | 3300053079 | Bacteria | 12171 |
| 1015 | Ga0495619_0185339 | 3300053085 | Bacteria | 1440 |
| 1016 | Ga0500644_0053915 | 3300053088 | Bacteria | 1390 |
| 1017 | Ga0500647_0133216 | 3300053091 | Bacteria | 1171 |
| 1018 | Ga0500651_0045805 | 3300053093 | Bacteria | 2751 |
| 1019 | Ga0500650_0046871 | 3300053098 | Bacteria | 2003 |
| 1020 | Ga0500571_010381 | 3300053110 | Bacteria | 5144 |
| 1021 | Ga0500593_005223 | 3300053117 | Bacteria | 5093 |
| 1022 | Ga0500594_0003123 | 3300053118 | Bacteria | 3623 |
| 1023 | Ga0500607_007771 | 3300053121 | Bacteria | 6586 |
| 1024 | Ga0500608_035205 | 3300053122 | Bacteria | 2388 |
| 1025 | Ga0500655_006844 | 3300053133 | Bacteria | 2052 |
| 1026 | Ga0500658_0001265 | 3300053134 | Bacteria | 10249 |
| 1027 | Ga0500658_0002137 | 3300053134 | Bacteria | 7686 |
| 1028 | Ga0500658_0130232 | 3300053134 | Bacteria | 1121 |
| 1029 | Ga0500559_0005433 | 3300053136 | Bacteria | 5861 |
| 1030 | Ga0500568_0001949 | 3300053139 | Bacteria | 12653 |
| 1031 | Ga0500627_0022906 | 3300053158 | Bacteria | 2540 |
| 1032 | Ga0500634_0065523 | 3300053161 | Bacteria | 1916 |
| 1033 | Ga0500637_0005139 | 3300053178 | Bacteria | 6306 |
| 1034 | Ga0500645_000198 | 3300053730 | Bacteria | 46701 |
| 1035 | Ga0500645_000493 | 3300053730 | Bacteria | 26655 |
| 1036 | Ga0500645_011097 | 3300053730 | Bacteria | 2954 |
| 1037 | Ga0500587_000066 | 3300053739 | Bacteria | 8567 |
| 1038 | 2511245932 | 2511231002 | Bacteria | 5042903 |
| 1039 | 2512036213 | 2511231221 | Bacteria | 6846400 |
| 1040 | 2513231799 | 2513020051 | Bacteria | 6053213 |
| 1041 | 2548497399 | 2547132374 | Bacteria | 5530232 |
| 1042 | 2587757178 | 2585428062 | Bacteria | 6842168 |
| 1043 | 2599101933 | 2597490356 | Bacteria | 7030811 |
| 1044 | 2599626662 | 2599185214 | Bacteria | 8209958 |
| 1045 | 2599675726 | 2599185226 | Bacteria | 8233575 |
| 1046 | 2599684199 | 2599185227 | Bacteria | 8246414 |
| 1047 | 2599696213 | 2599185229 | Bacteria | 8216126 |
| 1048 | 2599902927 | 2599185292 | Bacteria | 6290804 |
| 1049 | 2643861750 | 2643221569 | Bacteria | 6064337 |
| 1050 | 2643866565 | 2643221570 | Bacteria | 5103772 |
| 1051 | 2643983215 | 2643221594 | Bacteria | 5811388 |
| 1052 | 2643993317 | 2643221596 | Bacteria | 5006805 |
| 1053 | 2644060686 | 2643221609 | Bacteria | 6756331 |
| 1054 | 2644074006 | 2643221611 | Bacteria | 6820941 |
| 1055 | 2644123476 | 2643221621 | Bacteria | 6212786 |
| 1056 | 2644159576 | 2643221628 | Bacteria | 5745828 |
| 1057 | 2644294078 | 2643221652 | Bacteria | 5140275 |
| 1058 | 2644303759 | 2643221654 | Bacteria | 5273570 |
| 1059 | 2644327938 | 2643221658 | Bacteria | 6064537 |
| 1060 | 2644397900 | 2643221672 | Bacteria | 6322190 |
| 1061 | 2644468259 | 2643221683 | Bacteria | 5749203 |
| 1062 | 2644646251 | 2643221717 | Bacteria | 5676132 |
| 1063 | 2738718081 | 2738541277 | Bacteria | 7458140 |
| 1064 | 2738885020 | 2738541307 | Bacteria | 8606193 |
| 1065 | 2739242712 | 2738543012 | Bacteria | 7115078 |
| 1066 | 2739250458 | 2738543013 | Bacteria | 5618633 |
| 1067 | 2739278767 | 2738543019 | Bacteria | 7459457 |
| 1068 | 2753357601 | 2751185800 | Bacteria | 5467370 |
| 1069 | 2758640098 | 2758568016 | Bacteria | 5645291 |
| 1070 | 2809033260 | 2808606395 | Bacteria | 6020352 |
| 1071 | 2816472972 | 2816332133 | Bacteria | 7249298 |
| 1072 | 2819595772 | 2818991446 | Bacteria | 7757362 |
| 1073 | 2831266783 | 2831265667 | Bacteria | 7184833 |
| 1074 | 2838057136 | 2838054893 | Bacteria | 7451788 |
| 1075 | 2842335006 | 2842333319 | Bacteria | 8899485 |
| 1076 | 2842682576 | 2842677519 | Bacteria | 5615038 |
| 1077 | 2842735584 | 2842733646 | Bacteria | 5716726 |
| 1078 | 2842751321 | 2842747753 | Bacteria | 5578255 |
| 1079 | 2846958079 | 2846952575 | Bacteria | 6587527 |
| 1080 | 2848864859 | 2848858292 | Bacteria | 7391279 |
| 1081 | 2854913334 | 2854911287 | Bacteria | 5582813 |
| 1082 | 2857538241 | 2857537821 | Bacteria | 5248181 |
| 1083 | 2857580794 | 2857576091 | Bacteria | 5465855 |
| 1084 | 2858952051 | 2858950400 | Bacteria | 6783797 |
| 1085 | 2885192725 | 2885192300 | Bacteria | 5882526 |
| 1086 | 2885201232 | 2885198086 | Bacteria | 7212419 |
| 1087 | 2885214886 | 2885211737 | Bacteria | 7212420 |
| 1088 | 2894027683 | 2894023352 | Bacteria | 5167372 |
| 1089 | 2897805876 | 2897803580 | Bacteria | 7000062 |
| 1090 | 2899925118 | 2899924645 | Bacteria | 7487985 |
| 1091 | 2904454452 | 2904449895 | Bacteria | 6927402 |
| 1092 | 2904461105 | 2904456579 | Bacteria | 6819253 |
| 1093 | 2904544741 | 2904541872 | Bacteria | 8915136 |
| 1094 | 2919465982 | 2919462493 | Bacteria | 5817112 |
| 1095 | 2919707444 | 2919704043 | Bacteria | 5560311 |
| 1096 | 2928038757 | 2928037797 | Bacteria | 7273642 |
| 1097 | 2928045638 | 2928044640 | Bacteria | 7271509 |
| 1098 | 2928053255 | 2928051484 | Bacteria | 7773759 |
| 1099 | 2928066860 | 2928064002 | Bacteria | 7419480 |
| 1100 | 2928071254 | 2928070936 | Bacteria | 8062541 |
| 1101 | 2928084817 | 2928084124 | Bacteria | 7159212 |
| 1102 | 2928119626 | 2928115317 | Bacteria | 6477646 |
| 1103 | 2929163588 | 2929160207 | Bacteria | 9075316 |
| 1104 | 2929526987 | 2929520902 | Bacteria | 6765052 |
| 1105 | 2932425138 | 2932422444 | Bacteria | 4678430 |
| 1106 | 2941482490 | |||
| 1107 | 2945912275 | 2945909444 | Bacteria | 7065066 |
| 1108 | 2945948209 | 2945945610 | Bacteria | 5951079 |
| 1109 | 2945985414 | 2945984333 | Bacteria | 7358892 |
| 1110 | 2954772326 | 2954767861 | Bacteria | 5535784 |
| 1111 | 2974323373 | 2974320154 | Bacteria | 4571377 |
| 1112 | 2990712248 | 2990710928 | Bacteria | 5002431 |
| 1113 | 8054008479 | 8054002106 | Bacteria | 7987183 |
| 1114 | Ga0070678_100004479 | |||
| 1115 | SwRhRL2b_contig_2666113 | |||
| 1116 | JGI24749J21850_1004017 | |||
| 1117 | JGI25155J39150_1000002 | |||
| 1118 | JGI25156J39149_1000003 | |||
| 1119 | JGI25154J39366_1000009 | |||
| 1120 | JGI25157J39369_1000002 | |||
| 1121 | JGI25152J39213_1001234 | |||
| 1122 | JGI25150J39212_1000784 | |||
| 1123 | JGI25159J45721_1000148 | |||
| 1124 | JGI25159J45721_1001075 | |||
| 1125 | JGI25159J45721_1023052 | |||
| 1126 | JGI25151J46595_10001070 | |||
| 1127 | JGI25151J46595_10002632 | |||
| 1128 | JGI25151J46595_10011867 | |||
| 1129 | JGI25151J46595_10024513 | |||
| 1130 | JGI25151J46595_10043128 | |||
| 1131 | JGI25153J46596_10001727 | |||
| 1132 | JGI25153J46596_10001768 | |||
| 1133 | JGI25160J50197_1000123 | |||
| 1134 | JGI25160J50197_1009409 | |||
| 1135 | JGI25161J50226_1000032 | |||
| 1136 | JGI25161J50226_1001050 | |||
| 1137 | Ga0055542_1000021 | |||
| 1138 | Ga0055526_1001458 | |||
| 1139 | Ga0055526_1002300 | |||
| 1140 | Ga0055526_1002744 | |||
| 1141 | Ga0055526_1003550 | |||
| 1142 | Ga0055526_1003943 | |||
| 1143 | Ga0055526_1007340 | |||
| 1144 | Ga0055526_1010696 | |||
| 1145 | Ga0055537_1000079 | |||
| 1146 | Ga0055537_1003026 | |||
| 1147 | Ga0055524_1000012 | |||
| 1148 | Ga0055524_1000097 | |||
| 1149 | Ga0055524_1000987 | |||
| 1150 | Ga0055524_1001542 | |||
| 1151 | Ga0055524_1001822 | |||
| 1152 | Ga0055536_1000657 | |||
| 1153 | Ga0055536_1000861 | |||
| 1154 | Ga0055536_1001022 | |||
| 1155 | Ga0055536_1001230 | |||
| 1156 | Ga0055536_1005409 | |||
| 1157 | Ga0055536_1008299 | |||
| 1158 | Ga0055536_1009066 | |||
| 1159 | Ga0055534_1000092 | |||
| 1160 | Ga0055534_1001022 | |||
| 1161 | Ga0055534_1001081 | |||
| 1162 | Ga0055534_1001381 | |||
| 1163 | Ga0055534_1004666 | |||
| 1164 | Ga0055528_1000956 | |||
| 1165 | Ga0055528_1002291 | |||
| 1166 | Ga0055528_1009159 | |||
| 1167 | Ga0055530_10000453 | |||
| 1168 | Ga0055530_10000793 | |||
| 1169 | Ga0055530_10017436 | |||
| 1170 | Ga0055540_1000012 | |||
| 1171 | Ga0055540_1001467 | |||
| 1172 | Ga0055540_1002293 | |||
| 1173 | Ga0055531_10000653 | |||
| 1174 | Ga0055531_10001541 | |||
| 1175 | Ga0055543_1000294 | |||
| 1176 | Ga0055543_1000696 | |||
| 1177 | Ga0065165_1002228 | |||
| 1178 | Ga0065165_1012757 | |||
| 1179 | Ga0065165_1012901 | |||
| 1180 | Ga0065704_10011989 | |||
| 1181 | Ga0065712_10148324 | |||
| 1182 | Ga0065715_10125828 | |||
| 1183 | Ga0065715_10129220 | |||
| 1184 | Ga0070676_10014907 | |||
| 1185 | Ga0070676_10035845 | |||
| 1186 | Ga0070676_10079487 | |||
| 1187 | Ga0070676_10283737 | |||
| 1188 | Ga0070683_100023735 | |||
| 1189 | Ga0070690_100003489 | |||
| 1190 | Ga0070690_100056744 | |||
| 1191 | Ga0070690_100110902 | |||
| 1192 | Ga0070670_100001483 | |||
| 1193 | Ga0070670_100002742 | |||
| 1194 | Ga0070670_100007028 | |||
| 1195 | Ga0070670_100008068 | |||
| 1196 | Ga0070670_100037126 | |||
| 1197 | Ga0070670_100066159 | |||
| 1198 | Ga0070670_100084979 | |||
| 1199 | Ga0070670_100113866 | |||
| 1200 | Ga0070677_10002129 | |||
| 1201 | Ga0070677_10022565 | |||
| 1202 | Ga0070677_10030335 | |||
| 1203 | Ga0070677_10040639 | |||
| 1204 | Ga0070677_10080223 | |||
| 1205 | Ga0070677_10083395 | |||
| 1206 | Ga0068869_100000178 | |||
| 1207 | Ga0068869_100009675 | |||
| 1208 | Ga0068869_100042331 | |||
| 1209 | Ga0068869_100091902 | |||
| 1210 | Ga0070666_10014344 | |||
| 1211 | Ga0070666_10025971 | |||
| 1212 | Ga0070666_10074039 | |||
| 1213 | Ga0070666_10088379 | |||
| 1214 | Ga0070666_10276568 | |||
| 1215 | Ga0070680_100143639 | |||
| 1216 | Ga0068868_100005608 | |||
| 1217 | Ga0068868_100068148 | |||
| 1218 | Ga0068868_100092542 | |||
| 1219 | Ga0070687_100006353 | |||
| 1220 | Ga0070661_100003091 | |||
| 1221 | Ga0070661_100014055 | |||
| 1222 | Ga0070661_100090249 | |||
| 1223 | Ga0070661_100431373 | |||
| 1224 | Ga0070692_10049561 | |||
| 1225 | Ga0070668_100004619 | |||
| 1226 | Ga0070668_100034232 | |||
| 1227 | Ga0070668_100053700 | |||
| 1228 | Ga0070668_100065909 | |||
| 1229 | Ga0070668_100078177 | |||
| 1230 | Ga0070668_100103436 | |||
| 1231 | Ga0070668_100177094 | |||
| 1232 | Ga0070669_100008927 | |||
| 1233 | Ga0070669_100015579 | |||
| 1234 | Ga0070669_100018890 | |||
| 1235 | Ga0070669_100065009 | |||
| 1236 | Ga0070669_100098538 | |||
| 1237 | Ga0070669_100113582 | |||
| 1238 | Ga0070669_100178562 | |||
| 1239 | Ga0070675_100001733 | |||
| 1240 | Ga0070675_100014191 | |||
| 1241 | Ga0070675_100020917 | |||
| 1242 | Ga0070675_100033094 | |||
| 1243 | Ga0070675_100080936 | |||
| 1244 | Ga0070675_100364892 | |||
| 1245 | Ga0070671_100004476 | |||
| 1246 | Ga0070671_100015093 | |||
| 1247 | Ga0070671_100020848 | |||
| 1248 | Ga0070671_100025674 | |||
| 1249 | Ga0070671_100063486 | |||
| 1250 | Ga0070671_100269750 | |||
| 1251 | Ga0070674_100024203 | |||
| 1252 | Ga0070674_100036087 | |||
| 1253 | Ga0070674_100047128 | |||
| 1254 | Ga0070674_100056035 | |||
| 1255 | Ga0070674_100075904 | |||
| 1256 | Ga0070674_100139183 | |||
| 1257 | Ga0070674_100152914 | |||
| 1258 | Ga0070673_100009444 | |||
| 1259 | Ga0070673_100017776 | |||
| 1260 | Ga0070673_100056382 | |||
| 1261 | Ga0070673_100205263 | |||
| 1262 | Ga0070688_100009048 | |||
| 1263 | Ga0070688_100025675 | |||
| 1264 | Ga0070659_100017155 | |||
| 1265 | Ga0070659_100332341 | |||
| 1266 | Ga0070667_100001198 | |||
| 1267 | Ga0070667_100018482 | |||
| 1268 | Ga0070667_100023441 | |||
| 1269 | Ga0070667_100120129 | |||
| 1270 | Ga0070667_100223216 | |||
| 1271 | Ga0070667_100255016 | |||
| 1272 | Ga0070705_100318140 | |||
| 1273 | Ga0070700_100004393 | |||
| 1274 | Ga0070700_100103998 | |||
| 1275 | Ga0070694_100150561 | |||
| 1276 | Ga0070663_100027541 | |||
| 1277 | Ga0070678_100013926 | |||
| 1278 | Ga0070678_100016709 | |||
| 1279 | Ga0070678_100040672 | |||
| 1280 | Ga0070678_100061942 | |||
| 1281 | Ga0070678_100283497 | |||
| 1282 | Ga0070662_100003994 | |||
| 1283 | Ga0070662_100005238 | |||
| 1284 | Ga0070662_100013360 | |||
| 1285 | Ga0070662_100116545 | |||
| 1286 | Ga0070681_10097261 | |||
| 1287 | Ga0068867_100000273 | |||
| 1288 | Ga0068867_100005155 | |||
| 1289 | Ga0068867_100031942 | |||
| 1290 | Ga0068867_100061662 | |||
| 1291 | Ga0068867_100091081 | |||
| 1292 | Ga0068867_100201226 | |||
| 1293 | Ga0068867_100261268 | |||
| 1294 | Ga0070685_10078150 | |||
| 1295 | Ga0070699_100413942 | |||
| 1296 | Ga0070679_100329255 | |||
| 1297 | Ga0068853_100014373 | |||
| 1298 | Ga0070672_100004667 | |||
| 1299 | Ga0070672_100027843 | |||
| 1300 | Ga0070672_100047555 | |||
| 1301 | Ga0070672_100049824 | |||
| 1302 | Ga0070672_100065484 | |||
| 1303 | Ga0070672_100281148 | |||
| 1304 | Ga0070672_100310324 | |||
| 1305 | Ga0070686_100051186 | |||
| 1306 | Ga0070686_100124845 | |||
| 1307 | Ga0070665_100001639 | |||
| 1308 | Ga0070665_100035254 | |||
| 1309 | Ga0070665_100088396 | |||
| 1310 | Ga0070665_100148512 | |||
| 1311 | Ga0070665_100351009 | |||
| 1312 | Ga0070704_100186982 | |||
| 1313 | Ga0068855_100031834 | |||
| 1314 | Ga0068855_100046637 | |||
| 1315 | Ga0068855_100051726 | |||
| 1316 | Ga0070664_100004590 | |||
| 1317 | Ga0070664_100005648 | |||
| 1318 | Ga0070664_100013082 | |||
| 1319 | Ga0070664_100023188 | |||
| 1320 | Ga0070664_100106699 | |||
| 1321 | Ga0070664_100112024 | |||
| 1322 | Ga0070664_100172815 | |||
| 1323 | Ga0070664_100176528 | |||
| 1324 | Ga0070664_100413950 | |||
| 1325 | Ga0068857_100001689 | |||
| 1326 | Ga0068857_100074298 | |||
| 1327 | Ga0068857_100088217 | |||
| 1328 | Ga0068857_100202659 | |||
| 1329 | Ga0068854_100013238 | |||
| 1330 | Ga0068854_100023805 | |||
| 1331 | Ga0068854_100541336 | |||
| 1332 | Ga0068856_100028024 | |||
| 1333 | Ga0068856_100193519 | |||
| 1334 | Ga0068856_100409959 | |||
| 1335 | Ga0068852_100012178 | |||
| 1336 | Ga0068852_100174244 | |||
| 1337 | Ga0068852_100201849 | |||
| 1338 | Ga0068852_100229881 | |||
| 1339 | Ga0068852_100255704 | |||
| 1340 | Ga0068852_100657862 | |||
| 1341 | Ga0068859_100007644 | |||
| 1342 | Ga0068859_100010715 | |||
| 1343 | Ga0068859_100121908 | |||
| 1344 | Ga0068859_100137430 | |||
| 1345 | Ga0068859_100165593 | |||
| 1346 | Ga0068859_100579609 | |||
| 1347 | Ga0068864_100000199 | |||
| 1348 | Ga0068864_100002200 | |||
| 1349 | Ga0068864_100004274 | |||
| 1350 | Ga0068864_100031330 | |||
| 1351 | Ga0068864_100032954 | |||
| 1352 | Ga0068864_100159549 | |||
| 1353 | Ga0068864_100189564 | |||
| 1354 | Ga0068864_100228543 | |||
| 1355 | Ga0068864_100247873 | |||
| 1356 | Ga0068866_10030595 | |||
| 1357 | Ga0068866_10037416 | |||
| 1358 | Ga0068861_100001618 | |||
| 1359 | Ga0068861_100002547 | |||
| 1360 | Ga0068861_100047800 | |||
| 1361 | Ga0068861_100233701 | |||
| 1362 | Ga0068851_10001589 | |||
| 1363 | Ga0068851_10032507 | |||
| 1364 | Ga0068851_10091791 | |||
| 1365 | Ga0068870_10160924 | |||
| 1366 | Ga0068863_100001289 | |||
| 1367 | Ga0068863_100001708 | |||
| 1368 | Ga0068863_100002680 | |||
| 1369 | Ga0068863_100101116 | |||
| 1370 | Ga0068863_100117284 | |||
| 1371 | Ga0068863_100196470 | |||
| 1372 | Ga0068863_100286672 | |||
| 1373 | Ga0068863_100336087 | |||
| 1374 | Ga0068858_100000413 | |||
| 1375 | Ga0068858_100018789 | |||
| 1376 | Ga0068858_100023951 | |||
| 1377 | Ga0068858_100041553 | |||
| 1378 | Ga0068858_100253568 | |||
| 1379 | Ga0068860_100004285 | |||
| 1380 | Ga0068860_100011743 | |||
| 1381 | Ga0068860_100035293 | |||
| 1382 | Ga0068860_100096647 | |||
| 1383 | Ga0068860_100150843 | |||
| 1384 | Ga0068860_100226399 | |||
| 1385 | Ga0068860_100319082 | |||
| 1386 | Ga0068862_100004502 | |||
| 1387 | Ga0068862_100011044 | |||
| 1388 | Ga0068862_100011483 | |||
| 1389 | Ga0068862_100017703 | |||
| 1390 | Ga0068862_100054515 | |||
| 1391 | Ga0068862_100098560 | |||
| 1392 | Ga0068862_100252081 | |||
| 1393 | Ga0068862_100404321 | |||
| 1394 | Ga0075365_10003595 | |||
| 1395 | Ga0075365_10127344 | |||
| 1396 | Ga0075368_10050796 | |||
| 1397 | Ga0075363_100028997 | |||
| 1398 | Ga0075364_10049617 | |||
| 1399 | Ga0075362_10008388 | |||
| 1400 | Ga0075362_10031282 | |||
| 1401 | Ga0075362_10086289 | |||
| 1402 | Ga0075362_10090512 | |||
| 1403 | Ga0075367_10059581 | |||
| 1404 | Ga0075367_10096874 | |||
| 1405 | Ga0075369_10050690 | |||
| 1406 | Ga0075369_10091043 | |||
| 1407 | Ga0075366_10010337 | |||
| 1408 | Ga0075366_10015004 | |||
| 1409 | Ga0075366_10031279 | |||
| 1410 | Ga0075366_10047615 | |||
| 1411 | Ga0075366_10076667 | |||
| 1412 | Ga0075366_10091349 | |||
| 1413 | Ga0075366_10186449 | |||
| 1414 | Ga0097621_100034225 | |||
| 1415 | Ga0097621_100048219 | |||
| 1416 | Ga0097621_100051615 | |||
| 1417 | Ga0097621_100054844 | |||
| 1418 | Ga0097621_100130979 | |||
| 1419 | Ga0097621_100318597 | |||
| 1420 | Ga0075370_10000555 | |||
| 1421 | Ga0075370_10024221 | |||
| 1422 | Ga0075370_10026443 | |||
| 1423 | Ga0075370_10036658 | |||
| 1424 | Ga0075370_10049636 | |||
| 1425 | Ga0075370_10052918 | |||
| 1426 | Ga0075370_10201756 | |||
| 1427 | Ga0068871_100011783 | |||
| 1428 | Ga0068871_100028695 | |||
| 1429 | Ga0068871_100102571 | |||
| 1430 | Ga0068871_100157237 | |||
| 1431 | Ga0068871_100215272 | |||
| 1432 | Ga0075428_100116147 | |||
| 1433 | Ga0075428_100116379 | |||
| 1434 | Ga0075430_100262382 | |||
| 1435 | Ga0075434_100124212 | |||
| 1436 | Ga0075429_100277178 | |||
| 1437 | Ga0075429_100365368 | |||
| 1438 | Ga0068865_100028724 | |||
| 1439 | Ga0068865_100077194 | |||
| 1440 | Ga0097620_100007644 | |||
| 1441 | Ga0097620_100010715 | |||
| 1442 | Ga0097620_100121912 | |||
| 1443 | Ga0097620_100137423 | |||
| 1444 | Ga0097620_100165591 | |||
| 1445 | Ga0097620_100579591 | |||
| 1446 | Ga0079104_1000019 | |||
| 1447 | Ga0099826_10000027 | |||
| 1448 | Ga0099826_10006221 | |||
| 1449 | Ga0105244_10000965 | |||
| 1450 | Ga0105240_10018468 | |||
| 1451 | Ga0105240_10219187 | |||
| 1452 | Ga0111539_10207790 | |||
| 1453 | Ga0105245_10012088 | |||
| 1454 | Ga0105245_10396835 | |||
| 1455 | Ga0105247_10416447 | |||
| 1456 | Ga0114129_10032558 | |||
| 1457 | Ga0114129_10457835 | |||
| 1458 | Ga0105243_10001682 | |||
| 1459 | Ga0105243_10004695 | |||
| 1460 | Ga0105243_10043521 | |||
| 1461 | Ga0105243_10141731 | |||
| 1462 | Ga0105243_10145806 | |||
| 1463 | Ga0105243_10147041 | |||
| 1464 | Ga0105243_10281602 | |||
| 1465 | Ga0105241_10190773 | |||
| 1466 | Ga0105242_10019130 | |||
| 1467 | Ga0105242_10026470 | |||
| 1468 | Ga0105242_10122447 | |||
| 1469 | Ga0105242_10571759 | |||
| 1470 | Ga0105248_10003661 | |||
| 1471 | Ga0105248_10006013 | |||
| 1472 | Ga0105248_10074417 | |||
| 1473 | Ga0105248_10152277 | |||
| 1474 | Ga0105237_10001628 | |||
| 1475 | Ga0105237_10097306 | |||
| 1476 | Ga0105237_10106835 | |||
| 1477 | Ga0105237_10295838 | |||
| 1478 | Ga0105238_10093980 | |||
| 1479 | Ga0105249_10029237 | |||
| 1480 | Ga0105249_10099373 | |||
| 1481 | Ga0105249_10203716 | |||
| 1482 | Ga0105249_10269646 | |||
| 1483 | Ga0105249_10296283 | |||
| 1484 | Ga0105239_10001684 | |||
| 1485 | Ga0105239_10605511 | |||
| 1486 | Ga0105246_10107068 | |||
| 1487 | Ga0157369_10016621 | |||
| 1488 | Ga0157369_10181105 | |||
| 1489 | Ga0157374_10010969 | |||
| 1490 | Ga0157374_10294593 | |||
| 1491 | Ga0157374_10297913 | |||
| 1492 | Ga0157374_10497260 | |||
| 1493 | Ga0157378_10004470 | |||
| 1494 | Ga0157378_10039364 | |||
| 1495 | Ga0157378_10081937 | |||
| 1496 | Ga0157378_10193818 | |||
| 1497 | Ga0163162_10008437 | |||
| 1498 | Ga0163162_10045471 | |||
| 1499 | Ga0163162_10106036 | |||
| 1500 | Ga0163162_10141004 | |||
| 1501 | Ga0163162_10682703 | |||
| 1502 | Ga0157372_10076681 | |||
| 1503 | Ga0157372_10204874 | |||
| 1504 | Ga0157372_10225279 | |||
| 1505 | Ga0157372_10757061 | |||
| 1506 | Ga0157375_10032335 | |||
| 1507 | Ga0157375_10050218 | |||
| 1508 | Ga0157375_10067123 | |||
| 1509 | Ga0157375_10094008 | |||
| 1510 | Ga0157375_10234111 | |||
| 1511 | Ga0157375_10250551 | |||
| 1512 | Ga0157375_10305054 | |||
| 1513 | Ga0157375_10492337 | |||
| 1514 | Ga0163163_10001130 | |||
| 1515 | Ga0163163_10009364 | |||
| 1516 | Ga0163163_10073498 | |||
| 1517 | Ga0163163_10079344 | |||
| 1518 | Ga0163163_10107903 | |||
| 1519 | Ga0157380_10026504 | |||
| 1520 | Ga0157380_10033826 | |||
| 1521 | Ga0157380_10034112 | |||
| 1522 | Ga0157380_10112611 | |||
| 1523 | Ga0157380_10134768 | |||
| 1524 | Ga0157380_10163276 | |||
| 1525 | Ga0182008_10009302 | |||
| 1526 | Ga0182008_10019759 | |||
| 1527 | Ga0182008_10047686 | |||
| 1528 | Ga0157377_10013130 | |||
| 1529 | Ga0157379_10010513 | |||
| 1530 | Ga0157379_10025218 | |||
| 1531 | Ga0157379_10037328 | |||
| 1532 | Ga0157379_10045346 | |||
| 1533 | Ga0157379_10078733 | |||
| 1534 | Ga0157379_10094540 | |||
| 1535 | Ga0157379_10246802 | |||
| 1536 | Ga0157376_10008722 | |||
| 1537 | Ga0157376_10068333 | |||
| 1538 | Ga0157376_10158997 | |||
| 1539 | Ga0157376_10200191 | |||
| 1540 | Ga0157376_10206137 | |||
| 1541 | Ga0182006_1001032 | |||
| 1542 | Ga0182007_10000366 | |||
| 1543 | Ga0182007_10011494 | |||
| 1544 | Ga0183362_10001 | |||
| 1545 | Ga0163161_10001014 | |||
| 1546 | Ga0163161_10018424 | |||
| 1547 | Ga0163161_10038391 | |||
| 1548 | Ga0163161_10133045 | |||
| 1549 | Ga0209435_100001 | |||
| 1550 | Ga0209672_100665 | |||
| 1551 | Ga0209147_101220 | |||
| 1552 | Ga0209258_100058 | |||
| 1553 | Ga0207425_1000733 | |||
| 1554 | Ga0207425_1002759 | |||
| 1555 | Ga0209646_1000001 | |||
| 1556 | Ga0209026_1000003 | |||
| 1557 | Ga0209148_1000071 | |||
| 1558 | Ga0209759_1000001 | |||
| 1559 | Ga0209129_1000023 | |||
| 1560 | Ga0209129_1001044 | |||
| 1561 | Ga0209129_1004583 | |||
| 1562 | Ga0209565_1000004 | |||
| 1563 | Ga0209565_1000073 | |||
| 1564 | Ga0209565_1000187 | |||
| 1565 | Ga0209565_1000912 | |||
| 1566 | Ga0209565_1005208 | |||
| 1567 | Ga0209673_1000066 | |||
| 1568 | Ga0209673_1000074 | |||
| 1569 | Ga0209673_1000127 | |||
| 1570 | Ga0209673_1000389 | |||
| 1571 | Ga0209673_1002877 | |||
| 1572 | Ga0209130_1000050 | |||
| 1573 | Ga0209130_1000069 | |||
| 1574 | Ga0209130_1000082 | |||
| 1575 | Ga0209675_1000029 | |||
| 1576 | Ga0209675_1000044 | |||
| 1577 | Ga0209675_1000226 | |||
| 1578 | Ga0209675_1000232 | |||
| 1579 | Ga0209675_1005829 | |||
| 1580 | Ga0209675_1008851 | |||
| 1581 | Ga0209675_1009803 | |||
| 1582 | Ga0209676_1000005 | |||
| 1583 | Ga0209676_1000029 | |||
| 1584 | Ga0209676_1000083 | |||
| 1585 | Ga0209676_1000142 | |||
| 1586 | Ga0209676_1001525 | |||
| 1587 | Ga0209676_1007840 | |||
| 1588 | Ga0209676_1008694 | |||
| 1589 | Ga0209676_1010602 | |||
| 1590 | Ga0209676_1029646 | |||
| 1591 | Ga0209025_1000316 | |||
| 1592 | Ga0209025_1000351 | |||
| 1593 | Ga0209025_1000583 | |||
| 1594 | Ga0209025_1000766 | |||
| 1595 | Ga0209025_1001156 | |||
| 1596 | Ga0209025_1002301 | |||
| 1597 | Ga0209025_1005031 | |||
| 1598 | Ga0209025_1021697 | |||
| 1599 | Ga0209025_1023162 | |||
| 1600 | Ga0209025_1023652 | |||
| 1601 | Ga0209025_1036435 | |||
| 1602 | Ga0209025_1039894 | |||
| 1603 | Ga0209564_1000090 | |||
| 1604 | Ga0209564_1000145 | |||
| 1605 | Ga0209564_1000585 | |||
| 1606 | Ga0209564_1001244 | |||
| 1607 | Ga0209564_1001318 | |||
| 1608 | Ga0209564_1001617 | |||
| 1609 | Ga0209564_1002063 | |||
| 1610 | Ga0209758_1000044 | |||
| 1611 | Ga0209758_1000249 | |||
| 1612 | Ga0209758_1024457 | |||
| 1613 | Ga0209758_1043783 | |||
| 1614 | Ga0209050_1000003 | |||
| 1615 | Ga0209050_1000007 | |||
| 1616 | Ga0209050_1001232 | |||
| 1617 | Ga0209050_1002246 | |||
| 1618 | Ga0209050_1013755 | |||
| 1619 | Ga0209050_1014496 | |||
| 1620 | Ga0209256_1000001 | |||
| 1621 | Ga0209256_1000020 | |||
| 1622 | Ga0209256_1000022 | |||
| 1623 | Ga0209256_1000051 | |||
| 1624 | Ga0209256_1000127 | |||
| 1625 | Ga0209256_1001660 | |||
| 1626 | Ga0207426_1000001 | |||
| 1627 | Ga0207426_1000031 | |||
| 1628 | Ga0207426_1000071 | |||
| 1629 | Ga0207426_1001744 | |||
| 1630 | Ga0209051_1000003 | |||
| 1631 | Ga0209051_1000036 | |||
| 1632 | Ga0209051_1000416 | |||
| 1633 | Ga0209051_1000500 | |||
| 1634 | Ga0209051_1000542 | |||
| 1635 | Ga0209051_1000735 | |||
| 1636 | Ga0209051_1011957 | |||
| 1637 | Ga0209051_1018109 | |||
| 1638 | Ga0209051_1031523 | |||
| 1639 | Ga0209257_1000011 | |||
| 1640 | Ga0209257_1000012 | |||
| 1641 | Ga0209257_1000018 | |||
| 1642 | Ga0209257_1000226 | |||
| 1643 | Ga0209257_1003858 | |||
| 1644 | Ga0209257_1005060 | |||
| 1645 | Ga0207697_10000857 | |||
| 1646 | Ga0207656_10004471 | |||
| 1647 | Ga0207656_10007788 | |||
| 1648 | Ga0207655_1002684 | |||
| 1649 | Ga0207682_10000120 | |||
| 1650 | Ga0207682_10001604 | |||
| 1651 | Ga0207682_10047517 | |||
| 1652 | Ga0207682_10051884 | |||
| 1653 | Ga0207682_10065244 | |||
| 1654 | Ga0207642_10016419 | |||
| 1655 | Ga0207642_10029220 | |||
| 1656 | Ga0207642_10068697 | |||
| 1657 | Ga0207680_10011590 | |||
| 1658 | Ga0207680_10147969 | |||
| 1659 | Ga0207647_10059083 | |||
| 1660 | Ga0207645_10001475 | |||
| 1661 | Ga0207645_10017113 | |||
| 1662 | Ga0207645_10085833 | |||
| 1663 | Ga0207643_10000681 | |||
| 1664 | Ga0207643_10026471 | |||
| 1665 | Ga0207643_10107981 | |||
| 1666 | Ga0207654_10099305 | |||
| 1667 | Ga0207695_10118124 | |||
| 1668 | Ga0207671_10001800 | |||
| 1669 | Ga0207660_10155321 | |||
| 1670 | Ga0207662_10004254 | |||
| 1671 | Ga0207657_10000822 | |||
| 1672 | Ga0207649_10049281 | |||
| 1673 | Ga0207649_10090844 | |||
| 1674 | Ga0207681_10016998 | |||
| 1675 | Ga0207681_10021841 | |||
| 1676 | Ga0207681_10057263 | |||
| 1677 | Ga0207694_10004998 | |||
| 1678 | Ga0207650_10006154 | |||
| 1679 | Ga0207650_10040265 | |||
| 1680 | Ga0207650_10043242 | |||
| 1681 | Ga0207650_10174301 | |||
| 1682 | Ga0207659_10010325 | |||
| 1683 | Ga0207659_10024313 | |||
| 1684 | Ga0207659_10039189 | |||
| 1685 | Ga0207659_10101309 | |||
| 1686 | Ga0207659_10413358 | |||
| 1687 | Ga0207659_10474914 | |||
| 1688 | Ga0207644_10008321 | |||
| 1689 | Ga0207644_10021143 | |||
| 1690 | Ga0207690_10002002 | |||
| 1691 | Ga0207706_10000149 | |||
| 1692 | Ga0207706_10000850 | |||
| 1693 | Ga0207706_10003793 | |||
| 1694 | Ga0207706_10029503 | |||
| 1695 | Ga0207706_10108327 | |||
| 1696 | Ga0207706_10134632 | |||
| 1697 | Ga0207706_10272194 | |||
| 1698 | Ga0207686_10148193 | |||
| 1699 | Ga0207709_10000771 | |||
| 1700 | Ga0207709_10001360 | |||
| 1701 | Ga0207709_10025348 | |||
| 1702 | Ga0207709_10028943 | |||
| 1703 | Ga0207709_10029949 | |||
| 1704 | Ga0207709_10117902 | |||
| 1705 | Ga0207709_10136795 | |||
| 1706 | Ga0207709_10148361 | |||
| 1707 | Ga0207670_10400184 | |||
| 1708 | Ga0207669_10006269 | |||
| 1709 | Ga0207669_10061575 | |||
| 1710 | Ga0207669_10097632 | |||
| 1711 | Ga0207669_10241973 | |||
| 1712 | Ga0207704_10018734 | |||
| 1713 | Ga0207704_10026431 | |||
| 1714 | Ga0207704_10091255 | |||
| 1715 | Ga0207704_10271794 | |||
| 1716 | Ga0207691_10000773 | |||
| 1717 | Ga0207691_10001626 | |||
| 1718 | Ga0207691_10004125 | |||
| 1719 | Ga0207691_10016262 | |||
| 1720 | Ga0207691_10022311 | |||
| 1721 | Ga0207691_10024119 | |||
| 1722 | Ga0207691_10041027 | |||
| 1723 | Ga0207691_10082806 | |||
| 1724 | Ga0207691_10089646 | |||
| 1725 | Ga0207691_10245462 | |||
| 1726 | Ga0207691_10287616 | |||
| 1727 | Ga0207711_10023053 | |||
| 1728 | Ga0207711_10124729 | |||
| 1729 | Ga0207711_10155887 | |||
| 1730 | Ga0207711_10156409 | |||
| 1731 | Ga0207711_10344043 | |||
| 1732 | Ga0207689_10000049 | |||
| 1733 | Ga0207689_10000307 | |||
| 1734 | Ga0207689_10001301 | |||
| 1735 | Ga0207689_10008205 | |||
| 1736 | Ga0207689_10060861 | |||
| 1737 | Ga0207689_10165152 | |||
| 1738 | Ga0207689_10193318 | |||
| 1739 | Ga0207689_10231835 | |||
| 1740 | Ga0207679_10008364 | |||
| 1741 | Ga0207679_10062155 | |||
| 1742 | Ga0207679_10106195 | |||
| 1743 | Ga0207679_10217309 | |||
| 1744 | Ga0207667_10001720 | |||
| 1745 | Ga0207667_10032111 | |||
| 1746 | Ga0207667_10133856 | |||
| 1747 | Ga0207667_10432257 | |||
| 1748 | Ga0207651_10001889 | |||
| 1749 | Ga0207651_10019990 | |||
| 1750 | Ga0207651_10022461 | |||
| 1751 | Ga0207651_10078633 | |||
| 1752 | Ga0207651_10120546 | |||
| 1753 | Ga0207712_10010255 | |||
| 1754 | Ga0207712_10064721 | |||
| 1755 | Ga0207712_10094687 | |||
| 1756 | Ga0207668_10008031 | |||
| 1757 | Ga0207668_10029069 | |||
| 1758 | Ga0207668_10056523 | |||
| 1759 | Ga0207668_10069586 | |||
| 1760 | Ga0207668_10146608 | |||
| 1761 | Ga0207668_10273177 | |||
| 1762 | Ga0207668_10276807 | |||
| 1763 | Ga0207640_10044846 | |||
| 1764 | Ga0207640_10062911 | |||
| 1765 | Ga0207658_10003343 | |||
| 1766 | Ga0207658_10006980 | |||
| 1767 | Ga0207658_10021590 | |||
| 1768 | Ga0207658_10040679 | |||
| 1769 | Ga0207677_10003034 | |||
| 1770 | Ga0207677_10008690 | |||
| 1771 | Ga0207677_10059178 | |||
| 1772 | Ga0207677_10076559 | |||
| 1773 | Ga0207677_10173734 | |||
| 1774 | Ga0207677_10398444 | |||
| 1775 | Ga0207703_10002822 | |||
| 1776 | Ga0207703_10003906 | |||
| 1777 | Ga0207703_10037171 | |||
| 1778 | Ga0207703_10274231 | |||
| 1779 | Ga0207639_10005031 | |||
| 1780 | Ga0207639_10055874 | |||
| 1781 | Ga0207639_10221377 | |||
| 1782 | Ga0207639_10234731 | |||
| 1783 | Ga0207639_10313675 | |||
| 1784 | Ga0207678_10011833 | |||
| 1785 | Ga0207678_10100600 | |||
| 1786 | Ga0207678_10103375 | |||
| 1787 | Ga0207678_10220158 | |||
| 1788 | Ga0207678_10299085 | |||
| 1789 | Ga0207708_10000529 | |||
| 1790 | Ga0207708_10008749 | |||
| 1791 | Ga0207708_10022047 | |||
| 1792 | Ga0207708_10274462 | |||
| 1793 | Ga0207702_10157221 | |||
| 1794 | Ga0207702_10205785 | |||
| 1795 | Ga0207641_10008475 | |||
| 1796 | Ga0207641_10017295 | |||
| 1797 | Ga0207641_10036405 | |||
| 1798 | Ga0207641_10065664 | |||
| 1799 | Ga0207641_10141285 | |||
| 1800 | Ga0207641_10207970 | |||
| 1801 | Ga0207648_10002306 | |||
| 1802 | Ga0207648_10003420 | |||
| 1803 | Ga0207648_10006661 | |||
| 1804 | Ga0207648_10010535 | |||
| 1805 | Ga0207648_10021312 | |||
| 1806 | Ga0207648_10027187 | |||
| 1807 | Ga0207648_10049953 | |||
| 1808 | Ga0207648_10080063 | |||
| 1809 | Ga0207648_10461373 | |||
| 1810 | Ga0207676_10004825 | |||
| 1811 | Ga0207676_10027811 | |||
| 1812 | Ga0207676_10064917 | |||
| 1813 | Ga0207676_10105918 | |||
| 1814 | Ga0207676_10197159 | |||
| 1815 | Ga0207676_10337422 | |||
| 1816 | Ga0207674_10003249 | |||
| 1817 | Ga0207674_10003275 | |||
| 1818 | Ga0207674_10020383 | |||
| 1819 | Ga0207674_10157866 | |||
| 1820 | Ga0207675_100003946 | |||
| 1821 | Ga0207675_100008033 | |||
| 1822 | Ga0207675_100032927 | |||
| 1823 | Ga0207675_100035316 | |||
| 1824 | Ga0207675_100035639 | |||
| 1825 | Ga0207675_100055481 | |||
| 1826 | Ga0207675_100596275 | |||
| 1827 | Ga0207683_10006932 | |||
| 1828 | Ga0207683_10008101 | |||
| 1829 | Ga0207683_10010884 | |||
| 1830 | Ga0207683_10030812 | |||
| 1831 | Ga0207683_10050620 | |||
| 1832 | Ga0207683_10240983 | |||
| 1833 | Ga0207683_10260994 | |||
| 1834 | Ga0207683_10318998 | |||
| 1835 | Ga0207698_10034135 | |||
| 1836 | Ga0207698_10121441 | |||
| 1837 | Ga0207698_10182443 | |||
| 1838 | Ga0207698_10427876 | |||
| 1839 | Ga0207698_10624105 | |||
| 1840 | Ga0209281_1000160 | |||
| 1841 | Ga0209371_1003487 | |||
| 1842 | Ga0209999_1015003 | |||
| 1843 | Ga0209983_1006590 | |||
| 1844 | Ga0209983_1028576 | |||
| 1845 | Ga0209282_1000069 | |||
| 1846 | Ga0209282_1018317 | |||
| 1847 | Ga0209282_1087699 | |||
| 1848 | Ga0209971_1015433 | |||
| 1849 | Ga0209998_10027200 | |||
| 1850 | Ga0268266_10017786 | |||
| 1851 | Ga0268266_10039667 | |||
| 1852 | Ga0268266_10044855 | |||
| 1853 | Ga0268266_10078909 | |||
| 1854 | Ga0268266_10079755 | |||
| 1855 | Ga0268266_10086096 | |||
| 1856 | Ga0268266_10154105 | |||
| 1857 | Ga0268265_10006606 | |||
| 1858 | Ga0268265_10029739 | |||
| 1859 | Ga0268265_10088981 | |||
| 1860 | Ga0268265_10164888 | |||
| 1861 | Ga0268265_10191253 | |||
| 1862 | Ga0268265_10294024 | |||
| 1863 | Ga0268264_10000624 | |||
| 1864 | Ga0268264_10017548 | |||
| 1865 | Ga0268264_10102319 | |||
| 1866 | Ga0268264_10180804 | |||
| 1867 | Ga0268264_10186400 | |||
| 1868 | Ga0268264_10452026 | |||
| 1869 | Ga0307517_10033655 | |||
| 1870 | Ga0307515_10000058 | |||
| 1871 | Ga0307515_10000267 | |||
| 1872 | Ga0307515_10000283 | |||
| 1873 | Ga0307515_10000302 | |||
| 1874 | Ga0307515_10000586 | |||
| 1875 | Ga0307515_10003631 | |||
| 1876 | Ga0307515_10011842 | |||
| 1877 | Ga0307515_10081285 | |||
| 1878 | Ga0307515_10105750 | |||
| 1879 | Ga0307515_10118612 | |||
| 1880 | Ga0307515_10157981 | |||
| 1881 | Ga0307515_10251002 | |||
| 1882 | Ga0268256_1007657 | |||
| 1883 | Ga0307512_10018592 | |||
| 1884 | Ga0307512_10038652 | |||
| 1885 | Ga0316177_1102153 | |||
| 1886 | Ga0314311_1141747 | |||
| 1887 | Ga0316183_1033032 | |||
| 1888 | Ga0265327_10005641 | |||
| 1889 | Ga0307513_10000010 | |||
| 1890 | Ga0307513_10000051 | |||
| 1891 | Ga0307513_10049729 | |||
| 1892 | Ga0307513_10060104 | |||
| 1893 | Ga0307513_10077516 | |||
| 1894 | Ga0307513_10103072 | |||
| 1895 | Ga0307513_10108365 | |||
| 1896 | Ga0307513_10139562 | |||
| 1897 | Ga0307513_10399439 | |||
| 1898 | Ga0307509_10011999 | |||
| 1899 | Ga0307509_10071187 | |||
| 1900 | Ga0307509_10096280 | |||
| 1901 | Ga0307408_100000193 | |||
| 1902 | Ga0307408_100001412 | |||
| 1903 | Ga0307408_100007530 | |||
| 1904 | Ga0307408_100022612 | |||
| 1905 | Ga0307408_100056105 | |||
| 1906 | Ga0307408_100090913 | |||
| 1907 | Ga0307408_100128014 | |||
| 1908 | Ga0307508_10000876 | |||
| 1909 | Ga0307508_10001111 | |||
| 1910 | Ga0307508_10016840 | |||
| 1911 | Ga0307508_10171782 | |||
| 1912 | Ga0307514_10000806 | |||
| 1913 | Ga0307514_10014746 | |||
| 1914 | Ga0307514_10068076 | |||
| 1915 | Ga0307516_10001118 | |||
| 1916 | Ga0307516_10037208 | |||
| 1917 | Ga0307516_10097543 | |||
| 1918 | Ga0307405_10397803 | |||
| 1919 | Ga0307410_10001817 | |||
| 1920 | Ga0307406_10000944 | |||
| 1921 | Ga0307406_10002109 | |||
| 1922 | Ga0307406_10020580 | |||
| 1923 | Ga0307406_10107886 | |||
| 1924 | Ga0307407_10087522 | |||
| 1925 | Ga0307412_10002610 | |||
| 1926 | Ga0307412_10008248 | |||
| 1927 | Ga0307412_10059041 | |||
| 1928 | Ga0307409_100026624 | |||
| 1929 | Ga0307416_100095618 | |||
| 1930 | Ga0307416_100523136 | |||
| 1931 | Ga0307416_100694142 | |||
| 1932 | Ga0307414_10061593 | |||
| 1933 | Ga0307414_10272083 | |||
| 1934 | Ga0307411_10128359 | |||
| 1935 | Ga0307411_10135310 | |||
| 1936 | Ga0307411_10196374 | |||
| 1937 | Ga0307507_10247610 | |||
| 1938 | Ga0307510_10133426 | |||
| 1939 | Ga0373953_0045721 | |||
| 1940 | Ga0373955_0061335 | |||
| 1941 | Ga0373955_0079570 | |||
| 1942 | Ga0373924_0136413 | |||
| 1943 | Ga0373931_0052842 | |||
| 1944 | Ga0373937_0014096 | |||
| 1945 | Ga0373937_0064919 | |||
| 1946 | Ga0373937_0246317 | |||
| 1947 | Ga0373925_0003621 | |||
| 1948 | Ga0373925_0106669 | |||
| 1949 | Ga0400483_058929 | |||
| 1950 | Ga0400483_242388 | |||
| 1951 | Ga0439436_0001073 | |||
| 1952 | Ga0439436_0026058 | |||
| 1953 | Ga0439436_0056618 | |||
| 1954 | Ga0439447_004235 | |||
| 1955 | Ga0439431_0016358 | |||
| 1956 | Ga0439442_020080 | |||
| 1957 | Ga0439432_001458 | |||
| 1958 | Ga0439449_0000923 | |||
| 1959 | Ga0439449_0005718 | |||
| 1960 | Ga0439449_0040190 | |||
| 1961 | Ga0439450_024941 | |||
| 1962 | Ga0439452_005984 | |||
| 1963 | Ga0439452_019491 | |||
| 1964 | Ga0439452_027810 | |||
| 1965 | Ga0439457_002549 | |||
| 1966 | Ga0439462_0015908 | |||
| 1967 | Ga0439462_0035634 | |||
| 1968 | Ga0450911_000137 | |||
| 1969 | Ga0450921_000339 | |||
| 1970 | Ga0450898_006861 | |||
| 1971 | Ga0439434_0002704 | |||
| 1972 | Ga0450918_002201 | |||
| 1973 | Ga0450893_0009504 | |||
| 1974 | Ga0451577_0029841 | |||
| 1975 | Ga0451577_0075805 | |||
| 1976 | Ga0451577_0104665 | |||
| 1977 | Ga0451577_0131994 | |||
| 1978 | Ga0453684_0004147 | |||
| 1979 | Ga0453684_0059476 | |||
| 1980 | Ga0453684_0150918 | |||
| 1981 | Ga0451576_0009619 | |||
| 1982 | Ga0451576_0116563 | |||
| 1983 | Ga0495627_006938 | |||
| 1984 | Ga0495627_020194 | |||
| 1985 | Ga0495590_0014273 | |||
| 1986 | Ga0495629_0243433 | |||
| 1987 | Ga0495605_0004236 | |||
| 1988 | Ga0495639_0015227 | |||
| 1989 | Ga0495664_0015726 | |||
| 1990 | Ga0495596_0000317 | |||
| 1991 | Ga0495607_0000280 | |||
| 1992 | Ga0495583_0063383 | |||
| 1993 | Ga0495610_0000424 | |||
| 1994 | Ga0495610_0018922 | |||
| 1995 | Ga0495616_0006264 | |||
| 1996 | Ga0495616_0044348 | |||
| 1997 | Ga0495620_0052852 | |||
| 1998 | Ga0495631_0001923 | |||
| 1999 | Ga0495632_0048912 | |||
| 2000 | Ga0495632_0051016 | |||
| 2001 | Ga0495637_0007031 | |||
| 2002 | Ga0495637_0013071 | |||
| 2003 | Ga0495643_0093802 | |||
| 2004 | Ga0495642_0111393 | |||
| 2005 | Ga0495654_0008854 | |||
| 2006 | Ga0495609_0009581 | |||
| 2007 | Ga0495621_0095725 | |||
| 2008 | Ga0495597_0020417 | |||
| 2009 | Ga0495597_0022634 | |||
| 2010 | Ga0495633_0006330 | |||
| 2011 | Ga0495656_0002566 | |||
| 2012 | Ga0495625_0000396 | |||
| 2013 | Ga0495625_0000807 | |||
| 2014 | Ga0495625_0038121 | |||
| 2015 | Ga0495625_0081869 | |||
| 2016 | Ga0495661_0068155 | |||
| 2017 | Ga0495658_0006349 | |||
| 2018 | Ga0495671_0001711 | |||
| 2019 | Ga0495649_0175933 | |||
| 2020 | Ga0495660_0035956 | |||
| 2021 | Ga0495672_0005564 | |||
| 2022 | Ga0495687_000196 | |||
| 2023 | Ga0495687_021061 | |||
| 2024 | Ga0495687_045689 | |||
| 2025 | Ga0495677_0103754 | |||
| 2026 | Ga0495686_0145921 | |||
| 2027 | Ga0496101_0003644 | |||
| 2028 | Ga0496102_0024833 | |||
| 2029 | Ga0496103_0023992 | |||
| 2030 | Ga0496103_0208205 | |||
| 2031 | Ga0496104_0021963 | |||
| 2032 | Ga0496105_0021257 | |||
| 2033 | Ga0496105_0095237 | |||
| 2034 | Ga0496105_0173682 | |||
| 2035 | Ga0496106_0036400 | |||
| 2036 | Ga0496107_0008919 | |||
| 2037 | Ga0496107_0223374 | |||
| 2038 | Ga0496108_0020007 | |||
| 2039 | Ga0496109_0005385 | |||
| 2040 | Ga0496109_0038690 | |||
| 2041 | Ga0496109_0337549 | |||
| 2042 | Ga0496110_0027094 | |||
| 2043 | Ga0496110_0042796 | |||
| 2044 | Ga0496110_0094456 | |||
| 2045 | Ga0496112_0541449 | |||
| 2046 | Ga0496114_0030341 | |||
| 2047 | Ga0496114_0047087 | |||
| 2048 | Ga0496114_0099241 | |||
| 2049 | Ga0496116_0009002 | |||
| 2050 | Ga0496116_0016831 | |||
| 2051 | Ga0496116_0020474 | |||
| 2052 | Ga0496116_0024283 | |||
| 2053 | Ga0496116_0099800 | |||
| 2054 | Ga0496117_0034564 | |||
| 2055 | Ga0496117_0084871 | |||
| 2056 | Ga0496117_0114986 | |||
| 2057 | Ga0496118_0023463 | |||
| 2058 | Ga0496118_0070259 | |||
| 2059 | Ga0496118_0139684 | |||
| 2060 | Ga0496119_0017168 | |||
| 2061 | Ga0496119_0026563 | |||
| 2062 | Ga0496119_0147843 | |||
| 2063 | Ga0496120_0014853 | |||
| 2064 | Ga0496121_0000479 | |||
| 2065 | Ga0496121_0016763 | |||
| 2066 | Ga0496121_0049646 | |||
| 2067 | Ga0496121_0108493 | |||
| 2068 | Ga0496121_0161557 | |||
| 2069 | Ga0496122_0000217 | |||
| 2070 | Ga0496122_0000669 | |||
| 2071 | Ga0496122_0003097 | |||
| 2072 | Ga0496122_0003536 | |||
| 2073 | Ga0496122_0012827 | |||
| 2074 | Ga0496122_0046214 | |||
| 2075 | Ga0496123_0000057 | |||
| 2076 | Ga0496123_0000603 | |||
| 2077 | Ga0496123_0005860 | |||
| 2078 | Ga0496123_0017368 | |||
| 2079 | Ga0496123_0029483 | |||
| 2080 | Ga0496124_0052640 | |||
| 2081 | Ga0496124_0073690 | |||
| 2082 | Ga0496124_0087189 | |||
| 2083 | Ga0496124_0121197 | |||
| 2084 | Ga0496124_0282098 | |||
| 2085 | Ga0496125_0000168 | |||
| 2086 | Ga0496125_0000323 | |||
| 2087 | Ga0496125_0001023 | |||
| 2088 | Ga0496125_0023979 | |||
| 2089 | Ga0496125_0025456 | |||
| 2090 | Ga0496125_0030089 | |||
| 2091 | Ga0496125_0050199 | |||
| 2092 | Ga0496125_0064894 | |||
| 2093 | Ga0496125_0207534 | |||
| 2094 | Ga0496126_0016753 | |||
| 2095 | Ga0496126_0123726 | |||
| 2096 | Ga0496126_0162140 | |||
| 2097 | nmdc:mga03683_167353_c1 | |||
| 2098 | nmdc:mga03683_3206_c1 | |||
| 2099 | nmdc:mga03683_42761_c1 | |||
| 2100 | nmdc:mga03683_67440_c1 | |||
| 2101 | nmdc:mga03683_95159_c1 | |||
| 2102 | nmdc:mga03n38_54907_c1 | |||
| 2103 | nmdc:mga00v17_20825_c1 | |||
| 2104 | nmdc:mga0yw44_70118_c1 | |||
| 2105 | nmdc:mga0k408_132207_c1 | |||
| 2106 | nmdc:mga0k408_3141_c1 | |||
| 2107 | nmdc:mga0k408_42063_c1 | |||
| 2108 | nmdc:mga0k408_86130_c1 | |||
| 2109 | nmdc:mga06z11_79686_c1 | |||
| 2110 | nmdc:mga07m45_14323_c1 | |||
| 2111 | nmdc:mga07m45_17804_c1 | |||
| 2112 | nmdc:mga07m45_3635_c1 | |||
| 2113 | nmdc:mga07m45_50012_c1 | |||
| 2114 | nmdc:mga07m45_686_c1 | |||
| 2115 | nmdc:mga07m45_7718_c1 | |||
| 2116 | nmdc:mga05p37_228483_c1 | |||
| 2117 | nmdc:mga05p37_2709_c2 | |||
| 2118 | nmdc:mga09592_271113_c1 | |||
| 2119 | nmdc:mga09592_605991_c1 | |||
| 2120 | nmdc:mga09592_9202_c1 | |||
| 2121 | nmdc:mga0qj67_417732_c1 | |||
| 2122 | nmdc:mga06r32_458823_c1 | |||
| 2123 | nmdc:mga0n895_68479_c1 | |||
| 2124 | nmdc:mga0a205_9315_c1 | |||
| 2125 | nmdc:mga0sz30_123953_c1 | |||
| 2126 | nmdc:mga0sz30_6916_c1 | |||
| 2127 | Ga0500610_0000489 | |||
| 2128 | Ga0495619_0185339 | |||
| 2129 | Ga0500644_0053915 | |||
| 2130 | Ga0500647_0133216 | |||
| 2131 | Ga0500651_0045805 | |||
| 2132 | Ga0500650_0046871 | |||
| 2133 | Ga0500571_010381 | |||
| 2134 | Ga0500593_005223 | |||
| 2135 | Ga0500594_0003123 | |||
| 2136 | Ga0500607_007771 | |||
| 2137 | Ga0500608_035205 | |||
| 2138 | Ga0500655_006844 | |||
| 2139 | Ga0500658_0001265 | |||
| 2140 | Ga0500658_0002137 | |||
| 2141 | Ga0500658_0130232 | |||
| 2142 | Ga0500559_0005433 | |||
| 2143 | Ga0500568_0001949 | |||
| 2144 | Ga0500627_0022906 | |||
| 2145 | Ga0500634_0065523 | |||
| 2146 | Ga0500637_0005139 | |||
| 2147 | Ga0500645_000198 | |||
| 2148 | Ga0500645_000493 | |||
| 2149 | Ga0500645_011097 | |||
| 2150 | Ga0500587_000066 | |||
| 2151 | 2511245932 | |||
| 2152 | 2512036213 | |||
| 2153 | 2513231799 | |||
| 2154 | 2548497399 | |||
| 2155 | 2587757178 | |||
| 2156 | 2599101933 | |||
| 2157 | 2599626662 | |||
| 2158 | 2599675726 | |||
| 2159 | 2599684199 | |||
| 2160 | 2599696213 | |||
| 2161 | 2599902927 | |||
| 2162 | 2643861750 | |||
| 2163 | 2643866565 | |||
| 2164 | 2643983215 | |||
| 2165 | 2643993317 | |||
| 2166 | 2644060686 | |||
| 2167 | 2644074006 | |||
| 2168 | 2644123476 | |||
| 2169 | 2644159576 | |||
| 2170 | 2644294078 | |||
| 2171 | 2644303759 | |||
| 2172 | 2644327938 | |||
| 2173 | 2644397900 | |||
| 2174 | 2644468259 | |||
| 2175 | 2644646251 | |||
| 2176 | 2738718081 | |||
| 2177 | 2738885020 | |||
| 2178 | 2739242712 | |||
| 2179 | 2739250458 | |||
| 2180 | 2739278767 | |||
| 2181 | 2753357601 | |||
| 2182 | 2758640098 | |||
| 2183 | 2809033260 | |||
| 2184 | 2816472972 | |||
| 2185 | 2819595772 | |||
| 2186 | 2831266783 | |||
| 2187 | 2838057136 | |||
| 2188 | 2842335006 | |||
| 2189 | 2842682576 | |||
| 2190 | 2842735584 | |||
| 2191 | 2842751321 | |||
| 2192 | 2846958079 | |||
| 2193 | 2848864859 | |||
| 2194 | 2854913334 | |||
| 2195 | 2857538241 | |||
| 2196 | 2857580794 | |||
| 2197 | 2858952051 | |||
| 2198 | 2885192725 | |||
| 2199 | 2885201232 | |||
| 2200 | 2885214886 | |||
| 2201 | 2894027683 | |||
| 2202 | 2897805876 | |||
| 2203 | 2899925118 | |||
| 2204 | 2904454452 | |||
| 2205 | 2904461105 | |||
| 2206 | 2904544741 | |||
| 2207 | 2919465982 | |||
| 2208 | 2919707444 | |||
| 2209 | 2928038757 | |||
| 2210 | 2928045638 | |||
| 2211 | 2928053255 | |||
| 2212 | 2928066860 | |||
| 2213 | 2928071254 | |||
| 2214 | 2928084817 | |||
| 2215 | 2928119626 | |||
| 2216 | 2929163588 | |||
| 2217 | 2929526987 | |||
| 2218 | 2932425138 | |||
| 2219 | 2941482490 | |||
| 2220 | 2945912275 | |||
| 2221 | 2945948209 | |||
| 2222 | 2945985414 | |||
| 2223 | 2954772326 | |||
| 2224 | 2974323373 | |||
| 2225 | 2990712248 | |||
| 2226 | 8054008479 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1l7v-assembly1.cif.gz_B | bacterial abc transporter involved in b12 uptake | 0.5735 | 16 | 289 |
| 4dbl-assembly1.cif.gz_B | crystal structure of e159q mutant of btucdf | 0.5734 | 16 | 289 |
| 2nq2-assembly1.cif.gz_A | an inward-facing conformation of a putative metal-chelate type abc transporter. | 0.5646 | 16 | 288 |
| 7lb8-assembly1.cif.gz_B | structure of a ferrichrome importer fhucdb from e. coli | 0.5557 | 14 | 259 |
| 7kyo-assembly1.cif.gz_C-2 | psabc from streptococcus pneumoniae in complex with fab | 0.5444 | 13 | 285 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P77672_36_301_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.8124 | 20 | 281 | 1.10.3470.10 |
| af_P77672_36_301_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.7954 | 20 | 281 | 1.10.3470.10 |
| af_P0AGI4_56_383_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.7868 | 18 | 281 | 1.10.3470.10 |
| af_P77315_52_317_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.7848 | 18 | 281 | 1.10.3470.10 |
| af_P0AFS1_34_305_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.7796 | 16 | 281 | 1.10.3470.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3LI64-F1-model_v4 | ABC transporter permease | 0.9667 | 34 | 304 |
GO:0005886
GO:0022857 |
| AF-A0A4Q5VQG5-F1-model_v4 | deleted | 0.9623 | 5 | 230 |
|
| AF-A0A2S9QFS9-F1-model_v4 | ABC transporter permease | 0.9546 | 8 | 304 |
GO:0005886
GO:0022857 |
| AF-A0A7C6ZI90-F1-model_v4 | ABC transporter permease | 0.9448 | 14 | 301 |
GO:0005886
GO:0022857 |
| AF-A0A081C4P7-F1-model_v4 | Inner-membrane translocator | 0.9422 | 14 | 301 |
GO:0005886
GO:0022857 |