F490261

General Info

Members Datasets Scaffolds Average Seq Length
1113 432 2226 306

Family's Representative Sequence

Representative Sequence 3300005456|Ga0070678_100004479|Ga0070678_1000044797
Length 369
Sequence VRDRVSAFGGAKTEGRDDCKRPAPVIDAIASILVNADFWSAVLRIATPLVFGTLGVLLCERAGVLNLGIEGIMVAGALAGWLVVYLGAGLWIGVLAAAATGAVFGLLHGFLTVPLALSQHVAGLGITLFATSVSYFAYRVSFPSVTSPPTITPFVEMRWLSLPVLAAQTPLTLAALLLVPLVGWFLYRTPAGLAVRMVGENPAAAEGQGLDVHRVRMAAIVAGSALMGVAGAFLTLSAFNAFFFNMVNGRGWICVALVVFAGWRPGKALAGALLFAFFDAMQLRMQQAGDSGLPYQVWLMVPYLLSILALIAVARRAAYPQALMKPYVKGERLETTGPATRTRPFSAPYLPMRDCAASVIVASASSSTI

Samples

Sample ID Description Type Environment
1 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
15 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
20 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
21 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
22 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
23 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
28 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
29 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
35 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
38 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
39 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
40 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
41 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
42 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
43 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
44 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
45 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
46 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
47 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
48 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
51 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
52 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
53 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
56 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
57 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
58 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
59 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
83 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
84 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
85 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
86 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
87 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
88 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
89 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
94 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
95 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
96 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
97 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
100 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
101 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
102 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
103 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
105 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
106 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
109 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
125 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
128 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
129 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
130 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
131 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
132 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
133 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
137 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
138 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
139 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
141 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
142 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
145 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
148 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
150 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
153 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
207 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
211 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
217 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
218 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
219 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
220 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
221 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
222 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
223 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
224 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
225 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
226 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
227 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
228 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
229 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
230 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
231 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
232 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
233 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
234 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
235 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
236 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
237 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
238 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
239 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
240 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
241 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
242 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
243 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
244 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
245 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
246 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
247 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
248 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
249 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
250 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
251 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
252 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
253 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
254 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
255 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
256 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
257 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
258 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
259 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
260 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
261 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
262 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
263 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
264 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
265 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
266 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
267 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
268 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
269 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
270 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
271 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
272 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
273 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
274 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
275 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
276 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
277 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
278 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
279 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
280 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
281 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
282 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
283 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
284 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
285 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
286 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
287 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
288 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
289 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
290 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
291 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
292 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
293 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
294 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
295 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
296 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
297 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
298 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
299 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
300 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
301 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
302 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
303 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
304 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
305 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
306 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
307 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
308 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
309 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
310 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
311 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
312 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
313 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
314 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
315 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
316 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
317 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
318 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
319 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
320 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
321 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
322 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
323 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
324 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
325 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
326 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
327 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
328 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
329 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
330 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
331 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
332 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
333 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
334 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
335 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
336 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
337 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
338 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
339 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
340 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
341 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
342 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
343 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
344 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
345 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
346 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
347 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
348 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
349 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
350 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
351 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
352 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
353 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
354 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
355 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
356 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
357 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
358 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
359 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
360 2547132374 Acidovorax radicis N35 Isolate Unclassified
361 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
362 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
363 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
364 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
365 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
366 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
367 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
368 2643221569 Achromobacter sp. Root565 Isolate Unclassified
369 2643221570 Acidovorax sp. Root568 Isolate Unclassified
370 2643221594 Achromobacter sp. Root170 Isolate Unclassified
371 2643221596 Acidovorax sp. Root70 Isolate Unclassified
372 2643221609 Acidovorax sp. Root217 Isolate Unclassified
373 2643221611 Acidovorax sp. Root219 Isolate Unclassified
374 2643221621 Achromobacter sp. Root83 Isolate Unclassified
375 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
376 2643221652 Acidovorax sp. Root402 Isolate Unclassified
377 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
378 2643221658 Variovorax sp. Root411 Isolate Unclassified
379 2643221672 Variovorax sp. Root434 Isolate Unclassified
380 2643221683 Variovorax sp. Root473 Isolate Unclassified
381 2643221717 Acidovorax sp. Root267 Isolate Unclassified
382 2738541277 Variovorax sp. GV051 Isolate Unclassified
383 2738541307 Variovorax sp. GV008 Isolate Unclassified
384 2738543012 Acidovorax sp. CF301 Isolate Unclassified
385 2738543013 Variovorax sp. BT01 Isolate Unclassified
386 2738543019 Variovorax sp. GV040 Isolate Unclassified
387 2751185800 Brucella pituitosa AA2 Isolate Unclassified
388 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
389 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
390 2816332133 Acidovorax radicis 2721A Isolate Unclassified
391 2818991446 Variovorax sp. 1180 Isolate Unclassified
392 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
393 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
394 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
395 2842677519 Variovorax sp. R-72495 Isolate Unclassified
396 2842733646 Variovorax sp. R-72446 Isolate Unclassified
397 2842747753 Variovorax sp. R-72060 Isolate Unclassified
398 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
399 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
400 2854911287 Brucella lupini LUP21 Isolate Unclassified
401 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
402 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
403 2858950400 Achromobacter sp. K91 Isolate Unclassified
404 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
405 2885198086 Variovorax sp. 679 Isolate Unclassified
406 2885211737 Variovorax sp. 553 Isolate Unclassified
407 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
408 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
409 2899924645 Variovorax sp. 369 Isolate Unclassified
410 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
411 2904456579 Variovorax sp. 2002 Isolate Unclassified
412 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
413 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
414 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
415 2928037797 Variovorax sp. 1126 Isolate Unclassified
416 2928044640 Variovorax sp. 1128 Isolate Unclassified
417 2928051484 Variovorax sp. 1133 Isolate Unclassified
418 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
419 2928070936 Variovorax gossypii 1167 Isolate Unclassified
420 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
421 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
422 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
423 2929520902 Variovorax beijingensis 502 Isolate Unclassified
424 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
425 2941479691
426 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
427 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
428 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
429 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
430 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
431 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
432 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.17
Metatranscriptomes 0
Isolates 6.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.04
Nodule 0.9
Rhizoplane 2.34
Rhizosphere 63.52
Stem 0
Stem Tuber 0
Unclassified 0.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070678_100004479 3300005456 Bacteria 7927
2 SwRhRL2b_contig_2666113 2162886007 Bacteria 1415
3 JGI24749J21850_1004017 3300002076 Bacteria 2052
4 JGI25155J39150_1000002 3300002704 Bacteria 292156
5 JGI25156J39149_1000003 3300002705 Bacteria 305434
6 JGI25154J39366_1000009 3300002738 Bacteria 305408
7 JGI25157J39369_1000002 3300002741 Bacteria 305434
8 JGI25152J39213_1001234 3300002773 Bacteria 11687
9 JGI25150J39212_1000784 3300002774 Bacteria 10872
10 JGI25159J45721_1000148 3300002987 Bacteria 32592
11 JGI25159J45721_1001075 3300002987 Bacteria 11677
12 JGI25159J45721_1023052 3300002987 Bacteria 1138
13 JGI25151J46595_10001070 3300003187 Bacteria 20411
14 JGI25151J46595_10002632 3300003187 Bacteria 10571
15 JGI25151J46595_10011867 3300003187 Bacteria 3989
16 JGI25151J46595_10024513 3300003187 Bacteria 2467
17 JGI25151J46595_10043128 3300003187 Bacteria 1618
18 JGI25153J46596_10001727 3300003215 Bacteria 12962
19 JGI25153J46596_10001768 3300003215 Bacteria 12822
20 JGI25160J50197_1000123 3300003354 Bacteria 70031
21 JGI25160J50197_1009409 3300003354 Bacteria 3626
22 JGI25161J50226_1000032 3300003374 Bacteria 138440
23 JGI25161J50226_1001050 3300003374 Bacteria 9462
24 Ga0055542_1000021 3300003762 Bacteria 331499
25 Ga0055526_1001458 3300003771 Bacteria 16782
26 Ga0055526_1002300 3300003771 Bacteria 13035
27 Ga0055526_1002744 3300003771 Bacteria 11681
28 Ga0055526_1003550 3300003771 Bacteria 9828
29 Ga0055526_1003943 3300003771 Bacteria 9161
30 Ga0055526_1007340 3300003771 Bacteria 5757
31 Ga0055526_1010696 3300003771 Bacteria 4237
32 Ga0055537_1000079 3300003773 Bacteria 69953
33 Ga0055537_1003026 3300003773 Bacteria 5309
34 Ga0055524_1000012 3300003775 Bacteria 260384
35 Ga0055524_1000097 3300003775 Bacteria 108145
36 Ga0055524_1000987 3300003775 Bacteria 17754
37 Ga0055524_1001542 3300003775 Bacteria 13031
38 Ga0055524_1001822 3300003775 Bacteria 11681
39 Ga0055536_1000657 3300003781 Bacteria 23356
40 Ga0055536_1000861 3300003781 Bacteria 19829
41 Ga0055536_1001022 3300003781 Bacteria 17664
42 Ga0055536_1001230 3300003781 Bacteria 15819
43 Ga0055536_1005409 3300003781 Bacteria 6255
44 Ga0055536_1008299 3300003781 Bacteria 4488
45 Ga0055536_1009066 3300003781 Bacteria 4181
46 Ga0055534_1000092 3300003784 Bacteria 70082
47 Ga0055534_1001022 3300003784 Bacteria 12273
48 Ga0055534_1001081 3300003784 Bacteria 11681
49 Ga0055534_1001381 3300003784 Bacteria 9700
50 Ga0055534_1004666 3300003784 Bacteria 3889
51 Ga0055528_1000956 3300003790 Bacteria 19155
52 Ga0055528_1002291 3300003790 Bacteria 10371
53 Ga0055528_1009159 3300003790 Bacteria 4168
54 Ga0055530_10000453 3300003791 Bacteria 36520
55 Ga0055530_10000793 3300003791 Bacteria 26295
56 Ga0055530_10017436 3300003791 Bacteria 2251
57 Ga0055540_1000012 3300003792 Bacteria 262667
58 Ga0055540_1001467 3300003792 Bacteria 14051
59 Ga0055540_1002293 3300003792 Bacteria 10309
60 Ga0055531_10000653 3300003794 Bacteria 29813
61 Ga0055531_10001541 3300003794 Bacteria 16875
62 Ga0055543_1000294 3300004625 Bacteria 35881
63 Ga0055543_1000696 3300004625 Bacteria 17270
64 Ga0065165_1002228 3300005262 Bacteria 17278
65 Ga0065165_1012757 3300005262 Bacteria 3397
66 Ga0065165_1012901 3300005262 Bacteria 3361
67 Ga0065704_10011989 3300005289 Bacteria 2169
68 Ga0065712_10148324 3300005290 Bacteria 1384
69 Ga0065715_10125828 3300005293 Bacteria 2122
70 Ga0065715_10129220 3300005293 Bacteria 2030
71 Ga0070676_10014907 3300005328 Bacteria 4278
72 Ga0070676_10035845 3300005328 Bacteria 2855
73 Ga0070676_10079487 3300005328 Bacteria 1986
74 Ga0070676_10283737 3300005328 Bacteria 1117
75 Ga0070683_100023735 3300005329 Bacteria 5488
76 Ga0070690_100003489 3300005330 Bacteria 8600
77 Ga0070690_100056744 3300005330 Bacteria 2512
78 Ga0070690_100110902 3300005330 Bacteria 1831
79 Ga0070670_100001483 3300005331 Bacteria 18899
80 Ga0070670_100002742 3300005331 Bacteria 14546
81 Ga0070670_100007028 3300005331 Bacteria 9536
82 Ga0070670_100008068 3300005331 Bacteria 8956
83 Ga0070670_100037126 3300005331 Bacteria 4192
84 Ga0070670_100066159 3300005331 Bacteria 3101
85 Ga0070670_100084979 3300005331 Bacteria 2719
86 Ga0070670_100113866 3300005331 Bacteria 2332
87 Ga0070677_10002129 3300005333 Bacteria 6319
88 Ga0070677_10022565 3300005333 Bacteria 2320
89 Ga0070677_10030335 3300005333 Bacteria 2058
90 Ga0070677_10040639 3300005333 Bacteria 1831
91 Ga0070677_10080223 3300005333 Bacteria 1394
92 Ga0070677_10083395 3300005333 Bacteria 1373
93 Ga0068869_100000178 3300005334 Bacteria 32316
94 Ga0068869_100009675 3300005334 Bacteria 6258
95 Ga0068869_100042331 3300005334 Bacteria 3265
96 Ga0068869_100091902 3300005334 Bacteria 2283
97 Ga0070666_10014344 3300005335 Bacteria 5044
98 Ga0070666_10025971 3300005335 Bacteria 3822
99 Ga0070666_10074039 3300005335 Bacteria 2321
100 Ga0070666_10088379 3300005335 Bacteria 2126
101 Ga0070666_10276568 3300005335 Bacteria 1193
102 Ga0070680_100143639 3300005336 Bacteria 2002
103 Ga0068868_100005608 3300005338 Bacteria 8829
104 Ga0068868_100068148 3300005338 Bacteria 2833
105 Ga0068868_100092542 3300005338 Bacteria 2437
106 Ga0070687_100006353 3300005343 Bacteria 4838
107 Ga0070661_100003091 3300005344 Bacteria 11456
108 Ga0070661_100014055 3300005344 Bacteria 5633
109 Ga0070661_100090249 3300005344 Bacteria 2269
110 Ga0070661_100431373 3300005344 Bacteria 1046
111 Ga0070692_10049561 3300005345 Bacteria 2179
112 Ga0070668_100004619 3300005347 Bacteria 10201
113 Ga0070668_100034232 3300005347 Bacteria 3871
114 Ga0070668_100053700 3300005347 Bacteria 3107
115 Ga0070668_100065909 3300005347 Bacteria 2809
116 Ga0070668_100078177 3300005347 Bacteria 2587
117 Ga0070668_100103436 3300005347 Bacteria 2259
118 Ga0070668_100177094 3300005347 Bacteria 1740
119 Ga0070669_100008927 3300005353 Bacteria 7153
120 Ga0070669_100015579 3300005353 Bacteria 5422
121 Ga0070669_100018890 3300005353 Bacteria 4927
122 Ga0070669_100065009 3300005353 Bacteria 2687
123 Ga0070669_100098538 3300005353 Bacteria 2202
124 Ga0070669_100113582 3300005353 Bacteria 2058
125 Ga0070669_100178562 3300005353 Bacteria 1659
126 Ga0070675_100001733 3300005354 Bacteria 16097
127 Ga0070675_100014191 3300005354 Bacteria 6280
128 Ga0070675_100020917 3300005354 Bacteria 5225
129 Ga0070675_100033094 3300005354 Bacteria 4188
130 Ga0070675_100080936 3300005354 Bacteria 2708
131 Ga0070675_100364892 3300005354 Bacteria 1283
132 Ga0070671_100004476 3300005355 Bacteria 11061
133 Ga0070671_100015093 3300005355 Bacteria 6239
134 Ga0070671_100020848 3300005355 Bacteria 5347
135 Ga0070671_100025674 3300005355 Bacteria 4835
136 Ga0070671_100063486 3300005355 Bacteria 3076
137 Ga0070671_100269750 3300005355 Bacteria 1446
138 Ga0070674_100024203 3300005356 Bacteria 3938
139 Ga0070674_100036087 3300005356 Bacteria 3316
140 Ga0070674_100047128 3300005356 Bacteria 2951
141 Ga0070674_100056035 3300005356 Bacteria 2732
142 Ga0070674_100075904 3300005356 Bacteria 2388
143 Ga0070674_100139183 3300005356 Bacteria 1819
144 Ga0070674_100152914 3300005356 Bacteria 1743
145 Ga0070673_100009444 3300005364 Bacteria 6546
146 Ga0070673_100017776 3300005364 Bacteria 5066
147 Ga0070673_100056382 3300005364 Bacteria 3100
148 Ga0070673_100205263 3300005364 Bacteria 1699
149 Ga0070688_100009048 3300005365 Bacteria 5430
150 Ga0070688_100025675 3300005365 Bacteria 3491
151 Ga0070659_100017155 3300005366 Bacteria 5442
152 Ga0070659_100332341 3300005366 Bacteria 1272
153 Ga0070667_100001198 3300005367 Bacteria 23577
154 Ga0070667_100018482 3300005367 Bacteria 5781
155 Ga0070667_100023441 3300005367 Bacteria 5121
156 Ga0070667_100120129 3300005367 Bacteria 2285
157 Ga0070667_100223216 3300005367 Bacteria 1678
158 Ga0070667_100255016 3300005367 Bacteria 1569
159 Ga0070705_100318140 3300005440 Bacteria 1122
160 Ga0070700_100004393 3300005441 Bacteria 7360
161 Ga0070700_100103998 3300005441 Bacteria 1876
162 Ga0070694_100150561 3300005444 Bacteria 1699
163 Ga0070663_100027541 3300005455 Bacteria 3861
164 Ga0070678_100013926 3300005456 Bacteria 5057
165 Ga0070678_100016709 3300005456 Bacteria 4702
166 Ga0070678_100040672 3300005456 Bacteria 3290
167 Ga0070678_100061942 3300005456 Bacteria 2760
168 Ga0070678_100283497 3300005456 Bacteria 1402
169 Ga0070662_100003994 3300005457 Bacteria 9247
170 Ga0070662_100005238 3300005457 Bacteria 8274
171 Ga0070662_100013360 3300005457 Bacteria 5464
172 Ga0070662_100116545 3300005457 Bacteria 2042
173 Ga0070681_10097261 3300005458 Bacteria 2891
174 Ga0068867_100000273 3300005459 Bacteria 33912
175 Ga0068867_100005155 3300005459 Bacteria 9226
176 Ga0068867_100031942 3300005459 Bacteria 3804
177 Ga0068867_100061662 3300005459 Bacteria 2785
178 Ga0068867_100091081 3300005459 Bacteria 2314
179 Ga0068867_100201226 3300005459 Bacteria 1594
180 Ga0068867_100261268 3300005459 Bacteria 1412
181 Ga0070685_10078150 3300005466 Bacteria 1977
182 Ga0070699_100413942 3300005518 Bacteria 1220
183 Ga0070679_100329255 3300005530 Bacteria 1476
184 Ga0068853_100014373 3300005539 Bacteria 6481
185 Ga0070672_100004667 3300005543 Bacteria 8984
186 Ga0070672_100027843 3300005543 Bacteria 4220
187 Ga0070672_100047555 3300005543 Bacteria 3329
188 Ga0070672_100049824 3300005543 Bacteria 3260
189 Ga0070672_100065484 3300005543 Bacteria 2875
190 Ga0070672_100281148 3300005543 Bacteria 1407
191 Ga0070672_100310324 3300005543 Bacteria 1339
192 Ga0070686_100051186 3300005544 Bacteria 2628
193 Ga0070686_100124845 3300005544 Bacteria 1772
194 Ga0070665_100001639 3300005548 Bacteria 25785
195 Ga0070665_100035254 3300005548 Bacteria 5031
196 Ga0070665_100088396 3300005548 Bacteria 3104
197 Ga0070665_100148512 3300005548 Bacteria 2347
198 Ga0070665_100351009 3300005548 Bacteria 1480
199 Ga0070704_100186982 3300005549 Bacteria 1662
200 Ga0068855_100031834 3300005563 Bacteria 6296
201 Ga0068855_100046637 3300005563 Bacteria 5122
202 Ga0068855_100051726 3300005563 Bacteria 4839
203 Ga0070664_100004590 3300005564 Bacteria 11085
204 Ga0070664_100005648 3300005564 Bacteria 10071
205 Ga0070664_100013082 3300005564 Bacteria 6754
206 Ga0070664_100023188 3300005564 Bacteria 5126
207 Ga0070664_100106699 3300005564 Bacteria 2441
208 Ga0070664_100112024 3300005564 Bacteria 2382
209 Ga0070664_100172815 3300005564 Bacteria 1917
210 Ga0070664_100176528 3300005564 Bacteria 1897
211 Ga0070664_100413950 3300005564 Bacteria 1234
212 Ga0068857_100001689 3300005577 Bacteria 17740
213 Ga0068857_100074298 3300005577 Bacteria 3029
214 Ga0068857_100088217 3300005577 Bacteria 2775
215 Ga0068857_100202659 3300005577 Bacteria 1809
216 Ga0068854_100013238 3300005578 Bacteria 5407
217 Ga0068854_100023805 3300005578 Bacteria 4185
218 Ga0068854_100541336 3300005578 Bacteria 986
219 Ga0068856_100028024 3300005614 Bacteria 5496
220 Ga0068856_100193519 3300005614 Bacteria 2048
221 Ga0068856_100409959 3300005614 Bacteria 1375
222 Ga0068852_100012178 3300005616 Bacteria 6516
223 Ga0068852_100174244 3300005616 Bacteria 2019
224 Ga0068852_100201849 3300005616 Bacteria 1882
225 Ga0068852_100229881 3300005616 Bacteria 1767
226 Ga0068852_100255704 3300005616 Bacteria 1680
227 Ga0068852_100657862 3300005616 Bacteria 1056
228 Ga0068859_100007644 3300005617 Bacteria 10984
229 Ga0068859_100010715 3300005617 Bacteria 9227
230 Ga0068859_100121908 3300005617 Bacteria 2674
231 Ga0068859_100137430 3300005617 Bacteria 2517
232 Ga0068859_100165593 3300005617 Bacteria 2291
233 Ga0068859_100579609 3300005617 Bacteria 1215
234 Ga0068864_100000199 3300005618 Bacteria 54129
235 Ga0068864_100002200 3300005618 Bacteria 16087
236 Ga0068864_100004274 3300005618 Bacteria 11747
237 Ga0068864_100031330 3300005618 Bacteria 4512
238 Ga0068864_100032954 3300005618 Bacteria 4403
239 Ga0068864_100159549 3300005618 Bacteria 2049
240 Ga0068864_100189564 3300005618 Bacteria 1884
241 Ga0068864_100228543 3300005618 Bacteria 1720
242 Ga0068864_100247873 3300005618 Bacteria 1652
243 Ga0068866_10030595 3300005718 Bacteria 2586
244 Ga0068866_10037416 3300005718 Bacteria 2383
245 Ga0068861_100001618 3300005719 Bacteria 14363
246 Ga0068861_100002547 3300005719 Bacteria 11913
247 Ga0068861_100047800 3300005719 Bacteria 3232
248 Ga0068861_100233701 3300005719 Bacteria 1560
249 Ga0068851_10001589 3300005834 Bacteria 9966
250 Ga0068851_10032507 3300005834 Bacteria 2596
251 Ga0068851_10091791 3300005834 Bacteria 1599
252 Ga0068870_10160924 3300005840 Bacteria 1331
253 Ga0068863_100001289 3300005841 Bacteria 25007
254 Ga0068863_100001708 3300005841 Bacteria 21723
255 Ga0068863_100002680 3300005841 Bacteria 17598
256 Ga0068863_100101116 3300005841 Bacteria 2740
257 Ga0068863_100117284 3300005841 Bacteria 2537
258 Ga0068863_100196470 3300005841 Bacteria 1939
259 Ga0068863_100286672 3300005841 Bacteria 1596
260 Ga0068863_100336087 3300005841 Bacteria 1469
261 Ga0068858_100000413 3300005842 Bacteria 44413
262 Ga0068858_100018789 3300005842 Bacteria 6466
263 Ga0068858_100023951 3300005842 Bacteria 5688
264 Ga0068858_100041553 3300005842 Bacteria 4262
265 Ga0068858_100253568 3300005842 Bacteria 1672
266 Ga0068860_100004285 3300005843 Bacteria 14582
267 Ga0068860_100011743 3300005843 Bacteria 8631
268 Ga0068860_100035293 3300005843 Bacteria 4797
269 Ga0068860_100096647 3300005843 Bacteria 2816
270 Ga0068860_100150843 3300005843 Bacteria 2238
271 Ga0068860_100226399 3300005843 Bacteria 1816
272 Ga0068860_100319082 3300005843 Bacteria 1525
273 Ga0068862_100004502 3300005844 Bacteria 11751
274 Ga0068862_100011044 3300005844 Bacteria 7459
275 Ga0068862_100011483 3300005844 Bacteria 7312
276 Ga0068862_100017703 3300005844 Bacteria 5931
277 Ga0068862_100054515 3300005844 Bacteria 3423
278 Ga0068862_100098560 3300005844 Bacteria 2553
279 Ga0068862_100252081 3300005844 Bacteria 1609
280 Ga0068862_100404321 3300005844 Bacteria 1278
281 Ga0075365_10003595 3300006038 Bacteria 8023
282 Ga0075365_10127344 3300006038 Bacteria 1760
283 Ga0075368_10050796 3300006042 Bacteria 1648
284 Ga0075363_100028997 3300006048 Bacteria 2853
285 Ga0075364_10049617 3300006051 Bacteria 2738
286 Ga0075362_10008388 3300006177 Bacteria 3949
287 Ga0075362_10031282 3300006177 Bacteria 2302
288 Ga0075362_10086289 3300006177 Bacteria 1452
289 Ga0075362_10090512 3300006177 Bacteria 1420
290 Ga0075367_10059581 3300006178 Bacteria 2273
291 Ga0075367_10096874 3300006178 Bacteria 1799
292 Ga0075369_10050690 3300006186 Bacteria 1796
293 Ga0075369_10091043 3300006186 Bacteria 1361
294 Ga0075366_10010337 3300006195 Bacteria 5239
295 Ga0075366_10015004 3300006195 Bacteria 4430
296 Ga0075366_10031279 3300006195 Bacteria 3131
297 Ga0075366_10047615 3300006195 Bacteria 2542
298 Ga0075366_10076667 3300006195 Bacteria 1995
299 Ga0075366_10091349 3300006195 Bacteria 1824
300 Ga0075366_10186449 3300006195 Bacteria 1260
301 Ga0097621_100034225 3300006237 Bacteria 4052
302 Ga0097621_100048219 3300006237 Bacteria 3455
303 Ga0097621_100051615 3300006237 Bacteria 3347
304 Ga0097621_100054844 3300006237 Bacteria 3253
305 Ga0097621_100130979 3300006237 Bacteria 2135
306 Ga0097621_100318597 3300006237 Bacteria 1377
307 Ga0075370_10000555 3300006353 Bacteria 14308
308 Ga0075370_10024221 3300006353 Bacteria 3351
309 Ga0075370_10026443 3300006353 Bacteria 3215
310 Ga0075370_10036658 3300006353 Bacteria 2755
311 Ga0075370_10049636 3300006353 Bacteria 2379
312 Ga0075370_10052918 3300006353 Bacteria 2304
313 Ga0075370_10201756 3300006353 Bacteria 1173
314 Ga0068871_100011783 3300006358 Bacteria 6425
315 Ga0068871_100028695 3300006358 Bacteria 4366
316 Ga0068871_100102571 3300006358 Bacteria 2398
317 Ga0068871_100157237 3300006358 Bacteria 1942
318 Ga0068871_100215272 3300006358 Bacteria 1663
319 Ga0075428_100116147 3300006844 Unclassified 2915
320 Ga0075428_100116379 3300006844 Bacteria 2912
321 Ga0075430_100262382 3300006846 Bacteria 1431
322 Ga0075434_100124212 3300006871 Bacteria 2597
323 Ga0075429_100277178 3300006880 Unclassified 1468
324 Ga0075429_100365368 3300006880 Bacteria 1264
325 Ga0068865_100028724 3300006881 Bacteria 3683
326 Ga0068865_100077194 3300006881 Bacteria 2380
327 Ga0097620_100007644 3300006931 Bacteria 10984
328 Ga0097620_100010715 3300006931 Bacteria 9227
329 Ga0097620_100121912 3300006931 Bacteria 2674
330 Ga0097620_100137423 3300006931 Bacteria 2517
331 Ga0097620_100165591 3300006931 Bacteria 2291
332 Ga0097620_100579591 3300006931 Bacteria 1215
333 Ga0079104_1000019 3300006946 Bacteria 269313
334 Ga0099826_10000027 3300006948 Bacteria 140533
335 Ga0099826_10006221 3300006948 Bacteria 8671
336 Ga0105244_10000965 3300009036 Bacteria 24157
337 Ga0105240_10018468 3300009093 Bacteria 9363
338 Ga0105240_10219187 3300009093 Bacteria 2218
339 Ga0111539_10207790 3300009094 Bacteria 2282
340 Ga0105245_10012088 3300009098 Bacteria 7507
341 Ga0105245_10396835 3300009098 Bacteria 1377
342 Ga0105247_10416447 3300009101 Bacteria 961
343 Ga0114129_10032558 3300009147 Bacteria 7367
344 Ga0114129_10457835 3300009147 Bacteria 1672
345 Ga0105243_10001682 3300009148 Bacteria 19081
346 Ga0105243_10004695 3300009148 Bacteria 10755
347 Ga0105243_10043521 3300009148 Bacteria 3519
348 Ga0105243_10141731 3300009148 Bacteria 2052
349 Ga0105243_10145806 3300009148 Bacteria 2025
350 Ga0105243_10147041 3300009148 Bacteria 2017
351 Ga0105243_10281602 3300009148 Bacteria 1498
352 Ga0105241_10190773 3300009174 Bacteria 1706
353 Ga0105242_10019130 3300009176 Bacteria 5364
354 Ga0105242_10026470 3300009176 Bacteria 4598
355 Ga0105242_10122447 3300009176 Bacteria 2234
356 Ga0105242_10571759 3300009176 Bacteria 1087
357 Ga0105248_10003661 3300009177 Bacteria 17051
358 Ga0105248_10006013 3300009177 Bacteria 13318
359 Ga0105248_10074417 3300009177 Bacteria 3818
360 Ga0105248_10152277 3300009177 Bacteria 2610
361 Ga0105237_10001628 3300009545 Bacteria 29150
362 Ga0105237_10097306 3300009545 Bacteria 2933
363 Ga0105237_10106835 3300009545 Bacteria 2791
364 Ga0105237_10295838 3300009545 Bacteria 1622
365 Ga0105238_10093980 3300009551 Bacteria 2986
366 Ga0105249_10029237 3300009553 Bacteria 4976
367 Ga0105249_10099373 3300009553 Bacteria 2735
368 Ga0105249_10203716 3300009553 Bacteria 1937
369 Ga0105249_10269646 3300009553 Bacteria 1695
370 Ga0105249_10296283 3300009553 Bacteria 1621
371 Ga0105239_10001684 3300010375 Bacteria 29148
372 Ga0105239_10605511 3300010375 Bacteria 1250
373 Ga0105246_10107068 3300011119 Bacteria 2046
374 Ga0157369_10016621 3300013105 Bacteria 8272
375 Ga0157369_10181105 3300013105 Bacteria 2217
376 Ga0157374_10010969 3300013296 Bacteria 7825
377 Ga0157374_10294593 3300013296 Bacteria 1604
378 Ga0157374_10297913 3300013296 Bacteria 1595
379 Ga0157374_10497260 3300013296 Bacteria 1224
380 Ga0157378_10004470 3300013297 Bacteria 12280
381 Ga0157378_10039364 3300013297 Bacteria 4193
382 Ga0157378_10081937 3300013297 Bacteria 2917
383 Ga0157378_10193818 3300013297 Bacteria 1918
384 Ga0163162_10008437 3300013306 Bacteria 10048
385 Ga0163162_10045471 3300013306 Bacteria 4398
386 Ga0163162_10106036 3300013306 Bacteria 2905
387 Ga0163162_10141004 3300013306 Bacteria 2524
388 Ga0163162_10682703 3300013306 Bacteria 1149
389 Ga0157372_10076681 3300013307 Bacteria 3774
390 Ga0157372_10204874 3300013307 Bacteria 2286
391 Ga0157372_10225279 3300013307 Unclassified 2174
392 Ga0157372_10757061 3300013307 Bacteria 1129
393 Ga0157375_10032335 3300013308 Bacteria 4961
394 Ga0157375_10050218 3300013308 Bacteria 4090
395 Ga0157375_10067123 3300013308 Bacteria 3583
396 Ga0157375_10094008 3300013308 Bacteria 3065
397 Ga0157375_10234111 3300013308 Bacteria 1996
398 Ga0157375_10250551 3300013308 Bacteria 1931
399 Ga0157375_10305054 3300013308 Bacteria 1756
400 Ga0157375_10492337 3300013308 Bacteria 1391
401 Ga0163163_10001130 3300014325 Bacteria 22677
402 Ga0163163_10009364 3300014325 Bacteria 8742
403 Ga0163163_10073498 3300014325 Bacteria 3410
404 Ga0163163_10079344 3300014325 Bacteria 3281
405 Ga0163163_10107903 3300014325 Bacteria 2810
406 Ga0157380_10026504 3300014326 Bacteria 4401
407 Ga0157380_10033826 3300014326 Bacteria 3938
408 Ga0157380_10034112 3300014326 Bacteria 3924
409 Ga0157380_10112611 3300014326 Bacteria 2290
410 Ga0157380_10134768 3300014326 Bacteria 2112
411 Ga0157380_10163276 3300014326 Bacteria 1938
412 Ga0182008_10009302 3300014497 Bacteria 5311
413 Ga0182008_10019759 3300014497 Bacteria 3473
414 Ga0182008_10047686 3300014497 Bacteria 2128
415 Ga0157377_10013130 3300014745 Bacteria 4185
416 Ga0157379_10010513 3300014968 Bacteria 8067
417 Ga0157379_10025218 3300014968 Bacteria 5279
418 Ga0157379_10037328 3300014968 Bacteria 4331
419 Ga0157379_10045346 3300014968 Bacteria 3924
420 Ga0157379_10078733 3300014968 Bacteria 2952
421 Ga0157379_10094540 3300014968 Bacteria 2682
422 Ga0157379_10246802 3300014968 Bacteria 1620
423 Ga0157376_10008722 3300014969 Bacteria 7326
424 Ga0157376_10068333 3300014969 Bacteria 3009
425 Ga0157376_10158997 3300014969 Bacteria 2046
426 Ga0157376_10200191 3300014969 Bacteria 1837
427 Ga0157376_10206137 3300014969 Bacteria 1812
428 Ga0182006_1001032 3300015261 Bacteria 18152
429 Ga0182007_10000366 3300015262 Bacteria 28535
430 Ga0182007_10011494 3300015262 Bacteria 3445
431 Ga0183362_10001 3300015683 Bacteria 2046624
432 Ga0163161_10001014 3300017792 Bacteria 21406
433 Ga0163161_10018424 3300017792 Bacteria 4893
434 Ga0163161_10038391 3300017792 Bacteria 3435
435 Ga0163161_10133045 3300017792 Bacteria 1878
436 Ga0209435_100001 3300025206 Bacteria 1424171
437 Ga0209672_100665 3300025228 Bacteria 17404
438 Ga0209147_101220 3300025229 Bacteria 10252
439 Ga0209258_100058 3300025242 Bacteria 331567
440 Ga0207425_1000733 3300025245 Bacteria 17320
441 Ga0207425_1002759 3300025245 Bacteria 5968
442 Ga0209646_1000001 3300025246 Bacteria 3092932
443 Ga0209026_1000003 3300025250 Bacteria 1060571
444 Ga0209148_1000071 3300025254 Bacteria 331551
445 Ga0209759_1000001 3300025256 Bacteria 2799452
446 Ga0209129_1000023 3300025258 Bacteria 420646
447 Ga0209129_1001044 3300025258 Bacteria 16361
448 Ga0209129_1004583 3300025258 Bacteria 5315
449 Ga0209565_1000004 3300025263 Bacteria 983150
450 Ga0209565_1000073 3300025263 Bacteria 164695
451 Ga0209565_1000187 3300025263 Bacteria 76001
452 Ga0209565_1000912 3300025263 Bacteria 15923
453 Ga0209565_1005208 3300025263 Bacteria 3816
454 Ga0209673_1000066 3300025273 Bacteria 250037
455 Ga0209673_1000074 3300025273 Bacteria 233552
456 Ga0209673_1000127 3300025273 Bacteria 164695
457 Ga0209673_1000389 3300025273 Bacteria 79243
458 Ga0209673_1002877 3300025273 Bacteria 10944
459 Ga0209130_1000050 3300025284 Bacteria 222092
460 Ga0209130_1000069 3300025284 Bacteria 179177
461 Ga0209130_1000082 3300025284 Bacteria 164441
462 Ga0209675_1000029 3300025291 Bacteria 281053
463 Ga0209675_1000044 3300025291 Bacteria 230392
464 Ga0209675_1000226 3300025291 Bacteria 57689
465 Ga0209675_1000232 3300025291 Bacteria 56301
466 Ga0209675_1005829 3300025291 Bacteria 5063
467 Ga0209675_1008851 3300025291 Bacteria 3635
468 Ga0209675_1009803 3300025291 Bacteria 3343
469 Ga0209676_1000005 3300025292 Bacteria 1076001
470 Ga0209676_1000029 3300025292 Bacteria 520536
471 Ga0209676_1000083 3300025292 Bacteria 279816
472 Ga0209676_1000142 3300025292 Bacteria 175752
473 Ga0209676_1001525 3300025292 Bacteria 21042
474 Ga0209676_1007840 3300025292 Bacteria 4910
475 Ga0209676_1008694 3300025292 Bacteria 4486
476 Ga0209676_1010602 3300025292 Bacteria 3812
477 Ga0209676_1029646 3300025292 Bacteria 1686
478 Ga0209025_1000316 3300025294 Bacteria 107447
479 Ga0209025_1000351 3300025294 Bacteria 99585
480 Ga0209025_1000583 3300025294 Bacteria 66212
481 Ga0209025_1000766 3300025294 Bacteria 53411
482 Ga0209025_1001156 3300025294 Bacteria 37386
483 Ga0209025_1002301 3300025294 Bacteria 20715
484 Ga0209025_1005031 3300025294 Bacteria 11033
485 Ga0209025_1021697 3300025294 Bacteria 3445
486 Ga0209025_1023162 3300025294 Bacteria 3258
487 Ga0209025_1023652 3300025294 Bacteria 3201
488 Ga0209025_1036435 3300025294 Bacteria 2203
489 Ga0209025_1039894 3300025294 Bacteria 2040
490 Ga0209564_1000090 3300025295 Bacteria 249298
491 Ga0209564_1000145 3300025295 Bacteria 175251
492 Ga0209564_1000585 3300025295 Bacteria 57689
493 Ga0209564_1001244 3300025295 Bacteria 28537
494 Ga0209564_1001318 3300025295 Bacteria 26574
495 Ga0209564_1001617 3300025295 Bacteria 21862
496 Ga0209564_1002063 3300025295 Bacteria 17284
497 Ga0209758_1000044 3300025297 Bacteria 398448
498 Ga0209758_1000249 3300025297 Bacteria 110026
499 Ga0209758_1024457 3300025297 Bacteria 2691
500 Ga0209758_1043783 3300025297 Bacteria 1645
501 Ga0209050_1000003 3300025298 Bacteria 1609245
502 Ga0209050_1000007 3300025298 Bacteria 1187891
503 Ga0209050_1001232 3300025298 Bacteria 29637
504 Ga0209050_1002246 3300025298 Bacteria 17232
505 Ga0209050_1013755 3300025298 Bacteria 3561
506 Ga0209050_1014496 3300025298 Bacteria 3388
507 Ga0209256_1000001 3300025299 Bacteria 2166974
508 Ga0209256_1000020 3300025299 Bacteria 542402
509 Ga0209256_1000022 3300025299 Bacteria 481843
510 Ga0209256_1000051 3300025299 Bacteria 307241
511 Ga0209256_1000127 3300025299 Bacteria 164393
512 Ga0209256_1001660 3300025299 Bacteria 21630
513 Ga0207426_1000001 3300025302 Bacteria 1341301
514 Ga0207426_1000031 3300025302 Bacteria 460699
515 Ga0207426_1000071 3300025302 Bacteria 329539
516 Ga0207426_1001744 3300025302 Bacteria 16547
517 Ga0209051_1000003 3300025303 Bacteria 1609245
518 Ga0209051_1000036 3300025303 Bacteria 339863
519 Ga0209051_1000416 3300025303 Bacteria 58872
520 Ga0209051_1000500 3300025303 Bacteria 49702
521 Ga0209051_1000542 3300025303 Bacteria 46577
522 Ga0209051_1000735 3300025303 Bacteria 35429
523 Ga0209051_1011957 3300025303 Bacteria 4237
524 Ga0209051_1018109 3300025303 Bacteria 3126
525 Ga0209051_1031523 3300025303 Bacteria 2038
526 Ga0209257_1000011 3300025304 Bacteria 1112630
527 Ga0209257_1000012 3300025304 Bacteria 1111138
528 Ga0209257_1000018 3300025304 Bacteria 836016
529 Ga0209257_1000226 3300025304 Bacteria 133836
530 Ga0209257_1003858 3300025304 Bacteria 12252
531 Ga0209257_1005060 3300025304 Bacteria 9573
532 Ga0207697_10000857 3300025315 Bacteria 17209
533 Ga0207656_10004471 3300025321 Bacteria 4887
534 Ga0207656_10007788 3300025321 Bacteria 3920
535 Ga0207655_1002684 3300025728 Bacteria 13976
536 Ga0207682_10000120 3300025893 Bacteria 36172
537 Ga0207682_10001604 3300025893 Bacteria 10396
538 Ga0207682_10047517 3300025893 Bacteria 1767
539 Ga0207682_10051884 3300025893 Bacteria 1699
540 Ga0207682_10065244 3300025893 Bacteria 1532
541 Ga0207642_10016419 3300025899 Bacteria 2788
542 Ga0207642_10029220 3300025899 Bacteria 2280
543 Ga0207642_10068697 3300025899 Bacteria 1677
544 Ga0207680_10011590 3300025903 Bacteria 4459
545 Ga0207680_10147969 3300025903 Bacteria 1563
546 Ga0207647_10059083 3300025904 Bacteria 2347
547 Ga0207645_10001475 3300025907 Bacteria 19229
548 Ga0207645_10017113 3300025907 Bacteria 4789
549 Ga0207645_10085833 3300025907 Bacteria 2021
550 Ga0207643_10000681 3300025908 Bacteria 21214
551 Ga0207643_10026471 3300025908 Bacteria 3211
552 Ga0207643_10107981 3300025908 Bacteria 1637
553 Ga0207654_10099305 3300025911 Bacteria 1790
554 Ga0207695_10118124 3300025913 Bacteria 2623
555 Ga0207671_10001800 3300025914 Bacteria 23963
556 Ga0207660_10155321 3300025917 Bacteria 1761
557 Ga0207662_10004254 3300025918 Bacteria 7509
558 Ga0207657_10000822 3300025919 Bacteria 32803
559 Ga0207649_10049281 3300025920 Bacteria 2600
560 Ga0207649_10090844 3300025920 Bacteria 1999
561 Ga0207681_10016998 3300025923 Bacteria 4563
562 Ga0207681_10021841 3300025923 Bacteria 4074
563 Ga0207681_10057263 3300025923 Bacteria 2663
564 Ga0207694_10004998 3300025924 Bacteria 10260
565 Ga0207650_10006154 3300025925 Bacteria 8179
566 Ga0207650_10040265 3300025925 Bacteria 3419
567 Ga0207650_10043242 3300025925 Bacteria 3306
568 Ga0207650_10174301 3300025925 Bacteria 1711
569 Ga0207659_10010325 3300025926 Bacteria 5864
570 Ga0207659_10024313 3300025926 Bacteria 4057
571 Ga0207659_10039189 3300025926 Bacteria 3302
572 Ga0207659_10101309 3300025926 Bacteria 2172
573 Ga0207659_10413358 3300025926 Bacteria 1130
574 Ga0207659_10474914 3300025926 Bacteria 1056
575 Ga0207644_10008321 3300025931 Bacteria 6797
576 Ga0207644_10021143 3300025931 Bacteria 4429
577 Ga0207690_10002002 3300025932 Bacteria 12484
578 Ga0207706_10000149 3300025933 Bacteria 76532
579 Ga0207706_10000850 3300025933 Bacteria 31426
580 Ga0207706_10003793 3300025933 Bacteria 14408
581 Ga0207706_10029503 3300025933 Bacteria 4896
582 Ga0207706_10108327 3300025933 Bacteria 2445
583 Ga0207706_10134632 3300025933 Bacteria 2173
584 Ga0207706_10272194 3300025933 Bacteria 1478
585 Ga0207686_10148193 3300025934 Bacteria 1630
586 Ga0207709_10000771 3300025935 Bacteria 25177
587 Ga0207709_10001360 3300025935 Bacteria 17193
588 Ga0207709_10025348 3300025935 Bacteria 3394
589 Ga0207709_10028943 3300025935 Bacteria 3207
590 Ga0207709_10029949 3300025935 Bacteria 3162
591 Ga0207709_10117902 3300025935 Bacteria 1787
592 Ga0207709_10136795 3300025935 Bacteria 1678
593 Ga0207709_10148361 3300025935 Bacteria 1621
594 Ga0207670_10400184 3300025936 Bacteria 1098
595 Ga0207669_10006269 3300025937 Bacteria 5419
596 Ga0207669_10061575 3300025937 Bacteria 2307
597 Ga0207669_10097632 3300025937 Bacteria 1932
598 Ga0207669_10241973 3300025937 Bacteria 1338
599 Ga0207704_10018734 3300025938 Bacteria 3621
600 Ga0207704_10026431 3300025938 Bacteria 3185
601 Ga0207704_10091255 3300025938 Bacteria 2001
602 Ga0207704_10271794 3300025938 Bacteria 1284
603 Ga0207691_10000773 3300025940 Bacteria 31657
604 Ga0207691_10001626 3300025940 Bacteria 22311
605 Ga0207691_10004125 3300025940 Bacteria 14115
606 Ga0207691_10016262 3300025940 Bacteria 7064
607 Ga0207691_10022311 3300025940 Bacteria 5971
608 Ga0207691_10024119 3300025940 Bacteria 5721
609 Ga0207691_10041027 3300025940 Bacteria 4275
610 Ga0207691_10082806 3300025940 Bacteria 2881
611 Ga0207691_10089646 3300025940 Bacteria 2757
612 Ga0207691_10245462 3300025940 Bacteria 1547
613 Ga0207691_10287616 3300025940 Bacteria 1414
614 Ga0207711_10023053 3300025941 Bacteria 5212
615 Ga0207711_10124729 3300025941 Bacteria 2302
616 Ga0207711_10155887 3300025941 Bacteria 2064
617 Ga0207711_10156409 3300025941 Bacteria 2060
618 Ga0207711_10344043 3300025941 Bacteria 1381
619 Ga0207689_10000049 3300025942 Bacteria 88948
620 Ga0207689_10000307 3300025942 Bacteria 45007
621 Ga0207689_10001301 3300025942 Bacteria 24043
622 Ga0207689_10008205 3300025942 Bacteria 9100
623 Ga0207689_10060861 3300025942 Bacteria 3105
624 Ga0207689_10165152 3300025942 Bacteria 1824
625 Ga0207689_10193318 3300025942 Bacteria 1679
626 Ga0207689_10231835 3300025942 Bacteria 1526
627 Ga0207679_10008364 3300025945 Bacteria 6589
628 Ga0207679_10062155 3300025945 Bacteria 2782
629 Ga0207679_10106195 3300025945 Bacteria 2207
630 Ga0207679_10217309 3300025945 Bacteria 1606
631 Ga0207667_10001720 3300025949 Bacteria 27567
632 Ga0207667_10032111 3300025949 Bacteria 5660
633 Ga0207667_10133856 3300025949 Bacteria 2553
634 Ga0207667_10432257 3300025949 Bacteria 1339
635 Ga0207651_10001889 3300025960 Bacteria 9820
636 Ga0207651_10019990 3300025960 Bacteria 4029
637 Ga0207651_10022461 3300025960 Bacteria 3858
638 Ga0207651_10078633 3300025960 Bacteria 2366
639 Ga0207651_10120546 3300025960 Bacteria 1988
640 Ga0207712_10010255 3300025961 Bacteria 5944
641 Ga0207712_10064721 3300025961 Bacteria 2608
642 Ga0207712_10094687 3300025961 Bacteria 2207
643 Ga0207668_10008031 3300025972 Bacteria 6282
644 Ga0207668_10029069 3300025972 Bacteria 3620
645 Ga0207668_10056523 3300025972 Bacteria 2733
646 Ga0207668_10069586 3300025972 Bacteria 2506
647 Ga0207668_10146608 3300025972 Bacteria 1822
648 Ga0207668_10273177 3300025972 Bacteria 1383
649 Ga0207668_10276807 3300025972 Bacteria 1374
650 Ga0207640_10044846 3300025981 Bacteria 2836
651 Ga0207640_10062911 3300025981 Bacteria 2464
652 Ga0207658_10003343 3300025986 Bacteria 11381
653 Ga0207658_10006980 3300025986 Bacteria 7688
654 Ga0207658_10021590 3300025986 Bacteria 4473
655 Ga0207658_10040679 3300025986 Bacteria 3362
656 Ga0207677_10003034 3300026023 Bacteria 8873
657 Ga0207677_10008690 3300026023 Bacteria 5686
658 Ga0207677_10059178 3300026023 Bacteria 2642
659 Ga0207677_10076559 3300026023 Bacteria 2382
660 Ga0207677_10173734 3300026023 Bacteria 1688
661 Ga0207677_10398444 3300026023 Bacteria 1167
662 Ga0207703_10002822 3300026035 Bacteria 14826
663 Ga0207703_10003906 3300026035 Bacteria 12376
664 Ga0207703_10037171 3300026035 Bacteria 3879
665 Ga0207703_10274231 3300026035 Bacteria 1529
666 Ga0207639_10005031 3300026041 Bacteria 8906
667 Ga0207639_10055874 3300026041 Bacteria 3023
668 Ga0207639_10221377 3300026041 Bacteria 1635
669 Ga0207639_10234731 3300026041 Bacteria 1592
670 Ga0207639_10313675 3300026041 Bacteria 1390
671 Ga0207678_10011833 3300026067 Bacteria 7661
672 Ga0207678_10100600 3300026067 Bacteria 2469
673 Ga0207678_10103375 3300026067 Bacteria 2432
674 Ga0207678_10220158 3300026067 Bacteria 1625
675 Ga0207678_10299085 3300026067 Bacteria 1383
676 Ga0207708_10000529 3300026075 Bacteria 29463
677 Ga0207708_10008749 3300026075 Bacteria 7489
678 Ga0207708_10022047 3300026075 Bacteria 4808
679 Ga0207708_10274462 3300026075 Bacteria 1364
680 Ga0207702_10157221 3300026078 Bacteria 2073
681 Ga0207702_10205785 3300026078 Bacteria 1827
682 Ga0207641_10008475 3300026088 Bacteria 8497
683 Ga0207641_10017295 3300026088 Bacteria 5902
684 Ga0207641_10036405 3300026088 Bacteria 4108
685 Ga0207641_10065664 3300026088 Bacteria 3104
686 Ga0207641_10141285 3300026088 Bacteria 2172
687 Ga0207641_10207970 3300026088 Bacteria 1808
688 Ga0207648_10002306 3300026089 Bacteria 20605
689 Ga0207648_10003420 3300026089 Bacteria 16668
690 Ga0207648_10006661 3300026089 Bacteria 11462
691 Ga0207648_10010535 3300026089 Bacteria 8755
692 Ga0207648_10021312 3300026089 Bacteria 5826
693 Ga0207648_10027187 3300026089 Bacteria 5081
694 Ga0207648_10049953 3300026089 Bacteria 3658
695 Ga0207648_10080063 3300026089 Bacteria 2850
696 Ga0207648_10461373 3300026089 Bacteria 1158
697 Ga0207676_10004825 3300026095 Bacteria 9564
698 Ga0207676_10027811 3300026095 Bacteria 4217
699 Ga0207676_10064917 3300026095 Bacteria 2905
700 Ga0207676_10105918 3300026095 Bacteria 2342
701 Ga0207676_10197159 3300026095 Bacteria 1776
702 Ga0207676_10337422 3300026095 Bacteria 1389
703 Ga0207674_10003249 3300026116 Bacteria 20002
704 Ga0207674_10003275 3300026116 Bacteria 19914
705 Ga0207674_10020383 3300026116 Bacteria 7164
706 Ga0207674_10157866 3300026116 Bacteria 2223
707 Ga0207675_100003946 3300026118 Bacteria 14398
708 Ga0207675_100008033 3300026118 Bacteria 9941
709 Ga0207675_100032927 3300026118 Bacteria 4829
710 Ga0207675_100035316 3300026118 Bacteria 4662
711 Ga0207675_100035639 3300026118 Bacteria 4641
712 Ga0207675_100055481 3300026118 Bacteria 3696
713 Ga0207675_100596275 3300026118 Bacteria 1107
714 Ga0207683_10006932 3300026121 Bacteria 9705
715 Ga0207683_10008101 3300026121 Bacteria 8986
716 Ga0207683_10010884 3300026121 Bacteria 7760
717 Ga0207683_10030812 3300026121 Bacteria 4651
718 Ga0207683_10050620 3300026121 Bacteria 3639
719 Ga0207683_10240983 3300026121 Bacteria 1650
720 Ga0207683_10260994 3300026121 Bacteria 1582
721 Ga0207683_10318998 3300026121 Bacteria 1423
722 Ga0207698_10034135 3300026142 Bacteria 3705
723 Ga0207698_10121441 3300026142 Bacteria 2212
724 Ga0207698_10182443 3300026142 Bacteria 1861
725 Ga0207698_10427876 3300026142 Bacteria 1272
726 Ga0207698_10624105 3300026142 Bacteria 1065
727 Ga0209281_1000160 3300027111 Bacteria 161071
728 Ga0209371_1003487 3300027312 Bacteria 7604
729 Ga0209999_1015003 3300027543 Bacteria 1408
730 Ga0209983_1006590 3300027665 Bacteria 2383
731 Ga0209983_1028576 3300027665 Bacteria 1183
732 Ga0209282_1000069 3300027666 Bacteria 85661
733 Ga0209282_1018317 3300027666 Bacteria 4444
734 Ga0209282_1087699 3300027666 Bacteria 1640
735 Ga0209971_1015433 3300027682 Bacteria 1810
736 Ga0209998_10027200 3300027717 Bacteria 1252
737 Ga0268266_10017786 3300028379 Bacteria 6057
738 Ga0268266_10039667 3300028379 Bacteria 4011
739 Ga0268266_10044855 3300028379 Bacteria 3780
740 Ga0268266_10078909 3300028379 Bacteria 2866
741 Ga0268266_10079755 3300028379 Bacteria 2851
742 Ga0268266_10086096 3300028379 Bacteria 2747
743 Ga0268266_10154105 3300028379 Bacteria 2074
744 Ga0268265_10006606 3300028380 Bacteria 7850
745 Ga0268265_10029739 3300028380 Bacteria 3927
746 Ga0268265_10088981 3300028380 Bacteria 2461
747 Ga0268265_10164888 3300028380 Bacteria 1887
748 Ga0268265_10191253 3300028380 Bacteria 1767
749 Ga0268265_10294024 3300028380 Bacteria 1459
750 Ga0268264_10000624 3300028381 Bacteria 42120
751 Ga0268264_10017548 3300028381 Bacteria 5862
752 Ga0268264_10102319 3300028381 Bacteria 2492
753 Ga0268264_10180804 3300028381 Bacteria 1915
754 Ga0268264_10186400 3300028381 Bacteria 1888
755 Ga0268264_10452026 3300028381 Bacteria 1245
756 Ga0307517_10033655 3300028786 Bacteria 5873
757 Ga0307515_10000058 3300028794 Bacteria 259680
758 Ga0307515_10000267 3300028794 Bacteria 128554
759 Ga0307515_10000283 3300028794 Bacteria 124822
760 Ga0307515_10000302 3300028794 Bacteria 121875
761 Ga0307515_10000586 3300028794 Bacteria 85517
762 Ga0307515_10003631 3300028794 Bacteria 32412
763 Ga0307515_10011842 3300028794 Bacteria 16497
764 Ga0307515_10081285 3300028794 Bacteria 4211
765 Ga0307515_10105750 3300028794 Bacteria 3347
766 Ga0307515_10118612 3300028794 Bacteria 3018
767 Ga0307515_10157981 3300028794 Bacteria 2329
768 Ga0307515_10251002 3300028794 Bacteria 1522
769 Ga0268256_1007657 3300030500 Bacteria 3816
770 Ga0307512_10018592 3300030522 Bacteria 6347
771 Ga0307512_10038652 3300030522 Bacteria 4012
772 Ga0316177_1102153 3300030731 Bacteria 3157
773 Ga0314311_1141747 3300030733 Bacteria 3965
774 Ga0316183_1033032 3300030742 Bacteria 2810
775 Ga0265327_10005641 3300031251 Bacteria 10362
776 Ga0307513_10000010 3300031456 Bacteria 360812
777 Ga0307513_10000051 3300031456 Bacteria 149733
778 Ga0307513_10049729 3300031456 Bacteria 4538
779 Ga0307513_10060104 3300031456 Bacteria 4030
780 Ga0307513_10077516 3300031456 Bacteria 3441
781 Ga0307513_10103072 3300031456 Bacteria 2871
782 Ga0307513_10108365 3300031456 Bacteria 2779
783 Ga0307513_10139562 3300031456 Bacteria 2352
784 Ga0307513_10399439 3300031456 Bacteria 1109
785 Ga0307509_10011999 3300031507 Bacteria 10407
786 Ga0307509_10071187 3300031507 Bacteria 3628
787 Ga0307509_10096280 3300031507 Bacteria 3012
788 Ga0307408_100000193 3300031548 Bacteria 65882
789 Ga0307408_100001412 3300031548 Bacteria 17856
790 Ga0307408_100007530 3300031548 Bacteria 7197
791 Ga0307408_100022612 3300031548 Bacteria 4274
792 Ga0307408_100056105 3300031548 Bacteria 2855
793 Ga0307408_100090913 3300031548 Bacteria 2304
794 Ga0307408_100128014 3300031548 Bacteria 1977
795 Ga0307508_10000876 3300031616 Bacteria 35008
796 Ga0307508_10001111 3300031616 Bacteria 31133
797 Ga0307508_10016840 3300031616 Bacteria 6650
798 Ga0307508_10171782 3300031616 Bacteria 1771
799 Ga0307514_10000806 3300031649 Bacteria 51095
800 Ga0307514_10014746 3300031649 Bacteria 6462
801 Ga0307514_10068076 3300031649 Bacteria 2685
802 Ga0307516_10001118 3300031730 Bacteria 37358
803 Ga0307516_10037208 3300031730 Bacteria 4866
804 Ga0307516_10097543 3300031730 Bacteria 2759
805 Ga0307405_10397803 3300031731 Bacteria 1077
806 Ga0307410_10001817 3300031852 Bacteria 9908
807 Ga0307406_10000944 3300031901 Bacteria 16257
808 Ga0307406_10002109 3300031901 Bacteria 10838
809 Ga0307406_10020580 3300031901 Bacteria 3888
810 Ga0307406_10107886 3300031901 Bacteria 1910
811 Ga0307407_10087522 3300031903 Bacteria 1901
812 Ga0307412_10002610 3300031911 Bacteria 10008
813 Ga0307412_10008248 3300031911 Bacteria 5939
814 Ga0307412_10059041 3300031911 Bacteria 2569
815 Ga0307409_100026624 3300031995 Bacteria 4082
816 Ga0307416_100095618 3300032002 Bacteria 2566
817 Ga0307416_100523136 3300032002 Bacteria 1255
818 Ga0307416_100694142 3300032002 Bacteria 1106
819 Ga0307414_10061593 3300032004 Bacteria 2659
820 Ga0307414_10272083 3300032004 Bacteria 1419
821 Ga0307411_10128359 3300032005 Bacteria 1848
822 Ga0307411_10135310 3300032005 Bacteria 1808
823 Ga0307411_10196374 3300032005 Bacteria 1545
824 Ga0307507_10247610 3300033179 Bacteria 1156
825 Ga0307510_10133426 3300033180 Bacteria 2148
826 Ga0373953_0045721 3300035117 Bacteria 1756
827 Ga0373955_0061335 3300035172 Bacteria 2077
828 Ga0373955_0079570 3300035172 Bacteria 1849
829 Ga0373924_0136413 3300035410 Bacteria 1069
830 Ga0373931_0052842 3300035691 Bacteria 2167
831 Ga0373937_0014096 3300036401 Bacteria 7050
832 Ga0373937_0064919 3300036401 Bacteria 3359
833 Ga0373937_0246317 3300036401 Bacteria 1684
834 Ga0373925_0003621 3300037068 Bacteria 11900
835 Ga0373925_0106669 3300037068 Bacteria 2160
836 Ga0400483_058929 3300039062 Bacteria 2961
837 Ga0400483_242388 3300039062 Bacteria 1539
838 Ga0439436_0001073 3300041404 Bacteria 7715
839 Ga0439436_0026058 3300041404 Bacteria 1715
840 Ga0439436_0056618 3300041404 Bacteria 1101
841 Ga0439447_004235 3300041407 Bacteria 4973
842 Ga0439431_0016358 3300041997 Bacteria 1735
843 Ga0439442_020080 3300042002 Bacteria 1384
844 Ga0439432_001458 3300042006 Bacteria 8874
845 Ga0439449_0000923 3300042007 Bacteria 11452
846 Ga0439449_0005718 3300042007 Bacteria 4752
847 Ga0439449_0040190 3300042007 Bacteria 1739
848 Ga0439450_024941 3300042008 Bacteria 1307
849 Ga0439452_005984 3300042010 Bacteria 3854
850 Ga0439452_019491 3300042010 Bacteria 1793
851 Ga0439452_027810 3300042010 Bacteria 1417
852 Ga0439457_002549 3300042014 Bacteria 5168
853 Ga0439462_0015908 3300042015 Bacteria 1942
854 Ga0439462_0035634 3300042015 Bacteria 1323
855 Ga0450911_000137 3300042115 Bacteria 29337
856 Ga0450921_000339 3300042123 Bacteria 2107
857 Ga0450898_006861 3300042134 Bacteria 1760
858 Ga0439434_0002704 3300042435 Bacteria 5161
859 Ga0450918_002201 3300042531 Bacteria 3710
860 Ga0450893_0009504 3300042532 Bacteria 1589
861 Ga0451577_0029841 3300042876 Bacteria 4927
862 Ga0451577_0075805 3300042876 Bacteria 2999
863 Ga0451577_0104665 3300042876 Bacteria 2529
864 Ga0451577_0131994 3300042876 Bacteria 2241
865 Ga0453684_0004147 3300044712 Bacteria 31361
866 Ga0453684_0059476 3300044712 Bacteria 4925
867 Ga0453684_0150918 3300044712 Bacteria 2762
868 Ga0451576_0009619 3300045051 Bacteria 11183
869 Ga0451576_0116563 3300045051 Bacteria 2781
870 Ga0495627_006938 3300046453 Bacteria 4397
871 Ga0495627_020194 3300046453 Bacteria 2223
872 Ga0495590_0014273 3300046457 Bacteria 2901
873 Ga0495629_0243433 3300046459 Bacteria 1238
874 Ga0495605_0004236 3300046474 Bacteria 8448
875 Ga0495639_0015227 3300046475 Bacteria 3332
876 Ga0495664_0015726 3300046477 Bacteria 4306
877 Ga0495596_0000317 3300046500 Bacteria 31540
878 Ga0495607_0000280 3300046501 Bacteria 54943
879 Ga0495583_0063383 3300046506 Bacteria 1643
880 Ga0495610_0000424 3300046512 Bacteria 43401
881 Ga0495610_0018922 3300046512 Bacteria 3871
882 Ga0495616_0006264 3300046513 Bacteria 7226
883 Ga0495616_0044348 3300046513 Bacteria 2255
884 Ga0495620_0052852 3300046515 Bacteria 1723
885 Ga0495631_0001923 3300046518 Bacteria 12220
886 Ga0495632_0048912 3300046519 Bacteria 2092
887 Ga0495632_0051016 3300046519 Bacteria 2038
888 Ga0495637_0007031 3300046520 Bacteria 5604
889 Ga0495637_0013071 3300046520 Bacteria 3952
890 Ga0495643_0093802 3300046522 Bacteria 1545
891 Ga0495642_0111393 3300046528 Bacteria 1170
892 Ga0495654_0008854 3300046530 Bacteria 5534
893 Ga0495609_0009581 3300046538 Bacteria 4683
894 Ga0495621_0095725 3300046539 Bacteria 1125
895 Ga0495597_0020417 3300046542 Bacteria 3087
896 Ga0495597_0022634 3300046542 Bacteria 2913
897 Ga0495633_0006330 3300046558 Bacteria 7044
898 Ga0495656_0002566 3300046615 Bacteria 6051
899 Ga0495625_0000396 3300046660 Bacteria 66627
900 Ga0495625_0000807 3300046660 Bacteria 43441
901 Ga0495625_0038121 3300046660 Bacteria 3520
902 Ga0495625_0081869 3300046660 Bacteria 2246
903 Ga0495661_0068155 3300046665 Bacteria 2088
904 Ga0495658_0006349 3300046683 Bacteria 5806
905 Ga0495671_0001711 3300046692 Bacteria 14294
906 Ga0495649_0175933 3300046694 Bacteria 1118
907 Ga0495660_0035956 3300046810 Bacteria 2764
908 Ga0495672_0005564 3300047320 Bacteria 9963
909 Ga0495687_000196 3300047443 Bacteria 87053
910 Ga0495687_021061 3300047443 Bacteria 3165
911 Ga0495687_045689 3300047443 Bacteria 1894
912 Ga0495677_0103754 3300047445 Bacteria 1078
913 Ga0495686_0145921 3300047472 Bacteria 1393
914 Ga0496101_0003644 3300048904 Bacteria 9612
915 Ga0496102_0024833 3300048905 Bacteria 5330
916 Ga0496103_0023992 3300048906 Bacteria 3680
917 Ga0496103_0208205 3300048906 Bacteria 1258
918 Ga0496104_0021963 3300048907 Bacteria 5862
919 Ga0496105_0021257 3300048908 Bacteria 5251
920 Ga0496105_0095237 3300048908 Bacteria 2459
921 Ga0496105_0173682 3300048908 Bacteria 1766
922 Ga0496106_0036400 3300048909 Bacteria 3682
923 Ga0496107_0008919 3300048910 Bacteria 6949
924 Ga0496107_0223374 3300048910 Bacteria 1401
925 Ga0496108_0020007 3300048911 Bacteria 5500
926 Ga0496109_0005385 3300048912 Bacteria 10697
927 Ga0496109_0038690 3300048912 Bacteria 4313
928 Ga0496109_0337549 3300048912 Bacteria 1423
929 Ga0496110_0027094 3300048913 Bacteria 4910
930 Ga0496110_0042796 3300048913 Bacteria 3953
931 Ga0496110_0094456 3300048913 Bacteria 2678
932 Ga0496112_0541449 3300048915 Bacteria 1098
933 Ga0496114_0030341 3300048917 Bacteria 4448
934 Ga0496114_0047087 3300048917 Bacteria 3585
935 Ga0496114_0099241 3300048917 Bacteria 2484
936 Ga0496116_0009002 3300048919 Bacteria 8579
937 Ga0496116_0016831 3300048919 Bacteria 5703
938 Ga0496116_0020474 3300048919 Bacteria 5022
939 Ga0496116_0024283 3300048919 Bacteria 4488
940 Ga0496116_0099800 3300048919 Bacteria 1737
941 Ga0496117_0034564 3300048920 Bacteria 3806
942 Ga0496117_0084871 3300048920 Bacteria 2064
943 Ga0496117_0114986 3300048920 Bacteria 1666
944 Ga0496118_0023463 3300048921 Bacteria 5357
945 Ga0496118_0070259 3300048921 Bacteria 2529
946 Ga0496118_0139684 3300048921 Bacteria 1538
947 Ga0496119_0017168 3300048922 Bacteria 5461
948 Ga0496119_0026563 3300048922 Bacteria 4011
949 Ga0496119_0147843 3300048922 Bacteria 1262
950 Ga0496120_0014853 3300048923 Bacteria 5164
951 Ga0496121_0000479 3300048924 Bacteria 77608
952 Ga0496121_0016763 3300048924 Bacteria 7537
953 Ga0496121_0049646 3300048924 Bacteria 3555
954 Ga0496121_0108493 3300048924 Bacteria 2123
955 Ga0496121_0161557 3300048924 Bacteria 1637
956 Ga0496122_0000217 3300048925 Bacteria 128502
957 Ga0496122_0000669 3300048925 Bacteria 68904
958 Ga0496122_0003097 3300048925 Bacteria 22353
959 Ga0496122_0003536 3300048925 Bacteria 20449
960 Ga0496122_0012827 3300048925 Bacteria 8288
961 Ga0496122_0046214 3300048925 Bacteria 3374
962 Ga0496123_0000057 3300048926 Bacteria 228608
963 Ga0496123_0000603 3300048926 Bacteria 61111
964 Ga0496123_0005860 3300048926 Bacteria 12169
965 Ga0496123_0017368 3300048926 Bacteria 5791
966 Ga0496123_0029483 3300048926 Bacteria 4038
967 Ga0496124_0052640 3300048927 Bacteria 3457
968 Ga0496124_0073690 3300048927 Bacteria 2824
969 Ga0496124_0087189 3300048927 Bacteria 2553
970 Ga0496124_0121197 3300048927 Bacteria 2090
971 Ga0496124_0282098 3300048927 Bacteria 1210
972 Ga0496125_0000168 3300048928 Bacteria 146364
973 Ga0496125_0000323 3300048928 Bacteria 93243
974 Ga0496125_0001023 3300048928 Bacteria 43458
975 Ga0496125_0023979 3300048928 Bacteria 5620
976 Ga0496125_0025456 3300048928 Bacteria 5417
977 Ga0496125_0030089 3300048928 Bacteria 4863
978 Ga0496125_0050199 3300048928 Bacteria 3456
979 Ga0496125_0064894 3300048928 Bacteria 2897
980 Ga0496125_0207534 3300048928 Bacteria 1276
981 Ga0496126_0016753 3300048929 Bacteria 7319
982 Ga0496126_0123726 3300048929 Bacteria 2240
983 Ga0496126_0162140 3300048929 Bacteria 1910
984 nmdc:mga03683_167353_c1 3300050489 Bacteria 998
985 nmdc:mga03683_3206_c1 3300050489 Bacteria 5230
986 nmdc:mga03683_42761_c1 3300050489 Bacteria 1866
987 nmdc:mga03683_67440_c1 3300050489 Bacteria 1523
988 nmdc:mga03683_95159_c1 3300050489 Bacteria 1303
989 nmdc:mga03n38_54907_c1 3300050490 Bacteria 1792
990 nmdc:mga00v17_20825_c1 3300050491 Bacteria 3762
991 nmdc:mga0yw44_70118_c1 3300050492 Bacteria 2173
992 nmdc:mga0k408_132207_c1 3300050493 Bacteria 1482
993 nmdc:mga0k408_3141_c1 3300050493 Bacteria 8757
994 nmdc:mga0k408_42063_c1 3300050493 Bacteria 2632
995 nmdc:mga0k408_86130_c1 3300050493 Bacteria 1844
996 nmdc:mga06z11_79686_c1 3300050494 Bacteria 1754
997 nmdc:mga07m45_14323_c1 3300050496 Bacteria 3809
998 nmdc:mga07m45_17804_c1 3300050496 Bacteria 3823
999 nmdc:mga07m45_3635_c1 3300050496 Bacteria 7450
1000 nmdc:mga07m45_50012_c1 3300050496 Bacteria 2355
1001 nmdc:mga07m45_686_c1 3300050496 Bacteria 14388
1002 nmdc:mga07m45_7718_c1 3300050496 Bacteria 5505
1003 nmdc:mga05p37_228483_c1 3300050507 Bacteria 2243
1004 nmdc:mga05p37_2709_c2 3300050507 Bacteria 16162
1005 nmdc:mga09592_271113_c1 3300050508 Bacteria 1472
1006 nmdc:mga09592_605991_c1 3300050508 Bacteria 938
1007 nmdc:mga09592_9202_c1 3300050508 Bacteria 8035
1008 nmdc:mga0qj67_417732_c1 3300050509 Bacteria 1081
1009 nmdc:mga06r32_458823_c1 3300050510 Bacteria 1253
1010 nmdc:mga0n895_68479_c1 3300050512 Bacteria 3516
1011 nmdc:mga0a205_9315_c1 3300050515 Bacteria 8967
1012 nmdc:mga0sz30_123953_c1 3300050516 Bacteria 1136
1013 nmdc:mga0sz30_6916_c1 3300050516 Bacteria 4235
1014 Ga0500610_0000489 3300053079 Bacteria 12171
1015 Ga0495619_0185339 3300053085 Bacteria 1440
1016 Ga0500644_0053915 3300053088 Bacteria 1390
1017 Ga0500647_0133216 3300053091 Bacteria 1171
1018 Ga0500651_0045805 3300053093 Bacteria 2751
1019 Ga0500650_0046871 3300053098 Bacteria 2003
1020 Ga0500571_010381 3300053110 Bacteria 5144
1021 Ga0500593_005223 3300053117 Bacteria 5093
1022 Ga0500594_0003123 3300053118 Bacteria 3623
1023 Ga0500607_007771 3300053121 Bacteria 6586
1024 Ga0500608_035205 3300053122 Bacteria 2388
1025 Ga0500655_006844 3300053133 Bacteria 2052
1026 Ga0500658_0001265 3300053134 Bacteria 10249
1027 Ga0500658_0002137 3300053134 Bacteria 7686
1028 Ga0500658_0130232 3300053134 Bacteria 1121
1029 Ga0500559_0005433 3300053136 Bacteria 5861
1030 Ga0500568_0001949 3300053139 Bacteria 12653
1031 Ga0500627_0022906 3300053158 Bacteria 2540
1032 Ga0500634_0065523 3300053161 Bacteria 1916
1033 Ga0500637_0005139 3300053178 Bacteria 6306
1034 Ga0500645_000198 3300053730 Bacteria 46701
1035 Ga0500645_000493 3300053730 Bacteria 26655
1036 Ga0500645_011097 3300053730 Bacteria 2954
1037 Ga0500587_000066 3300053739 Bacteria 8567
1038 2511245932 2511231002 Bacteria 5042903
1039 2512036213 2511231221 Bacteria 6846400
1040 2513231799 2513020051 Bacteria 6053213
1041 2548497399 2547132374 Bacteria 5530232
1042 2587757178 2585428062 Bacteria 6842168
1043 2599101933 2597490356 Bacteria 7030811
1044 2599626662 2599185214 Bacteria 8209958
1045 2599675726 2599185226 Bacteria 8233575
1046 2599684199 2599185227 Bacteria 8246414
1047 2599696213 2599185229 Bacteria 8216126
1048 2599902927 2599185292 Bacteria 6290804
1049 2643861750 2643221569 Bacteria 6064337
1050 2643866565 2643221570 Bacteria 5103772
1051 2643983215 2643221594 Bacteria 5811388
1052 2643993317 2643221596 Bacteria 5006805
1053 2644060686 2643221609 Bacteria 6756331
1054 2644074006 2643221611 Bacteria 6820941
1055 2644123476 2643221621 Bacteria 6212786
1056 2644159576 2643221628 Bacteria 5745828
1057 2644294078 2643221652 Bacteria 5140275
1058 2644303759 2643221654 Bacteria 5273570
1059 2644327938 2643221658 Bacteria 6064537
1060 2644397900 2643221672 Bacteria 6322190
1061 2644468259 2643221683 Bacteria 5749203
1062 2644646251 2643221717 Bacteria 5676132
1063 2738718081 2738541277 Bacteria 7458140
1064 2738885020 2738541307 Bacteria 8606193
1065 2739242712 2738543012 Bacteria 7115078
1066 2739250458 2738543013 Bacteria 5618633
1067 2739278767 2738543019 Bacteria 7459457
1068 2753357601 2751185800 Bacteria 5467370
1069 2758640098 2758568016 Bacteria 5645291
1070 2809033260 2808606395 Bacteria 6020352
1071 2816472972 2816332133 Bacteria 7249298
1072 2819595772 2818991446 Bacteria 7757362
1073 2831266783 2831265667 Bacteria 7184833
1074 2838057136 2838054893 Bacteria 7451788
1075 2842335006 2842333319 Bacteria 8899485
1076 2842682576 2842677519 Bacteria 5615038
1077 2842735584 2842733646 Bacteria 5716726
1078 2842751321 2842747753 Bacteria 5578255
1079 2846958079 2846952575 Bacteria 6587527
1080 2848864859 2848858292 Bacteria 7391279
1081 2854913334 2854911287 Bacteria 5582813
1082 2857538241 2857537821 Bacteria 5248181
1083 2857580794 2857576091 Bacteria 5465855
1084 2858952051 2858950400 Bacteria 6783797
1085 2885192725 2885192300 Bacteria 5882526
1086 2885201232 2885198086 Bacteria 7212419
1087 2885214886 2885211737 Bacteria 7212420
1088 2894027683 2894023352 Bacteria 5167372
1089 2897805876 2897803580 Bacteria 7000062
1090 2899925118 2899924645 Bacteria 7487985
1091 2904454452 2904449895 Bacteria 6927402
1092 2904461105 2904456579 Bacteria 6819253
1093 2904544741 2904541872 Bacteria 8915136
1094 2919465982 2919462493 Bacteria 5817112
1095 2919707444 2919704043 Bacteria 5560311
1096 2928038757 2928037797 Bacteria 7273642
1097 2928045638 2928044640 Bacteria 7271509
1098 2928053255 2928051484 Bacteria 7773759
1099 2928066860 2928064002 Bacteria 7419480
1100 2928071254 2928070936 Bacteria 8062541
1101 2928084817 2928084124 Bacteria 7159212
1102 2928119626 2928115317 Bacteria 6477646
1103 2929163588 2929160207 Bacteria 9075316
1104 2929526987 2929520902 Bacteria 6765052
1105 2932425138 2932422444 Bacteria 4678430
1106 2941482490
1107 2945912275 2945909444 Bacteria 7065066
1108 2945948209 2945945610 Bacteria 5951079
1109 2945985414 2945984333 Bacteria 7358892
1110 2954772326 2954767861 Bacteria 5535784
1111 2974323373 2974320154 Bacteria 4571377
1112 2990712248 2990710928 Bacteria 5002431
1113 8054008479 8054002106 Bacteria 7987183
1114 Ga0070678_100004479
1115 SwRhRL2b_contig_2666113
1116 JGI24749J21850_1004017
1117 JGI25155J39150_1000002
1118 JGI25156J39149_1000003
1119 JGI25154J39366_1000009
1120 JGI25157J39369_1000002
1121 JGI25152J39213_1001234
1122 JGI25150J39212_1000784
1123 JGI25159J45721_1000148
1124 JGI25159J45721_1001075
1125 JGI25159J45721_1023052
1126 JGI25151J46595_10001070
1127 JGI25151J46595_10002632
1128 JGI25151J46595_10011867
1129 JGI25151J46595_10024513
1130 JGI25151J46595_10043128
1131 JGI25153J46596_10001727
1132 JGI25153J46596_10001768
1133 JGI25160J50197_1000123
1134 JGI25160J50197_1009409
1135 JGI25161J50226_1000032
1136 JGI25161J50226_1001050
1137 Ga0055542_1000021
1138 Ga0055526_1001458
1139 Ga0055526_1002300
1140 Ga0055526_1002744
1141 Ga0055526_1003550
1142 Ga0055526_1003943
1143 Ga0055526_1007340
1144 Ga0055526_1010696
1145 Ga0055537_1000079
1146 Ga0055537_1003026
1147 Ga0055524_1000012
1148 Ga0055524_1000097
1149 Ga0055524_1000987
1150 Ga0055524_1001542
1151 Ga0055524_1001822
1152 Ga0055536_1000657
1153 Ga0055536_1000861
1154 Ga0055536_1001022
1155 Ga0055536_1001230
1156 Ga0055536_1005409
1157 Ga0055536_1008299
1158 Ga0055536_1009066
1159 Ga0055534_1000092
1160 Ga0055534_1001022
1161 Ga0055534_1001081
1162 Ga0055534_1001381
1163 Ga0055534_1004666
1164 Ga0055528_1000956
1165 Ga0055528_1002291
1166 Ga0055528_1009159
1167 Ga0055530_10000453
1168 Ga0055530_10000793
1169 Ga0055530_10017436
1170 Ga0055540_1000012
1171 Ga0055540_1001467
1172 Ga0055540_1002293
1173 Ga0055531_10000653
1174 Ga0055531_10001541
1175 Ga0055543_1000294
1176 Ga0055543_1000696
1177 Ga0065165_1002228
1178 Ga0065165_1012757
1179 Ga0065165_1012901
1180 Ga0065704_10011989
1181 Ga0065712_10148324
1182 Ga0065715_10125828
1183 Ga0065715_10129220
1184 Ga0070676_10014907
1185 Ga0070676_10035845
1186 Ga0070676_10079487
1187 Ga0070676_10283737
1188 Ga0070683_100023735
1189 Ga0070690_100003489
1190 Ga0070690_100056744
1191 Ga0070690_100110902
1192 Ga0070670_100001483
1193 Ga0070670_100002742
1194 Ga0070670_100007028
1195 Ga0070670_100008068
1196 Ga0070670_100037126
1197 Ga0070670_100066159
1198 Ga0070670_100084979
1199 Ga0070670_100113866
1200 Ga0070677_10002129
1201 Ga0070677_10022565
1202 Ga0070677_10030335
1203 Ga0070677_10040639
1204 Ga0070677_10080223
1205 Ga0070677_10083395
1206 Ga0068869_100000178
1207 Ga0068869_100009675
1208 Ga0068869_100042331
1209 Ga0068869_100091902
1210 Ga0070666_10014344
1211 Ga0070666_10025971
1212 Ga0070666_10074039
1213 Ga0070666_10088379
1214 Ga0070666_10276568
1215 Ga0070680_100143639
1216 Ga0068868_100005608
1217 Ga0068868_100068148
1218 Ga0068868_100092542
1219 Ga0070687_100006353
1220 Ga0070661_100003091
1221 Ga0070661_100014055
1222 Ga0070661_100090249
1223 Ga0070661_100431373
1224 Ga0070692_10049561
1225 Ga0070668_100004619
1226 Ga0070668_100034232
1227 Ga0070668_100053700
1228 Ga0070668_100065909
1229 Ga0070668_100078177
1230 Ga0070668_100103436
1231 Ga0070668_100177094
1232 Ga0070669_100008927
1233 Ga0070669_100015579
1234 Ga0070669_100018890
1235 Ga0070669_100065009
1236 Ga0070669_100098538
1237 Ga0070669_100113582
1238 Ga0070669_100178562
1239 Ga0070675_100001733
1240 Ga0070675_100014191
1241 Ga0070675_100020917
1242 Ga0070675_100033094
1243 Ga0070675_100080936
1244 Ga0070675_100364892
1245 Ga0070671_100004476
1246 Ga0070671_100015093
1247 Ga0070671_100020848
1248 Ga0070671_100025674
1249 Ga0070671_100063486
1250 Ga0070671_100269750
1251 Ga0070674_100024203
1252 Ga0070674_100036087
1253 Ga0070674_100047128
1254 Ga0070674_100056035
1255 Ga0070674_100075904
1256 Ga0070674_100139183
1257 Ga0070674_100152914
1258 Ga0070673_100009444
1259 Ga0070673_100017776
1260 Ga0070673_100056382
1261 Ga0070673_100205263
1262 Ga0070688_100009048
1263 Ga0070688_100025675
1264 Ga0070659_100017155
1265 Ga0070659_100332341
1266 Ga0070667_100001198
1267 Ga0070667_100018482
1268 Ga0070667_100023441
1269 Ga0070667_100120129
1270 Ga0070667_100223216
1271 Ga0070667_100255016
1272 Ga0070705_100318140
1273 Ga0070700_100004393
1274 Ga0070700_100103998
1275 Ga0070694_100150561
1276 Ga0070663_100027541
1277 Ga0070678_100013926
1278 Ga0070678_100016709
1279 Ga0070678_100040672
1280 Ga0070678_100061942
1281 Ga0070678_100283497
1282 Ga0070662_100003994
1283 Ga0070662_100005238
1284 Ga0070662_100013360
1285 Ga0070662_100116545
1286 Ga0070681_10097261
1287 Ga0068867_100000273
1288 Ga0068867_100005155
1289 Ga0068867_100031942
1290 Ga0068867_100061662
1291 Ga0068867_100091081
1292 Ga0068867_100201226
1293 Ga0068867_100261268
1294 Ga0070685_10078150
1295 Ga0070699_100413942
1296 Ga0070679_100329255
1297 Ga0068853_100014373
1298 Ga0070672_100004667
1299 Ga0070672_100027843
1300 Ga0070672_100047555
1301 Ga0070672_100049824
1302 Ga0070672_100065484
1303 Ga0070672_100281148
1304 Ga0070672_100310324
1305 Ga0070686_100051186
1306 Ga0070686_100124845
1307 Ga0070665_100001639
1308 Ga0070665_100035254
1309 Ga0070665_100088396
1310 Ga0070665_100148512
1311 Ga0070665_100351009
1312 Ga0070704_100186982
1313 Ga0068855_100031834
1314 Ga0068855_100046637
1315 Ga0068855_100051726
1316 Ga0070664_100004590
1317 Ga0070664_100005648
1318 Ga0070664_100013082
1319 Ga0070664_100023188
1320 Ga0070664_100106699
1321 Ga0070664_100112024
1322 Ga0070664_100172815
1323 Ga0070664_100176528
1324 Ga0070664_100413950
1325 Ga0068857_100001689
1326 Ga0068857_100074298
1327 Ga0068857_100088217
1328 Ga0068857_100202659
1329 Ga0068854_100013238
1330 Ga0068854_100023805
1331 Ga0068854_100541336
1332 Ga0068856_100028024
1333 Ga0068856_100193519
1334 Ga0068856_100409959
1335 Ga0068852_100012178
1336 Ga0068852_100174244
1337 Ga0068852_100201849
1338 Ga0068852_100229881
1339 Ga0068852_100255704
1340 Ga0068852_100657862
1341 Ga0068859_100007644
1342 Ga0068859_100010715
1343 Ga0068859_100121908
1344 Ga0068859_100137430
1345 Ga0068859_100165593
1346 Ga0068859_100579609
1347 Ga0068864_100000199
1348 Ga0068864_100002200
1349 Ga0068864_100004274
1350 Ga0068864_100031330
1351 Ga0068864_100032954
1352 Ga0068864_100159549
1353 Ga0068864_100189564
1354 Ga0068864_100228543
1355 Ga0068864_100247873
1356 Ga0068866_10030595
1357 Ga0068866_10037416
1358 Ga0068861_100001618
1359 Ga0068861_100002547
1360 Ga0068861_100047800
1361 Ga0068861_100233701
1362 Ga0068851_10001589
1363 Ga0068851_10032507
1364 Ga0068851_10091791
1365 Ga0068870_10160924
1366 Ga0068863_100001289
1367 Ga0068863_100001708
1368 Ga0068863_100002680
1369 Ga0068863_100101116
1370 Ga0068863_100117284
1371 Ga0068863_100196470
1372 Ga0068863_100286672
1373 Ga0068863_100336087
1374 Ga0068858_100000413
1375 Ga0068858_100018789
1376 Ga0068858_100023951
1377 Ga0068858_100041553
1378 Ga0068858_100253568
1379 Ga0068860_100004285
1380 Ga0068860_100011743
1381 Ga0068860_100035293
1382 Ga0068860_100096647
1383 Ga0068860_100150843
1384 Ga0068860_100226399
1385 Ga0068860_100319082
1386 Ga0068862_100004502
1387 Ga0068862_100011044
1388 Ga0068862_100011483
1389 Ga0068862_100017703
1390 Ga0068862_100054515
1391 Ga0068862_100098560
1392 Ga0068862_100252081
1393 Ga0068862_100404321
1394 Ga0075365_10003595
1395 Ga0075365_10127344
1396 Ga0075368_10050796
1397 Ga0075363_100028997
1398 Ga0075364_10049617
1399 Ga0075362_10008388
1400 Ga0075362_10031282
1401 Ga0075362_10086289
1402 Ga0075362_10090512
1403 Ga0075367_10059581
1404 Ga0075367_10096874
1405 Ga0075369_10050690
1406 Ga0075369_10091043
1407 Ga0075366_10010337
1408 Ga0075366_10015004
1409 Ga0075366_10031279
1410 Ga0075366_10047615
1411 Ga0075366_10076667
1412 Ga0075366_10091349
1413 Ga0075366_10186449
1414 Ga0097621_100034225
1415 Ga0097621_100048219
1416 Ga0097621_100051615
1417 Ga0097621_100054844
1418 Ga0097621_100130979
1419 Ga0097621_100318597
1420 Ga0075370_10000555
1421 Ga0075370_10024221
1422 Ga0075370_10026443
1423 Ga0075370_10036658
1424 Ga0075370_10049636
1425 Ga0075370_10052918
1426 Ga0075370_10201756
1427 Ga0068871_100011783
1428 Ga0068871_100028695
1429 Ga0068871_100102571
1430 Ga0068871_100157237
1431 Ga0068871_100215272
1432 Ga0075428_100116147
1433 Ga0075428_100116379
1434 Ga0075430_100262382
1435 Ga0075434_100124212
1436 Ga0075429_100277178
1437 Ga0075429_100365368
1438 Ga0068865_100028724
1439 Ga0068865_100077194
1440 Ga0097620_100007644
1441 Ga0097620_100010715
1442 Ga0097620_100121912
1443 Ga0097620_100137423
1444 Ga0097620_100165591
1445 Ga0097620_100579591
1446 Ga0079104_1000019
1447 Ga0099826_10000027
1448 Ga0099826_10006221
1449 Ga0105244_10000965
1450 Ga0105240_10018468
1451 Ga0105240_10219187
1452 Ga0111539_10207790
1453 Ga0105245_10012088
1454 Ga0105245_10396835
1455 Ga0105247_10416447
1456 Ga0114129_10032558
1457 Ga0114129_10457835
1458 Ga0105243_10001682
1459 Ga0105243_10004695
1460 Ga0105243_10043521
1461 Ga0105243_10141731
1462 Ga0105243_10145806
1463 Ga0105243_10147041
1464 Ga0105243_10281602
1465 Ga0105241_10190773
1466 Ga0105242_10019130
1467 Ga0105242_10026470
1468 Ga0105242_10122447
1469 Ga0105242_10571759
1470 Ga0105248_10003661
1471 Ga0105248_10006013
1472 Ga0105248_10074417
1473 Ga0105248_10152277
1474 Ga0105237_10001628
1475 Ga0105237_10097306
1476 Ga0105237_10106835
1477 Ga0105237_10295838
1478 Ga0105238_10093980
1479 Ga0105249_10029237
1480 Ga0105249_10099373
1481 Ga0105249_10203716
1482 Ga0105249_10269646
1483 Ga0105249_10296283
1484 Ga0105239_10001684
1485 Ga0105239_10605511
1486 Ga0105246_10107068
1487 Ga0157369_10016621
1488 Ga0157369_10181105
1489 Ga0157374_10010969
1490 Ga0157374_10294593
1491 Ga0157374_10297913
1492 Ga0157374_10497260
1493 Ga0157378_10004470
1494 Ga0157378_10039364
1495 Ga0157378_10081937
1496 Ga0157378_10193818
1497 Ga0163162_10008437
1498 Ga0163162_10045471
1499 Ga0163162_10106036
1500 Ga0163162_10141004
1501 Ga0163162_10682703
1502 Ga0157372_10076681
1503 Ga0157372_10204874
1504 Ga0157372_10225279
1505 Ga0157372_10757061
1506 Ga0157375_10032335
1507 Ga0157375_10050218
1508 Ga0157375_10067123
1509 Ga0157375_10094008
1510 Ga0157375_10234111
1511 Ga0157375_10250551
1512 Ga0157375_10305054
1513 Ga0157375_10492337
1514 Ga0163163_10001130
1515 Ga0163163_10009364
1516 Ga0163163_10073498
1517 Ga0163163_10079344
1518 Ga0163163_10107903
1519 Ga0157380_10026504
1520 Ga0157380_10033826
1521 Ga0157380_10034112
1522 Ga0157380_10112611
1523 Ga0157380_10134768
1524 Ga0157380_10163276
1525 Ga0182008_10009302
1526 Ga0182008_10019759
1527 Ga0182008_10047686
1528 Ga0157377_10013130
1529 Ga0157379_10010513
1530 Ga0157379_10025218
1531 Ga0157379_10037328
1532 Ga0157379_10045346
1533 Ga0157379_10078733
1534 Ga0157379_10094540
1535 Ga0157379_10246802
1536 Ga0157376_10008722
1537 Ga0157376_10068333
1538 Ga0157376_10158997
1539 Ga0157376_10200191
1540 Ga0157376_10206137
1541 Ga0182006_1001032
1542 Ga0182007_10000366
1543 Ga0182007_10011494
1544 Ga0183362_10001
1545 Ga0163161_10001014
1546 Ga0163161_10018424
1547 Ga0163161_10038391
1548 Ga0163161_10133045
1549 Ga0209435_100001
1550 Ga0209672_100665
1551 Ga0209147_101220
1552 Ga0209258_100058
1553 Ga0207425_1000733
1554 Ga0207425_1002759
1555 Ga0209646_1000001
1556 Ga0209026_1000003
1557 Ga0209148_1000071
1558 Ga0209759_1000001
1559 Ga0209129_1000023
1560 Ga0209129_1001044
1561 Ga0209129_1004583
1562 Ga0209565_1000004
1563 Ga0209565_1000073
1564 Ga0209565_1000187
1565 Ga0209565_1000912
1566 Ga0209565_1005208
1567 Ga0209673_1000066
1568 Ga0209673_1000074
1569 Ga0209673_1000127
1570 Ga0209673_1000389
1571 Ga0209673_1002877
1572 Ga0209130_1000050
1573 Ga0209130_1000069
1574 Ga0209130_1000082
1575 Ga0209675_1000029
1576 Ga0209675_1000044
1577 Ga0209675_1000226
1578 Ga0209675_1000232
1579 Ga0209675_1005829
1580 Ga0209675_1008851
1581 Ga0209675_1009803
1582 Ga0209676_1000005
1583 Ga0209676_1000029
1584 Ga0209676_1000083
1585 Ga0209676_1000142
1586 Ga0209676_1001525
1587 Ga0209676_1007840
1588 Ga0209676_1008694
1589 Ga0209676_1010602
1590 Ga0209676_1029646
1591 Ga0209025_1000316
1592 Ga0209025_1000351
1593 Ga0209025_1000583
1594 Ga0209025_1000766
1595 Ga0209025_1001156
1596 Ga0209025_1002301
1597 Ga0209025_1005031
1598 Ga0209025_1021697
1599 Ga0209025_1023162
1600 Ga0209025_1023652
1601 Ga0209025_1036435
1602 Ga0209025_1039894
1603 Ga0209564_1000090
1604 Ga0209564_1000145
1605 Ga0209564_1000585
1606 Ga0209564_1001244
1607 Ga0209564_1001318
1608 Ga0209564_1001617
1609 Ga0209564_1002063
1610 Ga0209758_1000044
1611 Ga0209758_1000249
1612 Ga0209758_1024457
1613 Ga0209758_1043783
1614 Ga0209050_1000003
1615 Ga0209050_1000007
1616 Ga0209050_1001232
1617 Ga0209050_1002246
1618 Ga0209050_1013755
1619 Ga0209050_1014496
1620 Ga0209256_1000001
1621 Ga0209256_1000020
1622 Ga0209256_1000022
1623 Ga0209256_1000051
1624 Ga0209256_1000127
1625 Ga0209256_1001660
1626 Ga0207426_1000001
1627 Ga0207426_1000031
1628 Ga0207426_1000071
1629 Ga0207426_1001744
1630 Ga0209051_1000003
1631 Ga0209051_1000036
1632 Ga0209051_1000416
1633 Ga0209051_1000500
1634 Ga0209051_1000542
1635 Ga0209051_1000735
1636 Ga0209051_1011957
1637 Ga0209051_1018109
1638 Ga0209051_1031523
1639 Ga0209257_1000011
1640 Ga0209257_1000012
1641 Ga0209257_1000018
1642 Ga0209257_1000226
1643 Ga0209257_1003858
1644 Ga0209257_1005060
1645 Ga0207697_10000857
1646 Ga0207656_10004471
1647 Ga0207656_10007788
1648 Ga0207655_1002684
1649 Ga0207682_10000120
1650 Ga0207682_10001604
1651 Ga0207682_10047517
1652 Ga0207682_10051884
1653 Ga0207682_10065244
1654 Ga0207642_10016419
1655 Ga0207642_10029220
1656 Ga0207642_10068697
1657 Ga0207680_10011590
1658 Ga0207680_10147969
1659 Ga0207647_10059083
1660 Ga0207645_10001475
1661 Ga0207645_10017113
1662 Ga0207645_10085833
1663 Ga0207643_10000681
1664 Ga0207643_10026471
1665 Ga0207643_10107981
1666 Ga0207654_10099305
1667 Ga0207695_10118124
1668 Ga0207671_10001800
1669 Ga0207660_10155321
1670 Ga0207662_10004254
1671 Ga0207657_10000822
1672 Ga0207649_10049281
1673 Ga0207649_10090844
1674 Ga0207681_10016998
1675 Ga0207681_10021841
1676 Ga0207681_10057263
1677 Ga0207694_10004998
1678 Ga0207650_10006154
1679 Ga0207650_10040265
1680 Ga0207650_10043242
1681 Ga0207650_10174301
1682 Ga0207659_10010325
1683 Ga0207659_10024313
1684 Ga0207659_10039189
1685 Ga0207659_10101309
1686 Ga0207659_10413358
1687 Ga0207659_10474914
1688 Ga0207644_10008321
1689 Ga0207644_10021143
1690 Ga0207690_10002002
1691 Ga0207706_10000149
1692 Ga0207706_10000850
1693 Ga0207706_10003793
1694 Ga0207706_10029503
1695 Ga0207706_10108327
1696 Ga0207706_10134632
1697 Ga0207706_10272194
1698 Ga0207686_10148193
1699 Ga0207709_10000771
1700 Ga0207709_10001360
1701 Ga0207709_10025348
1702 Ga0207709_10028943
1703 Ga0207709_10029949
1704 Ga0207709_10117902
1705 Ga0207709_10136795
1706 Ga0207709_10148361
1707 Ga0207670_10400184
1708 Ga0207669_10006269
1709 Ga0207669_10061575
1710 Ga0207669_10097632
1711 Ga0207669_10241973
1712 Ga0207704_10018734
1713 Ga0207704_10026431
1714 Ga0207704_10091255
1715 Ga0207704_10271794
1716 Ga0207691_10000773
1717 Ga0207691_10001626
1718 Ga0207691_10004125
1719 Ga0207691_10016262
1720 Ga0207691_10022311
1721 Ga0207691_10024119
1722 Ga0207691_10041027
1723 Ga0207691_10082806
1724 Ga0207691_10089646
1725 Ga0207691_10245462
1726 Ga0207691_10287616
1727 Ga0207711_10023053
1728 Ga0207711_10124729
1729 Ga0207711_10155887
1730 Ga0207711_10156409
1731 Ga0207711_10344043
1732 Ga0207689_10000049
1733 Ga0207689_10000307
1734 Ga0207689_10001301
1735 Ga0207689_10008205
1736 Ga0207689_10060861
1737 Ga0207689_10165152
1738 Ga0207689_10193318
1739 Ga0207689_10231835
1740 Ga0207679_10008364
1741 Ga0207679_10062155
1742 Ga0207679_10106195
1743 Ga0207679_10217309
1744 Ga0207667_10001720
1745 Ga0207667_10032111
1746 Ga0207667_10133856
1747 Ga0207667_10432257
1748 Ga0207651_10001889
1749 Ga0207651_10019990
1750 Ga0207651_10022461
1751 Ga0207651_10078633
1752 Ga0207651_10120546
1753 Ga0207712_10010255
1754 Ga0207712_10064721
1755 Ga0207712_10094687
1756 Ga0207668_10008031
1757 Ga0207668_10029069
1758 Ga0207668_10056523
1759 Ga0207668_10069586
1760 Ga0207668_10146608
1761 Ga0207668_10273177
1762 Ga0207668_10276807
1763 Ga0207640_10044846
1764 Ga0207640_10062911
1765 Ga0207658_10003343
1766 Ga0207658_10006980
1767 Ga0207658_10021590
1768 Ga0207658_10040679
1769 Ga0207677_10003034
1770 Ga0207677_10008690
1771 Ga0207677_10059178
1772 Ga0207677_10076559
1773 Ga0207677_10173734
1774 Ga0207677_10398444
1775 Ga0207703_10002822
1776 Ga0207703_10003906
1777 Ga0207703_10037171
1778 Ga0207703_10274231
1779 Ga0207639_10005031
1780 Ga0207639_10055874
1781 Ga0207639_10221377
1782 Ga0207639_10234731
1783 Ga0207639_10313675
1784 Ga0207678_10011833
1785 Ga0207678_10100600
1786 Ga0207678_10103375
1787 Ga0207678_10220158
1788 Ga0207678_10299085
1789 Ga0207708_10000529
1790 Ga0207708_10008749
1791 Ga0207708_10022047
1792 Ga0207708_10274462
1793 Ga0207702_10157221
1794 Ga0207702_10205785
1795 Ga0207641_10008475
1796 Ga0207641_10017295
1797 Ga0207641_10036405
1798 Ga0207641_10065664
1799 Ga0207641_10141285
1800 Ga0207641_10207970
1801 Ga0207648_10002306
1802 Ga0207648_10003420
1803 Ga0207648_10006661
1804 Ga0207648_10010535
1805 Ga0207648_10021312
1806 Ga0207648_10027187
1807 Ga0207648_10049953
1808 Ga0207648_10080063
1809 Ga0207648_10461373
1810 Ga0207676_10004825
1811 Ga0207676_10027811
1812 Ga0207676_10064917
1813 Ga0207676_10105918
1814 Ga0207676_10197159
1815 Ga0207676_10337422
1816 Ga0207674_10003249
1817 Ga0207674_10003275
1818 Ga0207674_10020383
1819 Ga0207674_10157866
1820 Ga0207675_100003946
1821 Ga0207675_100008033
1822 Ga0207675_100032927
1823 Ga0207675_100035316
1824 Ga0207675_100035639
1825 Ga0207675_100055481
1826 Ga0207675_100596275
1827 Ga0207683_10006932
1828 Ga0207683_10008101
1829 Ga0207683_10010884
1830 Ga0207683_10030812
1831 Ga0207683_10050620
1832 Ga0207683_10240983
1833 Ga0207683_10260994
1834 Ga0207683_10318998
1835 Ga0207698_10034135
1836 Ga0207698_10121441
1837 Ga0207698_10182443
1838 Ga0207698_10427876
1839 Ga0207698_10624105
1840 Ga0209281_1000160
1841 Ga0209371_1003487
1842 Ga0209999_1015003
1843 Ga0209983_1006590
1844 Ga0209983_1028576
1845 Ga0209282_1000069
1846 Ga0209282_1018317
1847 Ga0209282_1087699
1848 Ga0209971_1015433
1849 Ga0209998_10027200
1850 Ga0268266_10017786
1851 Ga0268266_10039667
1852 Ga0268266_10044855
1853 Ga0268266_10078909
1854 Ga0268266_10079755
1855 Ga0268266_10086096
1856 Ga0268266_10154105
1857 Ga0268265_10006606
1858 Ga0268265_10029739
1859 Ga0268265_10088981
1860 Ga0268265_10164888
1861 Ga0268265_10191253
1862 Ga0268265_10294024
1863 Ga0268264_10000624
1864 Ga0268264_10017548
1865 Ga0268264_10102319
1866 Ga0268264_10180804
1867 Ga0268264_10186400
1868 Ga0268264_10452026
1869 Ga0307517_10033655
1870 Ga0307515_10000058
1871 Ga0307515_10000267
1872 Ga0307515_10000283
1873 Ga0307515_10000302
1874 Ga0307515_10000586
1875 Ga0307515_10003631
1876 Ga0307515_10011842
1877 Ga0307515_10081285
1878 Ga0307515_10105750
1879 Ga0307515_10118612
1880 Ga0307515_10157981
1881 Ga0307515_10251002
1882 Ga0268256_1007657
1883 Ga0307512_10018592
1884 Ga0307512_10038652
1885 Ga0316177_1102153
1886 Ga0314311_1141747
1887 Ga0316183_1033032
1888 Ga0265327_10005641
1889 Ga0307513_10000010
1890 Ga0307513_10000051
1891 Ga0307513_10049729
1892 Ga0307513_10060104
1893 Ga0307513_10077516
1894 Ga0307513_10103072
1895 Ga0307513_10108365
1896 Ga0307513_10139562
1897 Ga0307513_10399439
1898 Ga0307509_10011999
1899 Ga0307509_10071187
1900 Ga0307509_10096280
1901 Ga0307408_100000193
1902 Ga0307408_100001412
1903 Ga0307408_100007530
1904 Ga0307408_100022612
1905 Ga0307408_100056105
1906 Ga0307408_100090913
1907 Ga0307408_100128014
1908 Ga0307508_10000876
1909 Ga0307508_10001111
1910 Ga0307508_10016840
1911 Ga0307508_10171782
1912 Ga0307514_10000806
1913 Ga0307514_10014746
1914 Ga0307514_10068076
1915 Ga0307516_10001118
1916 Ga0307516_10037208
1917 Ga0307516_10097543
1918 Ga0307405_10397803
1919 Ga0307410_10001817
1920 Ga0307406_10000944
1921 Ga0307406_10002109
1922 Ga0307406_10020580
1923 Ga0307406_10107886
1924 Ga0307407_10087522
1925 Ga0307412_10002610
1926 Ga0307412_10008248
1927 Ga0307412_10059041
1928 Ga0307409_100026624
1929 Ga0307416_100095618
1930 Ga0307416_100523136
1931 Ga0307416_100694142
1932 Ga0307414_10061593
1933 Ga0307414_10272083
1934 Ga0307411_10128359
1935 Ga0307411_10135310
1936 Ga0307411_10196374
1937 Ga0307507_10247610
1938 Ga0307510_10133426
1939 Ga0373953_0045721
1940 Ga0373955_0061335
1941 Ga0373955_0079570
1942 Ga0373924_0136413
1943 Ga0373931_0052842
1944 Ga0373937_0014096
1945 Ga0373937_0064919
1946 Ga0373937_0246317
1947 Ga0373925_0003621
1948 Ga0373925_0106669
1949 Ga0400483_058929
1950 Ga0400483_242388
1951 Ga0439436_0001073
1952 Ga0439436_0026058
1953 Ga0439436_0056618
1954 Ga0439447_004235
1955 Ga0439431_0016358
1956 Ga0439442_020080
1957 Ga0439432_001458
1958 Ga0439449_0000923
1959 Ga0439449_0005718
1960 Ga0439449_0040190
1961 Ga0439450_024941
1962 Ga0439452_005984
1963 Ga0439452_019491
1964 Ga0439452_027810
1965 Ga0439457_002549
1966 Ga0439462_0015908
1967 Ga0439462_0035634
1968 Ga0450911_000137
1969 Ga0450921_000339
1970 Ga0450898_006861
1971 Ga0439434_0002704
1972 Ga0450918_002201
1973 Ga0450893_0009504
1974 Ga0451577_0029841
1975 Ga0451577_0075805
1976 Ga0451577_0104665
1977 Ga0451577_0131994
1978 Ga0453684_0004147
1979 Ga0453684_0059476
1980 Ga0453684_0150918
1981 Ga0451576_0009619
1982 Ga0451576_0116563
1983 Ga0495627_006938
1984 Ga0495627_020194
1985 Ga0495590_0014273
1986 Ga0495629_0243433
1987 Ga0495605_0004236
1988 Ga0495639_0015227
1989 Ga0495664_0015726
1990 Ga0495596_0000317
1991 Ga0495607_0000280
1992 Ga0495583_0063383
1993 Ga0495610_0000424
1994 Ga0495610_0018922
1995 Ga0495616_0006264
1996 Ga0495616_0044348
1997 Ga0495620_0052852
1998 Ga0495631_0001923
1999 Ga0495632_0048912
2000 Ga0495632_0051016
2001 Ga0495637_0007031
2002 Ga0495637_0013071
2003 Ga0495643_0093802
2004 Ga0495642_0111393
2005 Ga0495654_0008854
2006 Ga0495609_0009581
2007 Ga0495621_0095725
2008 Ga0495597_0020417
2009 Ga0495597_0022634
2010 Ga0495633_0006330
2011 Ga0495656_0002566
2012 Ga0495625_0000396
2013 Ga0495625_0000807
2014 Ga0495625_0038121
2015 Ga0495625_0081869
2016 Ga0495661_0068155
2017 Ga0495658_0006349
2018 Ga0495671_0001711
2019 Ga0495649_0175933
2020 Ga0495660_0035956
2021 Ga0495672_0005564
2022 Ga0495687_000196
2023 Ga0495687_021061
2024 Ga0495687_045689
2025 Ga0495677_0103754
2026 Ga0495686_0145921
2027 Ga0496101_0003644
2028 Ga0496102_0024833
2029 Ga0496103_0023992
2030 Ga0496103_0208205
2031 Ga0496104_0021963
2032 Ga0496105_0021257
2033 Ga0496105_0095237
2034 Ga0496105_0173682
2035 Ga0496106_0036400
2036 Ga0496107_0008919
2037 Ga0496107_0223374
2038 Ga0496108_0020007
2039 Ga0496109_0005385
2040 Ga0496109_0038690
2041 Ga0496109_0337549
2042 Ga0496110_0027094
2043 Ga0496110_0042796
2044 Ga0496110_0094456
2045 Ga0496112_0541449
2046 Ga0496114_0030341
2047 Ga0496114_0047087
2048 Ga0496114_0099241
2049 Ga0496116_0009002
2050 Ga0496116_0016831
2051 Ga0496116_0020474
2052 Ga0496116_0024283
2053 Ga0496116_0099800
2054 Ga0496117_0034564
2055 Ga0496117_0084871
2056 Ga0496117_0114986
2057 Ga0496118_0023463
2058 Ga0496118_0070259
2059 Ga0496118_0139684
2060 Ga0496119_0017168
2061 Ga0496119_0026563
2062 Ga0496119_0147843
2063 Ga0496120_0014853
2064 Ga0496121_0000479
2065 Ga0496121_0016763
2066 Ga0496121_0049646
2067 Ga0496121_0108493
2068 Ga0496121_0161557
2069 Ga0496122_0000217
2070 Ga0496122_0000669
2071 Ga0496122_0003097
2072 Ga0496122_0003536
2073 Ga0496122_0012827
2074 Ga0496122_0046214
2075 Ga0496123_0000057
2076 Ga0496123_0000603
2077 Ga0496123_0005860
2078 Ga0496123_0017368
2079 Ga0496123_0029483
2080 Ga0496124_0052640
2081 Ga0496124_0073690
2082 Ga0496124_0087189
2083 Ga0496124_0121197
2084 Ga0496124_0282098
2085 Ga0496125_0000168
2086 Ga0496125_0000323
2087 Ga0496125_0001023
2088 Ga0496125_0023979
2089 Ga0496125_0025456
2090 Ga0496125_0030089
2091 Ga0496125_0050199
2092 Ga0496125_0064894
2093 Ga0496125_0207534
2094 Ga0496126_0016753
2095 Ga0496126_0123726
2096 Ga0496126_0162140
2097 nmdc:mga03683_167353_c1
2098 nmdc:mga03683_3206_c1
2099 nmdc:mga03683_42761_c1
2100 nmdc:mga03683_67440_c1
2101 nmdc:mga03683_95159_c1
2102 nmdc:mga03n38_54907_c1
2103 nmdc:mga00v17_20825_c1
2104 nmdc:mga0yw44_70118_c1
2105 nmdc:mga0k408_132207_c1
2106 nmdc:mga0k408_3141_c1
2107 nmdc:mga0k408_42063_c1
2108 nmdc:mga0k408_86130_c1
2109 nmdc:mga06z11_79686_c1
2110 nmdc:mga07m45_14323_c1
2111 nmdc:mga07m45_17804_c1
2112 nmdc:mga07m45_3635_c1
2113 nmdc:mga07m45_50012_c1
2114 nmdc:mga07m45_686_c1
2115 nmdc:mga07m45_7718_c1
2116 nmdc:mga05p37_228483_c1
2117 nmdc:mga05p37_2709_c2
2118 nmdc:mga09592_271113_c1
2119 nmdc:mga09592_605991_c1
2120 nmdc:mga09592_9202_c1
2121 nmdc:mga0qj67_417732_c1
2122 nmdc:mga06r32_458823_c1
2123 nmdc:mga0n895_68479_c1
2124 nmdc:mga0a205_9315_c1
2125 nmdc:mga0sz30_123953_c1
2126 nmdc:mga0sz30_6916_c1
2127 Ga0500610_0000489
2128 Ga0495619_0185339
2129 Ga0500644_0053915
2130 Ga0500647_0133216
2131 Ga0500651_0045805
2132 Ga0500650_0046871
2133 Ga0500571_010381
2134 Ga0500593_005223
2135 Ga0500594_0003123
2136 Ga0500607_007771
2137 Ga0500608_035205
2138 Ga0500655_006844
2139 Ga0500658_0001265
2140 Ga0500658_0002137
2141 Ga0500658_0130232
2142 Ga0500559_0005433
2143 Ga0500568_0001949
2144 Ga0500627_0022906
2145 Ga0500634_0065523
2146 Ga0500637_0005139
2147 Ga0500645_000198
2148 Ga0500645_000493
2149 Ga0500645_011097
2150 Ga0500587_000066
2151 2511245932
2152 2512036213
2153 2513231799
2154 2548497399
2155 2587757178
2156 2599101933
2157 2599626662
2158 2599675726
2159 2599684199
2160 2599696213
2161 2599902927
2162 2643861750
2163 2643866565
2164 2643983215
2165 2643993317
2166 2644060686
2167 2644074006
2168 2644123476
2169 2644159576
2170 2644294078
2171 2644303759
2172 2644327938
2173 2644397900
2174 2644468259
2175 2644646251
2176 2738718081
2177 2738885020
2178 2739242712
2179 2739250458
2180 2739278767
2181 2753357601
2182 2758640098
2183 2809033260
2184 2816472972
2185 2819595772
2186 2831266783
2187 2838057136
2188 2842335006
2189 2842682576
2190 2842735584
2191 2842751321
2192 2846958079
2193 2848864859
2194 2854913334
2195 2857538241
2196 2857580794
2197 2858952051
2198 2885192725
2199 2885201232
2200 2885214886
2201 2894027683
2202 2897805876
2203 2899925118
2204 2904454452
2205 2904461105
2206 2904544741
2207 2919465982
2208 2919707444
2209 2928038757
2210 2928045638
2211 2928053255
2212 2928066860
2213 2928071254
2214 2928084817
2215 2928119626
2216 2929163588
2217 2929526987
2218 2932425138
2219 2941482490
2220 2945912275
2221 2945948209
2222 2945985414
2223 2954772326
2224 2974323373
2225 2990712248
2226 8054008479

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

38

310

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1l7v-assembly1.cif.gz_B bacterial abc transporter involved in b12 uptake 0.5735 16 289
4dbl-assembly1.cif.gz_B crystal structure of e159q mutant of btucdf 0.5734 16 289
2nq2-assembly1.cif.gz_A an inward-facing conformation of a putative metal-chelate type abc transporter. 0.5646 16 288
7lb8-assembly1.cif.gz_B structure of a ferrichrome importer fhucdb from e. coli 0.5557 14 259
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.5444 13 285
ID Description Score Start End Superfamily
af_P77672_36_301_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8124 20 281 1.10.3470.10
af_P77672_36_301_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7954 20 281 1.10.3470.10
af_P0AGI4_56_383_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7868 18 281 1.10.3470.10
af_P77315_52_317_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7848 18 281 1.10.3470.10
af_P0AFS1_34_305_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7796 16 281 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A4Q3LI64-F1-model_v4 ABC transporter permease 0.9667 34 304 GO:0005886
GO:0022857
AF-A0A4Q5VQG5-F1-model_v4 deleted 0.9623 5 230
AF-A0A2S9QFS9-F1-model_v4 ABC transporter permease 0.9546 8 304 GO:0005886
GO:0022857
AF-A0A7C6ZI90-F1-model_v4 ABC transporter permease 0.9448 14 301 GO:0005886
GO:0022857
AF-A0A081C4P7-F1-model_v4 Inner-membrane translocator 0.9422 14 301 GO:0005886
GO:0022857

Map