F490269

General Info

Members Datasets Scaffolds Average Seq Length
1113 833 2226 299

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221582|2643918320
Length 308
Sequence VESGSFMAALNFSDQRQSPDDVLASGEYPLTRRDLSEIAAMIYADAGIYLNDTKASLVYSRLSKHIRNLGLSGFREYCTLVSSTEGATARREMLSHLTTNFTRFFRENHHFEHLRDEVLPGLIARAKSGGRVRIWSAACSDGQEPYSIALTVLAMFPNAADYDFKILATDIDPKILAQARAGVYDDNALETVSPAMRKQWFTEVDAGGRRKFRIDDKVKRLITFNELNLMTQWPFKGNFDVIFCRNVVIYFDEPTQTRIWSRFAGLLPEGGHLYIGHSERVAGDAKNLFDNTGITTYRYIGHASGRKA

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
17 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
18 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
19 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
20 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
21 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
22 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
27 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
52 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
53 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
61 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
72 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
73 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
74 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
77 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
78 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
79 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
80 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
81 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
82 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
83 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
86 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
87 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
88 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
89 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
90 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
93 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
94 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
95 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
97 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
100 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
102 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
105 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
119 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
121 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
124 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
125 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
126 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
129 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
136 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
137 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
138 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
139 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
140 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
147 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
148 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
149 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
150 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
151 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
152 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
153 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
154 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
155 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
156 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
157 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
158 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
159 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
160 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
161 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
164 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
165 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
166 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
167 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
168 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
169 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
170 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
171 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
172 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
173 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
174 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
175 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
176 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
177 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
178 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
179 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
180 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
181 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
182 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
183 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
184 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
185 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
186 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
187 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
188 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
189 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
190 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
191 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
192 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
193 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
194 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
195 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
196 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
197 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
204 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
205 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
206 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
207 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
208 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
209 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
210 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
211 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
212 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
213 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
214 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
215 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
216 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
217 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
226 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
227 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
228 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
229 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
230 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
231 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
232 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
233 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
234 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
237 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
238 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
239 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
240 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
241 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
242 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
243 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
244 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
245 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
246 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
247 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
248 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
249 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
250 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
251 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
252 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
253 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
254 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
255 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
256 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
257 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
258 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
259 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
260 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
261 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
262 2643221582 Rhizobium sp. Root651 Isolate Unclassified
263 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
264 2509276019 Ensifer aridi TW10 Isolate Nodule
265 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
266 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
267 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
268 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
269 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
270 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
271 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
272 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
273 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
274 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
275 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
276 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
277 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
278 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
279 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
280 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
281 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
282 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
283 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
284 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
285 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
286 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
287 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
288 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
289 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
290 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
291 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
292 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
293 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
294 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
295 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
296 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
297 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
298 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
299 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
300 2516143018 Ensifer sp. BR816 Isolate Nodule
301 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
302 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
303 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
304 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
305 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
306 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
307 2519899620 Rhizobium sp. Pop5 Isolate Nodule
308 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
309 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
310 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
311 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
312 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
313 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
314 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
315 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
316 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
317 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
318 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
319 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
320 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
321 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
322 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
323 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
324 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
325 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
326 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
327 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
328 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
329 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
330 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
331 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
332 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
333 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
334 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
335 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
336 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
337 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
338 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
339 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
340 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
341 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
342 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
343 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
344 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
345 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
346 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
347 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
348 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
349 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
350 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
351 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
352 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
353 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
354 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
355 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
356 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
357 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
358 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
359 2643221557 Ensifer sp. Root558 Isolate Unclassified
360 2643221558 Rhizobium sp. Root149 Isolate Unclassified
361 2643221568 Rhizobium sp. Root564 Isolate Unclassified
362 2643221599 Rhizobium sp. Root708 Isolate Unclassified
363 2643221607 Rhizobium sp. Root73 Isolate Unclassified
364 2643221610 Ensifer sp. Root74 Isolate Unclassified
365 2643221618 Ensifer sp. Root231 Isolate Unclassified
366 2643221626 Ensifer sp. Root31 Isolate Unclassified
367 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
368 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
369 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
370 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
371 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
372 2643221655 Ensifer sp. Root1252 Isolate Unclassified
373 2643221659 Ensifer sp. Root127 Isolate Unclassified
374 2643221668 Ensifer sp. Root423 Isolate Unclassified
375 2643221675 Ensifer sp. Root1298 Isolate Unclassified
376 2643221680 Ensifer sp. Root1312 Isolate Unclassified
377 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
378 2643221688 Rhizobium sp. Root482 Isolate Unclassified
379 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
380 2643221693 Rhizobium sp. Root491 Isolate Unclassified
381 2643221698 Ensifer sp. Root142 Isolate Unclassified
382 2643221712 Ensifer sp. Root258 Isolate Unclassified
383 2643221718 Rhizobium sp. Root268 Isolate Unclassified
384 2643221719 Rhizobium sp. Root274 Isolate Unclassified
385 2643221723 Ensifer sp. Root278 Isolate Unclassified
386 2643221726 Ensifer sp. Root954 Isolate Unclassified
387 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
388 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
389 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
390 2718217882 Rhizobium sp. N741 Isolate Nodule
391 2718217927 Rhizobium sp. N324 Isolate Nodule
392 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
393 2718218009 Rhizobium sp. N561 Isolate Nodule
394 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
395 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
396 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
397 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
398 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
399 2718218363 Rhizobium sp. N113 Isolate Nodule
400 2718218365 Rhizobium sp. N731 Isolate Nodule
401 2718218366 Rhizobium sp. N621 Isolate Nodule
402 2718218423 Rhizobium sp. N941 Isolate Nodule
403 2721755514 Rhizobium sp. N6212 Isolate Nodule
404 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
405 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
406 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
407 2721755809 Rhizobium sp. N541 Isolate Nodule
408 2721755810 Rhizobium sp. N871 Isolate Nodule
409 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
410 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
411 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
412 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
413 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
414 2728369365 Rhizobium sp. N1341 Isolate Nodule
415 2728369397 Rhizobium sp. N1314 Isolate Nodule
416 2738541293 Rhizobium sp. GV031 Isolate Unclassified
417 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
418 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
419 2738543024 Aminobacter sp. AP02 Isolate Unclassified
420 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
421 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
422 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
423 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
424 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
425 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
426 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
427 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
428 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
429 2791355256 Rhizobium sp. M10 Isolate Nodule
430 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
431 2791355260 Rhizobium sp. L9 Isolate Nodule
432 2791355261 Rhizobium sp. J15 Isolate Nodule
433 2791355262 Rhizobium sp. M1 Isolate Nodule
434 2791355263 Rhizobium chutanense C5 Isolate Nodule
435 2791355264 Rhizobium sp. S9 Isolate Nodule
436 2791355265 Rhizobium sp. H4 Isolate Nodule
437 2791355266 Rhizobium sp. L43 Isolate Nodule
438 2791355267 Rhizobium sp. L18 Isolate Nodule
439 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
440 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
441 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
442 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
443 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
444 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
445 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
446 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
447 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
448 2802429633 Rhizobium anhuiense J3 Isolate Nodule
449 2802429634 Rhizobium anhuiense S10 Isolate Nodule
450 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
451 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
452 2802429637 Rhizobium anhuiense C15 Isolate Nodule
453 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
454 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
455 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
456 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
457 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
458 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
459 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
460 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
461 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
462 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
463 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
464 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
465 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
466 2838048938 Rhizobium pisi 27/80 Isolate Nodule
467 2838061910 Rhizobium phaseoli L15 Isolate Nodule
468 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
469 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
470 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
471 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
472 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
473 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
474 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
475 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
476 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
477 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
478 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
479 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
480 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
481 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
482 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
483 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
484 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
485 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
486 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
487 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
488 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
489 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
490 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
491 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
492 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
493 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
494 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
495 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
496 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
497 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
498 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
499 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
500 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
501 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
502 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
503 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
504 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
505 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
506 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
507 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
508 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
509 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
510 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
511 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
512 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
513 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
514 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
515 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
516 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
517 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
518 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
519 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
520 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
521 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
522 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
523 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
524 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
525 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
526 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
527 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
528 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
529 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
530 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
531 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
532 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
533 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
534 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
535 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
536 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
537 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
538 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
539 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
540 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
541 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
542 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
543 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
544 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
545 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
546 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
547 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
548 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
549 2844163670 Ensifer sp. 1H6 Isolate Unclassified
550 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
551 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
552 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
553 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
554 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
555 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
556 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
557 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
558 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
559 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
560 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
561 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
562 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
563 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
564 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
565 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
566 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
567 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
568 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
569 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
570 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
571 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
572 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
573 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
574 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
575 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
576 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
577 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
578 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
579 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
580 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
581 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
582 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
583 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
584 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
585 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
586 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
587 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
588 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
589 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
590 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
591 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
592 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
593 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
594 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
595 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
596 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
597 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
598 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
599 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
600 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
601 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
602 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
603 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
604 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
605 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
606 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
607 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
608 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
609 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
610 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
611 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
612 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
613 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
614 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
615 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
616 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
617 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
618 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
619 2932401849 Devosia sp. 2618 Isolate Rhizosphere
620 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
621 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
622 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
623 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
624 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
625 2933599457 Rhizobium phaseoli M3 Isolate Nodule
626 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
627 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
628 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
629 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
630 2936381700 Rhizobium chutanense C16 Isolate Unclassified
631 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
632 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
633 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
634 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
635 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
636 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
637 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
638 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
639 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
640 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
641 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
642 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
643 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
644 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
645 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
646 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
647 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
648 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
649 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
650 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
651 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
652 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
653 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
654 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
655 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
656 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
657 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
658 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
659 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
660 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
661 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
662 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
663 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
664 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
665 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
666 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
667 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
668 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
669 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
670 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
671 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
672 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
673 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
674 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
675 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
676 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
677 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
678 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
679 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
680 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
681 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
682 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
683 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
684 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
685 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
686 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
687 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
688 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
689 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
690 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
691 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
692 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
693 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
694 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
695 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
696 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
697 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
698 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
699 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
700 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
701 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
702 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
703 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
704 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
705 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
706 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
707 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
708 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
709 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
710 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
711 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
712 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
713 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
714 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
715 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
716 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
717 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
718 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
719 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
720 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
721 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
722 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
723 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
724 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
725 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
726 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
727 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
728 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
729 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
730 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
731 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
732 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
733 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
734 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
735 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
736 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
737 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
738 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
739 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
740 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
741 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
742 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
743 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
744 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
745 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
746 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
747 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
748 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
749 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
750 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
751 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
752 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
753 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
754 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
755 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
756 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
757 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
758 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
759 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
760 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
761 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
762 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
763 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
764 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
765 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
766 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
767 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
768 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
769 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
770 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
771 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
772 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
773 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
774 2996887358 Rhizobium sp. R711 Isolate Nodule
775 2996893221 Rhizobium sp. R635 Isolate Nodule
776 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
777 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
778 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
779 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
780 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
781 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
782 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
783 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
784 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
785 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
786 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
787 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
788 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
789 8005258706 Rhizobium sp. R693 Isolate Nodule
790 8005275841 Rhizobium sp. N4311 Isolate Nodule
791 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
792 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
793 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
794 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
795 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
796 8005321885 Rhizobium sp. R72 Isolate Nodule
797 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
798 8005382845 Rhizobium sp. R634 Isolate Nodule
799 8005395548 Rhizobium sp. R339 Isolate Nodule
800 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
801 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
802 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
803 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
804 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
805 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
806 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
807 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
808 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
809 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
810 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
811 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
812 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
813 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
814 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
815 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
816 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
817 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
818 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
819 8018176218 Rhizobium sp. N122 Isolate Nodule
820 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
821 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
822 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
823 8024501048 Rhizobium sp. H4 Isolate Nodule
824 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
825 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
826 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
827 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
828 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
829 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
830 8056382006 Rhizobium croatiense 13T Isolate Nodule
831 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
832 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
833 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 48.61
Metatranscriptomes 0
Isolates 51.39

Biome Distribution

Category Percentage (%)
Aerial Root 0.72
Bulb 0
Endosphere 18.42
Nodule 38.63
Rhizoplane 1.62
Rhizosphere 23.18
Stem 0
Stem Tuber 0
Unclassified 0.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000016 3300001979 Bacteria 58332
2 JGI25155J39150_1000157 3300002704 Bacteria 30370
3 JGI25156J39149_1000029 3300002705 Bacteria 126505
4 JGI25162J39368_1000169 3300002737 Bacteria 72114
5 JGI25162J39368_1000508 3300002737 Bacteria 29158
6 JGI25154J39366_1000286 3300002738 Bacteria 30355
7 JGI25158J39367_1000022 3300002739 Bacteria 38866
8 JGI25157J39369_1000247 3300002741 Bacteria 41079
9 JGI25152J39213_1000754 3300002773 Bacteria 16448
10 JGI25152J39213_1006226 3300002773 Bacteria 3304
11 JGI25152J39213_1006373 3300002773 Bacteria 3236
12 JGI25152J39213_1007385 3300002773 Bacteria 2851
13 JGI25152J39213_1011673 3300002773 Bacteria 1930
14 JGI25150J39212_1000012 3300002774 Bacteria 182468
15 JGI25150J39212_1011391 3300002774 Bacteria 1614
16 JGI25159J45721_1000137 3300002987 Bacteria 34522
17 JGI25159J45721_1000730 3300002987 Bacteria 14342
18 JGI25159J45721_1003596 3300002987 Bacteria 5419
19 JGI25151J46595_10000025 3300003187 Bacteria 213302
20 JGI25151J46595_10008949 3300003187 Bacteria 4775
21 JGI25151J46595_10014484 3300003187 Bacteria 3510
22 JGI25151J46595_10019714 3300003187 Bacteria 2858
23 JGI25151J46595_10020686 3300003187 Bacteria 2769
24 JGI25165J46597_1000355 3300003214 Bacteria 51475
25 JGI25165J46597_1000491 3300003214 Bacteria 38149
26 JGI25165J46597_1002805 3300003214 Bacteria 5045
27 JGI25165J46597_1002982 3300003214 Bacteria 4680
28 JGI25153J46596_10001788 3300003215 Bacteria 12753
29 JGI25153J46596_10005320 3300003215 Bacteria 6767
30 JGI25153J46596_10011406 3300003215 Bacteria 3930
31 JGI25153J46596_10014934 3300003215 Bacteria 3195
32 rootH2_10020588 3300003320 Bacteria 2532
33 rootL2_10000316 3300003322 Bacteria 7315
34 JGI25160J50197_1000003 3300003354 Bacteria 482719
35 JGI25160J50197_1000041 3300003354 Bacteria 152843
36 JGI25160J50197_1004302 3300003354 Bacteria 6173
37 JGI25160J50197_1004984 3300003354 Bacteria 5632
38 JGI25160J50197_1008638 3300003354 Bacteria 3863
39 JGI25161J50226_1000002 3300003374 Bacteria 420324
40 JGI25161J50226_1000143 3300003374 Bacteria 49711
41 JGI25161J50226_1000493 3300003374 Bacteria 17725
42 JGI25161J50226_1005407 3300003374 Bacteria 2484
43 Ga0055539_1007704 3300003752 Bacteria 1357
44 Ga0055526_1011121 3300003771 Bacteria 4099
45 Ga0055526_1015428 3300003771 Bacteria 3066
46 Ga0055526_1019108 3300003771 Bacteria 2513
47 Ga0055526_1030826 3300003771 Bacteria 1555
48 Ga0055524_1000776 3300003775 Bacteria 21442
49 Ga0055524_1013963 3300003775 Bacteria 3001
50 Ga0055524_1018649 3300003775 Bacteria 2401
51 Ga0055524_1021942 3300003775 Bacteria 2101
52 Ga0055524_1023588 3300003775 Bacteria 1977
53 Ga0055536_1003218 3300003781 Bacteria 8850
54 Ga0055536_1010563 3300003781 Bacteria 3644
55 Ga0055528_1000604 3300003790 Bacteria 26951
56 Ga0055528_1001318 3300003790 Bacteria 15525
57 Ga0055528_1007277 3300003790 Bacteria 4911
58 Ga0055528_1007971 3300003790 Bacteria 4610
59 Ga0055528_1020008 3300003790 Bacteria 2189
60 Ga0055528_1032103 3300003790 Bacteria 1350
61 Ga0055530_10023535 3300003791 Bacteria 1766
62 Ga0055540_1000249 3300003792 Bacteria 49180
63 Ga0055540_1001900 3300003792 Bacteria 11701
64 Ga0055540_1009280 3300003792 Bacteria 3415
65 Ga0055540_1011060 3300003792 Bacteria 2946
66 Ga0055531_10002859 3300003794 Bacteria 11257
67 Ga0058692_1000651 3300003856 Bacteria 14332
68 Ga0058692_1006563 3300003856 Bacteria 3174
69 Ga0058692_1013059 3300003856 Bacteria 1947
70 Ga0055543_1000008 3300004625 Bacteria 202062
71 Ga0055543_1000158 3300004625 Bacteria 56811
72 Ga0055543_1000263 3300004625 Bacteria 39326
73 Ga0055543_1002397 3300004625 Bacteria 6237
74 Ga0065165_1000031 3300005262 Bacteria 216330
75 Ga0065165_1000084 3300005262 Bacteria 154822
76 Ga0065165_1032974 3300005262 Bacteria 1617
77 Ga0070670_100000160 3300005331 Bacteria 61135
78 Ga0070689_100150898 3300005340 Bacteria 1874
79 Ga0070669_100312902 3300005353 Bacteria 1266
80 Ga0070671_100071497 3300005355 Bacteria 2895
81 Ga0068853_100005585 3300005539 Bacteria 9878
82 Ga0068853_100716037 3300005539 Bacteria 955
83 Ga0070665_100006971 3300005548 Bacteria 11488
84 Ga0070665_100030724 3300005548 Bacteria 5405
85 Ga0070665_100068975 3300005548 Bacteria 3544
86 Ga0070665_100183379 3300005548 Bacteria 2094
87 Ga0068855_100030372 3300005563 Bacteria 6464
88 Ga0068855_100356221 3300005563 Bacteria 1611
89 Ga0068855_100694160 3300005563 Bacteria 1090
90 Ga0068854_100010614 3300005578 Bacteria 5977
91 Ga0068856_100023203 3300005614 Bacteria 6035
92 Ga0068852_100067238 3300005616 Bacteria 3133
93 Ga0068851_10057716 3300005834 Bacteria 1982
94 Ga0081455_10120275 3300005937 Bacteria 2070
95 Ga0075365_10002780 3300006038 Bacteria 8748
96 Ga0075365_10073691 3300006038 Bacteria 2302
97 Ga0075368_10033956 3300006042 Bacteria 1986
98 Ga0075364_10001052 3300006051 Bacteria 14687
99 Ga0075362_10049289 3300006177 Bacteria 1881
100 Ga0075367_10020506 3300006178 Bacteria 3683
101 Ga0075367_10078712 3300006178 Bacteria 1991
102 Ga0075369_10008794 3300006186 Bacteria 3902
103 Ga0075369_10026093 3300006186 Bacteria 2434
104 Ga0075366_10007690 3300006195 Bacteria 5968
105 Ga0075370_10046246 3300006353 Bacteria 2463
106 Ga0075370_10081184 3300006353 Bacteria 1864
107 Ga0068871_100241737 3300006358 Bacteria 1570
108 Ga0068865_100056815 3300006881 Bacteria 2728
109 Ga0079104_1000452 3300006946 Bacteria 46570
110 Ga0099826_10000109 3300006948 Bacteria 38139
111 Ga0099826_10052386 3300006948 Bacteria 2726
112 Ga0105251_10049597 3300009011 Bacteria 2009
113 Ga0105240_10000460 3300009093 Bacteria 74956
114 Ga0105240_10033018 3300009093 Bacteria 6691
115 Ga0105240_10147525 3300009093 Bacteria 2805
116 Ga0105240_10406539 3300009093 Unclassified 1532
117 Ga0105245_10297941 3300009098 Unclassified 1581
118 Ga0105243_10189748 3300009148 Bacteria 1794
119 Ga0105241_10082735 3300009174 Bacteria 2517
120 Ga0105241_10111945 3300009174 Bacteria 2186
121 Ga0105241_10551437 3300009174 Bacteria 1035
122 Ga0105237_10000203 3300009545 Bacteria 84732
123 Ga0105237_10000814 3300009545 Bacteria 42652
124 Ga0105237_10003204 3300009545 Bacteria 19611
125 Ga0105237_10039891 3300009545 Bacteria 4737
126 Ga0105237_10277405 3300009545 Bacteria 1679
127 Ga0105238_10004247 3300009551 Bacteria 14240
128 Ga0105238_10232263 3300009551 Unclassified 1821
129 Ga0123341_1000040 3300009765 Bacteria 59249
130 Ga0123342_1014285 3300009766 Bacteria 7630
131 Ga0123342_1024557 3300009766 Bacteria 3757
132 Ga0105239_10000961 3300010375 Bacteria 40476
133 Ga0105239_10048550 3300010375 Bacteria 4655
134 Ga0105239_10065740 3300010375 Bacteria 3984
135 Ga0105239_10095969 3300010375 Bacteria 3275
136 Ga0105239_10218730 3300010375 Bacteria 2136
137 Ga0157322_1000175 3300012490 Bacteria 1823
138 Ga0157373_10000975 3300013100 Bacteria 22157
139 Ga0157373_10003509 3300013100 Bacteria 11857
140 Ga0157371_10000004 3300013102 Bacteria 512593
141 Ga0157371_10003340 3300013102 Bacteria 14639
142 Ga0157370_10000185 3300013104 Bacteria 78153
143 Ga0157370_10000952 3300013104 Bacteria 36741
144 Ga0157370_10075698 3300013104 Bacteria 3172
145 Ga0157369_10116422 3300013105 Bacteria 2838
146 Ga0157369_10284036 3300013105 Bacteria 1723
147 Ga0157369_10371908 3300013105 Bacteria 1484
148 Ga0171463_1001 3300013249 Bacteria 1406070
149 Ga0157374_10015143 3300013296 Bacteria 6762
150 Ga0163163_10254834 3300014325 Unclassified 1806
151 Ga0182008_10027245 3300014497 Bacteria 2897
152 Ga0182007_10000689 3300015262 Bacteria 19247
153 Ga0182005_1006222 3300015265 Bacteria 3665
154 Ga0183363_1003 3300015690 Bacteria 421263
155 Ga0183363_1032 3300015690 Bacteria 48614
156 Ga0163161_10142209 3300017792 Bacteria 1817
157 Ga0214544_1000012 3300021320 Bacteria 229808
158 Ga0214542_1000011 3300021321 Bacteria 238260
159 Ga0214542_1015274 3300021321 Bacteria 8100
160 Ga0214543_1000004 3300021327 Bacteria 527190
161 Ga0214543_1000259 3300021327 Bacteria 81880
162 Ga0228711_1000019 3300022739 Bacteria 111795
163 Ga0228710_1000022 3300022740 Bacteria 111795
164 Ga0209435_100011 3300025206 Bacteria 413027
165 Ga0209436_100461 3300025208 Bacteria 18099
166 Ga0209672_104444 3300025228 Bacteria 2602
167 Ga0209563_101710 3300025230 Bacteria 5551
168 Ga0207427_102165 3300025231 Bacteria 5603
169 Ga0209437_100056 3300025233 Bacteria 363071
170 Ga0209437_100196 3300025233 Bacteria 121199
171 Ga0207425_1000012 3300025245 Bacteria 528324
172 Ga0207425_1002334 3300025245 Bacteria 6782
173 Ga0207425_1010306 3300025245 Bacteria 2280
174 Ga0209646_1000024 3300025246 Bacteria 413027
175 Ga0209026_1000030 3300025250 Bacteria 329811
176 Ga0209677_100765 3300025253 Bacteria 16298
177 Ga0209148_1005457 3300025254 Bacteria 2914
178 Ga0209759_1000011 3300025256 Bacteria 413027
179 Ga0209129_1000081 3300025258 Bacteria 183694
180 Ga0209129_1000105 3300025258 Bacteria 159104
181 Ga0209129_1001073 3300025258 Bacteria 16132
182 Ga0209129_1001589 3300025258 Bacteria 12421
183 Ga0209129_1001943 3300025258 Bacteria 10827
184 Ga0209129_1005767 3300025258 Bacteria 4244
185 Ga0209129_1008820 3300025258 Bacteria 2748
186 Ga0209233_1000037 3300025261 Bacteria 554620
187 Ga0209233_1000071 3300025261 Bacteria 363290
188 Ga0209233_1000243 3300025261 Bacteria 90170
189 Ga0209233_1001636 3300025261 Bacteria 8722
190 Ga0209673_1000015 3300025273 Bacteria 530618
191 Ga0209673_1000709 3300025273 Bacteria 46936
192 Ga0209673_1002913 3300025273 Bacteria 10793
193 Ga0209673_1003862 3300025273 Bacteria 8457
194 Ga0209673_1005381 3300025273 Bacteria 6460
195 Ga0209673_1006637 3300025273 Bacteria 5529
196 Ga0209673_1018802 3300025273 Bacteria 2500
197 Ga0209130_1000002 3300025284 Bacteria 722648
198 Ga0209130_1000005 3300025284 Bacteria 599620
199 Ga0209130_1000088 3300025284 Bacteria 152927
200 Ga0209130_1011228 3300025284 Bacteria 2409
201 Ga0209130_1019596 3300025284 Bacteria 1565
202 Ga0209675_1005664 3300025291 Bacteria 5163
203 Ga0209676_1004283 3300025292 Bacteria 8044
204 Ga0209025_1000024 3300025294 Bacteria 528324
205 Ga0209025_1000037 3300025294 Bacteria 383429
206 Ga0209025_1000060 3300025294 Bacteria 305017
207 Ga0209025_1000295 3300025294 Bacteria 111489
208 Ga0209025_1000574 3300025294 Bacteria 66723
209 Ga0209025_1004420 3300025294 Bacteria 12226
210 Ga0209025_1006666 3300025294 Bacteria 8872
211 Ga0209025_1021284 3300025294 Bacteria 3499
212 Ga0209025_1062770 3300025294 Bacteria 1375
213 Ga0209564_1000093 3300025295 Bacteria 245793
214 Ga0209564_1000576 3300025295 Bacteria 58256
215 Ga0209564_1000744 3300025295 Bacteria 46190
216 Ga0209564_1003315 3300025295 Bacteria 11185
217 Ga0209564_1005971 3300025295 Bacteria 6737
218 Ga0209564_1022275 3300025295 Bacteria 2245
219 Ga0209564_1022639 3300025295 Bacteria 2212
220 Ga0209564_1030561 3300025295 Bacteria 1666
221 Ga0209758_1000046 3300025297 Bacteria 364931
222 Ga0209758_1000441 3300025297 Bacteria 69800
223 Ga0209758_1000575 3300025297 Bacteria 57471
224 Ga0209758_1000810 3300025297 Bacteria 44076
225 Ga0209758_1001120 3300025297 Bacteria 34521
226 Ga0209758_1013969 3300025297 Bacteria 4320
227 Ga0209758_1015725 3300025297 Bacteria 3897
228 Ga0209758_1038113 3300025297 Bacteria 1848
229 Ga0209050_1005438 3300025298 Bacteria 8002
230 Ga0209256_1000027 3300025299 Bacteria 423283
231 Ga0209256_1000646 3300025299 Bacteria 47375
232 Ga0209256_1003123 3300025299 Bacteria 12093
233 Ga0209256_1004089 3300025299 Bacteria 9460
234 Ga0209256_1004576 3300025299 Bacteria 8570
235 Ga0209256_1005525 3300025299 Bacteria 7225
236 Ga0209256_1006239 3300025299 Bacteria 6417
237 Ga0209256_1011971 3300025299 Bacteria 3392
238 Ga0209256_1018733 3300025299 Bacteria 2234
239 Ga0209256_1029324 3300025299 Bacteria 1536
240 Ga0207426_1000012 3300025302 Bacteria 730942
241 Ga0207426_1000013 3300025302 Bacteria 721897
242 Ga0207426_1000015 3300025302 Bacteria 599316
243 Ga0207426_1000063 3300025302 Bacteria 358920
244 Ga0207426_1000172 3300025302 Bacteria 163690
245 Ga0207426_1001042 3300025302 Bacteria 26389
246 Ga0209051_1000435 3300025303 Bacteria 56550
247 Ga0209051_1001495 3300025303 Bacteria 19567
248 Ga0209051_1002059 3300025303 Bacteria 15247
249 Ga0209051_1013785 3300025303 Bacteria 3817
250 Ga0209051_1033792 3300025303 Bacteria 1927
251 Ga0209051_1033794 3300025303 Bacteria 1927
252 Ga0209051_1035257 3300025303 Bacteria 1864
253 Ga0209257_1000598 3300025304 Bacteria 59869
254 Ga0209257_1001343 3300025304 Bacteria 29827
255 Ga0209257_1015925 3300025304 Bacteria 3082
256 Ga0207705_10101849 3300025909 Unclassified 2113
257 Ga0207695_10000036 3300025913 Bacteria 477897
258 Ga0207695_10002526 3300025913 Bacteria 26879
259 Ga0207695_10014432 3300025913 Bacteria 9359
260 Ga0207695_10033067 3300025913 Bacteria 5649
261 Ga0207671_10000177 3300025914 Bacteria 97072
262 Ga0207671_10000517 3300025914 Bacteria 52359
263 Ga0207694_10014209 3300025924 Bacteria 6004
264 Ga0207650_10000391 3300025925 Bacteria 40030
265 Ga0207644_10054057 3300025931 Bacteria 2891
266 Ga0207704_10004867 3300025938 Bacteria 6170
267 Ga0207667_10025939 3300025949 Bacteria 6410
268 Ga0207667_10055436 3300025949 Bacteria 4167
269 Ga0207667_10213721 3300025949 Bacteria 1977
270 Ga0207640_10009208 3300025981 Bacteria 5521
271 Ga0207702_10009604 3300026078 Bacteria 8121
272 Ga0207702_10433469 3300026078 Bacteria 1273
273 Ga0207698_10033932 3300026142 Bacteria 3714
274 Ga0209281_1000200 3300027111 Bacteria 135685
275 Ga0209281_1000227 3300027111 Bacteria 119329
276 Ga0209281_1000488 3300027111 Bacteria 54963
277 Ga0209371_1000009 3300027312 Bacteria 963030
278 Ga0209371_1000315 3300027312 Bacteria 53030
279 Ga0209371_1000424 3300027312 Bacteria 43444
280 Ga0209371_1001877 3300027312 Bacteria 12897
281 Ga0209282_1000042 3300027666 Bacteria 119329
282 Ga0209282_1002131 3300027666 Bacteria 11280
283 Ga0209813_10019163 3300027866 Bacteria 1898
284 Ga0209813_10020410 3300027866 Bacteria 1854
285 Ga0268266_10000343 3300028379 Bacteria 72589
286 Ga0268266_10027728 3300028379 Bacteria 4815
287 Ga0268266_10043210 3300028379 Bacteria 3850
288 Ga0268266_10075692 3300028379 Bacteria 2924
289 Ga0307515_10000121 3300028794 Bacteria 188657
290 Ga0307515_10001309 3300028794 Bacteria 56564
291 Ga0307515_10001439 3300028794 Bacteria 53690
292 Ga0307515_10048980 3300028794 Bacteria 6375
293 Ga0307515_10314605 3300028794 Bacteria 1237
294 Ga0268256_1000010 3300030500 Bacteria 963034
295 Ga0268256_1001516 3300030500 Bacteria 13723
296 Ga0268256_1003952 3300030500 Bacteria 6393
297 Ga0316182_1324402 3300030745 Bacteria 2051
298 Ga0307513_10002360 3300031456 Bacteria 26237
299 Ga0307513_10013648 3300031456 Bacteria 9964
300 Ga0307513_10195090 3300031456 Bacteria 1872
301 Ga0307408_100031751 3300031548 Bacteria 3679
302 Ga0316579_10096290 3300031691 Bacteria 1415
303 Ga0307516_10032356 3300031730 Bacteria 5268
304 Ga0307405_10002866 3300031731 Bacteria 7749
305 Ga0307405_10018812 3300031731 Bacteria 3820
306 Ga0307406_10004188 3300031901 Bacteria 7848
307 Ga0307406_10043976 3300031901 Bacteria 2797
308 Ga0307412_10000394 3300031911 Bacteria 26964
309 Ga0307412_10082914 3300031911 Bacteria 2221
310 Ga0307412_10220245 3300031911 Bacteria 1454
311 Ga0315914_1000009 3300031967 Bacteria 182444
312 Ga0307409_100066807 3300031995 Bacteria 2837
313 Ga0307414_10000147 3300032004 Bacteria 47511
314 Ga0307414_10036914 3300032004 Bacteria 3267
315 Ga0307414_10176721 3300032004 Bacteria 1713
316 Ga0307510_10144528 3300033180 Bacteria 2014
317 Ga0307510_10237844 3300033180 Bacteria 1318
318 Ga0315913_1000015 3300033430 Bacteria 119325
319 Ga0315915_1000013 3300033464 Bacteria 182438
320 Ga0373927_0000086 3300035695 Bacteria 69853
321 Ga0373925_0008735 3300037068 Bacteria 7380
322 Ga0395899_0098510 3300037312 Bacteria 2112
323 Ga0395900_0098655 3300037418 Bacteria 3001
324 Ga0395898_0129690 3300037466 Bacteria 2415
325 Ga0395905_0000775 3300037471 Bacteria 42024
326 Ga0395905_0002869 3300037471 Bacteria 18822
327 Ga0395901_0241671 3300038443 Bacteria 1883
328 Ga0400488_40386 3300038741 Bacteria 2199
329 Ga0400483_210922 3300039062 Bacteria 3277
330 Ga0439436_0019510 3300041404 Bacteria 2023
331 Ga0439465_0005470 3300041413 Bacteria 4055
332 Ga0451795_1599653 3300041456 Bacteria 1073
333 Ga0451839_0284469 3300041496 Bacteria 1211
334 Ga0451841_0185773 3300041498 Bacteria 1663
335 Ga0451845_0485343 3300041501 Bacteria 991
336 Ga0451855_0148620 3300041511 Bacteria 1233
337 Ga0439445_0017452 3300042004 Bacteria 1774
338 Ga0439445_0021883 3300042004 Bacteria 1609
339 Ga0439449_0010782 3300042007 Bacteria 3449
340 Ga0439462_0011190 3300042015 Bacteria 2281
341 Ga0450906_006429 3300042145 Bacteria 2373
342 Ga0450918_003188 3300042531 Bacteria 3058
343 Ga0466963_0082292 3300044694 Bacteria 2182
344 Ga0466968_0106166 3300044735 Bacteria 1259
345 Ga0451576_0012411 3300045051 Bacteria 9569
346 Ga0495638_0000788 3300046460 Bacteria 33436
347 Ga0495650_0039550 3300046471 Bacteria 2034
348 Ga0495605_0007669 3300046474 Bacteria 6118
349 Ga0495605_0024665 3300046474 Bacteria 3143
350 Ga0495662_0031958 3300046476 Bacteria 2542
351 Ga0495607_0023280 3300046501 Bacteria 3878
352 Ga0495607_0077205 3300046501 Bacteria 1840
353 Ga0495583_0034401 3300046506 Bacteria 2427
354 Ga0495606_0002833 3300046507 Bacteria 19241
355 Ga0495610_0005023 3300046512 Bacteria 9571
356 Ga0495610_0106832 3300046512 Bacteria 1245
357 Ga0495620_0026059 3300046515 Bacteria 2754
358 Ga0495631_0015169 3300046518 Bacteria 3701
359 Ga0495631_0076091 3300046518 Bacteria 1448
360 Ga0495632_0015112 3300046519 Bacteria 4340
361 Ga0495632_0043000 3300046519 Bacteria 2261
362 Ga0495648_0078617 3300046524 Bacteria 1886
363 Ga0495654_0000321 3300046530 Bacteria 42082
364 Ga0495640_0098569 3300046533 Bacteria 1921
365 Ga0495609_0025818 3300046538 Bacteria 2691
366 Ga0495597_0005914 3300046542 Bacteria 6389
367 Ga0495622_0043836 3300046557 Bacteria 2079
368 Ga0495633_0016323 3300046558 Bacteria 3832
369 Ga0495668_0003954 3300046616 Bacteria 10812
370 Ga0495611_0010307 3300046648 Bacteria 3953
371 Ga0495625_0005054 3300046660 Bacteria 12222
372 Ga0495625_0064844 3300046660 Bacteria 2576
373 Ga0495635_0043983 3300046663 Bacteria 3081
374 Ga0495661_0107348 3300046665 Bacteria 1561
375 Ga0495588_0000622 3300046674 Bacteria 16604
376 Ga0495588_0024360 3300046674 Bacteria 3006
377 Ga0495657_0087658 3300046675 Bacteria 2002
378 Ga0495658_0125100 3300046683 Bacteria 1559
379 Ga0495670_0033964 3300046691 Bacteria 2539
380 Ga0495670_0110482 3300046691 Bacteria 1422
381 Ga0495671_0052781 3300046692 Bacteria 2020
382 Ga0495671_0122081 3300046692 Bacteria 1271
383 Ga0495604_0113830 3300047317 Bacteria 1968
384 Ga0495672_0107347 3300047320 Bacteria 1504
385 Ga0495683_0144195 3300047323 Bacteria 1114
386 Ga0495687_009034 3300047443 Bacteria 5619
387 Ga0495681_0002829 3300047470 Bacteria 12267
388 Ga0495686_0000458 3300047472 Bacteria 61256
389 Ga0495686_0039525 3300047472 Bacteria 3012
390 Ga0495686_0054506 3300047472 Bacteria 2503
391 Ga0495686_0194815 3300047472 Bacteria 1166
392 Ga0496100_0066239 3300048903 Bacteria 2395
393 Ga0496102_0007240 3300048905 Bacteria 9470
394 Ga0496103_0011291 3300048906 Bacteria 5288
395 Ga0496104_0064887 3300048907 Bacteria 3464
396 Ga0496106_0017682 3300048909 Bacteria 5273
397 Ga0496110_0119904 3300048913 Bacteria 2369
398 Ga0496111_0004636 3300048914 Bacteria 8699
399 Ga0496113_0120442 3300048916 Bacteria 2051
400 Ga0496116_0000100 3300048919 Bacteria 194740
401 Ga0496116_0010591 3300048919 Bacteria 7712
402 Ga0496116_0034978 3300048919 Bacteria 3534
403 Ga0496116_0040518 3300048919 Bacteria 3207
404 Ga0496116_0049931 3300048919 Bacteria 2791
405 Ga0496116_0056547 3300048919 Bacteria 2570
406 Ga0496116_0164571 3300048919 Bacteria 1211
407 Ga0496117_0000002 3300048920 Bacteria 2483758
408 Ga0496117_0001791 3300048920 Bacteria 29241
409 Ga0496117_0003238 3300048920 Bacteria 19173
410 Ga0496117_0027534 3300048920 Bacteria 4426
411 Ga0496117_0047858 3300048920 Bacteria 3061
412 Ga0496117_0048598 3300048920 Bacteria 3028
413 Ga0496117_0060042 3300048920 Bacteria 2623
414 Ga0496118_0001493 3300048921 Bacteria 34920
415 Ga0496118_0006723 3300048921 Bacteria 12529
416 Ga0496118_0007119 3300048921 Bacteria 12000
417 Ga0496118_0030242 3300048921 Bacteria 4523
418 Ga0496118_0101278 3300048921 Bacteria 1946
419 Ga0496119_0021672 3300048922 Bacteria 4632
420 Ga0496120_0000021 3300048923 Bacteria 250966
421 Ga0496120_0018092 3300048923 Bacteria 4550
422 Ga0496121_0000001 3300048924 Bacteria 1830318
423 Ga0496121_0001709 3300048924 Bacteria 35918
424 Ga0496121_0002141 3300048924 Bacteria 31012
425 Ga0496121_0012257 3300048924 Bacteria 9386
426 Ga0496121_0012986 3300048924 Bacteria 9001
427 Ga0496121_0026205 3300048924 Bacteria 5503
428 Ga0496121_0078597 3300048924 Bacteria 2622
429 Ga0496121_0081281 3300048924 Bacteria 2565
430 Ga0496121_0103836 3300048924 Bacteria 2185
431 Ga0496121_0190280 3300048924 Bacteria 1472
432 Ga0496122_0000001 3300048925 Bacteria 1827766
433 Ga0496122_0000147 3300048925 Bacteria 165589
434 Ga0496122_0001112 3300048925 Bacteria 46455
435 Ga0496122_0004207 3300048925 Bacteria 18095
436 Ga0496122_0013026 3300048925 Bacteria 8191
437 Ga0496122_0047680 3300048925 Bacteria 3305
438 Ga0496122_0053134 3300048925 Bacteria 3057
439 Ga0496122_0063563 3300048925 Bacteria 2692
440 Ga0496122_0064956 3300048925 Bacteria 2650
441 Ga0496122_0166022 3300048925 Bacteria 1338
442 Ga0496123_0000001 3300048926 Bacteria 1831497
443 Ga0496123_0000158 3300048926 Bacteria 136078
444 Ga0496123_0000910 3300048926 Bacteria 46499
445 Ga0496123_0060370 3300048926 Bacteria 2445
446 Ga0496123_0069336 3300048926 Bacteria 2214
447 Ga0496123_0089386 3300048926 Bacteria 1835
448 Ga0496123_0124760 3300048926 Bacteria 1439
449 Ga0496124_0000063 3300048927 Bacteria 229705
450 Ga0496124_0000551 3300048927 Bacteria 63371
451 Ga0496124_0008733 3300048927 Bacteria 10526
452 Ga0496124_0021178 3300048927 Bacteria 5994
453 Ga0496124_0037083 3300048927 Bacteria 4243
454 Ga0496124_0049047 3300048927 Bacteria 3603
455 Ga0496124_0050127 3300048927 Bacteria 3559
456 Ga0496124_0060239 3300048927 Bacteria 3185
457 Ga0496124_0168106 3300048927 Bacteria 1702
458 Ga0496124_0186404 3300048927 Bacteria 1592
459 Ga0496124_0260101 3300048927 Bacteria 1278
460 Ga0496125_0000001 3300048928 Bacteria 1766138
461 Ga0496125_0000981 3300048928 Bacteria 44598
462 Ga0496125_0025057 3300048928 Bacteria 5473
463 Ga0496125_0029800 3300048928 Bacteria 4896
464 Ga0496125_0032809 3300048928 Bacteria 4607
465 Ga0496125_0055609 3300048928 Bacteria 3222
466 Ga0496126_0000094 3300048929 Bacteria 208184
467 Ga0496126_0000195 3300048929 Bacteria 135582
468 Ga0496126_0015337 3300048929 Bacteria 7710
469 Ga0496126_0052315 3300048929 Bacteria 3712
470 Ga0496126_0054690 3300048929 Bacteria 3613
471 Ga0496126_0096523 3300048929 Bacteria 2591
472 Ga0495682_0020262 3300049460 Bacteria 2497
473 Ga0501031_0019562 3300049568 Bacteria 4410
474 Ga0501032_0035214 3300049569 Bacteria 3424
475 Ga0501033_0000396 3300049570 Bacteria 41913
476 Ga0501033_0008788 3300049570 Bacteria 7807
477 Ga0501034_0012395 3300049571 Bacteria 8806
478 Ga0501034_0116860 3300049571 Bacteria 2655
479 Ga0501034_0169425 3300049571 Bacteria 2151
480 Ga0501034_0230224 3300049571 Bacteria 1802
481 Ga0501034_0252080 3300049571 Bacteria 1709
482 Ga0501037_0148425 3300049573 Bacteria 1677
483 Ga0501043_0016875 3300049579 Bacteria 5723
484 Ga0501046_0052880 3300049580 Bacteria 3200
485 Ga0501047_0195815 3300049581 Bacteria 1883
486 Ga0501047_0210632 3300049581 Bacteria 1802
487 Ga0501047_0249795 3300049581 Bacteria 1622
488 Ga0501068_0100704 3300049584 Bacteria 1791
489 Ga0501070_0079005 3300049586 Bacteria 2722
490 Ga0501074_0324806 3300049590 Bacteria 1093
491 Ga0501223_000256 3300049663 Bacteria 13526
492 Ga0501224_000034 3300049664 Bacteria 37769
493 Ga0501233_002460 3300049668 Bacteria 3267
494 Ga0501225_0000865 3300049705 Bacteria 9405
495 Ga0501083_0082272 3300049744 Bacteria 2133
496 Ga0501280_004240 3300049776 Bacteria 2121
497 Ga0501035_0000647 3300049822 Bacteria 38388
498 Ga0501035_0007015 3300049822 Bacteria 10525
499 Ga0501035_0118102 3300049822 Bacteria 2320
500 Ga0501044_0020415 3300049823 Bacteria 7074
501 Ga0501044_0089814 3300049823 Bacteria 3100
502 Ga0501044_0138692 3300049823 Bacteria 2421
503 Ga0501226_000038 3300049853 Bacteria 64184
504 nmdc:mga03n38_99294_c1 3300050490 Bacteria 1402
505 nmdc:mga00v17_140754_c1 3300050491 Bacteria 1547
506 nmdc:mga00v17_39_c1 3300050491 Bacteria 82050
507 nmdc:mga00v17_48_c1 3300050491 Bacteria 75606
508 nmdc:mga0yw44_35102_c1 3300050492 Bacteria 2945
509 nmdc:mga0yw44_439_c1 3300050492 Bacteria 9518
510 nmdc:mga04h51_1693_c1 3300050495 Bacteria 5148
511 nmdc:mga0sz30_287_c1 3300050516 Bacteria 19364
512 nmdc:mga0sz30_69478_c1 3300050516 Bacteria 1514
513 Ga0500610_0029107 3300053079 Bacteria 2788
514 Ga0500578_0085656 3300053086 Bacteria 2001
515 Ga0500644_0003697 3300053088 Bacteria 3798
516 Ga0500557_019472 3300053105 Bacteria 1913
517 Ga0500560_000754 3300053107 Bacteria 4912
518 Ga0500560_073441 3300053107 Bacteria 1130
519 Ga0500569_014925 3300053109 Bacteria 1934
520 Ga0500572_003242 3300053111 Bacteria 3750
521 Ga0500593_068618 3300053117 Bacteria 1543
522 Ga0500607_099280 3300053121 Bacteria 1449
523 Ga0500608_030758 3300053122 Bacteria 2545
524 Ga0500618_000119 3300053125 Bacteria 64330
525 Ga0500618_000359 3300053125 Bacteria 31723
526 Ga0500559_0006632 3300053136 Bacteria 5209
527 Ga0500559_0007875 3300053136 Bacteria 4703
528 Ga0500561_0000213 3300053137 Bacteria 10547
529 Ga0500568_0008632 3300053139 Bacteria 4894
530 Ga0500568_0020058 3300053139 Bacteria 2898
531 Ga0500616_0002453 3300053153 Bacteria 15395
532 Ga0500616_0002986 3300053153 Bacteria 13387
533 Ga0500622_0002012 3300053156 Bacteria 15189
534 Ga0500622_0013526 3300053156 Bacteria 4403
535 Ga0500622_0019253 3300053156 Bacteria 3626
536 Ga0500627_0019420 3300053158 Bacteria 2708
537 Ga0500634_0000017 3300053161 Bacteria 111983
538 Ga0500634_0049992 3300053161 Bacteria 2253
539 Ga0500636_0000006 3300053177 Bacteria 183899
540 Ga0500636_0075104 3300053177 Bacteria 1955
541 Ga0501082_0072834 3300060353 Bacteria 2959
542 2643918320 2643221582 Bacteria 5804683
543 2509106965 2508501122 Bacteria 6292184
544 2509375079 2509276019 Bacteria 6802256
545 2509388517 2509276021 Bacteria 7634384
546 2509444067 2509276033 Bacteria 7180565
547 2510131336 2510065019 Bacteria 6903379
548 2510303575 2510065057 Bacteria 6649661
549 2510841138 2510461069 Bacteria 5505000
550 2510897690 2510461076 Bacteria 8618824
551 2511134793 2510917022 Bacteria 6504556
552 2511171242 2510917026 Bacteria 7046020
553 2511184711 2510917028 Bacteria 6185411
554 2511195324 2510917030 Bacteria 7460662
555 2511500447 2511231052 Bacteria 6974333
556 2512531907 2512047086 Bacteria 6850303
557 2512972763 2512875026 Bacteria 6861065
558 2513570554 2513237084 Bacteria 7231967
559 2513580293 2513237085 Bacteria 7695351
560 2513585423 2513237086 Bacteria 7265287
561 2513596656 2513237088 Bacteria 6927906
562 2513602848 2513237089 Bacteria 6553624
563 2513616672 2513237091 Bacteria 6900273
564 2513634173 2513237093 Bacteria 7545552
565 2513707039 2513237103 Bacteria 7647401
566 2513864931 2513237138 Bacteria 7368160
567 2513885639 2513237140 Bacteria 7076289
568 2513904010 2513237143 Bacteria 6664116
569 2513910275 2513237144 Bacteria 7530820
570 2513929785 2513237146 Bacteria 7166346
571 2513996687 2513237159 Bacteria 6810126
572 2514005100 2513237160 Bacteria 6650282
573 2514020324 2513237162 Bacteria 7468464
574 2515110289 2515075009 Bacteria 7288508
575 2515607649 2515154107 Bacteria 6795637
576 2515634497 2515154113 Bacteria 7807172
577 2515643722 2515154114 Bacteria 7848616
578 2515657120 2515154116 Bacteria 7552979
579 2515743380 2515154134 Bacteria 7220242
580 2516204414 2516143018 Bacteria 6951533
581 2516891780 2516653046 Bacteria 6989037
582 2517038974 2516653077 Bacteria 7555578
583 2517079240 2516653085 Bacteria 7346596
584 2517093168 2517093000 Bacteria 7412387
585 2517409438 2517287029 Bacteria 6905599
586 2517568578 2517487022 Bacteria 7227575
587 2520375570 2519899620 Bacteria 6499161
588 2524450606 2524023207 Bacteria 6813453
589 2524458283 2524023209 Bacteria 6679728
590 2530647899 2529292951 Bacteria 6916614
591 2535515018 2534681796 Bacteria 7146037
592 2537876002 2537561587 Bacteria 5425293
593 2551677069 2551306084 Bacteria 8942552
594 2551684035 2551306085 Bacteria 7347181
595 2551696047 2551306086 Bacteria 6843938
596 2554246550 2554235003 Bacteria 5877155
597 2558866183 2558860100 Bacteria 8458965
598 2559293725 2558860242 Bacteria 5568029
599 2561467007 2558860983 Bacteria 4133860
600 2585164921 2582581283 Bacteria 6030556
601 2585203595 2582581294 Bacteria 6626667
602 2585223683 2582581298 Bacteria 7315509
603 2585229741 2582581299 Bacteria 6518058
604 2585255993 2582581304 Bacteria 5831370
605 2585265297 2582581306 Bacteria 6450535
606 2585273859 2582581307 Bacteria 6597605
607 2585280160 2582581308 Bacteria 7413247
608 2585326059 2582581315 Bacteria 7318924
609 2585330228 2582581316 Bacteria 7774528
610 2585385569 2582581865 Bacteria 6644329
611 2585391985 2582581866 Bacteria 6859583
612 2585398628 2582581867 Bacteria 7184437
613 2585529344 2585427526 Bacteria 7258840
614 2585533589 2585427527 Bacteria 7273426
615 2585539605 2585427528 Bacteria 6842387
616 2585545721 2585427529 Bacteria 7395659
617 2585553178 2585427530 Bacteria 7383882
618 2585560035 2585427531 Bacteria 6992870
619 2585819222 2585427590 Bacteria 6824633
620 2585837562 2585427593 Bacteria 7141551
621 2585844128 2585427594 Bacteria 6180594
622 2585900710 2585427608 Bacteria 6544331
623 2585905785 2585427609 Bacteria 6667127
624 2585994314 2585427633 Bacteria 6413184
625 2585998772 2585427634 Bacteria 6455027
626 2587979099 2585428125 Bacteria 6662905
627 2599332934 2599185156 Bacteria 5403036
628 2599419267 2599185170 Bacteria 7295545
629 2599606033 2599185210 Bacteria 5624189
630 2599719629 2599185236 Bacteria 6875203
631 2600191373 2599185352 Bacteria 7228948
632 2600374625 2600254933 Bacteria 4750527
633 2601609250 2600255279 Bacteria 5605316
634 2601746025 2600255308 Bacteria 5611129
635 2616297037 2615840624 Bacteria 6557588
636 2616310293 2615840626 Bacteria 7921970
637 2616553326 2615840698 Bacteria 7319877
638 2617380341 2617270742 Bacteria 6808054
639 2643806208 2643221557 Bacteria 7184309
640 2643812838 2643221558 Bacteria 5460675
641 2643855224 2643221568 Bacteria 5187270
642 2644004820 2643221599 Bacteria 6292121
643 2644047232 2643221607 Bacteria 6314006
644 2644070188 2643221610 Bacteria 7480339
645 2644103324 2643221618 Bacteria 7717186
646 2644144263 2643221626 Bacteria 8069654
647 2644190497 2643221634 Bacteria 6705461
648 2644199603 2643221636 Bacteria 6583769
649 2644206785 2643221637 Bacteria 5345260
650 2644241624 2643221643 Bacteria 5749658
651 2644297714 2643221653 Bacteria 4569637
652 2644306254 2643221655 Bacteria 7722067
653 2644330503 2643221659 Bacteria 7890716
654 2644377470 2643221668 Bacteria 7306521
655 2644420950 2643221675 Bacteria 7473456
656 2644454473 2643221680 Bacteria 7473610
657 2644480021 2643221686 Bacteria 6310811
658 2644492323 2643221688 Bacteria 5260751
659 2644496834 2643221689 Bacteria 6042950
660 2644519308 2643221693 Bacteria 5513853
661 2644542750 2643221698 Bacteria 7756764
662 2644611865 2643221712 Bacteria 7729434
663 2644650433 2643221718 Bacteria 5345506
664 2644655967 2643221719 Bacteria 4568197
665 2644671886 2643221723 Bacteria 7095460
666 2644692411 2643221726 Bacteria 7455827
667 2657681821 2657244999 Bacteria 5946535
668 2671113742 2667528174 Bacteria 6435400
669 2692317332 2690316117 Bacteria 6800650
670 2719179489 2718217882 Bacteria 6556348
671 2719384045 2718217927 Bacteria 6972593
672 2719663836 2718217997 Bacteria 6740740
673 2719730159 2718218009 Bacteria 6478651
674 2720490255 2718218199 Bacteria 6740745
675 2720611632 2718218232 Bacteria 6720332
676 2720618481 2718218233 Bacteria 6662049
677 2720629889 2718218235 Bacteria 6630699
678 2720773584 2718218269 Bacteria 6906114
679 2721145582 2718218363 Bacteria 6524337
680 2721157099 2718218365 Bacteria 6274507
681 2721162461 2718218366 Bacteria 6425255
682 2721397815 2718218423 Bacteria 6438183
683 2722838631 2721755514 Bacteria 6424414
684 2723025255 2721755556 Bacteria 6745503
685 2723558840 2721755684 Bacteria 6859907
686 2723565410 2721755685 Bacteria 6704835
687 2724036625 2721755809 Bacteria 6438790
688 2724042915 2721755810 Bacteria 6479005
689 2724088191 2721755819 Bacteria 6906405
690 2724102675 2721755822 Bacteria 6726041
691 2724108571 2721755823 Bacteria 6752556
692 2725948914 2724679232 Bacteria 7646494
693 2730106191 2728369352 Bacteria 6745171
694 2730162726 2728369365 Bacteria 6555560
695 2730296731 2728369397 Bacteria 6274511
696 2738801319 2738541293 Bacteria 7065685
697 2738948327 2738541317 Bacteria 5340176
698 2739036995 2738541333 Bacteria 7106503
699 2739306123 2738543024 Bacteria 5603683
700 2753461269 2751185821 Bacteria 6189929
701 2766062836 2765235942 Bacteria 7445910
702 2776911992 2775507049 Bacteria 6284736
703 2778179636 2775507266 Bacteria 7392367
704 2792582997 2791355082 Bacteria 5973319
705 2792623884 2791355091 Bacteria 6135441
706 2792629736 2791355092 Bacteria 6248105
707 2792638069 2791355094 Bacteria 7011481
708 2793282068 2791355253 Bacteria 5171699
709 2793295288 2791355256 Bacteria 6798008
710 2793316410 2791355259 Bacteria 7254731
711 2793323360 2791355260 Bacteria 6598818
712 2793326246 2791355261 Bacteria 6661293
713 2793334307 2791355262 Bacteria 6774204
714 2793341886 2791355263 Bacteria 6872478
715 2793348223 2791355264 Bacteria 6429314
716 2793355711 2791355265 Bacteria 6539969
717 2793361592 2791355266 Bacteria 7116587
718 2793364596 2791355267 Bacteria 7222458
719 2802720389 2802428858 Bacteria 6636079
720 2802726209 2802428859 Bacteria 6667919
721 2802731627 2802428860 Bacteria 6525526
722 2802739378 2802428861 Bacteria 6534206
723 2802742520 2802428862 Bacteria 6633353
724 2802749225 2802428863 Bacteria 6410669
725 2804750841 2802429268 Bacteria 6094027
726 2805929291 2802429605 Bacteria 6875453
727 2805932450 2802429606 Bacteria 6346811
728 2806047623 2802429633 Bacteria 7341974
729 2806055042 2802429634 Bacteria 7083200
730 2806062056 2802429635 Bacteria 7650140
731 2806067218 2802429636 Bacteria 7597525
732 2806076539 2802429637 Bacteria 7067217
733 2808986447 2808606387 Bacteria 5697198
734 2819245244 2818991272 Bacteria 4622173
735 2819556577 2818991439 Bacteria 6907412
736 2819608489 2818991448 Bacteria 6772224
737 2819640594 2818991453 Bacteria 7181617
738 2819686239 2818991461 Bacteria 7026071
739 2821123558 2821123053 Bacteria 7836056
740 2837651880 2837651117 Bacteria 3772164
741 2838020204 2838016132 Bacteria 6577831
742 2838025723 2838022645 Bacteria 6494267
743 2838029372 2838029111 Bacteria 6603031
744 2838037049 2838035591 Bacteria 7166484
745 2838044518 2838042994 Bacteria 6046894
746 2838051580 2838048938 Bacteria 6044578
747 2838064055 2838061910 Bacteria 6794874
748 2838071030 2838068647 Bacteria 6208656
749 2838075294 2838074704 Bacteria 6785777
750 2838663774 2838661181 Bacteria 7385261
751 2838672475 2838668709 Bacteria 6671819
752 2838677305 2838675328 Bacteria 4909118
753 2838680503 2838680041 Bacteria 6545511
754 2838691663 2838686498 Bacteria 7807632
755 2838695464 2838694306 Bacteria 6853137
756 2838703783 2838701080 Bacteria 6669771
757 2838708841 2838707686 Bacteria 6619912
758 2838716193 2838714209 Bacteria 5525906
759 2838720007 2838719591 Bacteria 5523910
760 2838726945 2838724970 Bacteria 4908691
761 2838733853 2838729681 Bacteria 7400765
762 2838739408 2838736955 Bacteria 5760694
763 2838747083 2838742623 Bacteria 7396178
764 2841843306 2841840854 Bacteria 5761912
765 2841846939 2841846520 Bacteria 5345850
766 2841856224 2841851746 Bacteria 7532261
767 2841860533 2841859092 Bacteria 5436171
768 2841866893 2841864319 Bacteria 6742987
769 2842079924 2842077413 Bacteria 6508645
770 2842112129 2842110456 Bacteria 7656360
771 2842120542 2842118031 Bacteria 7033875
772 2842127032 2842124991 Bacteria 5346824
773 2842132198 2842130223 Bacteria 4909145
774 2842145973 2842140634 Bacteria 5759631
775 2842148425 2842146304 Bacteria 5957337
776 2842152633 2842152218 Bacteria 4908957
777 2842162012 2842156927 Bacteria 6894975
778 2842169611 2842163707 Bacteria 6916235
779 2842172438 2842170452 Bacteria 5525737
780 2842176252 2842175837 Bacteria 4908771
781 2842185854 2842180545 Bacteria 6888678
782 2842189300 2842187318 Bacteria 5524014
783 2842192805 2842192696 Bacteria 6147454
784 2842202874 2842198810 Bacteria 6608673
785 2842207032 2842205361 Bacteria 6340321
786 2842213614 2842211629 Bacteria 5523832
787 2842218875 2842217011 Bacteria 7497767
788 2842224768 2842224351 Bacteria 5524473
789 2842235382 2842229732 Bacteria 7475766
790 2842238252 2842237096 Bacteria 6620661
791 2842248163 2842243621 Bacteria 7421798
792 2842253491 2842250916 Bacteria 6579627
793 2842262243 2842257432 Bacteria 7401195
794 2842268842 2842264693 Bacteria 6472963
795 2842276636 2842271015 Bacteria 7807131
796 2842280275 2842278818 Bacteria 6340002
797 2842286757 2842285085 Bacteria 6011953
798 2842293585 2842291075 Bacteria 7076806
799 2842299531 2842298080 Bacteria 6123127
800 2842306582 2842304105 Bacteria 7023636
801 2842312702 2842311132 Bacteria 6616990
802 2842322433 2842317721 Bacteria 6793725
803 2842343155 2842341865 Bacteria 7003929
804 2842360958 2842357229 Bacteria 6485165
805 2842367120 2842363717 Bacteria 6844742
806 2842370966 2842370503 Bacteria 7038661
807 2842379982 2842377471 Bacteria 7140707
808 2842387053 2842384541 Bacteria 7057858
809 2842399167 2842395702 Bacteria 6780583
810 2842403690 2842402390 Bacteria 6681310
811 2842410608 2842409023 Bacteria 6687331
812 2842417254 2842415677 Bacteria 6596907
813 2842424645 2842422224 Bacteria 6239196
814 2842432958 2842428310 Bacteria 6767288
815 2842439263 2842434925 Bacteria 6502746
816 2842445892 2842441272 Bacteria 6769273
817 2842451927 2842447887 Bacteria 6754142
818 2842467078 2842462802 Bacteria 6588055
819 2842473894 2842469257 Bacteria 6752936
820 2842476198 2842475841 Bacteria 6603183
821 2842487663 2842482326 Bacteria 7212537
822 2842492541 2842489311 Bacteria 6620893
823 2842500121 2842495871 Bacteria 6820686
824 2842502900 2842502639 Bacteria 6604161
825 2842509124 2842509118 Bacteria 6850950
826 2842517318 2842515876 Bacteria 5436280
827 2842521617 2842521101 Bacteria 6569494
828 2842923242 2842922631 Bacteria 5824079
829 2844165169 2844163670 Bacteria 7266046
830 2844456072 2844454524 Bacteria 7952546
831 2847417599 2847417321 Bacteria 6913799
832 2848992405 2848992105 Bacteria 6810864
833 2850079901 2850079185 Bacteria 6848280
834 2852388397 2852387548 Bacteria 8025568
835 2854898181 2854896431 Bacteria 5869725
836 2854919863 2854916844 Bacteria 5725939
837 2855828148 2855825444 Bacteria 6785811
838 2855839920 2855839649 Bacteria 7135830
839 2855873456 2855872281 Bacteria 6964271
840 2857521725 2857516855 Bacteria 7787325
841 2857531121 2857531043 Bacteria 6754041
842 2858803893 2858800743 Bacteria 6603254
843 2891375014 2891373044 Bacteria 5202277
844 2896391632 2896384573 Bacteria 7700774
845 2899792615 2899792073 Bacteria 4926588
846 2899805382 2899803654 Bacteria 5577784
847 2899846015 2899845264 Bacteria 5672268
848 2913298068 2913295892 Bacteria 6333755
849 2913313331 2913308742 Bacteria 5350706
850 2915980708 2915980308 Bacteria 6624279
851 2915990582 2915986958 Bacteria 6739310
852 2915998225 2915993759 Bacteria 7016183
853 2916001029 2916000859 Bacteria 6865702
854 2916011080 2916007675 Bacteria 6898660
855 2916015500 2916014648 Bacteria 6946486
856 2916025423 2916021584 Bacteria 6854472
857 2916031109 2916028427 Bacteria 6748433
858 2916036436 2916035215 Bacteria 6755766
859 2916045647 2916041962 Bacteria 6820487
860 2916053748 2916048683 Bacteria 6543552
861 2916057327 2916055098 Bacteria 6758838
862 2916063725 2916061851 Bacteria 6737736
863 2916069640 2916068649 Bacteria 6943657
864 2919101431 2919100787 Bacteria 7710546
865 2919116396 2919114240 Bacteria 5700270
866 2919166795 2919166419 Bacteria 4952238
867 2919172177 2919171160 Bacteria 6499771
868 2919408719 2919408235 Bacteria 6149349
869 2920763472 2920760137 Bacteria 7427611
870 2920823292 2920822456 Bacteria 6897201
871 2921207017 2921201388 Bacteria 6926299
872 2921212213 2921208531 Bacteria 6745326
873 2921242029 2921237296 Bacteria 6876710
874 2921248895 2921244191 Bacteria 6568419
875 2921257234 2921250672 Bacteria 6677771
876 2921260943 2921257292 Bacteria 6808382
877 2921266402 2921263974 Bacteria 6864552
878 2921288489 2921282425 Bacteria 6826397
879 2921294458 2921289301 Bacteria 7316391
880 2921300176 2921296804 Bacteria 7176999
881 2923557065 2923556063 Bacteria 6793593
882 2924149833 2924144063 Bacteria 6883928
883 2924156580 2924150972 Bacteria 7169444
884 2924163418 2924158325 Bacteria 7188855
885 2924170408 2924165586 Bacteria 7260590
886 2924177691 2924172951 Bacteria 6749356
887 2924183545 2924179722 Bacteria 6843264
888 2924190781 2924186466 Bacteria 6876637
889 2924199082 2924193448 Bacteria 6955718
890 2924205614 2924200457 Bacteria 6757188
891 2924209126 2924207177 Bacteria 6917007
892 2924215226 2924214083 Bacteria 7080103
893 2924228354 2924221636 Bacteria 7113495
894 2924232842 2924228884 Bacteria 6633132
895 2926757350 2926754445 Bacteria 5964435
896 2926761566 2926760298 Bacteria 5505990
897 2928029504 2928027323 Bacteria 4382488
898 2929138729 2929138655 Bacteria 5810547
899 2932405988 2932401849 Bacteria 4262978
900 2933007278 2933006813 Bacteria 4912075
901 2933015131 2933011516 Bacteria 5439334
902 2933573651 2933570622 Bacteria 7023390
903 2933587457 2933586486 Bacteria 7667493
904 2933594483 2933594066 Bacteria 5594265
905 2933601829 2933599457 Bacteria 5858799
906 2935895988 2935894831 Bacteria 6620579
907 2935907246 2935901341 Bacteria 7341747
908 2936369010 2936367885 Bacteria 7324495
909 2936378374 2936375103 Bacteria 6652732
910 2936383661 2936381700 Bacteria 7006523
911 2936997855 2936996657 Bacteria 6298727
912 2937007614 2937002841 Bacteria 6934057
913 2937014862 2937009748 Bacteria 6746052
914 2937022394 2937016420 Bacteria 6782579
915 2937023282 2937023124 Bacteria 6815156
916 2937034604 2937029754 Bacteria 6424026
917 2937041235 2937036028 Bacteria 6846469
918 2937045988 2937042894 Bacteria 6741576
919 2937051829 2937049772 Bacteria 6757901
920 2937062640 2937056579 Bacteria 7107896
921 2937068340 2937063883 Bacteria 7199456
922 2937074843 2937071275 Bacteria 6984483
923 2937078816 2937078374 Bacteria 6610289
924 2937089102 2937084907 Bacteria 6618516
925 2937095206 2937091812 Bacteria 6979387
926 2937104396 2937098957 Bacteria 7249374
927 2937112408 2937106411 Bacteria 6947143
928 2937119566 2937113482 Bacteria 6505872
929 2937126096 2937119839 Bacteria 6597547
930 2937131519 2937126314 Bacteria 6771275
931 2941500796 2941499720 Bacteria 7599444
932 2957382132 2957375807 Bacteria 6425588
933 2957388582 2957382221 Bacteria 6737050
934 2957393991 2957388812 Bacteria 6778072
935 2957399079 2957395598 Bacteria 6822399
936 2957403340 2957402308 Bacteria 6741770
937 2957412038 2957408893 Bacteria 6558585
938 2957418140 2957415311 Bacteria 6991633
939 2957423935 2957422303 Bacteria 7172205
940 2957434067 2957430029 Bacteria 7022557
941 2957442563 2957437181 Bacteria 6568994
942 2957447203 2957443900 Bacteria 6869977
943 2957455236 2957450854 Bacteria 6765715
944 2957462747 2957457609 Bacteria 6967680
945 2957466239 2957464669 Bacteria 6568877
946 2957473703 2957471148 Bacteria 6797643
947 2957479708 2957478035 Bacteria 6756658
948 2957484925 2957484790 Bacteria 6703082
949 2957496110 2957491536 Bacteria 6695180
950 2957500572 2957498199 Bacteria 7126688
951 2957508219 2957505466 Bacteria 7253085
952 2960589379 2960584000 Bacteria 6864594
953 2960594691 2960591022 Bacteria 6622873
954 2960603486 2960597568 Bacteria 6550735
955 2960608765 2960603979 Bacteria 6898737
956 2960614410 2960610863 Bacteria 6691244
957 2960621621 2960617483 Bacteria 6727748
958 2960628915 2960624210 Bacteria 6875384
959 2960637532 2960631154 Bacteria 6732508
960 2960645045 2960637947 Bacteria 7296468
961 2960647991 2960645483 Bacteria 7211087
962 2960658368 2960652885 Bacteria 7083688
963 2960660487 2960660292 Bacteria 7041660
964 2960672278 2960667422 Bacteria 6763020
965 2960677196 2960674078 Bacteria 6609048
966 2960686536 2960680706 Bacteria 6624464
967 2960690391 2960687367 Bacteria 6535474
968 2960698899 2960693952 Bacteria 6749742
969 2964613080 2964607997 Bacteria 7101408
970 2964618942 2964615318 Bacteria 6809089
971 2964627997 2964621998 Bacteria 6834995
972 2964632729 2964628898 Bacteria 7083044
973 2964639021 2964636051 Bacteria 7091832
974 2964649289 2964643177 Bacteria 6820887
975 2964650256 2964649959 Bacteria 6675118
976 2964661142 2964656573 Bacteria 7100150
977 2964668187 2964663802 Bacteria 7019362
978 2964675531 2964670856 Bacteria 6851364
979 2964683367 2964678106 Bacteria 6792020
980 2964690626 2964685014 Bacteria 6839111
981 2964694685 2964691889 Bacteria 6802758
982 2964700585 2964698721 Bacteria 6765331
983 2964709900 2964705432 Bacteria 7114648
984 2964717322 2964712639 Bacteria 6695970
985 2964722984 2964719344 Bacteria 7286602
986 2967667807 2967664464 Bacteria 6948836
987 2967675342 2967671571 Bacteria 7021409
988 2967684779 2967678726 Bacteria 7264382
989 2967691450 2967686174 Bacteria 6678622
990 2967694994 2967693043 Bacteria 6804451
991 2967705139 2967699805 Bacteria 6854538
992 2967712175 2967706974 Bacteria 7186053
993 2967714588 2967714385 Bacteria 7000047
994 2967722537 2967721400 Bacteria 7073753
995 2967730483 2967728569 Bacteria 6641507
996 2967739338 2967735183 Bacteria 6827012
997 2967748257 2967742019 Bacteria 6794534
998 2967754977 2967748971 Bacteria 6733771
999 2967759313 2967755722 Bacteria 6814706
1000 2967766465 2967762386 Bacteria 6923502
1001 2967774657 2967769361 Bacteria 6587838
1002 2967782539 2967775926 Bacteria 6738189
1003 2970022851 2970019648 Bacteria 7072033
1004 2970030504 2970026789 Bacteria 6785236
1005 2970037020 2970033650 Bacteria 7118744
1006 2970041205 2970040964 Bacteria 6731123
1007 2970052795 2970047711 Bacteria 7088379
1008 2970056752 2970054988 Bacteria 6611507
1009 2970067911 2970061556 Bacteria 7099761
1010 2970073946 2970068827 Bacteria 7123112
1011 2970081683 2970076120 Bacteria 6697332
1012 2970088475 2970082768 Bacteria 6183754
1013 2970091362 2970088815 Bacteria 6933825
1014 2970102010 2970095765 Bacteria 6936963
1015 2970105893 2970102677 Bacteria 6812532
1016 2970115666 2970109326 Bacteria 6863976
1017 2970117532 2970116247 Bacteria 6501857
1018 2970124316 2970122695 Bacteria 6625855
1019 2970131492 2970129317 Bacteria 6806560
1020 2970136699 2970136068 Bacteria 7207982
1021 2970147691 2970143518 Bacteria 6446480
1022 2970151780 2970149975 Bacteria 6779706
1023 2970163334 2970156795 Bacteria 7168044
1024 2970170012 2970164137 Bacteria 6861252
1025 2970175734 2970170962 Bacteria 6876229
1026 2970181974 2970177841 Bacteria 6768001
1027 2970191768 2970184632 Bacteria 7054431
1028 2970196650 2970191845 Bacteria 7032787
1029 2977519983 2977516862 Bacteria 6940108
1030 2977528388 2977523885 Bacteria 6960446
1031 2977535786 2977530762 Bacteria 6951399
1032 2977543891 2977537788 Bacteria 6929320
1033 2977549540 2977544691 Bacteria 6875412
1034 2977553602 2977551784 Bacteria 7125765
1035 2977564820 2977558990 Bacteria 6863948
1036 2977571826 2977565890 Bacteria 6901543
1037 2977574587 2977572785 Bacteria 6763888
1038 2977584529 2977579622 Bacteria 6772100
1039 2978973211 2978969890 Bacteria 5400756
1040 2979093144 2979089926 Bacteria 5670289
1041 2979099469 2979095461 Bacteria 5669583
1042 2979105112 2979100975 Bacteria 5423623
1043 2984513047 2984509177 Bacteria 5274802
1044 2984520589 2984518228 Bacteria 5277463
1045 2984539883 2984537506 Bacteria 5277481
1046 2984557020 2984555340 Bacteria 4247089
1047 2984568670 2984564862 Bacteria 4339992
1048 2984591460 2984587000 Bacteria 5263363
1049 2984602090 2984601300 Bacteria 5455244
1050 2989351490 2989349275 Bacteria 6349068
1051 2989772712 2989771324 Bacteria 5605128
1052 2989777344 2989776772 Bacteria 4843317
1053 2993359664 2993356040 Bacteria 4247105
1054 2996888434 2996887358 Bacteria 5795980
1055 2996893353 2996893221 Bacteria 5823108
1056 3003931871 3003930520 Bacteria 5667563
1057 3005411151 3005409236 Bacteria 7188837
1058 3005422889 3005416602 Bacteria 7064308
1059 3005446102 3005445848 Bacteria 6906074
1060 639646568 639633055 Bacteria 7751309
1061 643824464 643692032 Bacteria 6891900
1062 648741578 648276728 Bacteria 6968865
1063 650738967 650716007 Bacteria 5573770
1064 8002287269 8002285264 Bacteria 6717907
1065 8003572599 8003570095 Bacteria 5747666
1066 8003992372 8003992118 Bacteria 7266902
1067 8003999701 8003999396 Bacteria 7063185
1068 8005247468 8005246636 Bacteria 4933972
1069 8005261006 8005258706 Bacteria 6184835
1070 8005278756 8005275841 Bacteria 6929066
1071 8005289090 8005282627 Bacteria 6675747
1072 8005291164 8005289223 Bacteria 6634003
1073 8005301469 8005301065 Bacteria 6614431
1074 8005309276 8005307578 Bacteria 7395396
1075 8005321575 8005314921 Bacteria 7072929
1076 8005322961 8005321885 Bacteria 5795980
1077 8005377516 8005376324 Bacteria 6590079
1078 8005387378 8005382845 Bacteria 6732062
1079 8005400044 8005395548 Bacteria 6806915
1080 8005432850 8005430974 Bacteria 6689030
1081 8005460928 8005460587 Bacteria 7157962
1082 8005484867 8005484373 Bacteria 6297373
1083 8005498580 8005497431 Bacteria 6477605
1084 8005543690 8005542996 Bacteria 7077758
1085 8005560541 8005556819 Bacteria 6908598
1086 8005564001 8005563573 Bacteria 7153261
1087 8005576840 8005570704 Bacteria 6957481
1088 8005619772 8005619151 Bacteria 7030230
1089 8005628344 8005626139 Bacteria 6534237
1090 8005649561 8005645114 Bacteria 6950293
1091 8005660701 8005658619 Bacteria 4500593
1092 8005669991 8005668836 Bacteria 6953162
1093 8005685196 8005682033 Bacteria 6726518
1094 8005690185 8005688590 Bacteria 6610080
1095 8005699335 8005695170 Bacteria 6912330
1096 8018133040 8018127388 Bacteria 7351159
1097 8018153007 8018150411 Bacteria 5549903
1098 8018168942 8018163183 Bacteria 7277977
1099 8018178882 8018176218 Bacteria 6896178
1100 8023684322 8023680758 Bacteria 7729763
1101 8024480194 8024479707 Bacteria 6954785
1102 8024491492 8024486573 Bacteria 6540512
1103 8024501684 8024501048 Bacteria 6427847
1104 8046770783 8046767195 Bacteria 7547379
1105 8049293398 8049293176 Bacteria 6128433
1106 8054461241 8054460903 Bacteria 4872905
1107 8054562309 8054558443 Bacteria 5204801
1108 8055435669 8055431914 Bacteria 4551896
1109 8056375553 8056375014 Bacteria 7006639
1110 8056385867 8056382006 Bacteria 6408074
1111 8056878964 8056875544 Bacteria 4355797
1112 8057577755 8057575449 Bacteria 7367519
1113 8057875967 8057874678 Bacteria 7494653
1114 JGI24740J21852_10000016
1115 JGI25155J39150_1000157
1116 JGI25156J39149_1000029
1117 JGI25162J39368_1000169
1118 JGI25162J39368_1000508
1119 JGI25154J39366_1000286
1120 JGI25158J39367_1000022
1121 JGI25157J39369_1000247
1122 JGI25152J39213_1000754
1123 JGI25152J39213_1006226
1124 JGI25152J39213_1006373
1125 JGI25152J39213_1007385
1126 JGI25152J39213_1011673
1127 JGI25150J39212_1000012
1128 JGI25150J39212_1011391
1129 JGI25159J45721_1000137
1130 JGI25159J45721_1000730
1131 JGI25159J45721_1003596
1132 JGI25151J46595_10000025
1133 JGI25151J46595_10008949
1134 JGI25151J46595_10014484
1135 JGI25151J46595_10019714
1136 JGI25151J46595_10020686
1137 JGI25165J46597_1000355
1138 JGI25165J46597_1000491
1139 JGI25165J46597_1002805
1140 JGI25165J46597_1002982
1141 JGI25153J46596_10001788
1142 JGI25153J46596_10005320
1143 JGI25153J46596_10011406
1144 JGI25153J46596_10014934
1145 rootH2_10020588
1146 rootL2_10000316
1147 JGI25160J50197_1000003
1148 JGI25160J50197_1000041
1149 JGI25160J50197_1004302
1150 JGI25160J50197_1004984
1151 JGI25160J50197_1008638
1152 JGI25161J50226_1000002
1153 JGI25161J50226_1000143
1154 JGI25161J50226_1000493
1155 JGI25161J50226_1005407
1156 Ga0055539_1007704
1157 Ga0055526_1011121
1158 Ga0055526_1015428
1159 Ga0055526_1019108
1160 Ga0055526_1030826
1161 Ga0055524_1000776
1162 Ga0055524_1013963
1163 Ga0055524_1018649
1164 Ga0055524_1021942
1165 Ga0055524_1023588
1166 Ga0055536_1003218
1167 Ga0055536_1010563
1168 Ga0055528_1000604
1169 Ga0055528_1001318
1170 Ga0055528_1007277
1171 Ga0055528_1007971
1172 Ga0055528_1020008
1173 Ga0055528_1032103
1174 Ga0055530_10023535
1175 Ga0055540_1000249
1176 Ga0055540_1001900
1177 Ga0055540_1009280
1178 Ga0055540_1011060
1179 Ga0055531_10002859
1180 Ga0058692_1000651
1181 Ga0058692_1006563
1182 Ga0058692_1013059
1183 Ga0055543_1000008
1184 Ga0055543_1000158
1185 Ga0055543_1000263
1186 Ga0055543_1002397
1187 Ga0065165_1000031
1188 Ga0065165_1000084
1189 Ga0065165_1032974
1190 Ga0070670_100000160
1191 Ga0070689_100150898
1192 Ga0070669_100312902
1193 Ga0070671_100071497
1194 Ga0068853_100005585
1195 Ga0068853_100716037
1196 Ga0070665_100006971
1197 Ga0070665_100030724
1198 Ga0070665_100068975
1199 Ga0070665_100183379
1200 Ga0068855_100030372
1201 Ga0068855_100356221
1202 Ga0068855_100694160
1203 Ga0068854_100010614
1204 Ga0068856_100023203
1205 Ga0068852_100067238
1206 Ga0068851_10057716
1207 Ga0081455_10120275
1208 Ga0075365_10002780
1209 Ga0075365_10073691
1210 Ga0075368_10033956
1211 Ga0075364_10001052
1212 Ga0075362_10049289
1213 Ga0075367_10020506
1214 Ga0075367_10078712
1215 Ga0075369_10008794
1216 Ga0075369_10026093
1217 Ga0075366_10007690
1218 Ga0075370_10046246
1219 Ga0075370_10081184
1220 Ga0068871_100241737
1221 Ga0068865_100056815
1222 Ga0079104_1000452
1223 Ga0099826_10000109
1224 Ga0099826_10052386
1225 Ga0105251_10049597
1226 Ga0105240_10000460
1227 Ga0105240_10033018
1228 Ga0105240_10147525
1229 Ga0105240_10406539
1230 Ga0105245_10297941
1231 Ga0105243_10189748
1232 Ga0105241_10082735
1233 Ga0105241_10111945
1234 Ga0105241_10551437
1235 Ga0105237_10000203
1236 Ga0105237_10000814
1237 Ga0105237_10003204
1238 Ga0105237_10039891
1239 Ga0105237_10277405
1240 Ga0105238_10004247
1241 Ga0105238_10232263
1242 Ga0123341_1000040
1243 Ga0123342_1014285
1244 Ga0123342_1024557
1245 Ga0105239_10000961
1246 Ga0105239_10048550
1247 Ga0105239_10065740
1248 Ga0105239_10095969
1249 Ga0105239_10218730
1250 Ga0157322_1000175
1251 Ga0157373_10000975
1252 Ga0157373_10003509
1253 Ga0157371_10000004
1254 Ga0157371_10003340
1255 Ga0157370_10000185
1256 Ga0157370_10000952
1257 Ga0157370_10075698
1258 Ga0157369_10116422
1259 Ga0157369_10284036
1260 Ga0157369_10371908
1261 Ga0171463_1001
1262 Ga0157374_10015143
1263 Ga0163163_10254834
1264 Ga0182008_10027245
1265 Ga0182007_10000689
1266 Ga0182005_1006222
1267 Ga0183363_1003
1268 Ga0183363_1032
1269 Ga0163161_10142209
1270 Ga0214544_1000012
1271 Ga0214542_1000011
1272 Ga0214542_1015274
1273 Ga0214543_1000004
1274 Ga0214543_1000259
1275 Ga0228711_1000019
1276 Ga0228710_1000022
1277 Ga0209435_100011
1278 Ga0209436_100461
1279 Ga0209672_104444
1280 Ga0209563_101710
1281 Ga0207427_102165
1282 Ga0209437_100056
1283 Ga0209437_100196
1284 Ga0207425_1000012
1285 Ga0207425_1002334
1286 Ga0207425_1010306
1287 Ga0209646_1000024
1288 Ga0209026_1000030
1289 Ga0209677_100765
1290 Ga0209148_1005457
1291 Ga0209759_1000011
1292 Ga0209129_1000081
1293 Ga0209129_1000105
1294 Ga0209129_1001073
1295 Ga0209129_1001589
1296 Ga0209129_1001943
1297 Ga0209129_1005767
1298 Ga0209129_1008820
1299 Ga0209233_1000037
1300 Ga0209233_1000071
1301 Ga0209233_1000243
1302 Ga0209233_1001636
1303 Ga0209673_1000015
1304 Ga0209673_1000709
1305 Ga0209673_1002913
1306 Ga0209673_1003862
1307 Ga0209673_1005381
1308 Ga0209673_1006637
1309 Ga0209673_1018802
1310 Ga0209130_1000002
1311 Ga0209130_1000005
1312 Ga0209130_1000088
1313 Ga0209130_1011228
1314 Ga0209130_1019596
1315 Ga0209675_1005664
1316 Ga0209676_1004283
1317 Ga0209025_1000024
1318 Ga0209025_1000037
1319 Ga0209025_1000060
1320 Ga0209025_1000295
1321 Ga0209025_1000574
1322 Ga0209025_1004420
1323 Ga0209025_1006666
1324 Ga0209025_1021284
1325 Ga0209025_1062770
1326 Ga0209564_1000093
1327 Ga0209564_1000576
1328 Ga0209564_1000744
1329 Ga0209564_1003315
1330 Ga0209564_1005971
1331 Ga0209564_1022275
1332 Ga0209564_1022639
1333 Ga0209564_1030561
1334 Ga0209758_1000046
1335 Ga0209758_1000441
1336 Ga0209758_1000575
1337 Ga0209758_1000810
1338 Ga0209758_1001120
1339 Ga0209758_1013969
1340 Ga0209758_1015725
1341 Ga0209758_1038113
1342 Ga0209050_1005438
1343 Ga0209256_1000027
1344 Ga0209256_1000646
1345 Ga0209256_1003123
1346 Ga0209256_1004089
1347 Ga0209256_1004576
1348 Ga0209256_1005525
1349 Ga0209256_1006239
1350 Ga0209256_1011971
1351 Ga0209256_1018733
1352 Ga0209256_1029324
1353 Ga0207426_1000012
1354 Ga0207426_1000013
1355 Ga0207426_1000015
1356 Ga0207426_1000063
1357 Ga0207426_1000172
1358 Ga0207426_1001042
1359 Ga0209051_1000435
1360 Ga0209051_1001495
1361 Ga0209051_1002059
1362 Ga0209051_1013785
1363 Ga0209051_1033792
1364 Ga0209051_1033794
1365 Ga0209051_1035257
1366 Ga0209257_1000598
1367 Ga0209257_1001343
1368 Ga0209257_1015925
1369 Ga0207705_10101849
1370 Ga0207695_10000036
1371 Ga0207695_10002526
1372 Ga0207695_10014432
1373 Ga0207695_10033067
1374 Ga0207671_10000177
1375 Ga0207671_10000517
1376 Ga0207694_10014209
1377 Ga0207650_10000391
1378 Ga0207644_10054057
1379 Ga0207704_10004867
1380 Ga0207667_10025939
1381 Ga0207667_10055436
1382 Ga0207667_10213721
1383 Ga0207640_10009208
1384 Ga0207702_10009604
1385 Ga0207702_10433469
1386 Ga0207698_10033932
1387 Ga0209281_1000200
1388 Ga0209281_1000227
1389 Ga0209281_1000488
1390 Ga0209371_1000009
1391 Ga0209371_1000315
1392 Ga0209371_1000424
1393 Ga0209371_1001877
1394 Ga0209282_1000042
1395 Ga0209282_1002131
1396 Ga0209813_10019163
1397 Ga0209813_10020410
1398 Ga0268266_10000343
1399 Ga0268266_10027728
1400 Ga0268266_10043210
1401 Ga0268266_10075692
1402 Ga0307515_10000121
1403 Ga0307515_10001309
1404 Ga0307515_10001439
1405 Ga0307515_10048980
1406 Ga0307515_10314605
1407 Ga0268256_1000010
1408 Ga0268256_1001516
1409 Ga0268256_1003952
1410 Ga0316182_1324402
1411 Ga0307513_10002360
1412 Ga0307513_10013648
1413 Ga0307513_10195090
1414 Ga0307408_100031751
1415 Ga0316579_10096290
1416 Ga0307516_10032356
1417 Ga0307405_10002866
1418 Ga0307405_10018812
1419 Ga0307406_10004188
1420 Ga0307406_10043976
1421 Ga0307412_10000394
1422 Ga0307412_10082914
1423 Ga0307412_10220245
1424 Ga0315914_1000009
1425 Ga0307409_100066807
1426 Ga0307414_10000147
1427 Ga0307414_10036914
1428 Ga0307414_10176721
1429 Ga0307510_10144528
1430 Ga0307510_10237844
1431 Ga0315913_1000015
1432 Ga0315915_1000013
1433 Ga0373927_0000086
1434 Ga0373925_0008735
1435 Ga0395899_0098510
1436 Ga0395900_0098655
1437 Ga0395898_0129690
1438 Ga0395905_0000775
1439 Ga0395905_0002869
1440 Ga0395901_0241671
1441 Ga0400488_40386
1442 Ga0400483_210922
1443 Ga0439436_0019510
1444 Ga0439465_0005470
1445 Ga0451795_1599653
1446 Ga0451839_0284469
1447 Ga0451841_0185773
1448 Ga0451845_0485343
1449 Ga0451855_0148620
1450 Ga0439445_0017452
1451 Ga0439445_0021883
1452 Ga0439449_0010782
1453 Ga0439462_0011190
1454 Ga0450906_006429
1455 Ga0450918_003188
1456 Ga0466963_0082292
1457 Ga0466968_0106166
1458 Ga0451576_0012411
1459 Ga0495638_0000788
1460 Ga0495650_0039550
1461 Ga0495605_0007669
1462 Ga0495605_0024665
1463 Ga0495662_0031958
1464 Ga0495607_0023280
1465 Ga0495607_0077205
1466 Ga0495583_0034401
1467 Ga0495606_0002833
1468 Ga0495610_0005023
1469 Ga0495610_0106832
1470 Ga0495620_0026059
1471 Ga0495631_0015169
1472 Ga0495631_0076091
1473 Ga0495632_0015112
1474 Ga0495632_0043000
1475 Ga0495648_0078617
1476 Ga0495654_0000321
1477 Ga0495640_0098569
1478 Ga0495609_0025818
1479 Ga0495597_0005914
1480 Ga0495622_0043836
1481 Ga0495633_0016323
1482 Ga0495668_0003954
1483 Ga0495611_0010307
1484 Ga0495625_0005054
1485 Ga0495625_0064844
1486 Ga0495635_0043983
1487 Ga0495661_0107348
1488 Ga0495588_0000622
1489 Ga0495588_0024360
1490 Ga0495657_0087658
1491 Ga0495658_0125100
1492 Ga0495670_0033964
1493 Ga0495670_0110482
1494 Ga0495671_0052781
1495 Ga0495671_0122081
1496 Ga0495604_0113830
1497 Ga0495672_0107347
1498 Ga0495683_0144195
1499 Ga0495687_009034
1500 Ga0495681_0002829
1501 Ga0495686_0000458
1502 Ga0495686_0039525
1503 Ga0495686_0054506
1504 Ga0495686_0194815
1505 Ga0496100_0066239
1506 Ga0496102_0007240
1507 Ga0496103_0011291
1508 Ga0496104_0064887
1509 Ga0496106_0017682
1510 Ga0496110_0119904
1511 Ga0496111_0004636
1512 Ga0496113_0120442
1513 Ga0496116_0000100
1514 Ga0496116_0010591
1515 Ga0496116_0034978
1516 Ga0496116_0040518
1517 Ga0496116_0049931
1518 Ga0496116_0056547
1519 Ga0496116_0164571
1520 Ga0496117_0000002
1521 Ga0496117_0001791
1522 Ga0496117_0003238
1523 Ga0496117_0027534
1524 Ga0496117_0047858
1525 Ga0496117_0048598
1526 Ga0496117_0060042
1527 Ga0496118_0001493
1528 Ga0496118_0006723
1529 Ga0496118_0007119
1530 Ga0496118_0030242
1531 Ga0496118_0101278
1532 Ga0496119_0021672
1533 Ga0496120_0000021
1534 Ga0496120_0018092
1535 Ga0496121_0000001
1536 Ga0496121_0001709
1537 Ga0496121_0002141
1538 Ga0496121_0012257
1539 Ga0496121_0012986
1540 Ga0496121_0026205
1541 Ga0496121_0078597
1542 Ga0496121_0081281
1543 Ga0496121_0103836
1544 Ga0496121_0190280
1545 Ga0496122_0000001
1546 Ga0496122_0000147
1547 Ga0496122_0001112
1548 Ga0496122_0004207
1549 Ga0496122_0013026
1550 Ga0496122_0047680
1551 Ga0496122_0053134
1552 Ga0496122_0063563
1553 Ga0496122_0064956
1554 Ga0496122_0166022
1555 Ga0496123_0000001
1556 Ga0496123_0000158
1557 Ga0496123_0000910
1558 Ga0496123_0060370
1559 Ga0496123_0069336
1560 Ga0496123_0089386
1561 Ga0496123_0124760
1562 Ga0496124_0000063
1563 Ga0496124_0000551
1564 Ga0496124_0008733
1565 Ga0496124_0021178
1566 Ga0496124_0037083
1567 Ga0496124_0049047
1568 Ga0496124_0050127
1569 Ga0496124_0060239
1570 Ga0496124_0168106
1571 Ga0496124_0186404
1572 Ga0496124_0260101
1573 Ga0496125_0000001
1574 Ga0496125_0000981
1575 Ga0496125_0025057
1576 Ga0496125_0029800
1577 Ga0496125_0032809
1578 Ga0496125_0055609
1579 Ga0496126_0000094
1580 Ga0496126_0000195
1581 Ga0496126_0015337
1582 Ga0496126_0052315
1583 Ga0496126_0054690
1584 Ga0496126_0096523
1585 Ga0495682_0020262
1586 Ga0501031_0019562
1587 Ga0501032_0035214
1588 Ga0501033_0000396
1589 Ga0501033_0008788
1590 Ga0501034_0012395
1591 Ga0501034_0116860
1592 Ga0501034_0169425
1593 Ga0501034_0230224
1594 Ga0501034_0252080
1595 Ga0501037_0148425
1596 Ga0501043_0016875
1597 Ga0501046_0052880
1598 Ga0501047_0195815
1599 Ga0501047_0210632
1600 Ga0501047_0249795
1601 Ga0501068_0100704
1602 Ga0501070_0079005
1603 Ga0501074_0324806
1604 Ga0501223_000256
1605 Ga0501224_000034
1606 Ga0501233_002460
1607 Ga0501225_0000865
1608 Ga0501083_0082272
1609 Ga0501280_004240
1610 Ga0501035_0000647
1611 Ga0501035_0007015
1612 Ga0501035_0118102
1613 Ga0501044_0020415
1614 Ga0501044_0089814
1615 Ga0501044_0138692
1616 Ga0501226_000038
1617 nmdc:mga03n38_99294_c1
1618 nmdc:mga00v17_140754_c1
1619 nmdc:mga00v17_39_c1
1620 nmdc:mga00v17_48_c1
1621 nmdc:mga0yw44_35102_c1
1622 nmdc:mga0yw44_439_c1
1623 nmdc:mga04h51_1693_c1
1624 nmdc:mga0sz30_287_c1
1625 nmdc:mga0sz30_69478_c1
1626 Ga0500610_0029107
1627 Ga0500578_0085656
1628 Ga0500644_0003697
1629 Ga0500557_019472
1630 Ga0500560_000754
1631 Ga0500560_073441
1632 Ga0500569_014925
1633 Ga0500572_003242
1634 Ga0500593_068618
1635 Ga0500607_099280
1636 Ga0500608_030758
1637 Ga0500618_000119
1638 Ga0500618_000359
1639 Ga0500559_0006632
1640 Ga0500559_0007875
1641 Ga0500561_0000213
1642 Ga0500568_0008632
1643 Ga0500568_0020058
1644 Ga0500616_0002453
1645 Ga0500616_0002986
1646 Ga0500622_0002012
1647 Ga0500622_0013526
1648 Ga0500622_0019253
1649 Ga0500627_0019420
1650 Ga0500634_0000017
1651 Ga0500634_0049992
1652 Ga0500636_0000006
1653 Ga0500636_0075104
1654 Ga0501082_0072834
1655 2643918320
1656 2509106965
1657 2509375079
1658 2509388517
1659 2509444067
1660 2510131336
1661 2510303575
1662 2510841138
1663 2510897690
1664 2511134793
1665 2511171242
1666 2511184711
1667 2511195324
1668 2511500447
1669 2512531907
1670 2512972763
1671 2513570554
1672 2513580293
1673 2513585423
1674 2513596656
1675 2513602848
1676 2513616672
1677 2513634173
1678 2513707039
1679 2513864931
1680 2513885639
1681 2513904010
1682 2513910275
1683 2513929785
1684 2513996687
1685 2514005100
1686 2514020324
1687 2515110289
1688 2515607649
1689 2515634497
1690 2515643722
1691 2515657120
1692 2515743380
1693 2516204414
1694 2516891780
1695 2517038974
1696 2517079240
1697 2517093168
1698 2517409438
1699 2517568578
1700 2520375570
1701 2524450606
1702 2524458283
1703 2530647899
1704 2535515018
1705 2537876002
1706 2551677069
1707 2551684035
1708 2551696047
1709 2554246550
1710 2558866183
1711 2559293725
1712 2561467007
1713 2585164921
1714 2585203595
1715 2585223683
1716 2585229741
1717 2585255993
1718 2585265297
1719 2585273859
1720 2585280160
1721 2585326059
1722 2585330228
1723 2585385569
1724 2585391985
1725 2585398628
1726 2585529344
1727 2585533589
1728 2585539605
1729 2585545721
1730 2585553178
1731 2585560035
1732 2585819222
1733 2585837562
1734 2585844128
1735 2585900710
1736 2585905785
1737 2585994314
1738 2585998772
1739 2587979099
1740 2599332934
1741 2599419267
1742 2599606033
1743 2599719629
1744 2600191373
1745 2600374625
1746 2601609250
1747 2601746025
1748 2616297037
1749 2616310293
1750 2616553326
1751 2617380341
1752 2643806208
1753 2643812838
1754 2643855224
1755 2644004820
1756 2644047232
1757 2644070188
1758 2644103324
1759 2644144263
1760 2644190497
1761 2644199603
1762 2644206785
1763 2644241624
1764 2644297714
1765 2644306254
1766 2644330503
1767 2644377470
1768 2644420950
1769 2644454473
1770 2644480021
1771 2644492323
1772 2644496834
1773 2644519308
1774 2644542750
1775 2644611865
1776 2644650433
1777 2644655967
1778 2644671886
1779 2644692411
1780 2657681821
1781 2671113742
1782 2692317332
1783 2719179489
1784 2719384045
1785 2719663836
1786 2719730159
1787 2720490255
1788 2720611632
1789 2720618481
1790 2720629889
1791 2720773584
1792 2721145582
1793 2721157099
1794 2721162461
1795 2721397815
1796 2722838631
1797 2723025255
1798 2723558840
1799 2723565410
1800 2724036625
1801 2724042915
1802 2724088191
1803 2724102675
1804 2724108571
1805 2725948914
1806 2730106191
1807 2730162726
1808 2730296731
1809 2738801319
1810 2738948327
1811 2739036995
1812 2739306123
1813 2753461269
1814 2766062836
1815 2776911992
1816 2778179636
1817 2792582997
1818 2792623884
1819 2792629736
1820 2792638069
1821 2793282068
1822 2793295288
1823 2793316410
1824 2793323360
1825 2793326246
1826 2793334307
1827 2793341886
1828 2793348223
1829 2793355711
1830 2793361592
1831 2793364596
1832 2802720389
1833 2802726209
1834 2802731627
1835 2802739378
1836 2802742520
1837 2802749225
1838 2804750841
1839 2805929291
1840 2805932450
1841 2806047623
1842 2806055042
1843 2806062056
1844 2806067218
1845 2806076539
1846 2808986447
1847 2819245244
1848 2819556577
1849 2819608489
1850 2819640594
1851 2819686239
1852 2821123558
1853 2837651880
1854 2838020204
1855 2838025723
1856 2838029372
1857 2838037049
1858 2838044518
1859 2838051580
1860 2838064055
1861 2838071030
1862 2838075294
1863 2838663774
1864 2838672475
1865 2838677305
1866 2838680503
1867 2838691663
1868 2838695464
1869 2838703783
1870 2838708841
1871 2838716193
1872 2838720007
1873 2838726945
1874 2838733853
1875 2838739408
1876 2838747083
1877 2841843306
1878 2841846939
1879 2841856224
1880 2841860533
1881 2841866893
1882 2842079924
1883 2842112129
1884 2842120542
1885 2842127032
1886 2842132198
1887 2842145973
1888 2842148425
1889 2842152633
1890 2842162012
1891 2842169611
1892 2842172438
1893 2842176252
1894 2842185854
1895 2842189300
1896 2842192805
1897 2842202874
1898 2842207032
1899 2842213614
1900 2842218875
1901 2842224768
1902 2842235382
1903 2842238252
1904 2842248163
1905 2842253491
1906 2842262243
1907 2842268842
1908 2842276636
1909 2842280275
1910 2842286757
1911 2842293585
1912 2842299531
1913 2842306582
1914 2842312702
1915 2842322433
1916 2842343155
1917 2842360958
1918 2842367120
1919 2842370966
1920 2842379982
1921 2842387053
1922 2842399167
1923 2842403690
1924 2842410608
1925 2842417254
1926 2842424645
1927 2842432958
1928 2842439263
1929 2842445892
1930 2842451927
1931 2842467078
1932 2842473894
1933 2842476198
1934 2842487663
1935 2842492541
1936 2842500121
1937 2842502900
1938 2842509124
1939 2842517318
1940 2842521617
1941 2842923242
1942 2844165169
1943 2844456072
1944 2847417599
1945 2848992405
1946 2850079901
1947 2852388397
1948 2854898181
1949 2854919863
1950 2855828148
1951 2855839920
1952 2855873456
1953 2857521725
1954 2857531121
1955 2858803893
1956 2891375014
1957 2896391632
1958 2899792615
1959 2899805382
1960 2899846015
1961 2913298068
1962 2913313331
1963 2915980708
1964 2915990582
1965 2915998225
1966 2916001029
1967 2916011080
1968 2916015500
1969 2916025423
1970 2916031109
1971 2916036436
1972 2916045647
1973 2916053748
1974 2916057327
1975 2916063725
1976 2916069640
1977 2919101431
1978 2919116396
1979 2919166795
1980 2919172177
1981 2919408719
1982 2920763472
1983 2920823292
1984 2921207017
1985 2921212213
1986 2921242029
1987 2921248895
1988 2921257234
1989 2921260943
1990 2921266402
1991 2921288489
1992 2921294458
1993 2921300176
1994 2923557065
1995 2924149833
1996 2924156580
1997 2924163418
1998 2924170408
1999 2924177691
2000 2924183545
2001 2924190781
2002 2924199082
2003 2924205614
2004 2924209126
2005 2924215226
2006 2924228354
2007 2924232842
2008 2926757350
2009 2926761566
2010 2928029504
2011 2929138729
2012 2932405988
2013 2933007278
2014 2933015131
2015 2933573651
2016 2933587457
2017 2933594483
2018 2933601829
2019 2935895988
2020 2935907246
2021 2936369010
2022 2936378374
2023 2936383661
2024 2936997855
2025 2937007614
2026 2937014862
2027 2937022394
2028 2937023282
2029 2937034604
2030 2937041235
2031 2937045988
2032 2937051829
2033 2937062640
2034 2937068340
2035 2937074843
2036 2937078816
2037 2937089102
2038 2937095206
2039 2937104396
2040 2937112408
2041 2937119566
2042 2937126096
2043 2937131519
2044 2941500796
2045 2957382132
2046 2957388582
2047 2957393991
2048 2957399079
2049 2957403340
2050 2957412038
2051 2957418140
2052 2957423935
2053 2957434067
2054 2957442563
2055 2957447203
2056 2957455236
2057 2957462747
2058 2957466239
2059 2957473703
2060 2957479708
2061 2957484925
2062 2957496110
2063 2957500572
2064 2957508219
2065 2960589379
2066 2960594691
2067 2960603486
2068 2960608765
2069 2960614410
2070 2960621621
2071 2960628915
2072 2960637532
2073 2960645045
2074 2960647991
2075 2960658368
2076 2960660487
2077 2960672278
2078 2960677196
2079 2960686536
2080 2960690391
2081 2960698899
2082 2964613080
2083 2964618942
2084 2964627997
2085 2964632729
2086 2964639021
2087 2964649289
2088 2964650256
2089 2964661142
2090 2964668187
2091 2964675531
2092 2964683367
2093 2964690626
2094 2964694685
2095 2964700585
2096 2964709900
2097 2964717322
2098 2964722984
2099 2967667807
2100 2967675342
2101 2967684779
2102 2967691450
2103 2967694994
2104 2967705139
2105 2967712175
2106 2967714588
2107 2967722537
2108 2967730483
2109 2967739338
2110 2967748257
2111 2967754977
2112 2967759313
2113 2967766465
2114 2967774657
2115 2967782539
2116 2970022851
2117 2970030504
2118 2970037020
2119 2970041205
2120 2970052795
2121 2970056752
2122 2970067911
2123 2970073946
2124 2970081683
2125 2970088475
2126 2970091362
2127 2970102010
2128 2970105893
2129 2970115666
2130 2970117532
2131 2970124316
2132 2970131492
2133 2970136699
2134 2970147691
2135 2970151780
2136 2970163334
2137 2970170012
2138 2970175734
2139 2970181974
2140 2970191768
2141 2970196650
2142 2977519983
2143 2977528388
2144 2977535786
2145 2977543891
2146 2977549540
2147 2977553602
2148 2977564820
2149 2977571826
2150 2977574587
2151 2977584529
2152 2978973211
2153 2979093144
2154 2979099469
2155 2979105112
2156 2984513047
2157 2984520589
2158 2984539883
2159 2984557020
2160 2984568670
2161 2984591460
2162 2984602090
2163 2989351490
2164 2989772712
2165 2989777344
2166 2993359664
2167 2996888434
2168 2996893353
2169 3003931871
2170 3005411151
2171 3005422889
2172 3005446102
2173 639646568
2174 643824464
2175 648741578
2176 650738967
2177 8002287269
2178 8003572599
2179 8003992372
2180 8003999701
2181 8005247468
2182 8005261006
2183 8005278756
2184 8005289090
2185 8005291164
2186 8005301469
2187 8005309276
2188 8005321575
2189 8005322961
2190 8005377516
2191 8005387378
2192 8005400044
2193 8005432850
2194 8005460928
2195 8005484867
2196 8005498580
2197 8005543690
2198 8005560541
2199 8005564001
2200 8005576840
2201 8005619772
2202 8005628344
2203 8005649561
2204 8005660701
2205 8005669991
2206 8005685196
2207 8005690185
2208 8005699335
2209 8018133040
2210 8018153007
2211 8018168942
2212 8018178882
2213 8023684322
2214 8024480194
2215 8024491492
2216 8024501684
2217 8046770783
2218 8049293398
2219 8054461241
2220 8054562309
2221 8055435669
2222 8056375553
2223 8056385867
2224 8056878964
2225 8057577755
2226 8057875967

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01739

CheR

CheR methyltransferase, SAM binding domain

100

298

0.97

PF03705

CheR_N

CheR methyltransferase, all-alpha domain

33

85

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1bc5-assembly1.cif.gz_A chemotaxis receptor recognition by protein methyltransferase cher 0.8812 16 291
1bc5-assembly1.cif.gz_A chemotaxis receptor recognition by protein methyltransferase cher 0.875 16 291
5xlx-assembly1.cif.gz_D crystal structure of the c-terminal domain of cher1 containing sah 0.8685 94 291
5xlx-assembly1.cif.gz_D crystal structure of the c-terminal domain of cher1 containing sah 0.8522 94 291
7phf-assembly1.cif.gz_B chimeric carminomycin-4-o-methyltransferase (dnrk) with regions from 10-hydroxylase rdmb and 10-decarboxylase tamk 0.8309 225 267
ID Description Score Start End Superfamily
1bc5A01 Mainly Alpha;Orthogonal Bundle;Chemotaxis Receptor Methyltransferase Cher; domain 1;Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.9014 16 90 1.10.155.10
5ftwA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9011 92 291 3.40.50.150
1bc5A01 Mainly Alpha;Orthogonal Bundle;Chemotaxis Receptor Methyltransferase Cher; domain 1;Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.8901 16 90 1.10.155.10
5ftwA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8877 92 291 3.40.50.150
1af7A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8755 91 291 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A7W6J3H2-F1-model_v4 Chemotaxis protein methyltransferase (EC 2.1.1.80) 0.9833 6 295 GO:0008983
GO:0032259
AF-A0A357RVJ2-F1-model_v4 deleted 0.9825 205 291
AF-A0A512HDE6-F1-model_v4 Chemotaxis protein methyltransferase (EC 2.1.1.80) 0.9796 1 295 GO:0008983
GO:0032259
AF-A0A7W6Q8U9-F1-model_v4 Chemotaxis protein methyltransferase (EC 2.1.1.80) 0.9768 2 300 GO:0008983
GO:0032259
AF-A0A7W5PJU2-F1-model_v4 deleted 0.9763 2 300

Map