F490274
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1114 | 391 | 2228 | 467 |
Family's Representative Sequence
| Representative Sequence | 3300006852|Ga0075433_10016860|Ga0075433_100168605 |
| Length | 534 |
| Sequence | VLWSRLDVLAYAQPASDHVILRGVPNMTALNARTEEATMAATTRSVRAQRAGGDIERDAPFASAWRRAHMSVDERVGRGRAARNEAPRSSHGHWEAAPDRPDPISLLEEQAKSRVAELVPIRYGRMLASPFTFYRGAAAIMAADLAGTPTSGVTVQLCGDAHLSNFGLFGTPERRLLFDINDFDETLPGPWEWDVKRLAASFEVMGREGGFSPADRRAVVMAGVRQYREKMGHAAKMGTLGAWYDQLDAQMLLKLVNEETRLRRLRRKEALTAGRRVAQARTRDSIRVFAKRARELNGELRIVADPPLIVPIEDLVIPGSEWENPTPLIKKLLSTYRRTLGRQGHPLEEFRYVHAARKVVGVGSVGTRCYLLLLMGRDRGDPLFLQVKEAQASVLEPFLGRSTYPHHGERIVVGQRLMQGATDIFLGWQRIRGLDGMTRDYYVRQFHDWKGGATVENLKMPGATFYARLCAATLARAHARWGDRIAIAAYLGKGDAFDRAIADFSVIYADQNERDYDSFRAAVNSGRLSAQTGI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 4 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 5 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 68 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 69 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 70 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 71 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 73 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 74 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 80 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 81 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 86 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 87 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 117 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 120 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 124 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 125 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 186 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 190 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 191 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 192 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 193 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 194 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 195 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 196 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 197 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 198 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 199 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 200 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 201 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 202 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 203 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 204 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 205 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 206 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 207 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 208 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 209 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 210 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 211 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 212 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 213 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 214 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 215 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 216 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 217 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 218 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 219 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 220 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 221 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 222 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 223 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 224 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 225 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 226 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 227 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 228 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 229 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 230 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 231 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 232 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 234 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 235 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 236 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 237 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 238 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 239 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 240 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 241 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 242 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 243 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 244 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 245 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 246 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 247 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 248 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 249 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 250 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 251 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 252 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 253 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 254 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 255 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 256 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 257 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 258 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 259 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 260 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 261 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 262 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 263 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 264 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 265 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 266 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 267 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 268 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 318 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 319 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 320 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 321 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 322 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 323 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 324 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 325 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 326 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 327 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 328 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 329 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 330 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 331 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 332 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 333 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 334 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 335 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 336 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 337 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 338 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 350 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 352 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 362 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 368 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 369 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 370 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 371 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 372 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 373 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 374 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 375 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 376 | 2523231044 | Gordonia rhizosphera NBRC 16068 | Isolate | Rhizosphere |
| 377 | 2684623219 | Planctomyces sp. SH-PL14 | Isolate | Unclassified |
| 378 | 2738541308 | Rhodococcus sp. OK551 | Isolate | Unclassified |
| 379 | 2739367857 | Flavobacterium sp. GV029 | Isolate | Unclassified |
| 380 | 2739367858 | Flavobacterium sp. GV028 | Isolate | Unclassified |
| 381 | 2757320536 | Microbacterium sp. NFIX05 | Isolate | Unclassified |
| 382 | 2811994882 | Terrabacter sp. SLBN-196 | Isolate | Unclassified |
| 383 | 2818991458 | Terrabacter sp. 3211 | Isolate | Rhizosphere |
| 384 | 2818991462 | Terrabacter sp. 3264 | Isolate | Rhizosphere |
| 385 | 2818991469 | Terrabacter lapilli 3265 | Isolate | Rhizosphere |
| 386 | 2857618242 | Flavobacterium sp. R-74482 | Isolate | Unclassified |
| 387 | 2870628048 | Microbacterium thalassium DSM 12511 | Isolate | Rhizosphere |
| 388 | 2919034639 | Paenarthrobacter nitroguajacolicus 247 | Isolate | Rhizosphere |
| 389 | 2919191525 | Flavobacterium sp. 2755 | Isolate | Rhizosphere |
| 390 | 2939657138 | Conyzicola nivalis 2857 | Isolate | Rhizosphere |
| 391 | 8054307821 | Flavobacterium soyae SCIV07 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.58 |
| Metatranscriptomes | 0.99 |
| Isolates | 1.44 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.35 |
| Nodule | 0.09 |
| Rhizoplane | 11.58 |
| Rhizosphere | 84.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.62 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0075433_10016860 | 3300006852 | Bacteria | 6036 |
| 2 | JGI24740J21852_10000802 | 3300001979 | Bacteria | 13809 |
| 3 | JGI25151J46595_10000166 | 3300003187 | Bacteria | 85475 |
| 4 | JGI25407J50210_10006261 | 3300003373 | Bacteria | 2958 |
| 5 | Ga0058863_11944294 | 3300004799 | Bacteria | 1894 |
| 6 | Ga0058861_10082651 | 3300004800 | Bacteria | 2054 |
| 7 | Ga0070683_100000558 | 3300005329 | Bacteria | 26449 |
| 8 | Ga0070683_100002533 | 3300005329 | Bacteria | 14580 |
| 9 | Ga0070683_100028383 | 3300005329 | Bacteria | 5056 |
| 10 | Ga0070683_100039126 | 3300005329 | Bacteria | 4352 |
| 11 | Ga0070683_100149948 | 3300005329 | Bacteria | 2211 |
| 12 | Ga0068869_100021699 | 3300005334 | Bacteria | 4419 |
| 13 | Ga0070680_100059941 | 3300005336 | Bacteria | 3115 |
| 14 | Ga0070682_100000013 | 3300005337 | Bacteria | 254641 |
| 15 | Ga0070682_100020489 | 3300005337 | Unclassified | 3891 |
| 16 | Ga0070682_100062599 | 3300005337 | Bacteria | 2357 |
| 17 | Ga0070682_100134408 | 3300005337 | Bacteria | 1678 |
| 18 | Ga0070682_100143366 | 3300005337 | Bacteria | 1631 |
| 19 | Ga0068868_100132802 | 3300005338 | Bacteria | 2038 |
| 20 | Ga0068868_100180700 | 3300005338 | Bacteria | 1750 |
| 21 | Ga0070660_100011436 | 3300005339 | Bacteria | 6305 |
| 22 | Ga0070689_100033350 | 3300005340 | Bacteria | 3923 |
| 23 | Ga0070691_10000100 | 3300005341 | Bacteria | 25275 |
| 24 | Ga0070691_10012578 | 3300005341 | Bacteria | 3876 |
| 25 | Ga0070691_10014628 | 3300005341 | Bacteria | 3601 |
| 26 | Ga0070692_10011129 | 3300005345 | Bacteria | 4122 |
| 27 | Ga0070692_10018220 | 3300005345 | Bacteria | 3372 |
| 28 | Ga0070692_10107762 | 3300005345 | Bacteria | 1537 |
| 29 | Ga0070668_100015399 | 3300005347 | Bacteria | 5715 |
| 30 | Ga0070668_100027645 | 3300005347 | Bacteria | 4306 |
| 31 | Ga0070668_100037245 | 3300005347 | Bacteria | 3713 |
| 32 | Ga0070668_100065222 | 3300005347 | Bacteria | 2825 |
| 33 | Ga0070669_100014929 | 3300005353 | Bacteria | 5535 |
| 34 | Ga0070669_100104806 | 3300005353 | Bacteria | 2138 |
| 35 | Ga0070675_100001463 | 3300005354 | Bacteria | 17411 |
| 36 | Ga0070675_100013342 | 3300005354 | Bacteria | 6456 |
| 37 | Ga0070675_100086774 | 3300005354 | Bacteria | 2616 |
| 38 | Ga0070674_100139241 | 3300005356 | Bacteria | 1819 |
| 39 | Ga0070674_100150710 | 3300005356 | Bacteria | 1755 |
| 40 | Ga0070688_100038237 | 3300005365 | Bacteria | 2929 |
| 41 | Ga0070659_100000852 | 3300005366 | Bacteria | 22251 |
| 42 | Ga0070659_100012095 | 3300005366 | Bacteria | 6390 |
| 43 | Ga0070659_100012543 | 3300005366 | Bacteria | 6283 |
| 44 | Ga0070659_100065148 | 3300005366 | Bacteria | 2886 |
| 45 | Ga0070659_100132928 | 3300005366 | Bacteria | 2021 |
| 46 | Ga0070659_100183191 | 3300005366 | Unclassified | 1719 |
| 47 | Ga0070667_100000597 | 3300005367 | Bacteria | 35219 |
| 48 | Ga0070667_100183131 | 3300005367 | Bacteria | 1853 |
| 49 | Ga0070714_100001300 | 3300005435 | Bacteria | 18068 |
| 50 | Ga0070714_100003174 | 3300005435 | Bacteria | 12216 |
| 51 | Ga0070714_100004997 | 3300005435 | Bacteria | 10082 |
| 52 | Ga0070714_100006732 | 3300005435 | Bacteria | 8905 |
| 53 | Ga0070714_100019304 | 3300005435 | Bacteria | 5549 |
| 54 | Ga0070714_100019464 | 3300005435 | Bacteria | 5532 |
| 55 | Ga0070714_100042155 | 3300005435 | Bacteria | 3854 |
| 56 | Ga0070714_100046135 | 3300005435 | Bacteria | 3695 |
| 57 | Ga0070714_100133144 | 3300005435 | Bacteria | 2223 |
| 58 | Ga0070713_100001413 | 3300005436 | Bacteria | 15387 |
| 59 | Ga0070713_100005405 | 3300005436 | Bacteria | 8726 |
| 60 | Ga0070713_100032866 | 3300005436 | Bacteria | 4149 |
| 61 | Ga0070713_100044804 | 3300005436 | Bacteria | 3622 |
| 62 | Ga0070710_10000002 | 3300005437 | Bacteria | 290371 |
| 63 | Ga0070710_10000267 | 3300005437 | Bacteria | 24789 |
| 64 | Ga0070710_10022888 | 3300005437 | Bacteria | 3275 |
| 65 | Ga0070710_10028899 | 3300005437 | Bacteria | 2969 |
| 66 | Ga0070701_10010033 | 3300005438 | Bacteria | 4173 |
| 67 | Ga0070701_10073309 | 3300005438 | Bacteria | 1836 |
| 68 | Ga0070711_100000788 | 3300005439 | Bacteria | 16554 |
| 69 | Ga0070711_100003451 | 3300005439 | Bacteria | 9212 |
| 70 | Ga0070711_100011244 | 3300005439 | Bacteria | 5552 |
| 71 | Ga0070711_100025477 | 3300005439 | Bacteria | 3870 |
| 72 | Ga0070711_100031448 | 3300005439 | Bacteria | 3524 |
| 73 | Ga0070711_100049324 | 3300005439 | Bacteria | 2883 |
| 74 | Ga0070711_100050791 | 3300005439 | Bacteria | 2845 |
| 75 | Ga0070711_100054959 | 3300005439 | Bacteria | 2749 |
| 76 | Ga0070711_100077818 | 3300005439 | Bacteria | 2355 |
| 77 | Ga0070711_100107448 | 3300005439 | Bacteria | 2042 |
| 78 | Ga0070705_100009341 | 3300005440 | Bacteria | 4871 |
| 79 | Ga0070700_100005283 | 3300005441 | Bacteria | 6833 |
| 80 | Ga0070700_100010097 | 3300005441 | Bacteria | 5198 |
| 81 | Ga0070700_100018773 | 3300005441 | Bacteria | 3980 |
| 82 | Ga0070700_100052626 | 3300005441 | Bacteria | 2539 |
| 83 | Ga0070694_100004651 | 3300005444 | Bacteria | 8260 |
| 84 | Ga0070694_100076615 | 3300005444 | Bacteria | 2316 |
| 85 | Ga0070708_100184572 | 3300005445 | Bacteria | 1950 |
| 86 | Ga0070663_100002472 | 3300005455 | Bacteria | 10427 |
| 87 | Ga0070663_100036784 | 3300005455 | Bacteria | 3403 |
| 88 | Ga0070663_100132944 | 3300005455 | Bacteria | 1891 |
| 89 | Ga0070663_100134704 | 3300005455 | Bacteria | 1880 |
| 90 | Ga0070678_100040934 | 3300005456 | Bacteria | 3281 |
| 91 | Ga0070678_100183952 | 3300005456 | Bacteria | 1713 |
| 92 | Ga0070662_100013035 | 3300005457 | Bacteria | 5526 |
| 93 | Ga0070662_100047016 | 3300005457 | Bacteria | 3102 |
| 94 | Ga0070662_100049611 | 3300005457 | Bacteria | 3027 |
| 95 | Ga0070662_100063899 | 3300005457 | Bacteria | 2694 |
| 96 | Ga0070662_100137455 | 3300005457 | Bacteria | 1891 |
| 97 | Ga0070662_100154358 | 3300005457 | Bacteria | 1791 |
| 98 | Ga0070681_10014198 | 3300005458 | Bacteria | 7925 |
| 99 | Ga0068867_100002154 | 3300005459 | Bacteria | 13812 |
| 100 | Ga0068867_100008485 | 3300005459 | Bacteria | 7252 |
| 101 | Ga0070685_10007229 | 3300005466 | Bacteria | 5676 |
| 102 | Ga0070706_100025104 | 3300005467 | Bacteria | 5486 |
| 103 | Ga0070707_100138905 | 3300005468 | Bacteria | 2364 |
| 104 | Ga0070698_100031035 | 3300005471 | Bacteria | 5541 |
| 105 | Ga0070698_100037283 | 3300005471 | Bacteria | 5013 |
| 106 | Ga0070698_100259376 | 3300005471 | Bacteria | 1670 |
| 107 | Ga0070699_100000043 | 3300005518 | Bacteria | 127213 |
| 108 | Ga0070679_100041121 | 3300005530 | Bacteria | 4602 |
| 109 | Ga0070679_100122463 | 3300005530 | Bacteria | 2585 |
| 110 | Ga0070684_100006264 | 3300005535 | Bacteria | 9186 |
| 111 | Ga0070684_100010636 | 3300005535 | Bacteria | 7297 |
| 112 | Ga0070684_100011666 | 3300005535 | Bacteria | 7007 |
| 113 | Ga0070684_100062282 | 3300005535 | Bacteria | 3267 |
| 114 | Ga0070697_100021855 | 3300005536 | Bacteria | 5073 |
| 115 | Ga0068853_100007231 | 3300005539 | Bacteria | 8893 |
| 116 | Ga0068853_100063625 | 3300005539 | Bacteria | 3195 |
| 117 | Ga0068853_100074408 | 3300005539 | Bacteria | 2963 |
| 118 | Ga0068853_100093895 | 3300005539 | Bacteria | 2642 |
| 119 | Ga0070672_100013162 | 3300005543 | Bacteria | 5834 |
| 120 | Ga0070686_100029552 | 3300005544 | Bacteria | 3335 |
| 121 | Ga0070686_100076181 | 3300005544 | Bacteria | 2208 |
| 122 | Ga0070686_100111680 | 3300005544 | Bacteria | 1863 |
| 123 | Ga0070695_100139300 | 3300005545 | Bacteria | 1680 |
| 124 | Ga0070696_100088208 | 3300005546 | Bacteria | 2204 |
| 125 | Ga0070696_100107322 | 3300005546 | Bacteria | 2008 |
| 126 | Ga0070693_100009311 | 3300005547 | Bacteria | 4881 |
| 127 | Ga0070665_100000106 | 3300005548 | Bacteria | 157315 |
| 128 | Ga0070665_100006680 | 3300005548 | Bacteria | 11731 |
| 129 | Ga0070665_100018108 | 3300005548 | Bacteria | 7067 |
| 130 | Ga0070665_100131441 | 3300005548 | Bacteria | 2505 |
| 131 | Ga0070665_100144277 | 3300005548 | Bacteria | 2384 |
| 132 | Ga0068855_100016708 | 3300005563 | Bacteria | 8826 |
| 133 | Ga0068855_100045286 | 3300005563 | Bacteria | 5203 |
| 134 | Ga0070664_100013358 | 3300005564 | Bacteria | 6688 |
| 135 | Ga0070664_100017902 | 3300005564 | Bacteria | 5817 |
| 136 | Ga0070664_100154820 | 3300005564 | Bacteria | 2025 |
| 137 | Ga0070664_100163711 | 3300005564 | Bacteria | 1969 |
| 138 | Ga0068857_100017156 | 3300005577 | Bacteria | 6341 |
| 139 | Ga0068857_100115106 | 3300005577 | Bacteria | 2419 |
| 140 | Ga0068854_100004234 | 3300005578 | Bacteria | 9034 |
| 141 | Ga0068854_100024072 | 3300005578 | Bacteria | 4165 |
| 142 | Ga0068856_100003506 | 3300005614 | Bacteria | 15837 |
| 143 | Ga0068856_100009718 | 3300005614 | Bacteria | 9344 |
| 144 | Ga0068856_100014872 | 3300005614 | Bacteria | 7512 |
| 145 | Ga0068856_100066493 | 3300005614 | Bacteria | 3562 |
| 146 | Ga0068856_100109819 | 3300005614 | Bacteria | 2754 |
| 147 | Ga0070702_100003799 | 3300005615 | Bacteria | 6824 |
| 148 | Ga0070702_100005715 | 3300005615 | Bacteria | 5821 |
| 149 | Ga0070702_100123530 | 3300005615 | Bacteria | 1624 |
| 150 | Ga0068852_100008106 | 3300005616 | Bacteria | 7710 |
| 151 | Ga0068852_100080517 | 3300005616 | Bacteria | 2888 |
| 152 | Ga0068852_100091270 | 3300005616 | Bacteria | 2725 |
| 153 | Ga0068852_100119796 | 3300005616 | Bacteria | 2407 |
| 154 | Ga0068864_100000024 | 3300005618 | Bacteria | 252632 |
| 155 | Ga0068864_100047627 | 3300005618 | Bacteria | 3683 |
| 156 | Ga0068866_10016127 | 3300005718 | Bacteria | 3333 |
| 157 | Ga0068861_100014414 | 3300005719 | Bacteria | 5549 |
| 158 | Ga0068861_100055131 | 3300005719 | Unclassified | 3030 |
| 159 | Ga0068861_100176098 | 3300005719 | Bacteria | 1776 |
| 160 | Ga0068870_10062911 | 3300005840 | Bacteria | 2000 |
| 161 | Ga0068870_10079616 | 3300005840 | Bacteria | 1808 |
| 162 | Ga0068863_100016249 | 3300005841 | Bacteria | 7141 |
| 163 | Ga0068863_100055706 | 3300005841 | Bacteria | 3744 |
| 164 | Ga0068863_100079728 | 3300005841 | Unclassified | 3101 |
| 165 | Ga0068858_100031114 | 3300005842 | Bacteria | 4955 |
| 166 | Ga0068858_100081825 | 3300005842 | Bacteria | 3001 |
| 167 | Ga0068860_100078060 | 3300005843 | Bacteria | 3149 |
| 168 | Ga0068860_100128723 | 3300005843 | Bacteria | 2428 |
| 169 | Ga0068860_100234091 | 3300005843 | Bacteria | 1785 |
| 170 | Ga0068862_100000366 | 3300005844 | Bacteria | 49032 |
| 171 | Ga0068862_100062940 | 3300005844 | Bacteria | 3192 |
| 172 | Ga0068862_100087848 | 3300005844 | Bacteria | 2704 |
| 173 | Ga0068862_100132971 | 3300005844 | Bacteria | 2202 |
| 174 | Ga0068862_100200344 | 3300005844 | Bacteria | 1800 |
| 175 | Ga0081455_10013896 | 3300005937 | Bacteria | 7914 |
| 176 | Ga0081455_10016343 | 3300005937 | Bacteria | 7169 |
| 177 | Ga0081538_10000023 | 3300005981 | Bacteria | 131101 |
| 178 | Ga0081540_1000181 | 3300005983 | Bacteria | 65791 |
| 179 | Ga0081540_1000757 | 3300005983 | Bacteria | 29739 |
| 180 | Ga0081540_1007808 | 3300005983 | Bacteria | 7570 |
| 181 | Ga0081540_1037492 | 3300005983 | Bacteria | 2568 |
| 182 | Ga0081539_10001052 | 3300005985 | Bacteria | 50554 |
| 183 | Ga0070717_10000006 | 3300006028 | Bacteria | 353403 |
| 184 | Ga0070717_10002252 | 3300006028 | Bacteria | 13525 |
| 185 | Ga0070717_10003906 | 3300006028 | Bacteria | 10722 |
| 186 | Ga0070717_10008176 | 3300006028 | Bacteria | 7808 |
| 187 | Ga0070717_10026014 | 3300006028 | Bacteria | 4664 |
| 188 | Ga0070717_10053450 | 3300006028 | Bacteria | 3329 |
| 189 | Ga0075363_100021934 | 3300006048 | Bacteria | 3224 |
| 190 | Ga0075364_10017590 | 3300006051 | Bacteria | 4469 |
| 191 | Ga0070715_10001599 | 3300006163 | Bacteria | 6675 |
| 192 | Ga0070716_100001363 | 3300006173 | Bacteria | 10842 |
| 193 | Ga0070716_100003719 | 3300006173 | Bacteria | 7223 |
| 194 | Ga0070712_100000003 | 3300006175 | Bacteria | 253696 |
| 195 | Ga0070712_100003227 | 3300006175 | Bacteria | 10049 |
| 196 | Ga0070712_100019601 | 3300006175 | Bacteria | 4415 |
| 197 | Ga0070712_100024148 | 3300006175 | Bacteria | 4024 |
| 198 | Ga0070712_100027943 | 3300006175 | Bacteria | 3769 |
| 199 | Ga0070712_100069626 | 3300006175 | Bacteria | 2511 |
| 200 | Ga0070712_100158695 | 3300006175 | Bacteria | 1745 |
| 201 | Ga0097621_100011114 | 3300006237 | Bacteria | 6622 |
| 202 | Ga0097621_100140573 | 3300006237 | Bacteria | 2063 |
| 203 | Ga0068871_100032952 | 3300006358 | Bacteria | 4097 |
| 204 | Ga0068871_100034036 | 3300006358 | Bacteria | 4040 |
| 205 | Ga0068871_100040731 | 3300006358 | Bacteria | 3722 |
| 206 | Ga0068871_100041886 | 3300006358 | Bacteria | 3673 |
| 207 | Ga0068871_100075188 | 3300006358 | Unclassified | 2788 |
| 208 | Ga0075428_100022812 | 3300006844 | Bacteria | 6926 |
| 209 | Ga0075428_100028236 | 3300006844 | Bacteria | 6205 |
| 210 | Ga0075428_100079512 | 3300006844 | Bacteria | 3578 |
| 211 | Ga0075428_100081909 | 3300006844 | Bacteria | 3521 |
| 212 | Ga0075428_100134561 | 3300006844 | Bacteria | 2688 |
| 213 | Ga0075430_100011868 | 3300006846 | Bacteria | 7415 |
| 214 | Ga0075430_100041483 | 3300006846 | Bacteria | 3893 |
| 215 | Ga0075430_100041844 | 3300006846 | Bacteria | 3876 |
| 216 | Ga0075430_100113457 | 3300006846 | Bacteria | 2259 |
| 217 | Ga0075431_100000685 | 3300006847 | Bacteria | 29059 |
| 218 | Ga0075431_100065005 | 3300006847 | Bacteria | 3767 |
| 219 | Ga0075431_100082299 | 3300006847 | Bacteria | 3322 |
| 220 | Ga0075433_10004165 | 3300006852 | Bacteria | 11227 |
| 221 | Ga0075433_10031502 | 3300006852 | Bacteria | 4534 |
| 222 | Ga0075433_10042932 | 3300006852 | Bacteria | 3924 |
| 223 | Ga0075433_10063711 | 3300006852 | Bacteria | 3230 |
| 224 | Ga0075434_100004695 | 3300006871 | Bacteria | 12345 |
| 225 | Ga0075434_100030794 | 3300006871 | Bacteria | 5286 |
| 226 | Ga0075434_100077166 | 3300006871 | Bacteria | 3326 |
| 227 | Ga0075434_100144366 | 3300006871 | Bacteria | 2400 |
| 228 | Ga0075434_100225994 | 3300006871 | Unclassified | 1891 |
| 229 | Ga0075434_100228529 | 3300006871 | Bacteria | 1880 |
| 230 | Ga0075429_100116021 | 3300006880 | Bacteria | 2341 |
| 231 | Ga0068865_100003061 | 3300006881 | Bacteria | 10003 |
| 232 | Ga0068865_100005688 | 3300006881 | Bacteria | 7573 |
| 233 | Ga0068865_100094754 | 3300006881 | Bacteria | 2173 |
| 234 | Ga0075436_100006626 | 3300006914 | Bacteria | 7936 |
| 235 | Ga0075436_100009259 | 3300006914 | Bacteria | 6738 |
| 236 | Ga0099824_1000332 | 3300006942 | Bacteria | 51674 |
| 237 | Ga0075435_100010048 | 3300007076 | Bacteria | 6901 |
| 238 | Ga0075435_100010366 | 3300007076 | Bacteria | 6814 |
| 239 | Ga0075435_100014025 | 3300007076 | Bacteria | 5976 |
| 240 | Ga0075435_100082894 | 3300007076 | Bacteria | 2636 |
| 241 | Ga0075435_100122502 | 3300007076 | Bacteria | 2171 |
| 242 | Ga0105240_10032970 | 3300009093 | Bacteria | 6698 |
| 243 | Ga0105240_10094357 | 3300009093 | Bacteria | 3650 |
| 244 | Ga0105240_10192408 | 3300009093 | Bacteria | 2398 |
| 245 | Ga0111539_10002534 | 3300009094 | Bacteria | 24191 |
| 246 | Ga0111539_10002876 | 3300009094 | Bacteria | 22852 |
| 247 | Ga0111539_10030024 | 3300009094 | Bacteria | 6613 |
| 248 | Ga0111539_10108769 | 3300009094 | Bacteria | 3253 |
| 249 | Ga0111539_10164550 | 3300009094 | Bacteria | 2594 |
| 250 | Ga0111539_10343497 | 3300009094 | Unclassified | 1737 |
| 251 | Ga0105245_10010376 | 3300009098 | Bacteria | 8114 |
| 252 | Ga0105245_10013722 | 3300009098 | Bacteria | 7057 |
| 253 | Ga0105245_10047423 | 3300009098 | Bacteria | 3841 |
| 254 | Ga0105245_10069086 | 3300009098 | Bacteria | 3203 |
| 255 | Ga0105245_10073817 | 3300009098 | Bacteria | 3103 |
| 256 | Ga0105245_10108511 | 3300009098 | Bacteria | 2578 |
| 257 | Ga0105245_10236092 | 3300009098 | Bacteria | 1770 |
| 258 | Ga0105247_10000369 | 3300009101 | Bacteria | 38254 |
| 259 | Ga0114129_10036368 | 3300009147 | Bacteria | 6954 |
| 260 | Ga0114129_10079769 | 3300009147 | Bacteria | 4551 |
| 261 | Ga0105243_10003685 | 3300009148 | Bacteria | 12321 |
| 262 | Ga0105243_10005915 | 3300009148 | Bacteria | 9476 |
| 263 | Ga0105243_10017401 | 3300009148 | Bacteria | 5434 |
| 264 | Ga0105243_10041665 | 3300009148 | Bacteria | 3590 |
| 265 | Ga0105243_10048351 | 3300009148 | Bacteria | 3353 |
| 266 | Ga0105243_10071064 | 3300009148 | Bacteria | 2813 |
| 267 | Ga0105243_10085160 | 3300009148 | Bacteria | 2590 |
| 268 | Ga0105241_10068171 | 3300009174 | Bacteria | 2756 |
| 269 | Ga0105242_10001159 | 3300009176 | Bacteria | 20774 |
| 270 | Ga0105242_10008877 | 3300009176 | Bacteria | 7714 |
| 271 | Ga0105242_10016636 | 3300009176 | Bacteria | 5721 |
| 272 | Ga0105242_10018440 | 3300009176 | Bacteria | 5456 |
| 273 | Ga0105242_10060082 | 3300009176 | Bacteria | 3121 |
| 274 | Ga0105242_10091633 | 3300009176 | Bacteria | 2559 |
| 275 | Ga0105242_10176318 | 3300009176 | Bacteria | 1882 |
| 276 | Ga0105242_10194217 | 3300009176 | Bacteria | 1799 |
| 277 | Ga0105242_10238791 | 3300009176 | Bacteria | 1633 |
| 278 | Ga0105248_10009406 | 3300009177 | Bacteria | 10759 |
| 279 | Ga0105248_10066247 | 3300009177 | Bacteria | 4056 |
| 280 | Ga0105248_10127493 | 3300009177 | Bacteria | 2871 |
| 281 | Ga0105248_10296632 | 3300009177 | Bacteria | 1820 |
| 282 | Ga0105237_10028453 | 3300009545 | Bacteria | 5693 |
| 283 | Ga0105237_10226999 | 3300009545 | Bacteria | 1868 |
| 284 | Ga0105238_10019629 | 3300009551 | Bacteria | 6883 |
| 285 | Ga0105238_10152433 | 3300009551 | Bacteria | 2286 |
| 286 | Ga0105238_10262486 | 3300009551 | Unclassified | 1707 |
| 287 | Ga0105249_10000916 | 3300009553 | Bacteria | 26081 |
| 288 | Ga0105249_10002508 | 3300009553 | Bacteria | 15869 |
| 289 | Ga0105249_10009694 | 3300009553 | Bacteria | 8440 |
| 290 | Ga0105249_10107528 | 3300009553 | Bacteria | 2632 |
| 291 | Ga0105249_10150221 | 3300009553 | Bacteria | 2242 |
| 292 | Ga0105239_10009449 | 3300010375 | Bacteria | 10987 |
| 293 | Ga0105239_10033703 | 3300010375 | Bacteria | 5623 |
| 294 | Ga0105239_10103632 | 3300010375 | Bacteria | 3149 |
| 295 | Ga0105239_10112707 | 3300010375 | Bacteria | 3016 |
| 296 | Ga0105246_10018236 | 3300011119 | Bacteria | 4472 |
| 297 | Ga0105246_10033619 | 3300011119 | Bacteria | 3410 |
| 298 | Ga0157373_10000003 | 3300013100 | Bacteria | 454601 |
| 299 | Ga0157373_10075674 | 3300013100 | Bacteria | 2375 |
| 300 | Ga0157371_10049289 | 3300013102 | Bacteria | 2992 |
| 301 | Ga0157370_10033202 | 3300013104 | Bacteria | 5031 |
| 302 | Ga0157370_10151057 | 3300013104 | Bacteria | 2161 |
| 303 | Ga0157369_10009457 | 3300013105 | Bacteria | 11144 |
| 304 | Ga0157369_10033435 | 3300013105 | Bacteria | 5651 |
| 305 | Ga0157369_10069460 | 3300013105 | Bacteria | 3784 |
| 306 | Ga0157374_10322458 | 3300013296 | Bacteria | 1531 |
| 307 | Ga0157378_10217413 | 3300013297 | Bacteria | 1815 |
| 308 | Ga0157378_10271297 | 3300013297 | Bacteria | 1632 |
| 309 | Ga0163162_10014212 | 3300013306 | Bacteria | 7777 |
| 310 | Ga0163162_10014551 | 3300013306 | Bacteria | 7689 |
| 311 | Ga0163162_10025640 | 3300013306 | Bacteria | 5828 |
| 312 | Ga0163162_10026336 | 3300013306 | Bacteria | 5748 |
| 313 | Ga0163162_10030239 | 3300013306 | Bacteria | 5366 |
| 314 | Ga0163162_10205614 | 3300013306 | Bacteria | 2098 |
| 315 | Ga0163162_10236293 | 3300013306 | Bacteria | 1958 |
| 316 | Ga0163162_10339249 | 3300013306 | Bacteria | 1635 |
| 317 | Ga0157372_10008824 | 3300013307 | Bacteria | 10708 |
| 318 | Ga0157372_10309031 | 3300013307 | Bacteria | 1840 |
| 319 | Ga0157375_10003892 | 3300013308 | Bacteria | 12951 |
| 320 | Ga0157375_10004006 | 3300013308 | Bacteria | 12778 |
| 321 | Ga0157375_10016208 | 3300013308 | Bacteria | 6684 |
| 322 | Ga0157375_10086370 | 3300013308 | Bacteria | 3188 |
| 323 | Ga0157375_10103526 | 3300013308 | Bacteria | 2934 |
| 324 | Ga0157375_10247796 | 3300013308 | Bacteria | 1942 |
| 325 | Ga0157375_10427895 | 3300013308 | Bacteria | 1490 |
| 326 | Ga0163163_10007110 | 3300014325 | Bacteria | 9840 |
| 327 | Ga0163163_10043622 | 3300014325 | Bacteria | 4397 |
| 328 | Ga0157380_10018093 | 3300014326 | Bacteria | 5227 |
| 329 | Ga0157380_10032636 | 3300014326 | Unclassified | 4007 |
| 330 | Ga0157380_10039774 | 3300014326 | Bacteria | 3659 |
| 331 | Ga0157380_10080362 | 3300014326 | Bacteria | 2664 |
| 332 | Ga0157380_10136826 | 3300014326 | Bacteria | 2098 |
| 333 | Ga0157380_10177339 | 3300014326 | Bacteria | 1869 |
| 334 | Ga0157377_10001163 | 3300014745 | Bacteria | 11149 |
| 335 | Ga0157377_10005504 | 3300014745 | Bacteria | 5959 |
| 336 | Ga0157377_10126072 | 3300014745 | Bacteria | 1558 |
| 337 | Ga0157379_10018892 | 3300014968 | Bacteria | 6081 |
| 338 | Ga0157379_10140789 | 3300014968 | Bacteria | 2175 |
| 339 | Ga0157376_10004119 | 3300014969 | Bacteria | 10073 |
| 340 | Ga0182006_1041690 | 3300015261 | Bacteria | 1801 |
| 341 | Ga0163161_10017674 | 3300017792 | Bacteria | 4996 |
| 342 | Ga0163161_10047150 | 3300017792 | Unclassified | 3112 |
| 343 | Ga0163161_10055314 | 3300017792 | Bacteria | 2881 |
| 344 | Ga0163161_10078165 | 3300017792 | Bacteria | 2432 |
| 345 | Ga0197907_10292294 | 3300020069 | Bacteria | 1676 |
| 346 | Ga0206355_1195442 | 3300020076 | Bacteria | 2100 |
| 347 | Ga0206351_10206386 | 3300020077 | Bacteria | 1904 |
| 348 | Ga0206351_10855698 | 3300020077 | Bacteria | 2173 |
| 349 | Ga0206352_10111744 | 3300020078 | Bacteria | 1992 |
| 350 | Ga0206352_11357117 | 3300020078 | Bacteria | 2025 |
| 351 | Ga0206353_11863956 | 3300020082 | Bacteria | 1900 |
| 352 | Ga0154015_1332211 | 3300020610 | Bacteria | 2384 |
| 353 | Ga0213872_10023559 | 3300021361 | Bacteria | 2833 |
| 354 | Ga0224712_10004327 | 3300022467 | Bacteria | 3817 |
| 355 | Ga0209025_1000053 | 3300025294 | Bacteria | 317600 |
| 356 | Ga0209758_1001127 | 3300025297 | Bacteria | 34298 |
| 357 | Ga0207692_10000005 | 3300025898 | Bacteria | 370169 |
| 358 | Ga0207692_10004714 | 3300025898 | Bacteria | 5411 |
| 359 | Ga0207692_10006213 | 3300025898 | Bacteria | 4837 |
| 360 | Ga0207642_10021960 | 3300025899 | Bacteria | 2522 |
| 361 | Ga0207710_10000227 | 3300025900 | Bacteria | 48932 |
| 362 | Ga0207688_10006721 | 3300025901 | Bacteria | 6255 |
| 363 | Ga0207688_10069458 | 3300025901 | Bacteria | 1996 |
| 364 | Ga0207647_10008001 | 3300025904 | Bacteria | 7603 |
| 365 | Ga0207647_10051955 | 3300025904 | Bacteria | 2531 |
| 366 | Ga0207647_10055729 | 3300025904 | Bacteria | 2428 |
| 367 | Ga0207685_10010684 | 3300025905 | Bacteria | 2724 |
| 368 | Ga0207685_10031309 | 3300025905 | Unclassified | 1903 |
| 369 | Ga0207699_10003875 | 3300025906 | Bacteria | 7148 |
| 370 | Ga0207645_10039419 | 3300025907 | Bacteria | 3027 |
| 371 | Ga0207705_10013443 | 3300025909 | Bacteria | 5905 |
| 372 | Ga0207684_10208636 | 3300025910 | Bacteria | 1685 |
| 373 | Ga0207654_10091040 | 3300025911 | Bacteria | 1859 |
| 374 | Ga0207707_10017087 | 3300025912 | Bacteria | 6322 |
| 375 | Ga0207707_10017437 | 3300025912 | Bacteria | 6260 |
| 376 | Ga0207695_10003637 | 3300025913 | Bacteria | 21542 |
| 377 | Ga0207693_10000009 | 3300025915 | Bacteria | 168990 |
| 378 | Ga0207693_10001273 | 3300025915 | Bacteria | 22484 |
| 379 | Ga0207693_10002186 | 3300025915 | Bacteria | 17054 |
| 380 | Ga0207693_10002493 | 3300025915 | Bacteria | 16014 |
| 381 | Ga0207693_10003950 | 3300025915 | Bacteria | 12603 |
| 382 | Ga0207693_10015101 | 3300025915 | Bacteria | 6199 |
| 383 | Ga0207693_10083758 | 3300025915 | Bacteria | 2498 |
| 384 | Ga0207693_10131025 | 3300025915 | Bacteria | 1971 |
| 385 | Ga0207663_10005201 | 3300025916 | Bacteria | 6548 |
| 386 | Ga0207663_10005313 | 3300025916 | Bacteria | 6484 |
| 387 | Ga0207663_10016114 | 3300025916 | Bacteria | 4136 |
| 388 | Ga0207663_10023197 | 3300025916 | Bacteria | 3557 |
| 389 | Ga0207663_10066960 | 3300025916 | Bacteria | 2301 |
| 390 | Ga0207663_10080764 | 3300025916 | Bacteria | 2127 |
| 391 | Ga0207663_10128601 | 3300025916 | Bacteria | 1746 |
| 392 | Ga0207660_10085054 | 3300025917 | Bacteria | 2332 |
| 393 | Ga0207662_10056488 | 3300025918 | Bacteria | 2344 |
| 394 | Ga0207657_10005677 | 3300025919 | Bacteria | 13017 |
| 395 | Ga0207657_10012567 | 3300025919 | Bacteria | 8346 |
| 396 | Ga0207657_10093682 | 3300025919 | Bacteria | 2502 |
| 397 | Ga0207649_10116054 | 3300025920 | Bacteria | 1797 |
| 398 | Ga0207652_10051270 | 3300025921 | Bacteria | 3538 |
| 399 | Ga0207646_10082643 | 3300025922 | Bacteria | 2872 |
| 400 | Ga0207646_10104150 | 3300025922 | Bacteria | 2545 |
| 401 | Ga0207681_10045347 | 3300025923 | Bacteria | 2951 |
| 402 | Ga0207681_10086256 | 3300025923 | Bacteria | 2230 |
| 403 | Ga0207694_10076077 | 3300025924 | Unclassified | 2628 |
| 404 | Ga0207659_10003884 | 3300025926 | Bacteria | 9009 |
| 405 | Ga0207659_10040587 | 3300025926 | Bacteria | 3255 |
| 406 | Ga0207687_10027279 | 3300025927 | Bacteria | 3831 |
| 407 | Ga0207687_10037166 | 3300025927 | Bacteria | 3320 |
| 408 | Ga0207687_10053621 | 3300025927 | Bacteria | 2818 |
| 409 | Ga0207687_10176006 | 3300025927 | Bacteria | 1654 |
| 410 | Ga0207700_10005015 | 3300025928 | Bacteria | 7875 |
| 411 | Ga0207700_10012605 | 3300025928 | Bacteria | 5461 |
| 412 | Ga0207700_10112071 | 3300025928 | Bacteria | 2197 |
| 413 | Ga0207664_10003838 | 3300025929 | Bacteria | 10096 |
| 414 | Ga0207664_10005028 | 3300025929 | Bacteria | 8996 |
| 415 | Ga0207664_10007360 | 3300025929 | Bacteria | 7630 |
| 416 | Ga0207664_10008030 | 3300025929 | Bacteria | 7338 |
| 417 | Ga0207664_10012014 | 3300025929 | Bacteria | 6182 |
| 418 | Ga0207664_10022821 | 3300025929 | Bacteria | 4680 |
| 419 | Ga0207664_10051885 | 3300025929 | Bacteria | 3241 |
| 420 | Ga0207664_10053517 | 3300025929 | Bacteria | 3196 |
| 421 | Ga0207664_10070425 | 3300025929 | Bacteria | 2814 |
| 422 | Ga0207664_10097511 | 3300025929 | Bacteria | 2422 |
| 423 | Ga0207690_10029423 | 3300025932 | Bacteria | 3493 |
| 424 | Ga0207690_10039765 | 3300025932 | Bacteria | 3070 |
| 425 | Ga0207690_10071111 | 3300025932 | Bacteria | 2399 |
| 426 | Ga0207706_10002554 | 3300025933 | Bacteria | 17744 |
| 427 | Ga0207706_10003441 | 3300025933 | Bacteria | 15118 |
| 428 | Ga0207706_10005339 | 3300025933 | Bacteria | 11976 |
| 429 | Ga0207706_10015246 | 3300025933 | Bacteria | 6951 |
| 430 | Ga0207706_10018736 | 3300025933 | Bacteria | 6226 |
| 431 | Ga0207706_10040269 | 3300025933 | Bacteria | 4141 |
| 432 | Ga0207706_10099242 | 3300025933 | Bacteria | 2562 |
| 433 | Ga0207686_10000035 | 3300025934 | Bacteria | 130483 |
| 434 | Ga0207686_10001551 | 3300025934 | Bacteria | 12972 |
| 435 | Ga0207686_10053260 | 3300025934 | Bacteria | 2529 |
| 436 | Ga0207709_10001318 | 3300025935 | Bacteria | 17566 |
| 437 | Ga0207709_10035002 | 3300025935 | Bacteria | 2965 |
| 438 | Ga0207709_10068835 | 3300025935 | Bacteria | 2239 |
| 439 | Ga0207709_10117364 | 3300025935 | Bacteria | 1790 |
| 440 | Ga0207670_10021496 | 3300025936 | Bacteria | 3982 |
| 441 | Ga0207669_10020443 | 3300025937 | Bacteria | 3473 |
| 442 | Ga0207704_10006123 | 3300025938 | Bacteria | 5579 |
| 443 | Ga0207704_10016620 | 3300025938 | Bacteria | 3787 |
| 444 | Ga0207704_10102160 | 3300025938 | Bacteria | 1914 |
| 445 | Ga0207665_10001498 | 3300025939 | Bacteria | 15698 |
| 446 | Ga0207665_10004626 | 3300025939 | Bacteria | 9137 |
| 447 | Ga0207665_10039692 | 3300025939 | Bacteria | 3139 |
| 448 | Ga0207665_10043840 | 3300025939 | Bacteria | 2992 |
| 449 | Ga0207691_10003769 | 3300025940 | Bacteria | 14721 |
| 450 | Ga0207691_10178554 | 3300025940 | Bacteria | 1856 |
| 451 | Ga0207711_10018257 | 3300025941 | Bacteria | 5830 |
| 452 | Ga0207711_10162875 | 3300025941 | Bacteria | 2020 |
| 453 | Ga0207689_10028298 | 3300025942 | Bacteria | 4690 |
| 454 | Ga0207689_10036645 | 3300025942 | Bacteria | 4072 |
| 455 | Ga0207689_10071506 | 3300025942 | Bacteria | 2849 |
| 456 | Ga0207689_10150840 | 3300025942 | Bacteria | 1916 |
| 457 | Ga0207661_10000896 | 3300025944 | Bacteria | 19528 |
| 458 | Ga0207661_10005047 | 3300025944 | Bacteria | 9262 |
| 459 | Ga0207661_10017682 | 3300025944 | Bacteria | 5283 |
| 460 | Ga0207661_10023477 | 3300025944 | Bacteria | 4660 |
| 461 | Ga0207661_10060629 | 3300025944 | Bacteria | 3053 |
| 462 | Ga0207661_10181926 | 3300025944 | Bacteria | 1837 |
| 463 | Ga0207679_10033544 | 3300025945 | Bacteria | 3613 |
| 464 | Ga0207712_10018506 | 3300025961 | Bacteria | 4539 |
| 465 | Ga0207712_10064710 | 3300025961 | Bacteria | 2608 |
| 466 | Ga0207712_10111032 | 3300025961 | Bacteria | 2057 |
| 467 | Ga0207712_10120762 | 3300025961 | Bacteria | 1982 |
| 468 | Ga0207668_10007005 | 3300025972 | Bacteria | 6686 |
| 469 | Ga0207668_10137382 | 3300025972 | Bacteria | 1875 |
| 470 | Ga0207668_10142092 | 3300025972 | Bacteria | 1847 |
| 471 | Ga0207640_10109174 | 3300025981 | Unclassified | 1957 |
| 472 | Ga0207658_10000465 | 3300025986 | Bacteria | 37863 |
| 473 | Ga0207677_10044985 | 3300026023 | Bacteria | 2945 |
| 474 | Ga0207677_10087065 | 3300026023 | Unclassified | 2260 |
| 475 | Ga0207677_10140050 | 3300026023 | Bacteria | 1851 |
| 476 | Ga0207703_10121530 | 3300026035 | Bacteria | 2242 |
| 477 | Ga0207703_10246477 | 3300026035 | Bacteria | 1608 |
| 478 | Ga0207639_10005344 | 3300026041 | Bacteria | 8678 |
| 479 | Ga0207639_10075794 | 3300026041 | Bacteria | 2646 |
| 480 | Ga0207678_10003330 | 3300026067 | Bacteria | 14492 |
| 481 | Ga0207678_10013416 | 3300026067 | Bacteria | 7192 |
| 482 | Ga0207678_10016969 | 3300026067 | Bacteria | 6394 |
| 483 | Ga0207678_10098105 | 3300026067 | Bacteria | 2503 |
| 484 | Ga0207678_10145917 | 3300026067 | Bacteria | 2020 |
| 485 | Ga0207708_10002772 | 3300026075 | Bacteria | 12872 |
| 486 | Ga0207708_10013121 | 3300026075 | Bacteria | 6183 |
| 487 | Ga0207708_10017990 | 3300026075 | Bacteria | 5317 |
| 488 | Ga0207708_10020425 | 3300026075 | Bacteria | 4996 |
| 489 | Ga0207708_10058018 | 3300026075 | Bacteria | 2954 |
| 490 | Ga0207702_10028773 | 3300026078 | Bacteria | 4621 |
| 491 | Ga0207702_10044134 | 3300026078 | Bacteria | 3746 |
| 492 | Ga0207702_10050195 | 3300026078 | Bacteria | 3522 |
| 493 | Ga0207702_10063186 | 3300026078 | Bacteria | 3165 |
| 494 | Ga0207702_10085384 | 3300026078 | Bacteria | 2750 |
| 495 | Ga0207641_10011889 | 3300026088 | Bacteria | 7140 |
| 496 | Ga0207641_10042529 | 3300026088 | Bacteria | 3812 |
| 497 | Ga0207641_10084193 | 3300026088 | Unclassified | 2768 |
| 498 | Ga0207648_10003623 | 3300026089 | Bacteria | 16151 |
| 499 | Ga0207648_10003682 | 3300026089 | Bacteria | 16035 |
| 500 | Ga0207648_10005519 | 3300026089 | Bacteria | 12747 |
| 501 | Ga0207648_10074878 | 3300026089 | Bacteria | 2951 |
| 502 | Ga0207676_10000048 | 3300026095 | Bacteria | 147853 |
| 503 | Ga0207676_10056628 | 3300026095 | Bacteria | 3083 |
| 504 | Ga0207674_10001090 | 3300026116 | Bacteria | 35329 |
| 505 | Ga0207674_10025958 | 3300026116 | Bacteria | 6235 |
| 506 | Ga0207675_100036180 | 3300026118 | Bacteria | 4605 |
| 507 | Ga0207675_100088285 | 3300026118 | Bacteria | 2912 |
| 508 | Ga0207675_100213549 | 3300026118 | Bacteria | 1857 |
| 509 | Ga0207675_100234454 | 3300026118 | Bacteria | 1772 |
| 510 | Ga0207683_10000941 | 3300026121 | Bacteria | 26696 |
| 511 | Ga0207683_10020763 | 3300026121 | Bacteria | 5620 |
| 512 | Ga0207683_10102639 | 3300026121 | Bacteria | 2554 |
| 513 | Ga0207683_10125432 | 3300026121 | Bacteria | 2307 |
| 514 | Ga0207698_10008521 | 3300026142 | Bacteria | 6494 |
| 515 | Ga0207698_10059113 | 3300026142 | Bacteria | 2975 |
| 516 | Ga0207698_10099693 | 3300026142 | Bacteria | 2404 |
| 517 | Ga0207698_10122177 | 3300026142 | Bacteria | 2206 |
| 518 | Ga0207428_10001212 | 3300027907 | Bacteria | 27686 |
| 519 | Ga0207428_10014005 | 3300027907 | Bacteria | 6985 |
| 520 | Ga0207428_10080458 | 3300027907 | Unclassified | 2545 |
| 521 | Ga0268266_10161541 | 3300028379 | Bacteria | 2027 |
| 522 | Ga0268266_10167727 | 3300028379 | Bacteria | 1991 |
| 523 | Ga0268265_10001048 | 3300028380 | Bacteria | 24851 |
| 524 | Ga0268264_10110101 | 3300028381 | Bacteria | 2411 |
| 525 | Ga0268264_10175727 | 3300028381 | Bacteria | 1941 |
| 526 | Ga0268264_10212271 | 3300028381 | Bacteria | 1777 |
| 527 | Ga0268264_10220509 | 3300028381 | Bacteria | 1746 |
| 528 | Ga0265337_1000060 | 3300028556 | Bacteria | 49697 |
| 529 | Ga0265326_10000056 | 3300028558 | Bacteria | 64840 |
| 530 | Ga0265319_1000037 | 3300028563 | Bacteria | 115642 |
| 531 | Ga0265322_10000017 | 3300028654 | Bacteria | 114833 |
| 532 | Ga0265338_10000051 | 3300028800 | Bacteria | 211202 |
| 533 | Ga0265338_10175064 | 3300028800 | Bacteria | 1641 |
| 534 | Ga0265324_10000196 | 3300029957 | Bacteria | 46096 |
| 535 | Ga0307511_10020634 | 3300030521 | Bacteria | 6233 |
| 536 | Ga0265332_10022481 | 3300031238 | Bacteria | 2783 |
| 537 | Ga0265328_10000258 | 3300031239 | Bacteria | 24453 |
| 538 | Ga0265320_10000068 | 3300031240 | Bacteria | 91884 |
| 539 | Ga0265329_10001686 | 3300031242 | Bacteria | 10577 |
| 540 | Ga0265331_10000606 | 3300031250 | Bacteria | 31608 |
| 541 | Ga0265331_10004016 | 3300031250 | Bacteria | 9283 |
| 542 | Ga0265327_10000018 | 3300031251 | Bacteria | 439197 |
| 543 | Ga0265327_10000317 | 3300031251 | Bacteria | 92215 |
| 544 | Ga0265327_10063849 | 3300031251 | Bacteria | 1868 |
| 545 | Ga0265316_10034806 | 3300031344 | Bacteria | 4089 |
| 546 | Ga0307513_10006242 | 3300031456 | Bacteria | 15613 |
| 547 | Ga0307513_10201135 | 3300031456 | Bacteria | 1833 |
| 548 | Ga0307408_100020500 | 3300031548 | Bacteria | 4465 |
| 549 | Ga0265313_10006987 | 3300031595 | Bacteria | 7829 |
| 550 | Ga0307508_10150367 | 3300031616 | Bacteria | 1932 |
| 551 | Ga0316575_10001075 | 3300031665 | Bacteria | 8519 |
| 552 | Ga0316575_10002167 | 3300031665 | Bacteria | 6550 |
| 553 | Ga0316579_10005583 | 3300031691 | Bacteria | 5088 |
| 554 | Ga0265314_10000973 | 3300031711 | Bacteria | 33669 |
| 555 | Ga0265314_10064755 | 3300031711 | Bacteria | 2473 |
| 556 | Ga0265342_10094047 | 3300031712 | Bacteria | 1715 |
| 557 | Ga0316576_10001067 | 3300031727 | Bacteria | 14245 |
| 558 | Ga0316576_10012627 | 3300031727 | Bacteria | 5587 |
| 559 | Ga0316576_10028532 | 3300031727 | Bacteria | 3934 |
| 560 | Ga0316576_10108327 | 3300031727 | Bacteria | 2081 |
| 561 | Ga0316578_10014810 | 3300031728 | Bacteria | 4178 |
| 562 | Ga0316577_10011476 | 3300031733 | Bacteria | 4800 |
| 563 | Ga0316577_10033831 | 3300031733 | Bacteria | 2856 |
| 564 | Ga0307413_10000272 | 3300031824 | Bacteria | 15774 |
| 565 | Ga0307410_10002547 | 3300031852 | Bacteria | 8826 |
| 566 | Ga0307406_10014287 | 3300031901 | Bacteria | 4565 |
| 567 | Ga0307407_10001800 | 3300031903 | Bacteria | 8022 |
| 568 | Ga0307412_10017513 | 3300031911 | Bacteria | 4289 |
| 569 | Ga0307409_100011608 | 3300031995 | Bacteria | 5565 |
| 570 | Ga0307416_100139478 | 3300032002 | Bacteria | 2201 |
| 571 | Ga0307414_10003567 | 3300032004 | Bacteria | 8329 |
| 572 | Ga0307411_10000003 | 3300032005 | Bacteria | 477556 |
| 573 | Ga0307411_10047461 | 3300032005 | Bacteria | 2776 |
| 574 | Ga0307415_100009645 | 3300032126 | Bacteria | 5427 |
| 575 | Ga0316585_10003725 | 3300032137 | Bacteria | 4205 |
| 576 | Ga0316585_10005770 | 3300032137 | Bacteria | 3505 |
| 577 | Ga0316580_10001868 | 3300032139 | Bacteria | 5650 |
| 578 | Ga0373926_0000085 | 3300035083 | Bacteria | 17960 |
| 579 | Ga0373934_0004651 | 3300035086 | Bacteria | 5075 |
| 580 | Ga0373940_0038524 | 3300035088 | Bacteria | 1305 |
| 581 | Ga0373944_0000201 | 3300035089 | Bacteria | 12777 |
| 582 | Ga0373951_0012974 | 3300035091 | Bacteria | 1874 |
| 583 | Ga0373923_0000654 | 3300035111 | Bacteria | 8765 |
| 584 | Ga0373932_0022750 | 3300035112 | Bacteria | 1668 |
| 585 | Ga0373936_0001199 | 3300035113 | Bacteria | 9336 |
| 586 | Ga0373936_0019069 | 3300035113 | Bacteria | 2656 |
| 587 | Ga0373941_0011532 | 3300035115 | Bacteria | 2286 |
| 588 | Ga0373945_0000115 | 3300035116 | Bacteria | 19575 |
| 589 | Ga0373945_0000374 | 3300035116 | Bacteria | 12870 |
| 590 | Ga0373953_0000290 | 3300035117 | Bacteria | 13750 |
| 591 | Ga0373953_0001319 | 3300035117 | Bacteria | 7116 |
| 592 | Ga0373954_0000277 | 3300035118 | Bacteria | 18681 |
| 593 | Ga0373954_0006958 | 3300035118 | Bacteria | 4938 |
| 594 | Ga0373956_0000733 | 3300035119 | Bacteria | 13479 |
| 595 | Ga0373956_0012653 | 3300035119 | Bacteria | 3501 |
| 596 | Ga0373957_0000032 | 3300035120 | Bacteria | 36214 |
| 597 | Ga0373957_0009644 | 3300035120 | Bacteria | 3164 |
| 598 | Ga0373943_0000129 | 3300035170 | Bacteria | 28679 |
| 599 | Ga0373943_0003042 | 3300035170 | Bacteria | 7618 |
| 600 | Ga0373943_0023348 | 3300035170 | Bacteria | 2875 |
| 601 | Ga0373943_0076020 | 3300035170 | Bacteria | 1712 |
| 602 | Ga0373946_0000428 | 3300035171 | Bacteria | 13745 |
| 603 | Ga0373946_0000709 | 3300035171 | Bacteria | 11299 |
| 604 | Ga0373955_0000092 | 3300035172 | Bacteria | 36115 |
| 605 | Ga0373955_0026927 | 3300035172 | Bacteria | 2967 |
| 606 | Ga0373955_0030615 | 3300035172 | Bacteria | 2811 |
| 607 | Ga0316574_0000052 | 3300035398 | Bacteria | 29685 |
| 608 | Ga0316574_0036378 | 3300035398 | Bacteria | 3013 |
| 609 | Ga0316574_0074281 | 3300035398 | Bacteria | 2151 |
| 610 | Ga0373924_0000555 | 3300035410 | Bacteria | 11493 |
| 611 | Ga0373924_0009457 | 3300035410 | Bacteria | 3571 |
| 612 | Ga0373931_0018769 | 3300035691 | Bacteria | 3443 |
| 613 | Ga0373935_0000628 | 3300035692 | Bacteria | 18518 |
| 614 | Ga0373935_0003273 | 3300035692 | Bacteria | 9366 |
| 615 | Ga0373935_0168636 | 3300035692 | Bacteria | 1496 |
| 616 | Ga0373927_0002848 | 3300035695 | Bacteria | 12621 |
| 617 | Ga0373927_0004146 | 3300035695 | Bacteria | 10196 |
| 618 | Ga0373927_0074168 | 3300035695 | Bacteria | 2203 |
| 619 | Ga0373933_0000121 | 3300035724 | Bacteria | 50773 |
| 620 | Ga0373947_0000901 | 3300035725 | Bacteria | 17992 |
| 621 | Ga0373947_0003331 | 3300035725 | Bacteria | 9516 |
| 622 | Ga0373947_0038902 | 3300035725 | Bacteria | 2829 |
| 623 | Ga0373947_0057317 | 3300035725 | Bacteria | 2357 |
| 624 | Ga0373947_0058616 | 3300035725 | Bacteria | 2333 |
| 625 | Ga0373947_0120244 | 3300035725 | Bacteria | 1668 |
| 626 | Ga0373947_0142491 | 3300035725 | Bacteria | 1538 |
| 627 | Ga0373937_0000169 | 3300036401 | Bacteria | 63595 |
| 628 | Ga0373937_0018127 | 3300036401 | Bacteria | 6280 |
| 629 | Ga0373937_0018778 | 3300036401 | Bacteria | 6179 |
| 630 | Ga0373937_0021306 | 3300036401 | Bacteria | 5817 |
| 631 | Ga0373937_0048404 | 3300036401 | Bacteria | 3892 |
| 632 | Ga0373937_0057773 | 3300036401 | Bacteria | 3564 |
| 633 | Ga0373937_0116738 | 3300036401 | Bacteria | 2485 |
| 634 | Ga0316582_0000166 | 3300036647 | Bacteria | 20311 |
| 635 | Ga0316584_0005054 | 3300036712 | Bacteria | 8789 |
| 636 | Ga0316584_0007826 | 3300036712 | Bacteria | 7331 |
| 637 | Ga0316584_0026524 | 3300036712 | Bacteria | 4259 |
| 638 | Ga0316584_0029469 | 3300036712 | Bacteria | 4051 |
| 639 | Ga0316584_0051911 | 3300036712 | Bacteria | 3067 |
| 640 | Ga0316584_0091485 | 3300036712 | Bacteria | 2278 |
| 641 | Ga0316584_0139184 | 3300036712 | Bacteria | 1811 |
| 642 | Ga0373925_0002434 | 3300037068 | Bacteria | 14935 |
| 643 | Ga0373925_0003472 | 3300037068 | Bacteria | 12194 |
| 644 | Ga0373925_0034931 | 3300037068 | Bacteria | 3707 |
| 645 | Ga0373925_0037510 | 3300037068 | Bacteria | 3578 |
| 646 | Ga0373925_0140157 | 3300037068 | Bacteria | 1892 |
| 647 | Ga0395900_0111834 | 3300037418 | Bacteria | 2805 |
| 648 | Ga0395900_0233340 | 3300037418 | Bacteria | 1849 |
| 649 | Ga0395898_0028626 | 3300037466 | Bacteria | 5583 |
| 650 | Ga0395898_0190730 | 3300037466 | Bacteria | 1958 |
| 651 | Ga0316581_0001663 | 3300037588 | Bacteria | 5103 |
| 652 | Ga0395901_0018262 | 3300038443 | Bacteria | 7161 |
| 653 | Ga0395901_0161922 | 3300038443 | Bacteria | 2350 |
| 654 | Ga0395901_0193477 | 3300038443 | Bacteria | 2133 |
| 655 | Ga0242420_000347 | 3300038996 | Bacteria | 5142 |
| 656 | Ga0436360_0633769 | 3300039438 | Bacteria | 11634 |
| 657 | Ga0436361_0002000 | 3300039447 | Bacteria | 1855 |
| 658 | Ga0436361_0035073 | 3300039447 | Bacteria | 7878 |
| 659 | Ga0436361_0336407 | 3300039447 | Bacteria | 16691 |
| 660 | Ga0436361_0510461 | 3300039447 | Bacteria | 4197 |
| 661 | Ga0436361_0735490 | 3300039447 | Bacteria | 23457 |
| 662 | Ga0436363_0472667 | 3300039450 | Bacteria | 1777 |
| 663 | Ga0436362_0003157 | 3300039453 | Bacteria | 13284 |
| 664 | Ga0439447_000024 | 3300041407 | Bacteria | 53601 |
| 665 | Ga0451853_1257484 | 3300041512 | Bacteria | 3450 |
| 666 | Ga0466963_0000281 | 3300044694 | Bacteria | 22762 |
| 667 | Ga0466963_0004575 | 3300044694 | Bacteria | 8052 |
| 668 | Ga0466958_0007766 | 3300045836 | Bacteria | 5919 |
| 669 | Ga0466967_0003703 | 3300045976 | Bacteria | 10067 |
| 670 | Ga0466967_0015423 | 3300045976 | Bacteria | 5989 |
| 671 | Ga0466967_0052298 | 3300045976 | Bacteria | 3584 |
| 672 | Ga0466967_0077622 | 3300045976 | Bacteria | 2990 |
| 673 | Ga0495592_0000070 | 3300046454 | Bacteria | 93255 |
| 674 | Ga0495592_0000220 | 3300046454 | Bacteria | 49173 |
| 675 | Ga0495592_0003048 | 3300046454 | Bacteria | 11941 |
| 676 | Ga0495603_0023570 | 3300046455 | Bacteria | 3722 |
| 677 | Ga0495603_0033679 | 3300046455 | Bacteria | 3082 |
| 678 | Ga0495629_0009244 | 3300046459 | Bacteria | 7212 |
| 679 | Ga0495629_0041398 | 3300046459 | Bacteria | 3242 |
| 680 | Ga0495629_0088760 | 3300046459 | Bacteria | 2157 |
| 681 | Ga0495629_0177689 | 3300046459 | Bacteria | 1476 |
| 682 | Ga0495641_0000044 | 3300046461 | Bacteria | 77415 |
| 683 | Ga0495641_0000742 | 3300046461 | Bacteria | 27572 |
| 684 | Ga0495641_0004675 | 3300046461 | Bacteria | 9554 |
| 685 | Ga0495641_0018240 | 3300046461 | Bacteria | 3626 |
| 686 | Ga0495641_0038696 | 3300046461 | Bacteria | 2227 |
| 687 | Ga0495651_0000034 | 3300046462 | Bacteria | 99213 |
| 688 | Ga0495651_0000042 | 3300046462 | Bacteria | 93255 |
| 689 | Ga0495651_0002437 | 3300046462 | Bacteria | 14361 |
| 690 | Ga0495651_0009283 | 3300046462 | Bacteria | 7548 |
| 691 | Ga0495651_0012581 | 3300046462 | Bacteria | 6530 |
| 692 | Ga0495651_0066441 | 3300046462 | Bacteria | 2752 |
| 693 | Ga0495651_0126539 | 3300046462 | Bacteria | 1871 |
| 694 | Ga0495653_0000416 | 3300046463 | Bacteria | 34136 |
| 695 | Ga0495653_0000669 | 3300046463 | Bacteria | 26191 |
| 696 | Ga0495653_0013842 | 3300046463 | Bacteria | 6574 |
| 697 | Ga0495653_0039619 | 3300046463 | Bacteria | 3690 |
| 698 | Ga0495653_0089525 | 3300046463 | Bacteria | 2254 |
| 699 | Ga0495582_0007328 | 3300046473 | Bacteria | 6112 |
| 700 | Ga0495582_0019734 | 3300046473 | Bacteria | 3686 |
| 701 | Ga0495582_0025352 | 3300046473 | Bacteria | 3248 |
| 702 | Ga0495662_0001224 | 3300046476 | Bacteria | 12633 |
| 703 | Ga0495662_0035185 | 3300046476 | Bacteria | 2417 |
| 704 | Ga0495664_0001885 | 3300046477 | Bacteria | 11153 |
| 705 | Ga0495664_0006030 | 3300046477 | Bacteria | 6681 |
| 706 | Ga0495664_0018691 | 3300046477 | Bacteria | 3976 |
| 707 | Ga0495664_0095018 | 3300046477 | Bacteria | 1794 |
| 708 | Ga0495584_0050343 | 3300046491 | Bacteria | 2098 |
| 709 | Ga0495594_0000001 | 3300046499 | Bacteria | 293051 |
| 710 | Ga0495594_0037340 | 3300046499 | Bacteria | 2650 |
| 711 | Ga0495608_0000054 | 3300046511 | Bacteria | 93255 |
| 712 | Ga0495608_0000584 | 3300046511 | Bacteria | 25040 |
| 713 | Ga0495608_0005192 | 3300046511 | Bacteria | 9304 |
| 714 | Ga0495608_0018319 | 3300046511 | Bacteria | 4832 |
| 715 | Ga0495608_0027634 | 3300046511 | Bacteria | 3859 |
| 716 | Ga0495608_0050745 | 3300046511 | Bacteria | 2752 |
| 717 | Ga0495608_0093071 | 3300046511 | Bacteria | 1947 |
| 718 | Ga0495618_0002174 | 3300046514 | Bacteria | 12819 |
| 719 | Ga0495620_0000144 | 3300046515 | Bacteria | 58204 |
| 720 | Ga0495628_0000040 | 3300046516 | Bacteria | 104506 |
| 721 | Ga0495628_0000106 | 3300046516 | Bacteria | 67965 |
| 722 | Ga0495628_0000548 | 3300046516 | Bacteria | 34470 |
| 723 | Ga0495628_0008134 | 3300046516 | Bacteria | 9024 |
| 724 | Ga0495628_0026747 | 3300046516 | Bacteria | 4699 |
| 725 | Ga0495628_0076419 | 3300046516 | Bacteria | 2606 |
| 726 | Ga0495628_0077467 | 3300046516 | Bacteria | 2586 |
| 727 | Ga0495628_0089313 | 3300046516 | Bacteria | 2387 |
| 728 | Ga0495628_0095682 | 3300046516 | Bacteria | 2294 |
| 729 | Ga0495628_0143245 | 3300046516 | Bacteria | 1823 |
| 730 | Ga0495630_0007970 | 3300046517 | Bacteria | 7602 |
| 731 | Ga0495630_0027711 | 3300046517 | Bacteria | 4207 |
| 732 | Ga0495630_0218180 | 3300046517 | Bacteria | 1456 |
| 733 | Ga0495666_0001713 | 3300046526 | Bacteria | 10830 |
| 734 | Ga0495652_0000119 | 3300046529 | Bacteria | 85582 |
| 735 | Ga0495652_0002645 | 3300046529 | Bacteria | 18255 |
| 736 | Ga0495652_0006599 | 3300046529 | Bacteria | 10780 |
| 737 | Ga0495652_0012958 | 3300046529 | Bacteria | 7515 |
| 738 | Ga0495652_0024428 | 3300046529 | Bacteria | 5349 |
| 739 | Ga0495652_0036500 | 3300046529 | Bacteria | 4273 |
| 740 | Ga0495652_0057114 | 3300046529 | Bacteria | 3311 |
| 741 | Ga0495652_0079778 | 3300046529 | Bacteria | 2705 |
| 742 | Ga0495665_0001874 | 3300046531 | Bacteria | 11363 |
| 743 | Ga0495665_0025665 | 3300046531 | Bacteria | 3165 |
| 744 | Ga0495640_0002238 | 3300046533 | Bacteria | 15493 |
| 745 | Ga0495640_0012252 | 3300046533 | Bacteria | 6561 |
| 746 | Ga0495640_0069624 | 3300046533 | Bacteria | 2366 |
| 747 | Ga0495586_0011461 | 3300046535 | Bacteria | 4713 |
| 748 | Ga0495586_0028610 | 3300046535 | Bacteria | 2982 |
| 749 | Ga0495587_0000055 | 3300046536 | Bacteria | 97024 |
| 750 | Ga0495587_0000119 | 3300046536 | Bacteria | 60244 |
| 751 | Ga0495587_0000208 | 3300046536 | Bacteria | 43565 |
| 752 | Ga0495587_0021986 | 3300046536 | Bacteria | 3931 |
| 753 | Ga0495587_0076226 | 3300046536 | Bacteria | 1947 |
| 754 | Ga0495645_0000073 | 3300046543 | Bacteria | 70164 |
| 755 | Ga0495645_0004517 | 3300046543 | Bacteria | 9499 |
| 756 | Ga0495645_0009728 | 3300046543 | Bacteria | 6724 |
| 757 | Ga0495645_0014243 | 3300046543 | Bacteria | 5639 |
| 758 | Ga0495645_0025818 | 3300046543 | Bacteria | 4265 |
| 759 | Ga0495645_0027180 | 3300046543 | Bacteria | 4155 |
| 760 | Ga0495645_0050054 | 3300046543 | Bacteria | 3042 |
| 761 | Ga0495645_0087386 | 3300046543 | Bacteria | 2230 |
| 762 | Ga0495645_0150754 | 3300046543 | Bacteria | 1615 |
| 763 | Ga0495622_0000033 | 3300046557 | Bacteria | 124162 |
| 764 | Ga0495667_0000019 | 3300046559 | Bacteria | 181645 |
| 765 | Ga0495667_0000253 | 3300046559 | Bacteria | 34719 |
| 766 | Ga0495667_0000786 | 3300046559 | Bacteria | 20379 |
| 767 | Ga0495667_0004224 | 3300046559 | Bacteria | 9683 |
| 768 | Ga0495667_0004526 | 3300046559 | Bacteria | 9380 |
| 769 | Ga0495667_0024978 | 3300046559 | Bacteria | 4026 |
| 770 | Ga0495634_0000018 | 3300046642 | Bacteria | 121323 |
| 771 | Ga0495634_0001902 | 3300046642 | Bacteria | 17893 |
| 772 | Ga0495634_0003663 | 3300046642 | Bacteria | 12250 |
| 773 | Ga0495625_0000109 | 3300046660 | Bacteria | 125064 |
| 774 | Ga0495635_0006237 | 3300046663 | Bacteria | 8305 |
| 775 | Ga0495635_0007795 | 3300046663 | Bacteria | 7476 |
| 776 | Ga0495635_0104834 | 3300046663 | Bacteria | 1932 |
| 777 | Ga0495657_0000067 | 3300046675 | Bacteria | 93255 |
| 778 | Ga0495657_0027438 | 3300046675 | Bacteria | 4018 |
| 779 | Ga0495657_0032893 | 3300046675 | Bacteria | 3615 |
| 780 | Ga0495657_0109621 | 3300046675 | Bacteria | 1750 |
| 781 | Ga0495599_0000042 | 3300046678 | Bacteria | 94912 |
| 782 | Ga0495599_0000173 | 3300046678 | Bacteria | 42460 |
| 783 | Ga0495599_0003417 | 3300046678 | Bacteria | 9292 |
| 784 | Ga0495599_0023499 | 3300046678 | Bacteria | 3855 |
| 785 | Ga0495599_0031788 | 3300046678 | Bacteria | 3313 |
| 786 | Ga0495599_0054268 | 3300046678 | Bacteria | 2511 |
| 787 | Ga0495623_0000101 | 3300046679 | Bacteria | 52470 |
| 788 | Ga0495623_0035821 | 3300046679 | Bacteria | 3181 |
| 789 | Ga0495623_0047400 | 3300046679 | Bacteria | 2727 |
| 790 | Ga0495623_0054890 | 3300046679 | Bacteria | 2513 |
| 791 | Ga0495623_0074173 | 3300046679 | Bacteria | 2114 |
| 792 | Ga0495623_0097522 | 3300046679 | Bacteria | 1795 |
| 793 | Ga0495646_0005486 | 3300046680 | Bacteria | 8017 |
| 794 | Ga0495646_0009050 | 3300046680 | Bacteria | 6313 |
| 795 | Ga0495646_0010006 | 3300046680 | Bacteria | 6029 |
| 796 | Ga0495646_0014587 | 3300046680 | Bacteria | 4993 |
| 797 | Ga0495646_0026385 | 3300046680 | Bacteria | 3649 |
| 798 | Ga0495646_0028953 | 3300046680 | Bacteria | 3466 |
| 799 | Ga0495647_0013226 | 3300046681 | Bacteria | 2857 |
| 800 | Ga0495647_0044345 | 3300046681 | Bacteria | 1705 |
| 801 | Ga0495658_0001583 | 3300046683 | Bacteria | 11873 |
| 802 | Ga0495658_0002011 | 3300046683 | Bacteria | 10362 |
| 803 | Ga0495613_0007629 | 3300046689 | Bacteria | 8046 |
| 804 | Ga0495613_0107403 | 3300046689 | Bacteria | 2013 |
| 805 | Ga0495613_0201242 | 3300046689 | Bacteria | 1404 |
| 806 | Ga0495624_0002113 | 3300046690 | Bacteria | 15159 |
| 807 | Ga0495624_0018620 | 3300046690 | Bacteria | 4643 |
| 808 | Ga0495624_0032751 | 3300046690 | Bacteria | 3368 |
| 809 | Ga0495600_0003523 | 3300046809 | Bacteria | 9203 |
| 810 | Ga0495600_0005898 | 3300046809 | Bacteria | 7411 |
| 811 | Ga0495600_0012266 | 3300046809 | Bacteria | 5355 |
| 812 | Ga0495600_0057945 | 3300046809 | Bacteria | 2530 |
| 813 | Ga0495581_0000642 | 3300047315 | Bacteria | 18306 |
| 814 | Ga0495581_0001959 | 3300047315 | Bacteria | 11531 |
| 815 | Ga0495581_0010170 | 3300047315 | Bacteria | 5442 |
| 816 | Ga0495604_0000120 | 3300047317 | Bacteria | 66462 |
| 817 | Ga0495604_0000121 | 3300047317 | Bacteria | 65991 |
| 818 | Ga0495604_0006362 | 3300047317 | Bacteria | 9364 |
| 819 | Ga0495604_0011115 | 3300047317 | Bacteria | 7146 |
| 820 | Ga0495674_0005612 | 3300047319 | Bacteria | 12032 |
| 821 | Ga0495674_0011270 | 3300047319 | Bacteria | 8440 |
| 822 | Ga0495674_0019676 | 3300047319 | Bacteria | 6263 |
| 823 | Ga0495674_0059367 | 3300047319 | Bacteria | 3340 |
| 824 | Ga0495674_0123969 | 3300047319 | Unclassified | 2181 |
| 825 | Ga0495676_0000928 | 3300047321 | Bacteria | 24577 |
| 826 | Ga0495676_0003693 | 3300047321 | Bacteria | 13893 |
| 827 | Ga0495676_0004043 | 3300047321 | Bacteria | 13354 |
| 828 | Ga0495676_0006190 | 3300047321 | Bacteria | 11004 |
| 829 | Ga0495676_0066007 | 3300047321 | Bacteria | 2806 |
| 830 | Ga0495676_0147446 | 3300047321 | Bacteria | 1679 |
| 831 | Ga0495680_0000054 | 3300047322 | Bacteria | 93244 |
| 832 | Ga0495680_0001641 | 3300047322 | Bacteria | 23765 |
| 833 | Ga0495680_0001765 | 3300047322 | Bacteria | 22914 |
| 834 | Ga0495680_0002289 | 3300047322 | Bacteria | 19707 |
| 835 | Ga0495680_0005698 | 3300047322 | Bacteria | 11659 |
| 836 | Ga0495680_0009533 | 3300047322 | Bacteria | 8725 |
| 837 | Ga0495680_0018763 | 3300047322 | Bacteria | 5862 |
| 838 | Ga0495680_0020072 | 3300047322 | Bacteria | 5630 |
| 839 | Ga0495680_0037660 | 3300047322 | Bacteria | 3873 |
| 840 | Ga0495680_0084308 | 3300047322 | Bacteria | 2395 |
| 841 | Ga0495675_0000029 | 3300047444 | Bacteria | 105305 |
| 842 | Ga0495675_0000176 | 3300047444 | Bacteria | 46587 |
| 843 | Ga0495675_0071560 | 3300047444 | Bacteria | 2188 |
| 844 | Ga0495675_0077140 | 3300047444 | Bacteria | 2099 |
| 845 | Ga0495684_0000562 | 3300047471 | Bacteria | 30116 |
| 846 | Ga0495684_0001716 | 3300047471 | Bacteria | 17633 |
| 847 | Ga0495684_0001870 | 3300047471 | Bacteria | 16849 |
| 848 | Ga0495684_0008951 | 3300047471 | Bacteria | 7732 |
| 849 | Ga0495684_0010104 | 3300047471 | Bacteria | 7299 |
| 850 | Ga0495684_0010681 | 3300047471 | Bacteria | 7099 |
| 851 | Ga0495684_0052690 | 3300047471 | Bacteria | 3105 |
| 852 | Ga0495686_0000020 | 3300047472 | Bacteria | 429191 |
| 853 | Ga0495686_0104501 | 3300047472 | Bacteria | 1705 |
| 854 | Ga0495593_0004833 | 3300047673 | Bacteria | 7990 |
| 855 | Ga0495602_0000083 | 3300048088 | Bacteria | 93242 |
| 856 | Ga0495602_0001081 | 3300048088 | Bacteria | 26704 |
| 857 | Ga0495602_0004291 | 3300048088 | Bacteria | 14846 |
| 858 | Ga0495602_0004572 | 3300048088 | Bacteria | 14436 |
| 859 | Ga0495602_0034960 | 3300048088 | Bacteria | 4692 |
| 860 | Ga0495602_0038087 | 3300048088 | Bacteria | 4452 |
| 861 | Ga0495602_0050130 | 3300048088 | Bacteria | 3733 |
| 862 | Ga0496100_0000019 | 3300048903 | Bacteria | 149995 |
| 863 | Ga0496100_0003734 | 3300048903 | Bacteria | 7970 |
| 864 | Ga0496100_0005515 | 3300048903 | Bacteria | 6827 |
| 865 | Ga0496100_0006389 | 3300048903 | Bacteria | 6425 |
| 866 | Ga0496100_0011308 | 3300048903 | Bacteria | 5079 |
| 867 | Ga0496100_0023604 | 3300048903 | Bacteria | 3739 |
| 868 | Ga0496100_0050281 | 3300048903 | Bacteria | 2700 |
| 869 | Ga0496101_0000005 | 3300048904 | Bacteria | 331455 |
| 870 | Ga0496101_0025969 | 3300048904 | Bacteria | 4068 |
| 871 | Ga0496101_0057627 | 3300048904 | Bacteria | 2810 |
| 872 | Ga0496101_0089632 | 3300048904 | Bacteria | 2286 |
| 873 | Ga0496101_0284127 | 3300048904 | Bacteria | 1294 |
| 874 | Ga0496102_0000021 | 3300048905 | Bacteria | 246920 |
| 875 | Ga0496102_0024895 | 3300048905 | Bacteria | 5323 |
| 876 | Ga0496102_0029102 | 3300048905 | Bacteria | 4939 |
| 877 | Ga0496102_0031693 | 3300048905 | Bacteria | 4744 |
| 878 | Ga0496102_0037880 | 3300048905 | Bacteria | 4349 |
| 879 | Ga0496102_0066504 | 3300048905 | Bacteria | 3303 |
| 880 | Ga0496102_0128068 | 3300048905 | Bacteria | 2374 |
| 881 | Ga0496102_0167077 | 3300048905 | Bacteria | 2071 |
| 882 | Ga0496102_0285040 | 3300048905 | Bacteria | 1557 |
| 883 | Ga0496103_0000001 | 3300048906 | Bacteria | 643471 |
| 884 | Ga0496103_0007179 | 3300048906 | Bacteria | 6643 |
| 885 | Ga0496103_0053282 | 3300048906 | Bacteria | 2507 |
| 886 | Ga0496103_0064679 | 3300048906 | Bacteria | 2280 |
| 887 | Ga0496103_0074041 | 3300048906 | Bacteria | 2134 |
| 888 | Ga0496104_0000029 | 3300048907 | Bacteria | 202968 |
| 889 | Ga0496104_0000551 | 3300048907 | Bacteria | 31933 |
| 890 | Ga0496104_0008695 | 3300048907 | Bacteria | 9030 |
| 891 | Ga0496104_0018535 | 3300048907 | Bacteria | 6351 |
| 892 | Ga0496104_0029165 | 3300048907 | Bacteria | 5117 |
| 893 | Ga0496104_0153399 | 3300048907 | Bacteria | 2211 |
| 894 | Ga0496104_0154114 | 3300048907 | Bacteria | 2205 |
| 895 | Ga0496104_0181132 | 3300048907 | Bacteria | 2017 |
| 896 | Ga0496104_0219752 | 3300048907 | Bacteria | 1812 |
| 897 | Ga0496105_0000002 | 3300048908 | Bacteria | 753215 |
| 898 | Ga0496105_0007317 | 3300048908 | Bacteria | 8527 |
| 899 | Ga0496105_0007781 | 3300048908 | Bacteria | 8318 |
| 900 | Ga0496105_0011873 | 3300048908 | Bacteria | 6898 |
| 901 | Ga0496105_0013858 | 3300048908 | Bacteria | 6404 |
| 902 | Ga0496105_0037207 | 3300048908 | Bacteria | 4008 |
| 903 | Ga0496105_0106059 | 3300048908 | Bacteria | 2320 |
| 904 | Ga0496105_0123184 | 3300048908 | Bacteria | 2137 |
| 905 | Ga0496105_0132247 | 3300048908 | Bacteria | 2057 |
| 906 | Ga0496106_0000033 | 3300048909 | Bacteria | 131412 |
| 907 | Ga0496106_0001620 | 3300048909 | Bacteria | 16924 |
| 908 | Ga0496106_0002498 | 3300048909 | Bacteria | 13685 |
| 909 | Ga0496106_0005382 | 3300048909 | Bacteria | 9471 |
| 910 | Ga0496106_0011536 | 3300048909 | Bacteria | 6534 |
| 911 | Ga0496106_0032180 | 3300048909 | Bacteria | 3910 |
| 912 | Ga0496106_0087764 | 3300048909 | Bacteria | 2397 |
| 913 | Ga0496106_0215607 | 3300048909 | Bacteria | 1530 |
| 914 | Ga0496106_0231732 | 3300048909 | Bacteria | 1474 |
| 915 | Ga0496107_0000004 | 3300048910 | Bacteria | 297680 |
| 916 | Ga0496107_0001120 | 3300048910 | Bacteria | 16167 |
| 917 | Ga0496107_0009391 | 3300048910 | Bacteria | 6783 |
| 918 | Ga0496107_0010207 | 3300048910 | Bacteria | 6516 |
| 919 | Ga0496107_0074309 | 3300048910 | Bacteria | 2473 |
| 920 | Ga0496107_0108244 | 3300048910 | Bacteria | 2041 |
| 921 | Ga0496107_0195020 | 3300048910 | Bacteria | 1505 |
| 922 | Ga0496108_0000187 | 3300048911 | Bacteria | 57568 |
| 923 | Ga0496108_0006174 | 3300048911 | Bacteria | 9692 |
| 924 | Ga0496108_0012519 | 3300048911 | Bacteria | 6908 |
| 925 | Ga0496108_0015305 | 3300048911 | Bacteria | 6258 |
| 926 | Ga0496108_0029554 | 3300048911 | Bacteria | 4540 |
| 927 | Ga0496108_0045410 | 3300048911 | Bacteria | 3670 |
| 928 | Ga0496108_0045656 | 3300048911 | Bacteria | 3659 |
| 929 | Ga0496108_0050063 | 3300048911 | Bacteria | 3496 |
| 930 | Ga0496108_0065269 | 3300048911 | Bacteria | 3068 |
| 931 | Ga0496108_0097162 | 3300048911 | Bacteria | 2510 |
| 932 | Ga0496108_0107050 | 3300048911 | Bacteria | 2387 |
| 933 | Ga0496109_0000636 | 3300048912 | Bacteria | 29254 |
| 934 | Ga0496109_0011911 | 3300048912 | Bacteria | 7488 |
| 935 | Ga0496109_0015902 | 3300048912 | Bacteria | 6571 |
| 936 | Ga0496109_0057804 | 3300048912 | Bacteria | 3542 |
| 937 | Ga0496109_0060773 | 3300048912 | Bacteria | 3453 |
| 938 | Ga0496109_0066426 | 3300048912 | Bacteria | 3302 |
| 939 | Ga0496109_0085910 | 3300048912 | Bacteria | 2905 |
| 940 | Ga0496109_0128724 | 3300048912 | Bacteria | 2362 |
| 941 | Ga0496110_0009948 | 3300048913 | Bacteria | 7711 |
| 942 | Ga0496110_0010762 | 3300048913 | Bacteria | 7455 |
| 943 | Ga0496110_0013223 | 3300048913 | Bacteria | 6815 |
| 944 | Ga0496110_0014802 | 3300048913 | Bacteria | 6481 |
| 945 | Ga0496110_0026382 | 3300048913 | Bacteria | 4971 |
| 946 | Ga0496110_0035902 | 3300048913 | Bacteria | 4304 |
| 947 | Ga0496110_0048112 | 3300048913 | Bacteria | 3737 |
| 948 | Ga0496110_0068392 | 3300048913 | Bacteria | 3143 |
| 949 | Ga0496110_0182004 | 3300048913 | Bacteria | 1908 |
| 950 | Ga0496110_0187494 | 3300048913 | Bacteria | 1878 |
| 951 | Ga0496110_0231352 | 3300048913 | Bacteria | 1681 |
| 952 | Ga0496111_0004675 | 3300048914 | Bacteria | 8678 |
| 953 | Ga0496111_0014526 | 3300048914 | Bacteria | 5383 |
| 954 | Ga0496111_0014676 | 3300048914 | Bacteria | 5358 |
| 955 | Ga0496111_0041217 | 3300048914 | Bacteria | 3313 |
| 956 | Ga0496111_0047847 | 3300048914 | Bacteria | 3080 |
| 957 | Ga0496111_0057454 | 3300048914 | Bacteria | 2817 |
| 958 | Ga0496111_0101851 | 3300048914 | Bacteria | 2110 |
| 959 | Ga0496111_0160691 | 3300048914 | Bacteria | 1668 |
| 960 | Ga0496111_0192486 | 3300048914 | Bacteria | 1516 |
| 961 | Ga0496112_0001147 | 3300048915 | Bacteria | 19779 |
| 962 | Ga0496112_0009893 | 3300048915 | Bacteria | 8621 |
| 963 | Ga0496112_0026382 | 3300048915 | Bacteria | 5589 |
| 964 | Ga0496112_0062499 | 3300048915 | Bacteria | 3673 |
| 965 | Ga0496112_0068233 | 3300048915 | Bacteria | 3511 |
| 966 | Ga0496112_0078518 | 3300048915 | Bacteria | 3264 |
| 967 | Ga0496112_0098819 | 3300048915 | Bacteria | 2888 |
| 968 | Ga0496112_0108236 | 3300048915 | Bacteria | 2750 |
| 969 | Ga0496112_0157518 | 3300048915 | Bacteria | 2238 |
| 970 | Ga0496113_0002968 | 3300048916 | Bacteria | 10034 |
| 971 | Ga0496113_0010955 | 3300048916 | Bacteria | 6022 |
| 972 | Ga0496113_0094109 | 3300048916 | Bacteria | 2314 |
| 973 | Ga0496113_0096997 | 3300048916 | Bacteria | 2280 |
| 974 | Ga0496113_0162980 | 3300048916 | Bacteria | 1763 |
| 975 | Ga0496113_0175229 | 3300048916 | Bacteria | 1699 |
| 976 | Ga0496114_0000003 | 3300048917 | Bacteria | 630981 |
| 977 | Ga0496114_0001583 | 3300048917 | Bacteria | 17261 |
| 978 | Ga0496114_0003903 | 3300048917 | Bacteria | 11499 |
| 979 | Ga0496114_0006313 | 3300048917 | Bacteria | 9328 |
| 980 | Ga0496114_0008959 | 3300048917 | Bacteria | 7934 |
| 981 | Ga0496114_0013045 | 3300048917 | Bacteria | 6659 |
| 982 | Ga0496114_0046563 | 3300048917 | Unclassified | 3604 |
| 983 | Ga0496114_0132957 | 3300048917 | Bacteria | 2150 |
| 984 | Ga0496115_0001724 | 3300048918 | Bacteria | 15676 |
| 985 | Ga0496115_0016518 | 3300048918 | Bacteria | 5622 |
| 986 | Ga0496115_0022266 | 3300048918 | Bacteria | 4908 |
| 987 | Ga0496115_0032311 | 3300048918 | Bacteria | 4128 |
| 988 | Ga0496115_0037757 | 3300048918 | Bacteria | 3829 |
| 989 | Ga0496115_0134780 | 3300048918 | Bacteria | 2036 |
| 990 | Ga0496115_0215009 | 3300048918 | Bacteria | 1587 |
| 991 | Ga0496116_0000138 | 3300048919 | Bacteria | 151606 |
| 992 | Ga0496117_0002715 | 3300048920 | Bacteria | 21760 |
| 993 | Ga0496118_0000424 | 3300048921 | Bacteria | 70137 |
| 994 | Ga0496119_0005703 | 3300048922 | Bacteria | 11807 |
| 995 | Ga0496119_0007790 | 3300048922 | Bacteria | 9553 |
| 996 | Ga0496119_0014904 | 3300048922 | Bacteria | 6043 |
| 997 | Ga0496119_0021422 | 3300048922 | Bacteria | 4674 |
| 998 | Ga0496119_0059615 | 3300048922 | Bacteria | 2291 |
| 999 | Ga0496120_0002506 | 3300048923 | Bacteria | 18404 |
| 1000 | Ga0496121_0008090 | 3300048924 | Bacteria | 12514 |
| 1001 | Ga0496121_0111864 | 3300048924 | Bacteria | 2081 |
| 1002 | Ga0496121_0161553 | 3300048924 | Bacteria | 1637 |
| 1003 | Ga0496125_0022767 | 3300048928 | Bacteria | 5808 |
| 1004 | Ga0501032_0004690 | 3300049569 | Bacteria | 10261 |
| 1005 | Ga0501033_0099214 | 3300049570 | Bacteria | 2126 |
| 1006 | Ga0501034_0009420 | 3300049571 | Bacteria | 10222 |
| 1007 | Ga0501034_0128786 | 3300049571 | Bacteria | 2515 |
| 1008 | Ga0501036_0046408 | 3300049572 | Bacteria | 3679 |
| 1009 | Ga0501038_0016446 | 3300049574 | Bacteria | 6704 |
| 1010 | Ga0501039_0030969 | 3300049575 | Bacteria | 4124 |
| 1011 | Ga0501039_0190209 | 3300049575 | Bacteria | 1614 |
| 1012 | Ga0501042_0007340 | 3300049578 | Bacteria | 7215 |
| 1013 | Ga0501042_0194806 | 3300049578 | Bacteria | 1461 |
| 1014 | Ga0501046_0045753 | 3300049580 | Bacteria | 3475 |
| 1015 | Ga0501047_0053952 | 3300049581 | Bacteria | 3889 |
| 1016 | Ga0501047_0182365 | 3300049581 | Bacteria | 1965 |
| 1017 | Ga0501069_0000387 | 3300049585 | Bacteria | 19897 |
| 1018 | Ga0501070_0006896 | 3300049586 | Bacteria | 9665 |
| 1019 | Ga0501070_0017234 | 3300049586 | Bacteria | 6065 |
| 1020 | Ga0501249_003280 | 3300049679 | Bacteria | 3255 |
| 1021 | Ga0501079_0071732 | 3300049741 | Bacteria | 2676 |
| 1022 | nmdc:mga06z11_55717_c1 | 3300050494 | Bacteria | 2042 |
| 1023 | nmdc:mga05p37_10540_c1 | 3300050507 | Bacteria | 10961 |
| 1024 | nmdc:mga05p37_27122_c1 | 3300050507 | Bacteria | 6972 |
| 1025 | nmdc:mga05p37_29021_c1 | 3300050507 | Bacteria | 6751 |
| 1026 | nmdc:mga05p37_38141_c1 | 3300050507 | Bacteria | 5893 |
| 1027 | nmdc:mga09592_111263_c1 | 3300050508 | Bacteria | 2350 |
| 1028 | nmdc:mga09592_31516_c1 | 3300050508 | Bacteria | 4418 |
| 1029 | nmdc:mga0qj67_100862_c1 | 3300050509 | Bacteria | 2327 |
| 1030 | nmdc:mga0qj67_105601_c1 | 3300050509 | Bacteria | 2272 |
| 1031 | nmdc:mga0qj67_126806_c1 | 3300050509 | Bacteria | 2065 |
| 1032 | nmdc:mga0qj67_18732_c1 | 3300050509 | Bacteria | 5278 |
| 1033 | nmdc:mga0qj67_21097_c1 | 3300050509 | Bacteria | 4995 |
| 1034 | nmdc:mga0qj67_241184_c1 | 3300050509 | Bacteria | 1467 |
| 1035 | nmdc:mga0qj67_70731_c1 | 3300050509 | Bacteria | 2784 |
| 1036 | nmdc:mga06r32_11724_c1 | 3300050510 | Bacteria | 7890 |
| 1037 | nmdc:mga06r32_217756_c1 | 3300050510 | Bacteria | 1897 |
| 1038 | nmdc:mga06r32_26545_c1 | 3300050510 | Bacteria | 5401 |
| 1039 | nmdc:mga08y16_1438_c1 | 3300050511 | Bacteria | 23849 |
| 1040 | nmdc:mga08y16_27181_c1 | 3300050511 | Bacteria | 6029 |
| 1041 | nmdc:mga08y16_51543_c1 | 3300050511 | Bacteria | 4305 |
| 1042 | nmdc:mga08y16_62383_c1 | 3300050511 | Bacteria | 3893 |
| 1043 | nmdc:mga0n895_103767_c1 | 3300050512 | Bacteria | 2855 |
| 1044 | nmdc:mga0n895_147475_c1 | 3300050512 | Bacteria | 2383 |
| 1045 | nmdc:mga0n895_191761_c1 | 3300050512 | Bacteria | 2075 |
| 1046 | nmdc:mga0n895_38576_c1 | 3300050512 | Bacteria | 4630 |
| 1047 | nmdc:mga0n895_4006_c1 | 3300050512 | Bacteria | 11980 |
| 1048 | nmdc:mga0n895_51772_c1 | 3300050512 | Bacteria | 4029 |
| 1049 | nmdc:mga0n895_52902_c1 | 3300050512 | Bacteria | 3988 |
| 1050 | nmdc:mga0n895_6500_c1 | 3300050512 | Bacteria | 9938 |
| 1051 | nmdc:mga0rr50_10917_c1 | 3300050513 | Bacteria | 5792 |
| 1052 | nmdc:mga0rr50_13008_c1 | 3300050513 | Bacteria | 5401 |
| 1053 | nmdc:mga0rr50_24764_c1 | 3300050513 | Bacteria | 4162 |
| 1054 | nmdc:mga0rr50_26236_c1 | 3300050513 | Bacteria | 4062 |
| 1055 | nmdc:mga0rr50_5422_c1 | 3300050513 | Bacteria | 7606 |
| 1056 | nmdc:mga0rr50_60781_c1 | 3300050513 | Bacteria | 2844 |
| 1057 | nmdc:mga0rr50_69963_c1 | 3300050513 | Bacteria | 2673 |
| 1058 | nmdc:mga08x19_38054_c1 | 3300050514 | Bacteria | 3055 |
| 1059 | nmdc:mga0a205_18213_c1 | 3300050515 | Bacteria | 6598 |
| 1060 | nmdc:mga0a205_185303_c1 | 3300050515 | Bacteria | 1974 |
| 1061 | nmdc:mga0a205_21593_c1 | 3300050515 | Bacteria | 6089 |
| 1062 | nmdc:mga0a205_25548_c1 | 3300050515 | Bacteria | 5627 |
| 1063 | nmdc:mga0a205_271288_c1 | 3300050515 | Bacteria | 1573 |
| 1064 | nmdc:mga0a205_3610_c1 | 3300050515 | Bacteria | 13853 |
| 1065 | nmdc:mga0a205_62187_c1 | 3300050515 | Bacteria | 3607 |
| 1066 | nmdc:mga0a205_679_c1 | 3300050515 | Bacteria | 27196 |
| 1067 | nmdc:mga0a205_69143_c1 | 3300050515 | Bacteria | 3411 |
| 1068 | nmdc:mga0sz30_56499_c2 | 3300050516 | Bacteria | 1381 |
| 1069 | Ga0495601_0000110 | 3300053077 | Bacteria | 44959 |
| 1070 | Ga0495601_0000124 | 3300053077 | Bacteria | 43205 |
| 1071 | Ga0495601_0003438 | 3300053077 | Bacteria | 9074 |
| 1072 | Ga0495601_0013142 | 3300053077 | Bacteria | 4977 |
| 1073 | Ga0495601_0020740 | 3300053077 | Bacteria | 4017 |
| 1074 | Ga0495601_0048222 | 3300053077 | Bacteria | 2683 |
| 1075 | Ga0495612_0003172 | 3300053078 | Bacteria | 6811 |
| 1076 | Ga0495612_0010699 | 3300053078 | Bacteria | 3707 |
| 1077 | Ga0495612_0010857 | 3300053078 | Bacteria | 3680 |
| 1078 | Ga0495612_0023356 | 3300053078 | Bacteria | 2481 |
| 1079 | Ga0495655_0000008 | 3300053083 | Bacteria | 153535 |
| 1080 | Ga0495595_0001178 | 3300053084 | Bacteria | 10157 |
| 1081 | Ga0495595_0016809 | 3300053084 | Bacteria | 3136 |
| 1082 | Ga0495595_0038686 | 3300053084 | Bacteria | 2174 |
| 1083 | Ga0495619_0000025 | 3300053085 | Bacteria | 167905 |
| 1084 | Ga0495619_0001863 | 3300053085 | Bacteria | 14045 |
| 1085 | Ga0495619_0009701 | 3300053085 | Bacteria | 6070 |
| 1086 | Ga0495619_0021921 | 3300053085 | Bacteria | 4084 |
| 1087 | Ga0495619_0025437 | 3300053085 | Bacteria | 3802 |
| 1088 | Ga0495619_0042642 | 3300053085 | Bacteria | 2972 |
| 1089 | Ga0495619_0107445 | 3300053085 | Bacteria | 1904 |
| 1090 | Ga0500566_0002923 | 3300053094 | Bacteria | 10195 |
| 1091 | Ga0500556_0001512 | 3300053104 | Bacteria | 9592 |
| 1092 | Ga0500572_001267 | 3300053111 | Bacteria | 7103 |
| 1093 | Ga0500614_000117 | 3300053123 | Bacteria | 19001 |
| 1094 | Ga0500628_000023 | 3300053129 | Bacteria | 77818 |
| 1095 | Ga0500658_0000015 | 3300053134 | Bacteria | 151134 |
| 1096 | Ga0500559_0010654 | 3300053136 | Bacteria | 3941 |
| 1097 | Ga0500616_0011561 | 3300053153 | Bacteria | 5203 |
| 1098 | Ga0501082_0056838 | 3300060353 | Bacteria | 3371 |
| 1099 | 2523385192 | 2523231044 | Bacteria | 6434991 |
| 1100 | 2687238119 | 2684623219 | Bacteria | 8442773 |
| 1101 | 2738886880 | 2738541308 | Bacteria | 7020677 |
| 1102 | 2740000265 | 2739367857 | Bacteria | 5433684 |
| 1103 | 2740005081 | 2739367858 | Bacteria | 5432813 |
| 1104 | 2758225509 | 2757320536 | Bacteria | 3629334 |
| 1105 | 2812372081 | 2811994882 | Bacteria | 4688362 |
| 1106 | 2819667620 | 2818991458 | Bacteria | 4794049 |
| 1107 | 2819690921 | 2818991462 | Bacteria | 4320267 |
| 1108 | 2819727738 | 2818991469 | Bacteria | 4644110 |
| 1109 | 2857621489 | 2857618242 | Bacteria | 5635925 |
| 1110 | 2870628812 | 2870628048 | Bacteria | 3696012 |
| 1111 | 2919036786 | 2919034639 | Bacteria | 4763403 |
| 1112 | 2919192496 | 2919191525 | Bacteria | 5765973 |
| 1113 | 2939658176 | 2939657138 | Bacteria | 3740283 |
| 1114 | 8054309405 | 8054307821 | Bacteria | 5212224 |
| 1115 | Ga0075433_10016860 | |||
| 1116 | JGI24740J21852_10000802 | |||
| 1117 | JGI25151J46595_10000166 | |||
| 1118 | JGI25407J50210_10006261 | |||
| 1119 | Ga0058863_11944294 | |||
| 1120 | Ga0058861_10082651 | |||
| 1121 | Ga0070683_100000558 | |||
| 1122 | Ga0070683_100002533 | |||
| 1123 | Ga0070683_100028383 | |||
| 1124 | Ga0070683_100039126 | |||
| 1125 | Ga0070683_100149948 | |||
| 1126 | Ga0068869_100021699 | |||
| 1127 | Ga0070680_100059941 | |||
| 1128 | Ga0070682_100000013 | |||
| 1129 | Ga0070682_100020489 | |||
| 1130 | Ga0070682_100062599 | |||
| 1131 | Ga0070682_100134408 | |||
| 1132 | Ga0070682_100143366 | |||
| 1133 | Ga0068868_100132802 | |||
| 1134 | Ga0068868_100180700 | |||
| 1135 | Ga0070660_100011436 | |||
| 1136 | Ga0070689_100033350 | |||
| 1137 | Ga0070691_10000100 | |||
| 1138 | Ga0070691_10012578 | |||
| 1139 | Ga0070691_10014628 | |||
| 1140 | Ga0070692_10011129 | |||
| 1141 | Ga0070692_10018220 | |||
| 1142 | Ga0070692_10107762 | |||
| 1143 | Ga0070668_100015399 | |||
| 1144 | Ga0070668_100027645 | |||
| 1145 | Ga0070668_100037245 | |||
| 1146 | Ga0070668_100065222 | |||
| 1147 | Ga0070669_100014929 | |||
| 1148 | Ga0070669_100104806 | |||
| 1149 | Ga0070675_100001463 | |||
| 1150 | Ga0070675_100013342 | |||
| 1151 | Ga0070675_100086774 | |||
| 1152 | Ga0070674_100139241 | |||
| 1153 | Ga0070674_100150710 | |||
| 1154 | Ga0070688_100038237 | |||
| 1155 | Ga0070659_100000852 | |||
| 1156 | Ga0070659_100012095 | |||
| 1157 | Ga0070659_100012543 | |||
| 1158 | Ga0070659_100065148 | |||
| 1159 | Ga0070659_100132928 | |||
| 1160 | Ga0070659_100183191 | |||
| 1161 | Ga0070667_100000597 | |||
| 1162 | Ga0070667_100183131 | |||
| 1163 | Ga0070714_100001300 | |||
| 1164 | Ga0070714_100003174 | |||
| 1165 | Ga0070714_100004997 | |||
| 1166 | Ga0070714_100006732 | |||
| 1167 | Ga0070714_100019304 | |||
| 1168 | Ga0070714_100019464 | |||
| 1169 | Ga0070714_100042155 | |||
| 1170 | Ga0070714_100046135 | |||
| 1171 | Ga0070714_100133144 | |||
| 1172 | Ga0070713_100001413 | |||
| 1173 | Ga0070713_100005405 | |||
| 1174 | Ga0070713_100032866 | |||
| 1175 | Ga0070713_100044804 | |||
| 1176 | Ga0070710_10000002 | |||
| 1177 | Ga0070710_10000267 | |||
| 1178 | Ga0070710_10022888 | |||
| 1179 | Ga0070710_10028899 | |||
| 1180 | Ga0070701_10010033 | |||
| 1181 | Ga0070701_10073309 | |||
| 1182 | Ga0070711_100000788 | |||
| 1183 | Ga0070711_100003451 | |||
| 1184 | Ga0070711_100011244 | |||
| 1185 | Ga0070711_100025477 | |||
| 1186 | Ga0070711_100031448 | |||
| 1187 | Ga0070711_100049324 | |||
| 1188 | Ga0070711_100050791 | |||
| 1189 | Ga0070711_100054959 | |||
| 1190 | Ga0070711_100077818 | |||
| 1191 | Ga0070711_100107448 | |||
| 1192 | Ga0070705_100009341 | |||
| 1193 | Ga0070700_100005283 | |||
| 1194 | Ga0070700_100010097 | |||
| 1195 | Ga0070700_100018773 | |||
| 1196 | Ga0070700_100052626 | |||
| 1197 | Ga0070694_100004651 | |||
| 1198 | Ga0070694_100076615 | |||
| 1199 | Ga0070708_100184572 | |||
| 1200 | Ga0070663_100002472 | |||
| 1201 | Ga0070663_100036784 | |||
| 1202 | Ga0070663_100132944 | |||
| 1203 | Ga0070663_100134704 | |||
| 1204 | Ga0070678_100040934 | |||
| 1205 | Ga0070678_100183952 | |||
| 1206 | Ga0070662_100013035 | |||
| 1207 | Ga0070662_100047016 | |||
| 1208 | Ga0070662_100049611 | |||
| 1209 | Ga0070662_100063899 | |||
| 1210 | Ga0070662_100137455 | |||
| 1211 | Ga0070662_100154358 | |||
| 1212 | Ga0070681_10014198 | |||
| 1213 | Ga0068867_100002154 | |||
| 1214 | Ga0068867_100008485 | |||
| 1215 | Ga0070685_10007229 | |||
| 1216 | Ga0070706_100025104 | |||
| 1217 | Ga0070707_100138905 | |||
| 1218 | Ga0070698_100031035 | |||
| 1219 | Ga0070698_100037283 | |||
| 1220 | Ga0070698_100259376 | |||
| 1221 | Ga0070699_100000043 | |||
| 1222 | Ga0070679_100041121 | |||
| 1223 | Ga0070679_100122463 | |||
| 1224 | Ga0070684_100006264 | |||
| 1225 | Ga0070684_100010636 | |||
| 1226 | Ga0070684_100011666 | |||
| 1227 | Ga0070684_100062282 | |||
| 1228 | Ga0070697_100021855 | |||
| 1229 | Ga0068853_100007231 | |||
| 1230 | Ga0068853_100063625 | |||
| 1231 | Ga0068853_100074408 | |||
| 1232 | Ga0068853_100093895 | |||
| 1233 | Ga0070672_100013162 | |||
| 1234 | Ga0070686_100029552 | |||
| 1235 | Ga0070686_100076181 | |||
| 1236 | Ga0070686_100111680 | |||
| 1237 | Ga0070695_100139300 | |||
| 1238 | Ga0070696_100088208 | |||
| 1239 | Ga0070696_100107322 | |||
| 1240 | Ga0070693_100009311 | |||
| 1241 | Ga0070665_100000106 | |||
| 1242 | Ga0070665_100006680 | |||
| 1243 | Ga0070665_100018108 | |||
| 1244 | Ga0070665_100131441 | |||
| 1245 | Ga0070665_100144277 | |||
| 1246 | Ga0068855_100016708 | |||
| 1247 | Ga0068855_100045286 | |||
| 1248 | Ga0070664_100013358 | |||
| 1249 | Ga0070664_100017902 | |||
| 1250 | Ga0070664_100154820 | |||
| 1251 | Ga0070664_100163711 | |||
| 1252 | Ga0068857_100017156 | |||
| 1253 | Ga0068857_100115106 | |||
| 1254 | Ga0068854_100004234 | |||
| 1255 | Ga0068854_100024072 | |||
| 1256 | Ga0068856_100003506 | |||
| 1257 | Ga0068856_100009718 | |||
| 1258 | Ga0068856_100014872 | |||
| 1259 | Ga0068856_100066493 | |||
| 1260 | Ga0068856_100109819 | |||
| 1261 | Ga0070702_100003799 | |||
| 1262 | Ga0070702_100005715 | |||
| 1263 | Ga0070702_100123530 | |||
| 1264 | Ga0068852_100008106 | |||
| 1265 | Ga0068852_100080517 | |||
| 1266 | Ga0068852_100091270 | |||
| 1267 | Ga0068852_100119796 | |||
| 1268 | Ga0068864_100000024 | |||
| 1269 | Ga0068864_100047627 | |||
| 1270 | Ga0068866_10016127 | |||
| 1271 | Ga0068861_100014414 | |||
| 1272 | Ga0068861_100055131 | |||
| 1273 | Ga0068861_100176098 | |||
| 1274 | Ga0068870_10062911 | |||
| 1275 | Ga0068870_10079616 | |||
| 1276 | Ga0068863_100016249 | |||
| 1277 | Ga0068863_100055706 | |||
| 1278 | Ga0068863_100079728 | |||
| 1279 | Ga0068858_100031114 | |||
| 1280 | Ga0068858_100081825 | |||
| 1281 | Ga0068860_100078060 | |||
| 1282 | Ga0068860_100128723 | |||
| 1283 | Ga0068860_100234091 | |||
| 1284 | Ga0068862_100000366 | |||
| 1285 | Ga0068862_100062940 | |||
| 1286 | Ga0068862_100087848 | |||
| 1287 | Ga0068862_100132971 | |||
| 1288 | Ga0068862_100200344 | |||
| 1289 | Ga0081455_10013896 | |||
| 1290 | Ga0081455_10016343 | |||
| 1291 | Ga0081538_10000023 | |||
| 1292 | Ga0081540_1000181 | |||
| 1293 | Ga0081540_1000757 | |||
| 1294 | Ga0081540_1007808 | |||
| 1295 | Ga0081540_1037492 | |||
| 1296 | Ga0081539_10001052 | |||
| 1297 | Ga0070717_10000006 | |||
| 1298 | Ga0070717_10002252 | |||
| 1299 | Ga0070717_10003906 | |||
| 1300 | Ga0070717_10008176 | |||
| 1301 | Ga0070717_10026014 | |||
| 1302 | Ga0070717_10053450 | |||
| 1303 | Ga0075363_100021934 | |||
| 1304 | Ga0075364_10017590 | |||
| 1305 | Ga0070715_10001599 | |||
| 1306 | Ga0070716_100001363 | |||
| 1307 | Ga0070716_100003719 | |||
| 1308 | Ga0070712_100000003 | |||
| 1309 | Ga0070712_100003227 | |||
| 1310 | Ga0070712_100019601 | |||
| 1311 | Ga0070712_100024148 | |||
| 1312 | Ga0070712_100027943 | |||
| 1313 | Ga0070712_100069626 | |||
| 1314 | Ga0070712_100158695 | |||
| 1315 | Ga0097621_100011114 | |||
| 1316 | Ga0097621_100140573 | |||
| 1317 | Ga0068871_100032952 | |||
| 1318 | Ga0068871_100034036 | |||
| 1319 | Ga0068871_100040731 | |||
| 1320 | Ga0068871_100041886 | |||
| 1321 | Ga0068871_100075188 | |||
| 1322 | Ga0075428_100022812 | |||
| 1323 | Ga0075428_100028236 | |||
| 1324 | Ga0075428_100079512 | |||
| 1325 | Ga0075428_100081909 | |||
| 1326 | Ga0075428_100134561 | |||
| 1327 | Ga0075430_100011868 | |||
| 1328 | Ga0075430_100041483 | |||
| 1329 | Ga0075430_100041844 | |||
| 1330 | Ga0075430_100113457 | |||
| 1331 | Ga0075431_100000685 | |||
| 1332 | Ga0075431_100065005 | |||
| 1333 | Ga0075431_100082299 | |||
| 1334 | Ga0075433_10004165 | |||
| 1335 | Ga0075433_10031502 | |||
| 1336 | Ga0075433_10042932 | |||
| 1337 | Ga0075433_10063711 | |||
| 1338 | Ga0075434_100004695 | |||
| 1339 | Ga0075434_100030794 | |||
| 1340 | Ga0075434_100077166 | |||
| 1341 | Ga0075434_100144366 | |||
| 1342 | Ga0075434_100225994 | |||
| 1343 | Ga0075434_100228529 | |||
| 1344 | Ga0075429_100116021 | |||
| 1345 | Ga0068865_100003061 | |||
| 1346 | Ga0068865_100005688 | |||
| 1347 | Ga0068865_100094754 | |||
| 1348 | Ga0075436_100006626 | |||
| 1349 | Ga0075436_100009259 | |||
| 1350 | Ga0099824_1000332 | |||
| 1351 | Ga0075435_100010048 | |||
| 1352 | Ga0075435_100010366 | |||
| 1353 | Ga0075435_100014025 | |||
| 1354 | Ga0075435_100082894 | |||
| 1355 | Ga0075435_100122502 | |||
| 1356 | Ga0105240_10032970 | |||
| 1357 | Ga0105240_10094357 | |||
| 1358 | Ga0105240_10192408 | |||
| 1359 | Ga0111539_10002534 | |||
| 1360 | Ga0111539_10002876 | |||
| 1361 | Ga0111539_10030024 | |||
| 1362 | Ga0111539_10108769 | |||
| 1363 | Ga0111539_10164550 | |||
| 1364 | Ga0111539_10343497 | |||
| 1365 | Ga0105245_10010376 | |||
| 1366 | Ga0105245_10013722 | |||
| 1367 | Ga0105245_10047423 | |||
| 1368 | Ga0105245_10069086 | |||
| 1369 | Ga0105245_10073817 | |||
| 1370 | Ga0105245_10108511 | |||
| 1371 | Ga0105245_10236092 | |||
| 1372 | Ga0105247_10000369 | |||
| 1373 | Ga0114129_10036368 | |||
| 1374 | Ga0114129_10079769 | |||
| 1375 | Ga0105243_10003685 | |||
| 1376 | Ga0105243_10005915 | |||
| 1377 | Ga0105243_10017401 | |||
| 1378 | Ga0105243_10041665 | |||
| 1379 | Ga0105243_10048351 | |||
| 1380 | Ga0105243_10071064 | |||
| 1381 | Ga0105243_10085160 | |||
| 1382 | Ga0105241_10068171 | |||
| 1383 | Ga0105242_10001159 | |||
| 1384 | Ga0105242_10008877 | |||
| 1385 | Ga0105242_10016636 | |||
| 1386 | Ga0105242_10018440 | |||
| 1387 | Ga0105242_10060082 | |||
| 1388 | Ga0105242_10091633 | |||
| 1389 | Ga0105242_10176318 | |||
| 1390 | Ga0105242_10194217 | |||
| 1391 | Ga0105242_10238791 | |||
| 1392 | Ga0105248_10009406 | |||
| 1393 | Ga0105248_10066247 | |||
| 1394 | Ga0105248_10127493 | |||
| 1395 | Ga0105248_10296632 | |||
| 1396 | Ga0105237_10028453 | |||
| 1397 | Ga0105237_10226999 | |||
| 1398 | Ga0105238_10019629 | |||
| 1399 | Ga0105238_10152433 | |||
| 1400 | Ga0105238_10262486 | |||
| 1401 | Ga0105249_10000916 | |||
| 1402 | Ga0105249_10002508 | |||
| 1403 | Ga0105249_10009694 | |||
| 1404 | Ga0105249_10107528 | |||
| 1405 | Ga0105249_10150221 | |||
| 1406 | Ga0105239_10009449 | |||
| 1407 | Ga0105239_10033703 | |||
| 1408 | Ga0105239_10103632 | |||
| 1409 | Ga0105239_10112707 | |||
| 1410 | Ga0105246_10018236 | |||
| 1411 | Ga0105246_10033619 | |||
| 1412 | Ga0157373_10000003 | |||
| 1413 | Ga0157373_10075674 | |||
| 1414 | Ga0157371_10049289 | |||
| 1415 | Ga0157370_10033202 | |||
| 1416 | Ga0157370_10151057 | |||
| 1417 | Ga0157369_10009457 | |||
| 1418 | Ga0157369_10033435 | |||
| 1419 | Ga0157369_10069460 | |||
| 1420 | Ga0157374_10322458 | |||
| 1421 | Ga0157378_10217413 | |||
| 1422 | Ga0157378_10271297 | |||
| 1423 | Ga0163162_10014212 | |||
| 1424 | Ga0163162_10014551 | |||
| 1425 | Ga0163162_10025640 | |||
| 1426 | Ga0163162_10026336 | |||
| 1427 | Ga0163162_10030239 | |||
| 1428 | Ga0163162_10205614 | |||
| 1429 | Ga0163162_10236293 | |||
| 1430 | Ga0163162_10339249 | |||
| 1431 | Ga0157372_10008824 | |||
| 1432 | Ga0157372_10309031 | |||
| 1433 | Ga0157375_10003892 | |||
| 1434 | Ga0157375_10004006 | |||
| 1435 | Ga0157375_10016208 | |||
| 1436 | Ga0157375_10086370 | |||
| 1437 | Ga0157375_10103526 | |||
| 1438 | Ga0157375_10247796 | |||
| 1439 | Ga0157375_10427895 | |||
| 1440 | Ga0163163_10007110 | |||
| 1441 | Ga0163163_10043622 | |||
| 1442 | Ga0157380_10018093 | |||
| 1443 | Ga0157380_10032636 | |||
| 1444 | Ga0157380_10039774 | |||
| 1445 | Ga0157380_10080362 | |||
| 1446 | Ga0157380_10136826 | |||
| 1447 | Ga0157380_10177339 | |||
| 1448 | Ga0157377_10001163 | |||
| 1449 | Ga0157377_10005504 | |||
| 1450 | Ga0157377_10126072 | |||
| 1451 | Ga0157379_10018892 | |||
| 1452 | Ga0157379_10140789 | |||
| 1453 | Ga0157376_10004119 | |||
| 1454 | Ga0182006_1041690 | |||
| 1455 | Ga0163161_10017674 | |||
| 1456 | Ga0163161_10047150 | |||
| 1457 | Ga0163161_10055314 | |||
| 1458 | Ga0163161_10078165 | |||
| 1459 | Ga0197907_10292294 | |||
| 1460 | Ga0206355_1195442 | |||
| 1461 | Ga0206351_10206386 | |||
| 1462 | Ga0206351_10855698 | |||
| 1463 | Ga0206352_10111744 | |||
| 1464 | Ga0206352_11357117 | |||
| 1465 | Ga0206353_11863956 | |||
| 1466 | Ga0154015_1332211 | |||
| 1467 | Ga0213872_10023559 | |||
| 1468 | Ga0224712_10004327 | |||
| 1469 | Ga0209025_1000053 | |||
| 1470 | Ga0209758_1001127 | |||
| 1471 | Ga0207692_10000005 | |||
| 1472 | Ga0207692_10004714 | |||
| 1473 | Ga0207692_10006213 | |||
| 1474 | Ga0207642_10021960 | |||
| 1475 | Ga0207710_10000227 | |||
| 1476 | Ga0207688_10006721 | |||
| 1477 | Ga0207688_10069458 | |||
| 1478 | Ga0207647_10008001 | |||
| 1479 | Ga0207647_10051955 | |||
| 1480 | Ga0207647_10055729 | |||
| 1481 | Ga0207685_10010684 | |||
| 1482 | Ga0207685_10031309 | |||
| 1483 | Ga0207699_10003875 | |||
| 1484 | Ga0207645_10039419 | |||
| 1485 | Ga0207705_10013443 | |||
| 1486 | Ga0207684_10208636 | |||
| 1487 | Ga0207654_10091040 | |||
| 1488 | Ga0207707_10017087 | |||
| 1489 | Ga0207707_10017437 | |||
| 1490 | Ga0207695_10003637 | |||
| 1491 | Ga0207693_10000009 | |||
| 1492 | Ga0207693_10001273 | |||
| 1493 | Ga0207693_10002186 | |||
| 1494 | Ga0207693_10002493 | |||
| 1495 | Ga0207693_10003950 | |||
| 1496 | Ga0207693_10015101 | |||
| 1497 | Ga0207693_10083758 | |||
| 1498 | Ga0207693_10131025 | |||
| 1499 | Ga0207663_10005201 | |||
| 1500 | Ga0207663_10005313 | |||
| 1501 | Ga0207663_10016114 | |||
| 1502 | Ga0207663_10023197 | |||
| 1503 | Ga0207663_10066960 | |||
| 1504 | Ga0207663_10080764 | |||
| 1505 | Ga0207663_10128601 | |||
| 1506 | Ga0207660_10085054 | |||
| 1507 | Ga0207662_10056488 | |||
| 1508 | Ga0207657_10005677 | |||
| 1509 | Ga0207657_10012567 | |||
| 1510 | Ga0207657_10093682 | |||
| 1511 | Ga0207649_10116054 | |||
| 1512 | Ga0207652_10051270 | |||
| 1513 | Ga0207646_10082643 | |||
| 1514 | Ga0207646_10104150 | |||
| 1515 | Ga0207681_10045347 | |||
| 1516 | Ga0207681_10086256 | |||
| 1517 | Ga0207694_10076077 | |||
| 1518 | Ga0207659_10003884 | |||
| 1519 | Ga0207659_10040587 | |||
| 1520 | Ga0207687_10027279 | |||
| 1521 | Ga0207687_10037166 | |||
| 1522 | Ga0207687_10053621 | |||
| 1523 | Ga0207687_10176006 | |||
| 1524 | Ga0207700_10005015 | |||
| 1525 | Ga0207700_10012605 | |||
| 1526 | Ga0207700_10112071 | |||
| 1527 | Ga0207664_10003838 | |||
| 1528 | Ga0207664_10005028 | |||
| 1529 | Ga0207664_10007360 | |||
| 1530 | Ga0207664_10008030 | |||
| 1531 | Ga0207664_10012014 | |||
| 1532 | Ga0207664_10022821 | |||
| 1533 | Ga0207664_10051885 | |||
| 1534 | Ga0207664_10053517 | |||
| 1535 | Ga0207664_10070425 | |||
| 1536 | Ga0207664_10097511 | |||
| 1537 | Ga0207690_10029423 | |||
| 1538 | Ga0207690_10039765 | |||
| 1539 | Ga0207690_10071111 | |||
| 1540 | Ga0207706_10002554 | |||
| 1541 | Ga0207706_10003441 | |||
| 1542 | Ga0207706_10005339 | |||
| 1543 | Ga0207706_10015246 | |||
| 1544 | Ga0207706_10018736 | |||
| 1545 | Ga0207706_10040269 | |||
| 1546 | Ga0207706_10099242 | |||
| 1547 | Ga0207686_10000035 | |||
| 1548 | Ga0207686_10001551 | |||
| 1549 | Ga0207686_10053260 | |||
| 1550 | Ga0207709_10001318 | |||
| 1551 | Ga0207709_10035002 | |||
| 1552 | Ga0207709_10068835 | |||
| 1553 | Ga0207709_10117364 | |||
| 1554 | Ga0207670_10021496 | |||
| 1555 | Ga0207669_10020443 | |||
| 1556 | Ga0207704_10006123 | |||
| 1557 | Ga0207704_10016620 | |||
| 1558 | Ga0207704_10102160 | |||
| 1559 | Ga0207665_10001498 | |||
| 1560 | Ga0207665_10004626 | |||
| 1561 | Ga0207665_10039692 | |||
| 1562 | Ga0207665_10043840 | |||
| 1563 | Ga0207691_10003769 | |||
| 1564 | Ga0207691_10178554 | |||
| 1565 | Ga0207711_10018257 | |||
| 1566 | Ga0207711_10162875 | |||
| 1567 | Ga0207689_10028298 | |||
| 1568 | Ga0207689_10036645 | |||
| 1569 | Ga0207689_10071506 | |||
| 1570 | Ga0207689_10150840 | |||
| 1571 | Ga0207661_10000896 | |||
| 1572 | Ga0207661_10005047 | |||
| 1573 | Ga0207661_10017682 | |||
| 1574 | Ga0207661_10023477 | |||
| 1575 | Ga0207661_10060629 | |||
| 1576 | Ga0207661_10181926 | |||
| 1577 | Ga0207679_10033544 | |||
| 1578 | Ga0207712_10018506 | |||
| 1579 | Ga0207712_10064710 | |||
| 1580 | Ga0207712_10111032 | |||
| 1581 | Ga0207712_10120762 | |||
| 1582 | Ga0207668_10007005 | |||
| 1583 | Ga0207668_10137382 | |||
| 1584 | Ga0207668_10142092 | |||
| 1585 | Ga0207640_10109174 | |||
| 1586 | Ga0207658_10000465 | |||
| 1587 | Ga0207677_10044985 | |||
| 1588 | Ga0207677_10087065 | |||
| 1589 | Ga0207677_10140050 | |||
| 1590 | Ga0207703_10121530 | |||
| 1591 | Ga0207703_10246477 | |||
| 1592 | Ga0207639_10005344 | |||
| 1593 | Ga0207639_10075794 | |||
| 1594 | Ga0207678_10003330 | |||
| 1595 | Ga0207678_10013416 | |||
| 1596 | Ga0207678_10016969 | |||
| 1597 | Ga0207678_10098105 | |||
| 1598 | Ga0207678_10145917 | |||
| 1599 | Ga0207708_10002772 | |||
| 1600 | Ga0207708_10013121 | |||
| 1601 | Ga0207708_10017990 | |||
| 1602 | Ga0207708_10020425 | |||
| 1603 | Ga0207708_10058018 | |||
| 1604 | Ga0207702_10028773 | |||
| 1605 | Ga0207702_10044134 | |||
| 1606 | Ga0207702_10050195 | |||
| 1607 | Ga0207702_10063186 | |||
| 1608 | Ga0207702_10085384 | |||
| 1609 | Ga0207641_10011889 | |||
| 1610 | Ga0207641_10042529 | |||
| 1611 | Ga0207641_10084193 | |||
| 1612 | Ga0207648_10003623 | |||
| 1613 | Ga0207648_10003682 | |||
| 1614 | Ga0207648_10005519 | |||
| 1615 | Ga0207648_10074878 | |||
| 1616 | Ga0207676_10000048 | |||
| 1617 | Ga0207676_10056628 | |||
| 1618 | Ga0207674_10001090 | |||
| 1619 | Ga0207674_10025958 | |||
| 1620 | Ga0207675_100036180 | |||
| 1621 | Ga0207675_100088285 | |||
| 1622 | Ga0207675_100213549 | |||
| 1623 | Ga0207675_100234454 | |||
| 1624 | Ga0207683_10000941 | |||
| 1625 | Ga0207683_10020763 | |||
| 1626 | Ga0207683_10102639 | |||
| 1627 | Ga0207683_10125432 | |||
| 1628 | Ga0207698_10008521 | |||
| 1629 | Ga0207698_10059113 | |||
| 1630 | Ga0207698_10099693 | |||
| 1631 | Ga0207698_10122177 | |||
| 1632 | Ga0207428_10001212 | |||
| 1633 | Ga0207428_10014005 | |||
| 1634 | Ga0207428_10080458 | |||
| 1635 | Ga0268266_10161541 | |||
| 1636 | Ga0268266_10167727 | |||
| 1637 | Ga0268265_10001048 | |||
| 1638 | Ga0268264_10110101 | |||
| 1639 | Ga0268264_10175727 | |||
| 1640 | Ga0268264_10212271 | |||
| 1641 | Ga0268264_10220509 | |||
| 1642 | Ga0265337_1000060 | |||
| 1643 | Ga0265326_10000056 | |||
| 1644 | Ga0265319_1000037 | |||
| 1645 | Ga0265322_10000017 | |||
| 1646 | Ga0265338_10000051 | |||
| 1647 | Ga0265338_10175064 | |||
| 1648 | Ga0265324_10000196 | |||
| 1649 | Ga0307511_10020634 | |||
| 1650 | Ga0265332_10022481 | |||
| 1651 | Ga0265328_10000258 | |||
| 1652 | Ga0265320_10000068 | |||
| 1653 | Ga0265329_10001686 | |||
| 1654 | Ga0265331_10000606 | |||
| 1655 | Ga0265331_10004016 | |||
| 1656 | Ga0265327_10000018 | |||
| 1657 | Ga0265327_10000317 | |||
| 1658 | Ga0265327_10063849 | |||
| 1659 | Ga0265316_10034806 | |||
| 1660 | Ga0307513_10006242 | |||
| 1661 | Ga0307513_10201135 | |||
| 1662 | Ga0307408_100020500 | |||
| 1663 | Ga0265313_10006987 | |||
| 1664 | Ga0307508_10150367 | |||
| 1665 | Ga0316575_10001075 | |||
| 1666 | Ga0316575_10002167 | |||
| 1667 | Ga0316579_10005583 | |||
| 1668 | Ga0265314_10000973 | |||
| 1669 | Ga0265314_10064755 | |||
| 1670 | Ga0265342_10094047 | |||
| 1671 | Ga0316576_10001067 | |||
| 1672 | Ga0316576_10012627 | |||
| 1673 | Ga0316576_10028532 | |||
| 1674 | Ga0316576_10108327 | |||
| 1675 | Ga0316578_10014810 | |||
| 1676 | Ga0316577_10011476 | |||
| 1677 | Ga0316577_10033831 | |||
| 1678 | Ga0307413_10000272 | |||
| 1679 | Ga0307410_10002547 | |||
| 1680 | Ga0307406_10014287 | |||
| 1681 | Ga0307407_10001800 | |||
| 1682 | Ga0307412_10017513 | |||
| 1683 | Ga0307409_100011608 | |||
| 1684 | Ga0307416_100139478 | |||
| 1685 | Ga0307414_10003567 | |||
| 1686 | Ga0307411_10000003 | |||
| 1687 | Ga0307411_10047461 | |||
| 1688 | Ga0307415_100009645 | |||
| 1689 | Ga0316585_10003725 | |||
| 1690 | Ga0316585_10005770 | |||
| 1691 | Ga0316580_10001868 | |||
| 1692 | Ga0373926_0000085 | |||
| 1693 | Ga0373934_0004651 | |||
| 1694 | Ga0373940_0038524 | |||
| 1695 | Ga0373944_0000201 | |||
| 1696 | Ga0373951_0012974 | |||
| 1697 | Ga0373923_0000654 | |||
| 1698 | Ga0373932_0022750 | |||
| 1699 | Ga0373936_0001199 | |||
| 1700 | Ga0373936_0019069 | |||
| 1701 | Ga0373941_0011532 | |||
| 1702 | Ga0373945_0000115 | |||
| 1703 | Ga0373945_0000374 | |||
| 1704 | Ga0373953_0000290 | |||
| 1705 | Ga0373953_0001319 | |||
| 1706 | Ga0373954_0000277 | |||
| 1707 | Ga0373954_0006958 | |||
| 1708 | Ga0373956_0000733 | |||
| 1709 | Ga0373956_0012653 | |||
| 1710 | Ga0373957_0000032 | |||
| 1711 | Ga0373957_0009644 | |||
| 1712 | Ga0373943_0000129 | |||
| 1713 | Ga0373943_0003042 | |||
| 1714 | Ga0373943_0023348 | |||
| 1715 | Ga0373943_0076020 | |||
| 1716 | Ga0373946_0000428 | |||
| 1717 | Ga0373946_0000709 | |||
| 1718 | Ga0373955_0000092 | |||
| 1719 | Ga0373955_0026927 | |||
| 1720 | Ga0373955_0030615 | |||
| 1721 | Ga0316574_0000052 | |||
| 1722 | Ga0316574_0036378 | |||
| 1723 | Ga0316574_0074281 | |||
| 1724 | Ga0373924_0000555 | |||
| 1725 | Ga0373924_0009457 | |||
| 1726 | Ga0373931_0018769 | |||
| 1727 | Ga0373935_0000628 | |||
| 1728 | Ga0373935_0003273 | |||
| 1729 | Ga0373935_0168636 | |||
| 1730 | Ga0373927_0002848 | |||
| 1731 | Ga0373927_0004146 | |||
| 1732 | Ga0373927_0074168 | |||
| 1733 | Ga0373933_0000121 | |||
| 1734 | Ga0373947_0000901 | |||
| 1735 | Ga0373947_0003331 | |||
| 1736 | Ga0373947_0038902 | |||
| 1737 | Ga0373947_0057317 | |||
| 1738 | Ga0373947_0058616 | |||
| 1739 | Ga0373947_0120244 | |||
| 1740 | Ga0373947_0142491 | |||
| 1741 | Ga0373937_0000169 | |||
| 1742 | Ga0373937_0018127 | |||
| 1743 | Ga0373937_0018778 | |||
| 1744 | Ga0373937_0021306 | |||
| 1745 | Ga0373937_0048404 | |||
| 1746 | Ga0373937_0057773 | |||
| 1747 | Ga0373937_0116738 | |||
| 1748 | Ga0316582_0000166 | |||
| 1749 | Ga0316584_0005054 | |||
| 1750 | Ga0316584_0007826 | |||
| 1751 | Ga0316584_0026524 | |||
| 1752 | Ga0316584_0029469 | |||
| 1753 | Ga0316584_0051911 | |||
| 1754 | Ga0316584_0091485 | |||
| 1755 | Ga0316584_0139184 | |||
| 1756 | Ga0373925_0002434 | |||
| 1757 | Ga0373925_0003472 | |||
| 1758 | Ga0373925_0034931 | |||
| 1759 | Ga0373925_0037510 | |||
| 1760 | Ga0373925_0140157 | |||
| 1761 | Ga0395900_0111834 | |||
| 1762 | Ga0395900_0233340 | |||
| 1763 | Ga0395898_0028626 | |||
| 1764 | Ga0395898_0190730 | |||
| 1765 | Ga0316581_0001663 | |||
| 1766 | Ga0395901_0018262 | |||
| 1767 | Ga0395901_0161922 | |||
| 1768 | Ga0395901_0193477 | |||
| 1769 | Ga0242420_000347 | |||
| 1770 | Ga0436360_0633769 | |||
| 1771 | Ga0436361_0002000 | |||
| 1772 | Ga0436361_0035073 | |||
| 1773 | Ga0436361_0336407 | |||
| 1774 | Ga0436361_0510461 | |||
| 1775 | Ga0436361_0735490 | |||
| 1776 | Ga0436363_0472667 | |||
| 1777 | Ga0436362_0003157 | |||
| 1778 | Ga0439447_000024 | |||
| 1779 | Ga0451853_1257484 | |||
| 1780 | Ga0466963_0000281 | |||
| 1781 | Ga0466963_0004575 | |||
| 1782 | Ga0466958_0007766 | |||
| 1783 | Ga0466967_0003703 | |||
| 1784 | Ga0466967_0015423 | |||
| 1785 | Ga0466967_0052298 | |||
| 1786 | Ga0466967_0077622 | |||
| 1787 | Ga0495592_0000070 | |||
| 1788 | Ga0495592_0000220 | |||
| 1789 | Ga0495592_0003048 | |||
| 1790 | Ga0495603_0023570 | |||
| 1791 | Ga0495603_0033679 | |||
| 1792 | Ga0495629_0009244 | |||
| 1793 | Ga0495629_0041398 | |||
| 1794 | Ga0495629_0088760 | |||
| 1795 | Ga0495629_0177689 | |||
| 1796 | Ga0495641_0000044 | |||
| 1797 | Ga0495641_0000742 | |||
| 1798 | Ga0495641_0004675 | |||
| 1799 | Ga0495641_0018240 | |||
| 1800 | Ga0495641_0038696 | |||
| 1801 | Ga0495651_0000034 | |||
| 1802 | Ga0495651_0000042 | |||
| 1803 | Ga0495651_0002437 | |||
| 1804 | Ga0495651_0009283 | |||
| 1805 | Ga0495651_0012581 | |||
| 1806 | Ga0495651_0066441 | |||
| 1807 | Ga0495651_0126539 | |||
| 1808 | Ga0495653_0000416 | |||
| 1809 | Ga0495653_0000669 | |||
| 1810 | Ga0495653_0013842 | |||
| 1811 | Ga0495653_0039619 | |||
| 1812 | Ga0495653_0089525 | |||
| 1813 | Ga0495582_0007328 | |||
| 1814 | Ga0495582_0019734 | |||
| 1815 | Ga0495582_0025352 | |||
| 1816 | Ga0495662_0001224 | |||
| 1817 | Ga0495662_0035185 | |||
| 1818 | Ga0495664_0001885 | |||
| 1819 | Ga0495664_0006030 | |||
| 1820 | Ga0495664_0018691 | |||
| 1821 | Ga0495664_0095018 | |||
| 1822 | Ga0495584_0050343 | |||
| 1823 | Ga0495594_0000001 | |||
| 1824 | Ga0495594_0037340 | |||
| 1825 | Ga0495608_0000054 | |||
| 1826 | Ga0495608_0000584 | |||
| 1827 | Ga0495608_0005192 | |||
| 1828 | Ga0495608_0018319 | |||
| 1829 | Ga0495608_0027634 | |||
| 1830 | Ga0495608_0050745 | |||
| 1831 | Ga0495608_0093071 | |||
| 1832 | Ga0495618_0002174 | |||
| 1833 | Ga0495620_0000144 | |||
| 1834 | Ga0495628_0000040 | |||
| 1835 | Ga0495628_0000106 | |||
| 1836 | Ga0495628_0000548 | |||
| 1837 | Ga0495628_0008134 | |||
| 1838 | Ga0495628_0026747 | |||
| 1839 | Ga0495628_0076419 | |||
| 1840 | Ga0495628_0077467 | |||
| 1841 | Ga0495628_0089313 | |||
| 1842 | Ga0495628_0095682 | |||
| 1843 | Ga0495628_0143245 | |||
| 1844 | Ga0495630_0007970 | |||
| 1845 | Ga0495630_0027711 | |||
| 1846 | Ga0495630_0218180 | |||
| 1847 | Ga0495666_0001713 | |||
| 1848 | Ga0495652_0000119 | |||
| 1849 | Ga0495652_0002645 | |||
| 1850 | Ga0495652_0006599 | |||
| 1851 | Ga0495652_0012958 | |||
| 1852 | Ga0495652_0024428 | |||
| 1853 | Ga0495652_0036500 | |||
| 1854 | Ga0495652_0057114 | |||
| 1855 | Ga0495652_0079778 | |||
| 1856 | Ga0495665_0001874 | |||
| 1857 | Ga0495665_0025665 | |||
| 1858 | Ga0495640_0002238 | |||
| 1859 | Ga0495640_0012252 | |||
| 1860 | Ga0495640_0069624 | |||
| 1861 | Ga0495586_0011461 | |||
| 1862 | Ga0495586_0028610 | |||
| 1863 | Ga0495587_0000055 | |||
| 1864 | Ga0495587_0000119 | |||
| 1865 | Ga0495587_0000208 | |||
| 1866 | Ga0495587_0021986 | |||
| 1867 | Ga0495587_0076226 | |||
| 1868 | Ga0495645_0000073 | |||
| 1869 | Ga0495645_0004517 | |||
| 1870 | Ga0495645_0009728 | |||
| 1871 | Ga0495645_0014243 | |||
| 1872 | Ga0495645_0025818 | |||
| 1873 | Ga0495645_0027180 | |||
| 1874 | Ga0495645_0050054 | |||
| 1875 | Ga0495645_0087386 | |||
| 1876 | Ga0495645_0150754 | |||
| 1877 | Ga0495622_0000033 | |||
| 1878 | Ga0495667_0000019 | |||
| 1879 | Ga0495667_0000253 | |||
| 1880 | Ga0495667_0000786 | |||
| 1881 | Ga0495667_0004224 | |||
| 1882 | Ga0495667_0004526 | |||
| 1883 | Ga0495667_0024978 | |||
| 1884 | Ga0495634_0000018 | |||
| 1885 | Ga0495634_0001902 | |||
| 1886 | Ga0495634_0003663 | |||
| 1887 | Ga0495625_0000109 | |||
| 1888 | Ga0495635_0006237 | |||
| 1889 | Ga0495635_0007795 | |||
| 1890 | Ga0495635_0104834 | |||
| 1891 | Ga0495657_0000067 | |||
| 1892 | Ga0495657_0027438 | |||
| 1893 | Ga0495657_0032893 | |||
| 1894 | Ga0495657_0109621 | |||
| 1895 | Ga0495599_0000042 | |||
| 1896 | Ga0495599_0000173 | |||
| 1897 | Ga0495599_0003417 | |||
| 1898 | Ga0495599_0023499 | |||
| 1899 | Ga0495599_0031788 | |||
| 1900 | Ga0495599_0054268 | |||
| 1901 | Ga0495623_0000101 | |||
| 1902 | Ga0495623_0035821 | |||
| 1903 | Ga0495623_0047400 | |||
| 1904 | Ga0495623_0054890 | |||
| 1905 | Ga0495623_0074173 | |||
| 1906 | Ga0495623_0097522 | |||
| 1907 | Ga0495646_0005486 | |||
| 1908 | Ga0495646_0009050 | |||
| 1909 | Ga0495646_0010006 | |||
| 1910 | Ga0495646_0014587 | |||
| 1911 | Ga0495646_0026385 | |||
| 1912 | Ga0495646_0028953 | |||
| 1913 | Ga0495647_0013226 | |||
| 1914 | Ga0495647_0044345 | |||
| 1915 | Ga0495658_0001583 | |||
| 1916 | Ga0495658_0002011 | |||
| 1917 | Ga0495613_0007629 | |||
| 1918 | Ga0495613_0107403 | |||
| 1919 | Ga0495613_0201242 | |||
| 1920 | Ga0495624_0002113 | |||
| 1921 | Ga0495624_0018620 | |||
| 1922 | Ga0495624_0032751 | |||
| 1923 | Ga0495600_0003523 | |||
| 1924 | Ga0495600_0005898 | |||
| 1925 | Ga0495600_0012266 | |||
| 1926 | Ga0495600_0057945 | |||
| 1927 | Ga0495581_0000642 | |||
| 1928 | Ga0495581_0001959 | |||
| 1929 | Ga0495581_0010170 | |||
| 1930 | Ga0495604_0000120 | |||
| 1931 | Ga0495604_0000121 | |||
| 1932 | Ga0495604_0006362 | |||
| 1933 | Ga0495604_0011115 | |||
| 1934 | Ga0495674_0005612 | |||
| 1935 | Ga0495674_0011270 | |||
| 1936 | Ga0495674_0019676 | |||
| 1937 | Ga0495674_0059367 | |||
| 1938 | Ga0495674_0123969 | |||
| 1939 | Ga0495676_0000928 | |||
| 1940 | Ga0495676_0003693 | |||
| 1941 | Ga0495676_0004043 | |||
| 1942 | Ga0495676_0006190 | |||
| 1943 | Ga0495676_0066007 | |||
| 1944 | Ga0495676_0147446 | |||
| 1945 | Ga0495680_0000054 | |||
| 1946 | Ga0495680_0001641 | |||
| 1947 | Ga0495680_0001765 | |||
| 1948 | Ga0495680_0002289 | |||
| 1949 | Ga0495680_0005698 | |||
| 1950 | Ga0495680_0009533 | |||
| 1951 | Ga0495680_0018763 | |||
| 1952 | Ga0495680_0020072 | |||
| 1953 | Ga0495680_0037660 | |||
| 1954 | Ga0495680_0084308 | |||
| 1955 | Ga0495675_0000029 | |||
| 1956 | Ga0495675_0000176 | |||
| 1957 | Ga0495675_0071560 | |||
| 1958 | Ga0495675_0077140 | |||
| 1959 | Ga0495684_0000562 | |||
| 1960 | Ga0495684_0001716 | |||
| 1961 | Ga0495684_0001870 | |||
| 1962 | Ga0495684_0008951 | |||
| 1963 | Ga0495684_0010104 | |||
| 1964 | Ga0495684_0010681 | |||
| 1965 | Ga0495684_0052690 | |||
| 1966 | Ga0495686_0000020 | |||
| 1967 | Ga0495686_0104501 | |||
| 1968 | Ga0495593_0004833 | |||
| 1969 | Ga0495602_0000083 | |||
| 1970 | Ga0495602_0001081 | |||
| 1971 | Ga0495602_0004291 | |||
| 1972 | Ga0495602_0004572 | |||
| 1973 | Ga0495602_0034960 | |||
| 1974 | Ga0495602_0038087 | |||
| 1975 | Ga0495602_0050130 | |||
| 1976 | Ga0496100_0000019 | |||
| 1977 | Ga0496100_0003734 | |||
| 1978 | Ga0496100_0005515 | |||
| 1979 | Ga0496100_0006389 | |||
| 1980 | Ga0496100_0011308 | |||
| 1981 | Ga0496100_0023604 | |||
| 1982 | Ga0496100_0050281 | |||
| 1983 | Ga0496101_0000005 | |||
| 1984 | Ga0496101_0025969 | |||
| 1985 | Ga0496101_0057627 | |||
| 1986 | Ga0496101_0089632 | |||
| 1987 | Ga0496101_0284127 | |||
| 1988 | Ga0496102_0000021 | |||
| 1989 | Ga0496102_0024895 | |||
| 1990 | Ga0496102_0029102 | |||
| 1991 | Ga0496102_0031693 | |||
| 1992 | Ga0496102_0037880 | |||
| 1993 | Ga0496102_0066504 | |||
| 1994 | Ga0496102_0128068 | |||
| 1995 | Ga0496102_0167077 | |||
| 1996 | Ga0496102_0285040 | |||
| 1997 | Ga0496103_0000001 | |||
| 1998 | Ga0496103_0007179 | |||
| 1999 | Ga0496103_0053282 | |||
| 2000 | Ga0496103_0064679 | |||
| 2001 | Ga0496103_0074041 | |||
| 2002 | Ga0496104_0000029 | |||
| 2003 | Ga0496104_0000551 | |||
| 2004 | Ga0496104_0008695 | |||
| 2005 | Ga0496104_0018535 | |||
| 2006 | Ga0496104_0029165 | |||
| 2007 | Ga0496104_0153399 | |||
| 2008 | Ga0496104_0154114 | |||
| 2009 | Ga0496104_0181132 | |||
| 2010 | Ga0496104_0219752 | |||
| 2011 | Ga0496105_0000002 | |||
| 2012 | Ga0496105_0007317 | |||
| 2013 | Ga0496105_0007781 | |||
| 2014 | Ga0496105_0011873 | |||
| 2015 | Ga0496105_0013858 | |||
| 2016 | Ga0496105_0037207 | |||
| 2017 | Ga0496105_0106059 | |||
| 2018 | Ga0496105_0123184 | |||
| 2019 | Ga0496105_0132247 | |||
| 2020 | Ga0496106_0000033 | |||
| 2021 | Ga0496106_0001620 | |||
| 2022 | Ga0496106_0002498 | |||
| 2023 | Ga0496106_0005382 | |||
| 2024 | Ga0496106_0011536 | |||
| 2025 | Ga0496106_0032180 | |||
| 2026 | Ga0496106_0087764 | |||
| 2027 | Ga0496106_0215607 | |||
| 2028 | Ga0496106_0231732 | |||
| 2029 | Ga0496107_0000004 | |||
| 2030 | Ga0496107_0001120 | |||
| 2031 | Ga0496107_0009391 | |||
| 2032 | Ga0496107_0010207 | |||
| 2033 | Ga0496107_0074309 | |||
| 2034 | Ga0496107_0108244 | |||
| 2035 | Ga0496107_0195020 | |||
| 2036 | Ga0496108_0000187 | |||
| 2037 | Ga0496108_0006174 | |||
| 2038 | Ga0496108_0012519 | |||
| 2039 | Ga0496108_0015305 | |||
| 2040 | Ga0496108_0029554 | |||
| 2041 | Ga0496108_0045410 | |||
| 2042 | Ga0496108_0045656 | |||
| 2043 | Ga0496108_0050063 | |||
| 2044 | Ga0496108_0065269 | |||
| 2045 | Ga0496108_0097162 | |||
| 2046 | Ga0496108_0107050 | |||
| 2047 | Ga0496109_0000636 | |||
| 2048 | Ga0496109_0011911 | |||
| 2049 | Ga0496109_0015902 | |||
| 2050 | Ga0496109_0057804 | |||
| 2051 | Ga0496109_0060773 | |||
| 2052 | Ga0496109_0066426 | |||
| 2053 | Ga0496109_0085910 | |||
| 2054 | Ga0496109_0128724 | |||
| 2055 | Ga0496110_0009948 | |||
| 2056 | Ga0496110_0010762 | |||
| 2057 | Ga0496110_0013223 | |||
| 2058 | Ga0496110_0014802 | |||
| 2059 | Ga0496110_0026382 | |||
| 2060 | Ga0496110_0035902 | |||
| 2061 | Ga0496110_0048112 | |||
| 2062 | Ga0496110_0068392 | |||
| 2063 | Ga0496110_0182004 | |||
| 2064 | Ga0496110_0187494 | |||
| 2065 | Ga0496110_0231352 | |||
| 2066 | Ga0496111_0004675 | |||
| 2067 | Ga0496111_0014526 | |||
| 2068 | Ga0496111_0014676 | |||
| 2069 | Ga0496111_0041217 | |||
| 2070 | Ga0496111_0047847 | |||
| 2071 | Ga0496111_0057454 | |||
| 2072 | Ga0496111_0101851 | |||
| 2073 | Ga0496111_0160691 | |||
| 2074 | Ga0496111_0192486 | |||
| 2075 | Ga0496112_0001147 | |||
| 2076 | Ga0496112_0009893 | |||
| 2077 | Ga0496112_0026382 | |||
| 2078 | Ga0496112_0062499 | |||
| 2079 | Ga0496112_0068233 | |||
| 2080 | Ga0496112_0078518 | |||
| 2081 | Ga0496112_0098819 | |||
| 2082 | Ga0496112_0108236 | |||
| 2083 | Ga0496112_0157518 | |||
| 2084 | Ga0496113_0002968 | |||
| 2085 | Ga0496113_0010955 | |||
| 2086 | Ga0496113_0094109 | |||
| 2087 | Ga0496113_0096997 | |||
| 2088 | Ga0496113_0162980 | |||
| 2089 | Ga0496113_0175229 | |||
| 2090 | Ga0496114_0000003 | |||
| 2091 | Ga0496114_0001583 | |||
| 2092 | Ga0496114_0003903 | |||
| 2093 | Ga0496114_0006313 | |||
| 2094 | Ga0496114_0008959 | |||
| 2095 | Ga0496114_0013045 | |||
| 2096 | Ga0496114_0046563 | |||
| 2097 | Ga0496114_0132957 | |||
| 2098 | Ga0496115_0001724 | |||
| 2099 | Ga0496115_0016518 | |||
| 2100 | Ga0496115_0022266 | |||
| 2101 | Ga0496115_0032311 | |||
| 2102 | Ga0496115_0037757 | |||
| 2103 | Ga0496115_0134780 | |||
| 2104 | Ga0496115_0215009 | |||
| 2105 | Ga0496116_0000138 | |||
| 2106 | Ga0496117_0002715 | |||
| 2107 | Ga0496118_0000424 | |||
| 2108 | Ga0496119_0005703 | |||
| 2109 | Ga0496119_0007790 | |||
| 2110 | Ga0496119_0014904 | |||
| 2111 | Ga0496119_0021422 | |||
| 2112 | Ga0496119_0059615 | |||
| 2113 | Ga0496120_0002506 | |||
| 2114 | Ga0496121_0008090 | |||
| 2115 | Ga0496121_0111864 | |||
| 2116 | Ga0496121_0161553 | |||
| 2117 | Ga0496125_0022767 | |||
| 2118 | Ga0501032_0004690 | |||
| 2119 | Ga0501033_0099214 | |||
| 2120 | Ga0501034_0009420 | |||
| 2121 | Ga0501034_0128786 | |||
| 2122 | Ga0501036_0046408 | |||
| 2123 | Ga0501038_0016446 | |||
| 2124 | Ga0501039_0030969 | |||
| 2125 | Ga0501039_0190209 | |||
| 2126 | Ga0501042_0007340 | |||
| 2127 | Ga0501042_0194806 | |||
| 2128 | Ga0501046_0045753 | |||
| 2129 | Ga0501047_0053952 | |||
| 2130 | Ga0501047_0182365 | |||
| 2131 | Ga0501069_0000387 | |||
| 2132 | Ga0501070_0006896 | |||
| 2133 | Ga0501070_0017234 | |||
| 2134 | Ga0501249_003280 | |||
| 2135 | Ga0501079_0071732 | |||
| 2136 | nmdc:mga06z11_55717_c1 | |||
| 2137 | nmdc:mga05p37_10540_c1 | |||
| 2138 | nmdc:mga05p37_27122_c1 | |||
| 2139 | nmdc:mga05p37_29021_c1 | |||
| 2140 | nmdc:mga05p37_38141_c1 | |||
| 2141 | nmdc:mga09592_111263_c1 | |||
| 2142 | nmdc:mga09592_31516_c1 | |||
| 2143 | nmdc:mga0qj67_100862_c1 | |||
| 2144 | nmdc:mga0qj67_105601_c1 | |||
| 2145 | nmdc:mga0qj67_126806_c1 | |||
| 2146 | nmdc:mga0qj67_18732_c1 | |||
| 2147 | nmdc:mga0qj67_21097_c1 | |||
| 2148 | nmdc:mga0qj67_241184_c1 | |||
| 2149 | nmdc:mga0qj67_70731_c1 | |||
| 2150 | nmdc:mga06r32_11724_c1 | |||
| 2151 | nmdc:mga06r32_217756_c1 | |||
| 2152 | nmdc:mga06r32_26545_c1 | |||
| 2153 | nmdc:mga08y16_1438_c1 | |||
| 2154 | nmdc:mga08y16_27181_c1 | |||
| 2155 | nmdc:mga08y16_51543_c1 | |||
| 2156 | nmdc:mga08y16_62383_c1 | |||
| 2157 | nmdc:mga0n895_103767_c1 | |||
| 2158 | nmdc:mga0n895_147475_c1 | |||
| 2159 | nmdc:mga0n895_191761_c1 | |||
| 2160 | nmdc:mga0n895_38576_c1 | |||
| 2161 | nmdc:mga0n895_4006_c1 | |||
| 2162 | nmdc:mga0n895_51772_c1 | |||
| 2163 | nmdc:mga0n895_52902_c1 | |||
| 2164 | nmdc:mga0n895_6500_c1 | |||
| 2165 | nmdc:mga0rr50_10917_c1 | |||
| 2166 | nmdc:mga0rr50_13008_c1 | |||
| 2167 | nmdc:mga0rr50_24764_c1 | |||
| 2168 | nmdc:mga0rr50_26236_c1 | |||
| 2169 | nmdc:mga0rr50_5422_c1 | |||
| 2170 | nmdc:mga0rr50_60781_c1 | |||
| 2171 | nmdc:mga0rr50_69963_c1 | |||
| 2172 | nmdc:mga08x19_38054_c1 | |||
| 2173 | nmdc:mga0a205_18213_c1 | |||
| 2174 | nmdc:mga0a205_185303_c1 | |||
| 2175 | nmdc:mga0a205_21593_c1 | |||
| 2176 | nmdc:mga0a205_25548_c1 | |||
| 2177 | nmdc:mga0a205_271288_c1 | |||
| 2178 | nmdc:mga0a205_3610_c1 | |||
| 2179 | nmdc:mga0a205_62187_c1 | |||
| 2180 | nmdc:mga0a205_679_c1 | |||
| 2181 | nmdc:mga0a205_69143_c1 | |||
| 2182 | nmdc:mga0sz30_56499_c2 | |||
| 2183 | Ga0495601_0000110 | |||
| 2184 | Ga0495601_0000124 | |||
| 2185 | Ga0495601_0003438 | |||
| 2186 | Ga0495601_0013142 | |||
| 2187 | Ga0495601_0020740 | |||
| 2188 | Ga0495601_0048222 | |||
| 2189 | Ga0495612_0003172 | |||
| 2190 | Ga0495612_0010699 | |||
| 2191 | Ga0495612_0010857 | |||
| 2192 | Ga0495612_0023356 | |||
| 2193 | Ga0495655_0000008 | |||
| 2194 | Ga0495595_0001178 | |||
| 2195 | Ga0495595_0016809 | |||
| 2196 | Ga0495595_0038686 | |||
| 2197 | Ga0495619_0000025 | |||
| 2198 | Ga0495619_0001863 | |||
| 2199 | Ga0495619_0009701 | |||
| 2200 | Ga0495619_0021921 | |||
| 2201 | Ga0495619_0025437 | |||
| 2202 | Ga0495619_0042642 | |||
| 2203 | Ga0495619_0107445 | |||
| 2204 | Ga0500566_0002923 | |||
| 2205 | Ga0500556_0001512 | |||
| 2206 | Ga0500572_001267 | |||
| 2207 | Ga0500614_000117 | |||
| 2208 | Ga0500628_000023 | |||
| 2209 | Ga0500658_0000015 | |||
| 2210 | Ga0500559_0010654 | |||
| 2211 | Ga0500616_0011561 | |||
| 2212 | Ga0501082_0056838 | |||
| 2213 | 2523385192 | |||
| 2214 | 2687238119 | |||
| 2215 | 2738886880 | |||
| 2216 | 2740000265 | |||
| 2217 | 2740005081 | |||
| 2218 | 2758225509 | |||
| 2219 | 2812372081 | |||
| 2220 | 2819667620 | |||
| 2221 | 2819690921 | |||
| 2222 | 2819727738 | |||
| 2223 | 2857621489 | |||
| 2224 | 2870628812 | |||
| 2225 | 2919036786 | |||
| 2226 | 2919192496 | |||
| 2227 | 2939658176 | |||
| 2228 | 8054309405 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3dm8-assembly1.cif.gz_A-2 | crystal structure of putative isomerase from rhodopseudomonas palustris | 0.5083 | 269 | 314 |
| 3i4b-assembly1.cif.gz_A | crystal structure of gsk3b in complex with a pyrimidylpyrrole inhibitor | 0.4662 | 277 | 370 |
| 3rcd-assembly1.cif.gz_A | her2 kinase domain complexed with tak-285 | 0.4403 | 277 | 371 |
| 5jeb-assembly1.cif.gz_A | crystal structure of egfr tyrosine kinase domain with novel inhibitor of active state of her2 | 0.4272 | 273 | 371 |
| 4cyi-assembly2.cif.gz_C | chaetomium thermophilum pan3 | 0.4212 | 291 | 369 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9VIG3_1_153_3.30.200.20 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.5294 | 274 | 316 | 3.30.200.20 |
| 3dm8A00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.5083 | 269 | 314 | 3.10.450.50 |
| af_Q2FWK3_394_500_3.30.160.270 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Alpha-isopropylmalate synthase LeuA, regulatory domain | 0.4762 | 275 | 326 | 3.30.160.270 |
| 3attA01 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.4634 | 279 | 370 | 3.30.200.20 |
| af_Q12222_39_128_3.30.200.20 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.446 | 275 | 370 | 3.30.200.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1P8YCJ8-F1-model_v4 | DUF2252 domain-containing protein | 0.9812 | 1 | 458 |
GO:0016020
|
| AF-A0A359A5M1-F1-model_v4 | deleted | 0.9811 | 1 | 458 |
|
| AF-A0A401WF67-F1-model_v4 | DUF2252 domain-containing protein | 0.979 | 1 | 458 |
|
| AF-A0A359A5M1-F1-model_v4 | deleted | 0.979 | 1 | 458 |
|
| AF-A0A6B2XTZ6-F1-model_v4 | DUF2252 domain-containing protein | 0.9788 | 26 | 146 |
|