F490274

General Info

Members Datasets Scaffolds Average Seq Length
1114 391 2228 467

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10016860|Ga0075433_100168605
Length 534
Sequence VLWSRLDVLAYAQPASDHVILRGVPNMTALNARTEEATMAATTRSVRAQRAGGDIERDAPFASAWRRAHMSVDERVGRGRAARNEAPRSSHGHWEAAPDRPDPISLLEEQAKSRVAELVPIRYGRMLASPFTFYRGAAAIMAADLAGTPTSGVTVQLCGDAHLSNFGLFGTPERRLLFDINDFDETLPGPWEWDVKRLAASFEVMGREGGFSPADRRAVVMAGVRQYREKMGHAAKMGTLGAWYDQLDAQMLLKLVNEETRLRRLRRKEALTAGRRVAQARTRDSIRVFAKRARELNGELRIVADPPLIVPIEDLVIPGSEWENPTPLIKKLLSTYRRTLGRQGHPLEEFRYVHAARKVVGVGSVGTRCYLLLLMGRDRGDPLFLQVKEAQASVLEPFLGRSTYPHHGERIVVGQRLMQGATDIFLGWQRIRGLDGMTRDYYVRQFHDWKGGATVENLKMPGATFYARLCAATLARAHARWGDRIAIAAYLGKGDAFDRAIADFSVIYADQNERDYDSFRAAVNSGRLSAQTGI

Samples

Sample ID Description Type Environment
1 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
120 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
125 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
127 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
128 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
186 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
190 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
191 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
192 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
193 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
194 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
195 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
196 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
197 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
198 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
199 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
200 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
201 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
202 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
203 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
204 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
205 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
206 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
207 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
208 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
209 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
210 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
211 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
212 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
213 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
214 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
215 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
216 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
217 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
218 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
219 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
220 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
221 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
222 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
223 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
224 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
225 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
226 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
227 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
228 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
229 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
230 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
231 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
232 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
233 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
234 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
235 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
236 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
237 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
238 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
239 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
240 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
241 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
242 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
243 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
244 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
245 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
246 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
247 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
248 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
249 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
250 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
251 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
252 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
253 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
254 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
255 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
256 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
257 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
258 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
259 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
260 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
261 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
262 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
263 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
264 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
265 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
266 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
267 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
268 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
269 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
270 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
271 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
272 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
273 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
274 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
275 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
276 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
277 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
278 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
279 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
280 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
281 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
282 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
283 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
284 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
285 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
286 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
287 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
288 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
289 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
290 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
291 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
292 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
293 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
294 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
295 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
296 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
297 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
298 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
299 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
300 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
301 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
302 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
303 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
304 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
305 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
306 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
307 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
308 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
309 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
310 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
311 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
312 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
313 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
314 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
315 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
316 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
317 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
318 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
319 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
320 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
321 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
322 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
323 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
324 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
325 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
326 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
327 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
328 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
329 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
330 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
331 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
332 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
333 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
334 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
335 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
336 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
337 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
338 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
348 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
349 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
350 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
351 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
352 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
353 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
354 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
355 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
356 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
357 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
358 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
359 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
360 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
361 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
362 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
363 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
364 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
365 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
366 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
367 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
368 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
369 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
370 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
371 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
372 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
373 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
374 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
375 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
376 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
377 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified
378 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
379 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
380 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
381 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
382 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
383 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
384 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
385 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
386 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
387 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
388 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
389 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
390 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
391 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.58
Metatranscriptomes 0.99
Isolates 1.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.35
Nodule 0.09
Rhizoplane 11.58
Rhizosphere 84.65
Stem 0
Stem Tuber 0
Unclassified 1.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075433_10016860 3300006852 Bacteria 6036
2 JGI24740J21852_10000802 3300001979 Bacteria 13809
3 JGI25151J46595_10000166 3300003187 Bacteria 85475
4 JGI25407J50210_10006261 3300003373 Bacteria 2958
5 Ga0058863_11944294 3300004799 Bacteria 1894
6 Ga0058861_10082651 3300004800 Bacteria 2054
7 Ga0070683_100000558 3300005329 Bacteria 26449
8 Ga0070683_100002533 3300005329 Bacteria 14580
9 Ga0070683_100028383 3300005329 Bacteria 5056
10 Ga0070683_100039126 3300005329 Bacteria 4352
11 Ga0070683_100149948 3300005329 Bacteria 2211
12 Ga0068869_100021699 3300005334 Bacteria 4419
13 Ga0070680_100059941 3300005336 Bacteria 3115
14 Ga0070682_100000013 3300005337 Bacteria 254641
15 Ga0070682_100020489 3300005337 Unclassified 3891
16 Ga0070682_100062599 3300005337 Bacteria 2357
17 Ga0070682_100134408 3300005337 Bacteria 1678
18 Ga0070682_100143366 3300005337 Bacteria 1631
19 Ga0068868_100132802 3300005338 Bacteria 2038
20 Ga0068868_100180700 3300005338 Bacteria 1750
21 Ga0070660_100011436 3300005339 Bacteria 6305
22 Ga0070689_100033350 3300005340 Bacteria 3923
23 Ga0070691_10000100 3300005341 Bacteria 25275
24 Ga0070691_10012578 3300005341 Bacteria 3876
25 Ga0070691_10014628 3300005341 Bacteria 3601
26 Ga0070692_10011129 3300005345 Bacteria 4122
27 Ga0070692_10018220 3300005345 Bacteria 3372
28 Ga0070692_10107762 3300005345 Bacteria 1537
29 Ga0070668_100015399 3300005347 Bacteria 5715
30 Ga0070668_100027645 3300005347 Bacteria 4306
31 Ga0070668_100037245 3300005347 Bacteria 3713
32 Ga0070668_100065222 3300005347 Bacteria 2825
33 Ga0070669_100014929 3300005353 Bacteria 5535
34 Ga0070669_100104806 3300005353 Bacteria 2138
35 Ga0070675_100001463 3300005354 Bacteria 17411
36 Ga0070675_100013342 3300005354 Bacteria 6456
37 Ga0070675_100086774 3300005354 Bacteria 2616
38 Ga0070674_100139241 3300005356 Bacteria 1819
39 Ga0070674_100150710 3300005356 Bacteria 1755
40 Ga0070688_100038237 3300005365 Bacteria 2929
41 Ga0070659_100000852 3300005366 Bacteria 22251
42 Ga0070659_100012095 3300005366 Bacteria 6390
43 Ga0070659_100012543 3300005366 Bacteria 6283
44 Ga0070659_100065148 3300005366 Bacteria 2886
45 Ga0070659_100132928 3300005366 Bacteria 2021
46 Ga0070659_100183191 3300005366 Unclassified 1719
47 Ga0070667_100000597 3300005367 Bacteria 35219
48 Ga0070667_100183131 3300005367 Bacteria 1853
49 Ga0070714_100001300 3300005435 Bacteria 18068
50 Ga0070714_100003174 3300005435 Bacteria 12216
51 Ga0070714_100004997 3300005435 Bacteria 10082
52 Ga0070714_100006732 3300005435 Bacteria 8905
53 Ga0070714_100019304 3300005435 Bacteria 5549
54 Ga0070714_100019464 3300005435 Bacteria 5532
55 Ga0070714_100042155 3300005435 Bacteria 3854
56 Ga0070714_100046135 3300005435 Bacteria 3695
57 Ga0070714_100133144 3300005435 Bacteria 2223
58 Ga0070713_100001413 3300005436 Bacteria 15387
59 Ga0070713_100005405 3300005436 Bacteria 8726
60 Ga0070713_100032866 3300005436 Bacteria 4149
61 Ga0070713_100044804 3300005436 Bacteria 3622
62 Ga0070710_10000002 3300005437 Bacteria 290371
63 Ga0070710_10000267 3300005437 Bacteria 24789
64 Ga0070710_10022888 3300005437 Bacteria 3275
65 Ga0070710_10028899 3300005437 Bacteria 2969
66 Ga0070701_10010033 3300005438 Bacteria 4173
67 Ga0070701_10073309 3300005438 Bacteria 1836
68 Ga0070711_100000788 3300005439 Bacteria 16554
69 Ga0070711_100003451 3300005439 Bacteria 9212
70 Ga0070711_100011244 3300005439 Bacteria 5552
71 Ga0070711_100025477 3300005439 Bacteria 3870
72 Ga0070711_100031448 3300005439 Bacteria 3524
73 Ga0070711_100049324 3300005439 Bacteria 2883
74 Ga0070711_100050791 3300005439 Bacteria 2845
75 Ga0070711_100054959 3300005439 Bacteria 2749
76 Ga0070711_100077818 3300005439 Bacteria 2355
77 Ga0070711_100107448 3300005439 Bacteria 2042
78 Ga0070705_100009341 3300005440 Bacteria 4871
79 Ga0070700_100005283 3300005441 Bacteria 6833
80 Ga0070700_100010097 3300005441 Bacteria 5198
81 Ga0070700_100018773 3300005441 Bacteria 3980
82 Ga0070700_100052626 3300005441 Bacteria 2539
83 Ga0070694_100004651 3300005444 Bacteria 8260
84 Ga0070694_100076615 3300005444 Bacteria 2316
85 Ga0070708_100184572 3300005445 Bacteria 1950
86 Ga0070663_100002472 3300005455 Bacteria 10427
87 Ga0070663_100036784 3300005455 Bacteria 3403
88 Ga0070663_100132944 3300005455 Bacteria 1891
89 Ga0070663_100134704 3300005455 Bacteria 1880
90 Ga0070678_100040934 3300005456 Bacteria 3281
91 Ga0070678_100183952 3300005456 Bacteria 1713
92 Ga0070662_100013035 3300005457 Bacteria 5526
93 Ga0070662_100047016 3300005457 Bacteria 3102
94 Ga0070662_100049611 3300005457 Bacteria 3027
95 Ga0070662_100063899 3300005457 Bacteria 2694
96 Ga0070662_100137455 3300005457 Bacteria 1891
97 Ga0070662_100154358 3300005457 Bacteria 1791
98 Ga0070681_10014198 3300005458 Bacteria 7925
99 Ga0068867_100002154 3300005459 Bacteria 13812
100 Ga0068867_100008485 3300005459 Bacteria 7252
101 Ga0070685_10007229 3300005466 Bacteria 5676
102 Ga0070706_100025104 3300005467 Bacteria 5486
103 Ga0070707_100138905 3300005468 Bacteria 2364
104 Ga0070698_100031035 3300005471 Bacteria 5541
105 Ga0070698_100037283 3300005471 Bacteria 5013
106 Ga0070698_100259376 3300005471 Bacteria 1670
107 Ga0070699_100000043 3300005518 Bacteria 127213
108 Ga0070679_100041121 3300005530 Bacteria 4602
109 Ga0070679_100122463 3300005530 Bacteria 2585
110 Ga0070684_100006264 3300005535 Bacteria 9186
111 Ga0070684_100010636 3300005535 Bacteria 7297
112 Ga0070684_100011666 3300005535 Bacteria 7007
113 Ga0070684_100062282 3300005535 Bacteria 3267
114 Ga0070697_100021855 3300005536 Bacteria 5073
115 Ga0068853_100007231 3300005539 Bacteria 8893
116 Ga0068853_100063625 3300005539 Bacteria 3195
117 Ga0068853_100074408 3300005539 Bacteria 2963
118 Ga0068853_100093895 3300005539 Bacteria 2642
119 Ga0070672_100013162 3300005543 Bacteria 5834
120 Ga0070686_100029552 3300005544 Bacteria 3335
121 Ga0070686_100076181 3300005544 Bacteria 2208
122 Ga0070686_100111680 3300005544 Bacteria 1863
123 Ga0070695_100139300 3300005545 Bacteria 1680
124 Ga0070696_100088208 3300005546 Bacteria 2204
125 Ga0070696_100107322 3300005546 Bacteria 2008
126 Ga0070693_100009311 3300005547 Bacteria 4881
127 Ga0070665_100000106 3300005548 Bacteria 157315
128 Ga0070665_100006680 3300005548 Bacteria 11731
129 Ga0070665_100018108 3300005548 Bacteria 7067
130 Ga0070665_100131441 3300005548 Bacteria 2505
131 Ga0070665_100144277 3300005548 Bacteria 2384
132 Ga0068855_100016708 3300005563 Bacteria 8826
133 Ga0068855_100045286 3300005563 Bacteria 5203
134 Ga0070664_100013358 3300005564 Bacteria 6688
135 Ga0070664_100017902 3300005564 Bacteria 5817
136 Ga0070664_100154820 3300005564 Bacteria 2025
137 Ga0070664_100163711 3300005564 Bacteria 1969
138 Ga0068857_100017156 3300005577 Bacteria 6341
139 Ga0068857_100115106 3300005577 Bacteria 2419
140 Ga0068854_100004234 3300005578 Bacteria 9034
141 Ga0068854_100024072 3300005578 Bacteria 4165
142 Ga0068856_100003506 3300005614 Bacteria 15837
143 Ga0068856_100009718 3300005614 Bacteria 9344
144 Ga0068856_100014872 3300005614 Bacteria 7512
145 Ga0068856_100066493 3300005614 Bacteria 3562
146 Ga0068856_100109819 3300005614 Bacteria 2754
147 Ga0070702_100003799 3300005615 Bacteria 6824
148 Ga0070702_100005715 3300005615 Bacteria 5821
149 Ga0070702_100123530 3300005615 Bacteria 1624
150 Ga0068852_100008106 3300005616 Bacteria 7710
151 Ga0068852_100080517 3300005616 Bacteria 2888
152 Ga0068852_100091270 3300005616 Bacteria 2725
153 Ga0068852_100119796 3300005616 Bacteria 2407
154 Ga0068864_100000024 3300005618 Bacteria 252632
155 Ga0068864_100047627 3300005618 Bacteria 3683
156 Ga0068866_10016127 3300005718 Bacteria 3333
157 Ga0068861_100014414 3300005719 Bacteria 5549
158 Ga0068861_100055131 3300005719 Unclassified 3030
159 Ga0068861_100176098 3300005719 Bacteria 1776
160 Ga0068870_10062911 3300005840 Bacteria 2000
161 Ga0068870_10079616 3300005840 Bacteria 1808
162 Ga0068863_100016249 3300005841 Bacteria 7141
163 Ga0068863_100055706 3300005841 Bacteria 3744
164 Ga0068863_100079728 3300005841 Unclassified 3101
165 Ga0068858_100031114 3300005842 Bacteria 4955
166 Ga0068858_100081825 3300005842 Bacteria 3001
167 Ga0068860_100078060 3300005843 Bacteria 3149
168 Ga0068860_100128723 3300005843 Bacteria 2428
169 Ga0068860_100234091 3300005843 Bacteria 1785
170 Ga0068862_100000366 3300005844 Bacteria 49032
171 Ga0068862_100062940 3300005844 Bacteria 3192
172 Ga0068862_100087848 3300005844 Bacteria 2704
173 Ga0068862_100132971 3300005844 Bacteria 2202
174 Ga0068862_100200344 3300005844 Bacteria 1800
175 Ga0081455_10013896 3300005937 Bacteria 7914
176 Ga0081455_10016343 3300005937 Bacteria 7169
177 Ga0081538_10000023 3300005981 Bacteria 131101
178 Ga0081540_1000181 3300005983 Bacteria 65791
179 Ga0081540_1000757 3300005983 Bacteria 29739
180 Ga0081540_1007808 3300005983 Bacteria 7570
181 Ga0081540_1037492 3300005983 Bacteria 2568
182 Ga0081539_10001052 3300005985 Bacteria 50554
183 Ga0070717_10000006 3300006028 Bacteria 353403
184 Ga0070717_10002252 3300006028 Bacteria 13525
185 Ga0070717_10003906 3300006028 Bacteria 10722
186 Ga0070717_10008176 3300006028 Bacteria 7808
187 Ga0070717_10026014 3300006028 Bacteria 4664
188 Ga0070717_10053450 3300006028 Bacteria 3329
189 Ga0075363_100021934 3300006048 Bacteria 3224
190 Ga0075364_10017590 3300006051 Bacteria 4469
191 Ga0070715_10001599 3300006163 Bacteria 6675
192 Ga0070716_100001363 3300006173 Bacteria 10842
193 Ga0070716_100003719 3300006173 Bacteria 7223
194 Ga0070712_100000003 3300006175 Bacteria 253696
195 Ga0070712_100003227 3300006175 Bacteria 10049
196 Ga0070712_100019601 3300006175 Bacteria 4415
197 Ga0070712_100024148 3300006175 Bacteria 4024
198 Ga0070712_100027943 3300006175 Bacteria 3769
199 Ga0070712_100069626 3300006175 Bacteria 2511
200 Ga0070712_100158695 3300006175 Bacteria 1745
201 Ga0097621_100011114 3300006237 Bacteria 6622
202 Ga0097621_100140573 3300006237 Bacteria 2063
203 Ga0068871_100032952 3300006358 Bacteria 4097
204 Ga0068871_100034036 3300006358 Bacteria 4040
205 Ga0068871_100040731 3300006358 Bacteria 3722
206 Ga0068871_100041886 3300006358 Bacteria 3673
207 Ga0068871_100075188 3300006358 Unclassified 2788
208 Ga0075428_100022812 3300006844 Bacteria 6926
209 Ga0075428_100028236 3300006844 Bacteria 6205
210 Ga0075428_100079512 3300006844 Bacteria 3578
211 Ga0075428_100081909 3300006844 Bacteria 3521
212 Ga0075428_100134561 3300006844 Bacteria 2688
213 Ga0075430_100011868 3300006846 Bacteria 7415
214 Ga0075430_100041483 3300006846 Bacteria 3893
215 Ga0075430_100041844 3300006846 Bacteria 3876
216 Ga0075430_100113457 3300006846 Bacteria 2259
217 Ga0075431_100000685 3300006847 Bacteria 29059
218 Ga0075431_100065005 3300006847 Bacteria 3767
219 Ga0075431_100082299 3300006847 Bacteria 3322
220 Ga0075433_10004165 3300006852 Bacteria 11227
221 Ga0075433_10031502 3300006852 Bacteria 4534
222 Ga0075433_10042932 3300006852 Bacteria 3924
223 Ga0075433_10063711 3300006852 Bacteria 3230
224 Ga0075434_100004695 3300006871 Bacteria 12345
225 Ga0075434_100030794 3300006871 Bacteria 5286
226 Ga0075434_100077166 3300006871 Bacteria 3326
227 Ga0075434_100144366 3300006871 Bacteria 2400
228 Ga0075434_100225994 3300006871 Unclassified 1891
229 Ga0075434_100228529 3300006871 Bacteria 1880
230 Ga0075429_100116021 3300006880 Bacteria 2341
231 Ga0068865_100003061 3300006881 Bacteria 10003
232 Ga0068865_100005688 3300006881 Bacteria 7573
233 Ga0068865_100094754 3300006881 Bacteria 2173
234 Ga0075436_100006626 3300006914 Bacteria 7936
235 Ga0075436_100009259 3300006914 Bacteria 6738
236 Ga0099824_1000332 3300006942 Bacteria 51674
237 Ga0075435_100010048 3300007076 Bacteria 6901
238 Ga0075435_100010366 3300007076 Bacteria 6814
239 Ga0075435_100014025 3300007076 Bacteria 5976
240 Ga0075435_100082894 3300007076 Bacteria 2636
241 Ga0075435_100122502 3300007076 Bacteria 2171
242 Ga0105240_10032970 3300009093 Bacteria 6698
243 Ga0105240_10094357 3300009093 Bacteria 3650
244 Ga0105240_10192408 3300009093 Bacteria 2398
245 Ga0111539_10002534 3300009094 Bacteria 24191
246 Ga0111539_10002876 3300009094 Bacteria 22852
247 Ga0111539_10030024 3300009094 Bacteria 6613
248 Ga0111539_10108769 3300009094 Bacteria 3253
249 Ga0111539_10164550 3300009094 Bacteria 2594
250 Ga0111539_10343497 3300009094 Unclassified 1737
251 Ga0105245_10010376 3300009098 Bacteria 8114
252 Ga0105245_10013722 3300009098 Bacteria 7057
253 Ga0105245_10047423 3300009098 Bacteria 3841
254 Ga0105245_10069086 3300009098 Bacteria 3203
255 Ga0105245_10073817 3300009098 Bacteria 3103
256 Ga0105245_10108511 3300009098 Bacteria 2578
257 Ga0105245_10236092 3300009098 Bacteria 1770
258 Ga0105247_10000369 3300009101 Bacteria 38254
259 Ga0114129_10036368 3300009147 Bacteria 6954
260 Ga0114129_10079769 3300009147 Bacteria 4551
261 Ga0105243_10003685 3300009148 Bacteria 12321
262 Ga0105243_10005915 3300009148 Bacteria 9476
263 Ga0105243_10017401 3300009148 Bacteria 5434
264 Ga0105243_10041665 3300009148 Bacteria 3590
265 Ga0105243_10048351 3300009148 Bacteria 3353
266 Ga0105243_10071064 3300009148 Bacteria 2813
267 Ga0105243_10085160 3300009148 Bacteria 2590
268 Ga0105241_10068171 3300009174 Bacteria 2756
269 Ga0105242_10001159 3300009176 Bacteria 20774
270 Ga0105242_10008877 3300009176 Bacteria 7714
271 Ga0105242_10016636 3300009176 Bacteria 5721
272 Ga0105242_10018440 3300009176 Bacteria 5456
273 Ga0105242_10060082 3300009176 Bacteria 3121
274 Ga0105242_10091633 3300009176 Bacteria 2559
275 Ga0105242_10176318 3300009176 Bacteria 1882
276 Ga0105242_10194217 3300009176 Bacteria 1799
277 Ga0105242_10238791 3300009176 Bacteria 1633
278 Ga0105248_10009406 3300009177 Bacteria 10759
279 Ga0105248_10066247 3300009177 Bacteria 4056
280 Ga0105248_10127493 3300009177 Bacteria 2871
281 Ga0105248_10296632 3300009177 Bacteria 1820
282 Ga0105237_10028453 3300009545 Bacteria 5693
283 Ga0105237_10226999 3300009545 Bacteria 1868
284 Ga0105238_10019629 3300009551 Bacteria 6883
285 Ga0105238_10152433 3300009551 Bacteria 2286
286 Ga0105238_10262486 3300009551 Unclassified 1707
287 Ga0105249_10000916 3300009553 Bacteria 26081
288 Ga0105249_10002508 3300009553 Bacteria 15869
289 Ga0105249_10009694 3300009553 Bacteria 8440
290 Ga0105249_10107528 3300009553 Bacteria 2632
291 Ga0105249_10150221 3300009553 Bacteria 2242
292 Ga0105239_10009449 3300010375 Bacteria 10987
293 Ga0105239_10033703 3300010375 Bacteria 5623
294 Ga0105239_10103632 3300010375 Bacteria 3149
295 Ga0105239_10112707 3300010375 Bacteria 3016
296 Ga0105246_10018236 3300011119 Bacteria 4472
297 Ga0105246_10033619 3300011119 Bacteria 3410
298 Ga0157373_10000003 3300013100 Bacteria 454601
299 Ga0157373_10075674 3300013100 Bacteria 2375
300 Ga0157371_10049289 3300013102 Bacteria 2992
301 Ga0157370_10033202 3300013104 Bacteria 5031
302 Ga0157370_10151057 3300013104 Bacteria 2161
303 Ga0157369_10009457 3300013105 Bacteria 11144
304 Ga0157369_10033435 3300013105 Bacteria 5651
305 Ga0157369_10069460 3300013105 Bacteria 3784
306 Ga0157374_10322458 3300013296 Bacteria 1531
307 Ga0157378_10217413 3300013297 Bacteria 1815
308 Ga0157378_10271297 3300013297 Bacteria 1632
309 Ga0163162_10014212 3300013306 Bacteria 7777
310 Ga0163162_10014551 3300013306 Bacteria 7689
311 Ga0163162_10025640 3300013306 Bacteria 5828
312 Ga0163162_10026336 3300013306 Bacteria 5748
313 Ga0163162_10030239 3300013306 Bacteria 5366
314 Ga0163162_10205614 3300013306 Bacteria 2098
315 Ga0163162_10236293 3300013306 Bacteria 1958
316 Ga0163162_10339249 3300013306 Bacteria 1635
317 Ga0157372_10008824 3300013307 Bacteria 10708
318 Ga0157372_10309031 3300013307 Bacteria 1840
319 Ga0157375_10003892 3300013308 Bacteria 12951
320 Ga0157375_10004006 3300013308 Bacteria 12778
321 Ga0157375_10016208 3300013308 Bacteria 6684
322 Ga0157375_10086370 3300013308 Bacteria 3188
323 Ga0157375_10103526 3300013308 Bacteria 2934
324 Ga0157375_10247796 3300013308 Bacteria 1942
325 Ga0157375_10427895 3300013308 Bacteria 1490
326 Ga0163163_10007110 3300014325 Bacteria 9840
327 Ga0163163_10043622 3300014325 Bacteria 4397
328 Ga0157380_10018093 3300014326 Bacteria 5227
329 Ga0157380_10032636 3300014326 Unclassified 4007
330 Ga0157380_10039774 3300014326 Bacteria 3659
331 Ga0157380_10080362 3300014326 Bacteria 2664
332 Ga0157380_10136826 3300014326 Bacteria 2098
333 Ga0157380_10177339 3300014326 Bacteria 1869
334 Ga0157377_10001163 3300014745 Bacteria 11149
335 Ga0157377_10005504 3300014745 Bacteria 5959
336 Ga0157377_10126072 3300014745 Bacteria 1558
337 Ga0157379_10018892 3300014968 Bacteria 6081
338 Ga0157379_10140789 3300014968 Bacteria 2175
339 Ga0157376_10004119 3300014969 Bacteria 10073
340 Ga0182006_1041690 3300015261 Bacteria 1801
341 Ga0163161_10017674 3300017792 Bacteria 4996
342 Ga0163161_10047150 3300017792 Unclassified 3112
343 Ga0163161_10055314 3300017792 Bacteria 2881
344 Ga0163161_10078165 3300017792 Bacteria 2432
345 Ga0197907_10292294 3300020069 Bacteria 1676
346 Ga0206355_1195442 3300020076 Bacteria 2100
347 Ga0206351_10206386 3300020077 Bacteria 1904
348 Ga0206351_10855698 3300020077 Bacteria 2173
349 Ga0206352_10111744 3300020078 Bacteria 1992
350 Ga0206352_11357117 3300020078 Bacteria 2025
351 Ga0206353_11863956 3300020082 Bacteria 1900
352 Ga0154015_1332211 3300020610 Bacteria 2384
353 Ga0213872_10023559 3300021361 Bacteria 2833
354 Ga0224712_10004327 3300022467 Bacteria 3817
355 Ga0209025_1000053 3300025294 Bacteria 317600
356 Ga0209758_1001127 3300025297 Bacteria 34298
357 Ga0207692_10000005 3300025898 Bacteria 370169
358 Ga0207692_10004714 3300025898 Bacteria 5411
359 Ga0207692_10006213 3300025898 Bacteria 4837
360 Ga0207642_10021960 3300025899 Bacteria 2522
361 Ga0207710_10000227 3300025900 Bacteria 48932
362 Ga0207688_10006721 3300025901 Bacteria 6255
363 Ga0207688_10069458 3300025901 Bacteria 1996
364 Ga0207647_10008001 3300025904 Bacteria 7603
365 Ga0207647_10051955 3300025904 Bacteria 2531
366 Ga0207647_10055729 3300025904 Bacteria 2428
367 Ga0207685_10010684 3300025905 Bacteria 2724
368 Ga0207685_10031309 3300025905 Unclassified 1903
369 Ga0207699_10003875 3300025906 Bacteria 7148
370 Ga0207645_10039419 3300025907 Bacteria 3027
371 Ga0207705_10013443 3300025909 Bacteria 5905
372 Ga0207684_10208636 3300025910 Bacteria 1685
373 Ga0207654_10091040 3300025911 Bacteria 1859
374 Ga0207707_10017087 3300025912 Bacteria 6322
375 Ga0207707_10017437 3300025912 Bacteria 6260
376 Ga0207695_10003637 3300025913 Bacteria 21542
377 Ga0207693_10000009 3300025915 Bacteria 168990
378 Ga0207693_10001273 3300025915 Bacteria 22484
379 Ga0207693_10002186 3300025915 Bacteria 17054
380 Ga0207693_10002493 3300025915 Bacteria 16014
381 Ga0207693_10003950 3300025915 Bacteria 12603
382 Ga0207693_10015101 3300025915 Bacteria 6199
383 Ga0207693_10083758 3300025915 Bacteria 2498
384 Ga0207693_10131025 3300025915 Bacteria 1971
385 Ga0207663_10005201 3300025916 Bacteria 6548
386 Ga0207663_10005313 3300025916 Bacteria 6484
387 Ga0207663_10016114 3300025916 Bacteria 4136
388 Ga0207663_10023197 3300025916 Bacteria 3557
389 Ga0207663_10066960 3300025916 Bacteria 2301
390 Ga0207663_10080764 3300025916 Bacteria 2127
391 Ga0207663_10128601 3300025916 Bacteria 1746
392 Ga0207660_10085054 3300025917 Bacteria 2332
393 Ga0207662_10056488 3300025918 Bacteria 2344
394 Ga0207657_10005677 3300025919 Bacteria 13017
395 Ga0207657_10012567 3300025919 Bacteria 8346
396 Ga0207657_10093682 3300025919 Bacteria 2502
397 Ga0207649_10116054 3300025920 Bacteria 1797
398 Ga0207652_10051270 3300025921 Bacteria 3538
399 Ga0207646_10082643 3300025922 Bacteria 2872
400 Ga0207646_10104150 3300025922 Bacteria 2545
401 Ga0207681_10045347 3300025923 Bacteria 2951
402 Ga0207681_10086256 3300025923 Bacteria 2230
403 Ga0207694_10076077 3300025924 Unclassified 2628
404 Ga0207659_10003884 3300025926 Bacteria 9009
405 Ga0207659_10040587 3300025926 Bacteria 3255
406 Ga0207687_10027279 3300025927 Bacteria 3831
407 Ga0207687_10037166 3300025927 Bacteria 3320
408 Ga0207687_10053621 3300025927 Bacteria 2818
409 Ga0207687_10176006 3300025927 Bacteria 1654
410 Ga0207700_10005015 3300025928 Bacteria 7875
411 Ga0207700_10012605 3300025928 Bacteria 5461
412 Ga0207700_10112071 3300025928 Bacteria 2197
413 Ga0207664_10003838 3300025929 Bacteria 10096
414 Ga0207664_10005028 3300025929 Bacteria 8996
415 Ga0207664_10007360 3300025929 Bacteria 7630
416 Ga0207664_10008030 3300025929 Bacteria 7338
417 Ga0207664_10012014 3300025929 Bacteria 6182
418 Ga0207664_10022821 3300025929 Bacteria 4680
419 Ga0207664_10051885 3300025929 Bacteria 3241
420 Ga0207664_10053517 3300025929 Bacteria 3196
421 Ga0207664_10070425 3300025929 Bacteria 2814
422 Ga0207664_10097511 3300025929 Bacteria 2422
423 Ga0207690_10029423 3300025932 Bacteria 3493
424 Ga0207690_10039765 3300025932 Bacteria 3070
425 Ga0207690_10071111 3300025932 Bacteria 2399
426 Ga0207706_10002554 3300025933 Bacteria 17744
427 Ga0207706_10003441 3300025933 Bacteria 15118
428 Ga0207706_10005339 3300025933 Bacteria 11976
429 Ga0207706_10015246 3300025933 Bacteria 6951
430 Ga0207706_10018736 3300025933 Bacteria 6226
431 Ga0207706_10040269 3300025933 Bacteria 4141
432 Ga0207706_10099242 3300025933 Bacteria 2562
433 Ga0207686_10000035 3300025934 Bacteria 130483
434 Ga0207686_10001551 3300025934 Bacteria 12972
435 Ga0207686_10053260 3300025934 Bacteria 2529
436 Ga0207709_10001318 3300025935 Bacteria 17566
437 Ga0207709_10035002 3300025935 Bacteria 2965
438 Ga0207709_10068835 3300025935 Bacteria 2239
439 Ga0207709_10117364 3300025935 Bacteria 1790
440 Ga0207670_10021496 3300025936 Bacteria 3982
441 Ga0207669_10020443 3300025937 Bacteria 3473
442 Ga0207704_10006123 3300025938 Bacteria 5579
443 Ga0207704_10016620 3300025938 Bacteria 3787
444 Ga0207704_10102160 3300025938 Bacteria 1914
445 Ga0207665_10001498 3300025939 Bacteria 15698
446 Ga0207665_10004626 3300025939 Bacteria 9137
447 Ga0207665_10039692 3300025939 Bacteria 3139
448 Ga0207665_10043840 3300025939 Bacteria 2992
449 Ga0207691_10003769 3300025940 Bacteria 14721
450 Ga0207691_10178554 3300025940 Bacteria 1856
451 Ga0207711_10018257 3300025941 Bacteria 5830
452 Ga0207711_10162875 3300025941 Bacteria 2020
453 Ga0207689_10028298 3300025942 Bacteria 4690
454 Ga0207689_10036645 3300025942 Bacteria 4072
455 Ga0207689_10071506 3300025942 Bacteria 2849
456 Ga0207689_10150840 3300025942 Bacteria 1916
457 Ga0207661_10000896 3300025944 Bacteria 19528
458 Ga0207661_10005047 3300025944 Bacteria 9262
459 Ga0207661_10017682 3300025944 Bacteria 5283
460 Ga0207661_10023477 3300025944 Bacteria 4660
461 Ga0207661_10060629 3300025944 Bacteria 3053
462 Ga0207661_10181926 3300025944 Bacteria 1837
463 Ga0207679_10033544 3300025945 Bacteria 3613
464 Ga0207712_10018506 3300025961 Bacteria 4539
465 Ga0207712_10064710 3300025961 Bacteria 2608
466 Ga0207712_10111032 3300025961 Bacteria 2057
467 Ga0207712_10120762 3300025961 Bacteria 1982
468 Ga0207668_10007005 3300025972 Bacteria 6686
469 Ga0207668_10137382 3300025972 Bacteria 1875
470 Ga0207668_10142092 3300025972 Bacteria 1847
471 Ga0207640_10109174 3300025981 Unclassified 1957
472 Ga0207658_10000465 3300025986 Bacteria 37863
473 Ga0207677_10044985 3300026023 Bacteria 2945
474 Ga0207677_10087065 3300026023 Unclassified 2260
475 Ga0207677_10140050 3300026023 Bacteria 1851
476 Ga0207703_10121530 3300026035 Bacteria 2242
477 Ga0207703_10246477 3300026035 Bacteria 1608
478 Ga0207639_10005344 3300026041 Bacteria 8678
479 Ga0207639_10075794 3300026041 Bacteria 2646
480 Ga0207678_10003330 3300026067 Bacteria 14492
481 Ga0207678_10013416 3300026067 Bacteria 7192
482 Ga0207678_10016969 3300026067 Bacteria 6394
483 Ga0207678_10098105 3300026067 Bacteria 2503
484 Ga0207678_10145917 3300026067 Bacteria 2020
485 Ga0207708_10002772 3300026075 Bacteria 12872
486 Ga0207708_10013121 3300026075 Bacteria 6183
487 Ga0207708_10017990 3300026075 Bacteria 5317
488 Ga0207708_10020425 3300026075 Bacteria 4996
489 Ga0207708_10058018 3300026075 Bacteria 2954
490 Ga0207702_10028773 3300026078 Bacteria 4621
491 Ga0207702_10044134 3300026078 Bacteria 3746
492 Ga0207702_10050195 3300026078 Bacteria 3522
493 Ga0207702_10063186 3300026078 Bacteria 3165
494 Ga0207702_10085384 3300026078 Bacteria 2750
495 Ga0207641_10011889 3300026088 Bacteria 7140
496 Ga0207641_10042529 3300026088 Bacteria 3812
497 Ga0207641_10084193 3300026088 Unclassified 2768
498 Ga0207648_10003623 3300026089 Bacteria 16151
499 Ga0207648_10003682 3300026089 Bacteria 16035
500 Ga0207648_10005519 3300026089 Bacteria 12747
501 Ga0207648_10074878 3300026089 Bacteria 2951
502 Ga0207676_10000048 3300026095 Bacteria 147853
503 Ga0207676_10056628 3300026095 Bacteria 3083
504 Ga0207674_10001090 3300026116 Bacteria 35329
505 Ga0207674_10025958 3300026116 Bacteria 6235
506 Ga0207675_100036180 3300026118 Bacteria 4605
507 Ga0207675_100088285 3300026118 Bacteria 2912
508 Ga0207675_100213549 3300026118 Bacteria 1857
509 Ga0207675_100234454 3300026118 Bacteria 1772
510 Ga0207683_10000941 3300026121 Bacteria 26696
511 Ga0207683_10020763 3300026121 Bacteria 5620
512 Ga0207683_10102639 3300026121 Bacteria 2554
513 Ga0207683_10125432 3300026121 Bacteria 2307
514 Ga0207698_10008521 3300026142 Bacteria 6494
515 Ga0207698_10059113 3300026142 Bacteria 2975
516 Ga0207698_10099693 3300026142 Bacteria 2404
517 Ga0207698_10122177 3300026142 Bacteria 2206
518 Ga0207428_10001212 3300027907 Bacteria 27686
519 Ga0207428_10014005 3300027907 Bacteria 6985
520 Ga0207428_10080458 3300027907 Unclassified 2545
521 Ga0268266_10161541 3300028379 Bacteria 2027
522 Ga0268266_10167727 3300028379 Bacteria 1991
523 Ga0268265_10001048 3300028380 Bacteria 24851
524 Ga0268264_10110101 3300028381 Bacteria 2411
525 Ga0268264_10175727 3300028381 Bacteria 1941
526 Ga0268264_10212271 3300028381 Bacteria 1777
527 Ga0268264_10220509 3300028381 Bacteria 1746
528 Ga0265337_1000060 3300028556 Bacteria 49697
529 Ga0265326_10000056 3300028558 Bacteria 64840
530 Ga0265319_1000037 3300028563 Bacteria 115642
531 Ga0265322_10000017 3300028654 Bacteria 114833
532 Ga0265338_10000051 3300028800 Bacteria 211202
533 Ga0265338_10175064 3300028800 Bacteria 1641
534 Ga0265324_10000196 3300029957 Bacteria 46096
535 Ga0307511_10020634 3300030521 Bacteria 6233
536 Ga0265332_10022481 3300031238 Bacteria 2783
537 Ga0265328_10000258 3300031239 Bacteria 24453
538 Ga0265320_10000068 3300031240 Bacteria 91884
539 Ga0265329_10001686 3300031242 Bacteria 10577
540 Ga0265331_10000606 3300031250 Bacteria 31608
541 Ga0265331_10004016 3300031250 Bacteria 9283
542 Ga0265327_10000018 3300031251 Bacteria 439197
543 Ga0265327_10000317 3300031251 Bacteria 92215
544 Ga0265327_10063849 3300031251 Bacteria 1868
545 Ga0265316_10034806 3300031344 Bacteria 4089
546 Ga0307513_10006242 3300031456 Bacteria 15613
547 Ga0307513_10201135 3300031456 Bacteria 1833
548 Ga0307408_100020500 3300031548 Bacteria 4465
549 Ga0265313_10006987 3300031595 Bacteria 7829
550 Ga0307508_10150367 3300031616 Bacteria 1932
551 Ga0316575_10001075 3300031665 Bacteria 8519
552 Ga0316575_10002167 3300031665 Bacteria 6550
553 Ga0316579_10005583 3300031691 Bacteria 5088
554 Ga0265314_10000973 3300031711 Bacteria 33669
555 Ga0265314_10064755 3300031711 Bacteria 2473
556 Ga0265342_10094047 3300031712 Bacteria 1715
557 Ga0316576_10001067 3300031727 Bacteria 14245
558 Ga0316576_10012627 3300031727 Bacteria 5587
559 Ga0316576_10028532 3300031727 Bacteria 3934
560 Ga0316576_10108327 3300031727 Bacteria 2081
561 Ga0316578_10014810 3300031728 Bacteria 4178
562 Ga0316577_10011476 3300031733 Bacteria 4800
563 Ga0316577_10033831 3300031733 Bacteria 2856
564 Ga0307413_10000272 3300031824 Bacteria 15774
565 Ga0307410_10002547 3300031852 Bacteria 8826
566 Ga0307406_10014287 3300031901 Bacteria 4565
567 Ga0307407_10001800 3300031903 Bacteria 8022
568 Ga0307412_10017513 3300031911 Bacteria 4289
569 Ga0307409_100011608 3300031995 Bacteria 5565
570 Ga0307416_100139478 3300032002 Bacteria 2201
571 Ga0307414_10003567 3300032004 Bacteria 8329
572 Ga0307411_10000003 3300032005 Bacteria 477556
573 Ga0307411_10047461 3300032005 Bacteria 2776
574 Ga0307415_100009645 3300032126 Bacteria 5427
575 Ga0316585_10003725 3300032137 Bacteria 4205
576 Ga0316585_10005770 3300032137 Bacteria 3505
577 Ga0316580_10001868 3300032139 Bacteria 5650
578 Ga0373926_0000085 3300035083 Bacteria 17960
579 Ga0373934_0004651 3300035086 Bacteria 5075
580 Ga0373940_0038524 3300035088 Bacteria 1305
581 Ga0373944_0000201 3300035089 Bacteria 12777
582 Ga0373951_0012974 3300035091 Bacteria 1874
583 Ga0373923_0000654 3300035111 Bacteria 8765
584 Ga0373932_0022750 3300035112 Bacteria 1668
585 Ga0373936_0001199 3300035113 Bacteria 9336
586 Ga0373936_0019069 3300035113 Bacteria 2656
587 Ga0373941_0011532 3300035115 Bacteria 2286
588 Ga0373945_0000115 3300035116 Bacteria 19575
589 Ga0373945_0000374 3300035116 Bacteria 12870
590 Ga0373953_0000290 3300035117 Bacteria 13750
591 Ga0373953_0001319 3300035117 Bacteria 7116
592 Ga0373954_0000277 3300035118 Bacteria 18681
593 Ga0373954_0006958 3300035118 Bacteria 4938
594 Ga0373956_0000733 3300035119 Bacteria 13479
595 Ga0373956_0012653 3300035119 Bacteria 3501
596 Ga0373957_0000032 3300035120 Bacteria 36214
597 Ga0373957_0009644 3300035120 Bacteria 3164
598 Ga0373943_0000129 3300035170 Bacteria 28679
599 Ga0373943_0003042 3300035170 Bacteria 7618
600 Ga0373943_0023348 3300035170 Bacteria 2875
601 Ga0373943_0076020 3300035170 Bacteria 1712
602 Ga0373946_0000428 3300035171 Bacteria 13745
603 Ga0373946_0000709 3300035171 Bacteria 11299
604 Ga0373955_0000092 3300035172 Bacteria 36115
605 Ga0373955_0026927 3300035172 Bacteria 2967
606 Ga0373955_0030615 3300035172 Bacteria 2811
607 Ga0316574_0000052 3300035398 Bacteria 29685
608 Ga0316574_0036378 3300035398 Bacteria 3013
609 Ga0316574_0074281 3300035398 Bacteria 2151
610 Ga0373924_0000555 3300035410 Bacteria 11493
611 Ga0373924_0009457 3300035410 Bacteria 3571
612 Ga0373931_0018769 3300035691 Bacteria 3443
613 Ga0373935_0000628 3300035692 Bacteria 18518
614 Ga0373935_0003273 3300035692 Bacteria 9366
615 Ga0373935_0168636 3300035692 Bacteria 1496
616 Ga0373927_0002848 3300035695 Bacteria 12621
617 Ga0373927_0004146 3300035695 Bacteria 10196
618 Ga0373927_0074168 3300035695 Bacteria 2203
619 Ga0373933_0000121 3300035724 Bacteria 50773
620 Ga0373947_0000901 3300035725 Bacteria 17992
621 Ga0373947_0003331 3300035725 Bacteria 9516
622 Ga0373947_0038902 3300035725 Bacteria 2829
623 Ga0373947_0057317 3300035725 Bacteria 2357
624 Ga0373947_0058616 3300035725 Bacteria 2333
625 Ga0373947_0120244 3300035725 Bacteria 1668
626 Ga0373947_0142491 3300035725 Bacteria 1538
627 Ga0373937_0000169 3300036401 Bacteria 63595
628 Ga0373937_0018127 3300036401 Bacteria 6280
629 Ga0373937_0018778 3300036401 Bacteria 6179
630 Ga0373937_0021306 3300036401 Bacteria 5817
631 Ga0373937_0048404 3300036401 Bacteria 3892
632 Ga0373937_0057773 3300036401 Bacteria 3564
633 Ga0373937_0116738 3300036401 Bacteria 2485
634 Ga0316582_0000166 3300036647 Bacteria 20311
635 Ga0316584_0005054 3300036712 Bacteria 8789
636 Ga0316584_0007826 3300036712 Bacteria 7331
637 Ga0316584_0026524 3300036712 Bacteria 4259
638 Ga0316584_0029469 3300036712 Bacteria 4051
639 Ga0316584_0051911 3300036712 Bacteria 3067
640 Ga0316584_0091485 3300036712 Bacteria 2278
641 Ga0316584_0139184 3300036712 Bacteria 1811
642 Ga0373925_0002434 3300037068 Bacteria 14935
643 Ga0373925_0003472 3300037068 Bacteria 12194
644 Ga0373925_0034931 3300037068 Bacteria 3707
645 Ga0373925_0037510 3300037068 Bacteria 3578
646 Ga0373925_0140157 3300037068 Bacteria 1892
647 Ga0395900_0111834 3300037418 Bacteria 2805
648 Ga0395900_0233340 3300037418 Bacteria 1849
649 Ga0395898_0028626 3300037466 Bacteria 5583
650 Ga0395898_0190730 3300037466 Bacteria 1958
651 Ga0316581_0001663 3300037588 Bacteria 5103
652 Ga0395901_0018262 3300038443 Bacteria 7161
653 Ga0395901_0161922 3300038443 Bacteria 2350
654 Ga0395901_0193477 3300038443 Bacteria 2133
655 Ga0242420_000347 3300038996 Bacteria 5142
656 Ga0436360_0633769 3300039438 Bacteria 11634
657 Ga0436361_0002000 3300039447 Bacteria 1855
658 Ga0436361_0035073 3300039447 Bacteria 7878
659 Ga0436361_0336407 3300039447 Bacteria 16691
660 Ga0436361_0510461 3300039447 Bacteria 4197
661 Ga0436361_0735490 3300039447 Bacteria 23457
662 Ga0436363_0472667 3300039450 Bacteria 1777
663 Ga0436362_0003157 3300039453 Bacteria 13284
664 Ga0439447_000024 3300041407 Bacteria 53601
665 Ga0451853_1257484 3300041512 Bacteria 3450
666 Ga0466963_0000281 3300044694 Bacteria 22762
667 Ga0466963_0004575 3300044694 Bacteria 8052
668 Ga0466958_0007766 3300045836 Bacteria 5919
669 Ga0466967_0003703 3300045976 Bacteria 10067
670 Ga0466967_0015423 3300045976 Bacteria 5989
671 Ga0466967_0052298 3300045976 Bacteria 3584
672 Ga0466967_0077622 3300045976 Bacteria 2990
673 Ga0495592_0000070 3300046454 Bacteria 93255
674 Ga0495592_0000220 3300046454 Bacteria 49173
675 Ga0495592_0003048 3300046454 Bacteria 11941
676 Ga0495603_0023570 3300046455 Bacteria 3722
677 Ga0495603_0033679 3300046455 Bacteria 3082
678 Ga0495629_0009244 3300046459 Bacteria 7212
679 Ga0495629_0041398 3300046459 Bacteria 3242
680 Ga0495629_0088760 3300046459 Bacteria 2157
681 Ga0495629_0177689 3300046459 Bacteria 1476
682 Ga0495641_0000044 3300046461 Bacteria 77415
683 Ga0495641_0000742 3300046461 Bacteria 27572
684 Ga0495641_0004675 3300046461 Bacteria 9554
685 Ga0495641_0018240 3300046461 Bacteria 3626
686 Ga0495641_0038696 3300046461 Bacteria 2227
687 Ga0495651_0000034 3300046462 Bacteria 99213
688 Ga0495651_0000042 3300046462 Bacteria 93255
689 Ga0495651_0002437 3300046462 Bacteria 14361
690 Ga0495651_0009283 3300046462 Bacteria 7548
691 Ga0495651_0012581 3300046462 Bacteria 6530
692 Ga0495651_0066441 3300046462 Bacteria 2752
693 Ga0495651_0126539 3300046462 Bacteria 1871
694 Ga0495653_0000416 3300046463 Bacteria 34136
695 Ga0495653_0000669 3300046463 Bacteria 26191
696 Ga0495653_0013842 3300046463 Bacteria 6574
697 Ga0495653_0039619 3300046463 Bacteria 3690
698 Ga0495653_0089525 3300046463 Bacteria 2254
699 Ga0495582_0007328 3300046473 Bacteria 6112
700 Ga0495582_0019734 3300046473 Bacteria 3686
701 Ga0495582_0025352 3300046473 Bacteria 3248
702 Ga0495662_0001224 3300046476 Bacteria 12633
703 Ga0495662_0035185 3300046476 Bacteria 2417
704 Ga0495664_0001885 3300046477 Bacteria 11153
705 Ga0495664_0006030 3300046477 Bacteria 6681
706 Ga0495664_0018691 3300046477 Bacteria 3976
707 Ga0495664_0095018 3300046477 Bacteria 1794
708 Ga0495584_0050343 3300046491 Bacteria 2098
709 Ga0495594_0000001 3300046499 Bacteria 293051
710 Ga0495594_0037340 3300046499 Bacteria 2650
711 Ga0495608_0000054 3300046511 Bacteria 93255
712 Ga0495608_0000584 3300046511 Bacteria 25040
713 Ga0495608_0005192 3300046511 Bacteria 9304
714 Ga0495608_0018319 3300046511 Bacteria 4832
715 Ga0495608_0027634 3300046511 Bacteria 3859
716 Ga0495608_0050745 3300046511 Bacteria 2752
717 Ga0495608_0093071 3300046511 Bacteria 1947
718 Ga0495618_0002174 3300046514 Bacteria 12819
719 Ga0495620_0000144 3300046515 Bacteria 58204
720 Ga0495628_0000040 3300046516 Bacteria 104506
721 Ga0495628_0000106 3300046516 Bacteria 67965
722 Ga0495628_0000548 3300046516 Bacteria 34470
723 Ga0495628_0008134 3300046516 Bacteria 9024
724 Ga0495628_0026747 3300046516 Bacteria 4699
725 Ga0495628_0076419 3300046516 Bacteria 2606
726 Ga0495628_0077467 3300046516 Bacteria 2586
727 Ga0495628_0089313 3300046516 Bacteria 2387
728 Ga0495628_0095682 3300046516 Bacteria 2294
729 Ga0495628_0143245 3300046516 Bacteria 1823
730 Ga0495630_0007970 3300046517 Bacteria 7602
731 Ga0495630_0027711 3300046517 Bacteria 4207
732 Ga0495630_0218180 3300046517 Bacteria 1456
733 Ga0495666_0001713 3300046526 Bacteria 10830
734 Ga0495652_0000119 3300046529 Bacteria 85582
735 Ga0495652_0002645 3300046529 Bacteria 18255
736 Ga0495652_0006599 3300046529 Bacteria 10780
737 Ga0495652_0012958 3300046529 Bacteria 7515
738 Ga0495652_0024428 3300046529 Bacteria 5349
739 Ga0495652_0036500 3300046529 Bacteria 4273
740 Ga0495652_0057114 3300046529 Bacteria 3311
741 Ga0495652_0079778 3300046529 Bacteria 2705
742 Ga0495665_0001874 3300046531 Bacteria 11363
743 Ga0495665_0025665 3300046531 Bacteria 3165
744 Ga0495640_0002238 3300046533 Bacteria 15493
745 Ga0495640_0012252 3300046533 Bacteria 6561
746 Ga0495640_0069624 3300046533 Bacteria 2366
747 Ga0495586_0011461 3300046535 Bacteria 4713
748 Ga0495586_0028610 3300046535 Bacteria 2982
749 Ga0495587_0000055 3300046536 Bacteria 97024
750 Ga0495587_0000119 3300046536 Bacteria 60244
751 Ga0495587_0000208 3300046536 Bacteria 43565
752 Ga0495587_0021986 3300046536 Bacteria 3931
753 Ga0495587_0076226 3300046536 Bacteria 1947
754 Ga0495645_0000073 3300046543 Bacteria 70164
755 Ga0495645_0004517 3300046543 Bacteria 9499
756 Ga0495645_0009728 3300046543 Bacteria 6724
757 Ga0495645_0014243 3300046543 Bacteria 5639
758 Ga0495645_0025818 3300046543 Bacteria 4265
759 Ga0495645_0027180 3300046543 Bacteria 4155
760 Ga0495645_0050054 3300046543 Bacteria 3042
761 Ga0495645_0087386 3300046543 Bacteria 2230
762 Ga0495645_0150754 3300046543 Bacteria 1615
763 Ga0495622_0000033 3300046557 Bacteria 124162
764 Ga0495667_0000019 3300046559 Bacteria 181645
765 Ga0495667_0000253 3300046559 Bacteria 34719
766 Ga0495667_0000786 3300046559 Bacteria 20379
767 Ga0495667_0004224 3300046559 Bacteria 9683
768 Ga0495667_0004526 3300046559 Bacteria 9380
769 Ga0495667_0024978 3300046559 Bacteria 4026
770 Ga0495634_0000018 3300046642 Bacteria 121323
771 Ga0495634_0001902 3300046642 Bacteria 17893
772 Ga0495634_0003663 3300046642 Bacteria 12250
773 Ga0495625_0000109 3300046660 Bacteria 125064
774 Ga0495635_0006237 3300046663 Bacteria 8305
775 Ga0495635_0007795 3300046663 Bacteria 7476
776 Ga0495635_0104834 3300046663 Bacteria 1932
777 Ga0495657_0000067 3300046675 Bacteria 93255
778 Ga0495657_0027438 3300046675 Bacteria 4018
779 Ga0495657_0032893 3300046675 Bacteria 3615
780 Ga0495657_0109621 3300046675 Bacteria 1750
781 Ga0495599_0000042 3300046678 Bacteria 94912
782 Ga0495599_0000173 3300046678 Bacteria 42460
783 Ga0495599_0003417 3300046678 Bacteria 9292
784 Ga0495599_0023499 3300046678 Bacteria 3855
785 Ga0495599_0031788 3300046678 Bacteria 3313
786 Ga0495599_0054268 3300046678 Bacteria 2511
787 Ga0495623_0000101 3300046679 Bacteria 52470
788 Ga0495623_0035821 3300046679 Bacteria 3181
789 Ga0495623_0047400 3300046679 Bacteria 2727
790 Ga0495623_0054890 3300046679 Bacteria 2513
791 Ga0495623_0074173 3300046679 Bacteria 2114
792 Ga0495623_0097522 3300046679 Bacteria 1795
793 Ga0495646_0005486 3300046680 Bacteria 8017
794 Ga0495646_0009050 3300046680 Bacteria 6313
795 Ga0495646_0010006 3300046680 Bacteria 6029
796 Ga0495646_0014587 3300046680 Bacteria 4993
797 Ga0495646_0026385 3300046680 Bacteria 3649
798 Ga0495646_0028953 3300046680 Bacteria 3466
799 Ga0495647_0013226 3300046681 Bacteria 2857
800 Ga0495647_0044345 3300046681 Bacteria 1705
801 Ga0495658_0001583 3300046683 Bacteria 11873
802 Ga0495658_0002011 3300046683 Bacteria 10362
803 Ga0495613_0007629 3300046689 Bacteria 8046
804 Ga0495613_0107403 3300046689 Bacteria 2013
805 Ga0495613_0201242 3300046689 Bacteria 1404
806 Ga0495624_0002113 3300046690 Bacteria 15159
807 Ga0495624_0018620 3300046690 Bacteria 4643
808 Ga0495624_0032751 3300046690 Bacteria 3368
809 Ga0495600_0003523 3300046809 Bacteria 9203
810 Ga0495600_0005898 3300046809 Bacteria 7411
811 Ga0495600_0012266 3300046809 Bacteria 5355
812 Ga0495600_0057945 3300046809 Bacteria 2530
813 Ga0495581_0000642 3300047315 Bacteria 18306
814 Ga0495581_0001959 3300047315 Bacteria 11531
815 Ga0495581_0010170 3300047315 Bacteria 5442
816 Ga0495604_0000120 3300047317 Bacteria 66462
817 Ga0495604_0000121 3300047317 Bacteria 65991
818 Ga0495604_0006362 3300047317 Bacteria 9364
819 Ga0495604_0011115 3300047317 Bacteria 7146
820 Ga0495674_0005612 3300047319 Bacteria 12032
821 Ga0495674_0011270 3300047319 Bacteria 8440
822 Ga0495674_0019676 3300047319 Bacteria 6263
823 Ga0495674_0059367 3300047319 Bacteria 3340
824 Ga0495674_0123969 3300047319 Unclassified 2181
825 Ga0495676_0000928 3300047321 Bacteria 24577
826 Ga0495676_0003693 3300047321 Bacteria 13893
827 Ga0495676_0004043 3300047321 Bacteria 13354
828 Ga0495676_0006190 3300047321 Bacteria 11004
829 Ga0495676_0066007 3300047321 Bacteria 2806
830 Ga0495676_0147446 3300047321 Bacteria 1679
831 Ga0495680_0000054 3300047322 Bacteria 93244
832 Ga0495680_0001641 3300047322 Bacteria 23765
833 Ga0495680_0001765 3300047322 Bacteria 22914
834 Ga0495680_0002289 3300047322 Bacteria 19707
835 Ga0495680_0005698 3300047322 Bacteria 11659
836 Ga0495680_0009533 3300047322 Bacteria 8725
837 Ga0495680_0018763 3300047322 Bacteria 5862
838 Ga0495680_0020072 3300047322 Bacteria 5630
839 Ga0495680_0037660 3300047322 Bacteria 3873
840 Ga0495680_0084308 3300047322 Bacteria 2395
841 Ga0495675_0000029 3300047444 Bacteria 105305
842 Ga0495675_0000176 3300047444 Bacteria 46587
843 Ga0495675_0071560 3300047444 Bacteria 2188
844 Ga0495675_0077140 3300047444 Bacteria 2099
845 Ga0495684_0000562 3300047471 Bacteria 30116
846 Ga0495684_0001716 3300047471 Bacteria 17633
847 Ga0495684_0001870 3300047471 Bacteria 16849
848 Ga0495684_0008951 3300047471 Bacteria 7732
849 Ga0495684_0010104 3300047471 Bacteria 7299
850 Ga0495684_0010681 3300047471 Bacteria 7099
851 Ga0495684_0052690 3300047471 Bacteria 3105
852 Ga0495686_0000020 3300047472 Bacteria 429191
853 Ga0495686_0104501 3300047472 Bacteria 1705
854 Ga0495593_0004833 3300047673 Bacteria 7990
855 Ga0495602_0000083 3300048088 Bacteria 93242
856 Ga0495602_0001081 3300048088 Bacteria 26704
857 Ga0495602_0004291 3300048088 Bacteria 14846
858 Ga0495602_0004572 3300048088 Bacteria 14436
859 Ga0495602_0034960 3300048088 Bacteria 4692
860 Ga0495602_0038087 3300048088 Bacteria 4452
861 Ga0495602_0050130 3300048088 Bacteria 3733
862 Ga0496100_0000019 3300048903 Bacteria 149995
863 Ga0496100_0003734 3300048903 Bacteria 7970
864 Ga0496100_0005515 3300048903 Bacteria 6827
865 Ga0496100_0006389 3300048903 Bacteria 6425
866 Ga0496100_0011308 3300048903 Bacteria 5079
867 Ga0496100_0023604 3300048903 Bacteria 3739
868 Ga0496100_0050281 3300048903 Bacteria 2700
869 Ga0496101_0000005 3300048904 Bacteria 331455
870 Ga0496101_0025969 3300048904 Bacteria 4068
871 Ga0496101_0057627 3300048904 Bacteria 2810
872 Ga0496101_0089632 3300048904 Bacteria 2286
873 Ga0496101_0284127 3300048904 Bacteria 1294
874 Ga0496102_0000021 3300048905 Bacteria 246920
875 Ga0496102_0024895 3300048905 Bacteria 5323
876 Ga0496102_0029102 3300048905 Bacteria 4939
877 Ga0496102_0031693 3300048905 Bacteria 4744
878 Ga0496102_0037880 3300048905 Bacteria 4349
879 Ga0496102_0066504 3300048905 Bacteria 3303
880 Ga0496102_0128068 3300048905 Bacteria 2374
881 Ga0496102_0167077 3300048905 Bacteria 2071
882 Ga0496102_0285040 3300048905 Bacteria 1557
883 Ga0496103_0000001 3300048906 Bacteria 643471
884 Ga0496103_0007179 3300048906 Bacteria 6643
885 Ga0496103_0053282 3300048906 Bacteria 2507
886 Ga0496103_0064679 3300048906 Bacteria 2280
887 Ga0496103_0074041 3300048906 Bacteria 2134
888 Ga0496104_0000029 3300048907 Bacteria 202968
889 Ga0496104_0000551 3300048907 Bacteria 31933
890 Ga0496104_0008695 3300048907 Bacteria 9030
891 Ga0496104_0018535 3300048907 Bacteria 6351
892 Ga0496104_0029165 3300048907 Bacteria 5117
893 Ga0496104_0153399 3300048907 Bacteria 2211
894 Ga0496104_0154114 3300048907 Bacteria 2205
895 Ga0496104_0181132 3300048907 Bacteria 2017
896 Ga0496104_0219752 3300048907 Bacteria 1812
897 Ga0496105_0000002 3300048908 Bacteria 753215
898 Ga0496105_0007317 3300048908 Bacteria 8527
899 Ga0496105_0007781 3300048908 Bacteria 8318
900 Ga0496105_0011873 3300048908 Bacteria 6898
901 Ga0496105_0013858 3300048908 Bacteria 6404
902 Ga0496105_0037207 3300048908 Bacteria 4008
903 Ga0496105_0106059 3300048908 Bacteria 2320
904 Ga0496105_0123184 3300048908 Bacteria 2137
905 Ga0496105_0132247 3300048908 Bacteria 2057
906 Ga0496106_0000033 3300048909 Bacteria 131412
907 Ga0496106_0001620 3300048909 Bacteria 16924
908 Ga0496106_0002498 3300048909 Bacteria 13685
909 Ga0496106_0005382 3300048909 Bacteria 9471
910 Ga0496106_0011536 3300048909 Bacteria 6534
911 Ga0496106_0032180 3300048909 Bacteria 3910
912 Ga0496106_0087764 3300048909 Bacteria 2397
913 Ga0496106_0215607 3300048909 Bacteria 1530
914 Ga0496106_0231732 3300048909 Bacteria 1474
915 Ga0496107_0000004 3300048910 Bacteria 297680
916 Ga0496107_0001120 3300048910 Bacteria 16167
917 Ga0496107_0009391 3300048910 Bacteria 6783
918 Ga0496107_0010207 3300048910 Bacteria 6516
919 Ga0496107_0074309 3300048910 Bacteria 2473
920 Ga0496107_0108244 3300048910 Bacteria 2041
921 Ga0496107_0195020 3300048910 Bacteria 1505
922 Ga0496108_0000187 3300048911 Bacteria 57568
923 Ga0496108_0006174 3300048911 Bacteria 9692
924 Ga0496108_0012519 3300048911 Bacteria 6908
925 Ga0496108_0015305 3300048911 Bacteria 6258
926 Ga0496108_0029554 3300048911 Bacteria 4540
927 Ga0496108_0045410 3300048911 Bacteria 3670
928 Ga0496108_0045656 3300048911 Bacteria 3659
929 Ga0496108_0050063 3300048911 Bacteria 3496
930 Ga0496108_0065269 3300048911 Bacteria 3068
931 Ga0496108_0097162 3300048911 Bacteria 2510
932 Ga0496108_0107050 3300048911 Bacteria 2387
933 Ga0496109_0000636 3300048912 Bacteria 29254
934 Ga0496109_0011911 3300048912 Bacteria 7488
935 Ga0496109_0015902 3300048912 Bacteria 6571
936 Ga0496109_0057804 3300048912 Bacteria 3542
937 Ga0496109_0060773 3300048912 Bacteria 3453
938 Ga0496109_0066426 3300048912 Bacteria 3302
939 Ga0496109_0085910 3300048912 Bacteria 2905
940 Ga0496109_0128724 3300048912 Bacteria 2362
941 Ga0496110_0009948 3300048913 Bacteria 7711
942 Ga0496110_0010762 3300048913 Bacteria 7455
943 Ga0496110_0013223 3300048913 Bacteria 6815
944 Ga0496110_0014802 3300048913 Bacteria 6481
945 Ga0496110_0026382 3300048913 Bacteria 4971
946 Ga0496110_0035902 3300048913 Bacteria 4304
947 Ga0496110_0048112 3300048913 Bacteria 3737
948 Ga0496110_0068392 3300048913 Bacteria 3143
949 Ga0496110_0182004 3300048913 Bacteria 1908
950 Ga0496110_0187494 3300048913 Bacteria 1878
951 Ga0496110_0231352 3300048913 Bacteria 1681
952 Ga0496111_0004675 3300048914 Bacteria 8678
953 Ga0496111_0014526 3300048914 Bacteria 5383
954 Ga0496111_0014676 3300048914 Bacteria 5358
955 Ga0496111_0041217 3300048914 Bacteria 3313
956 Ga0496111_0047847 3300048914 Bacteria 3080
957 Ga0496111_0057454 3300048914 Bacteria 2817
958 Ga0496111_0101851 3300048914 Bacteria 2110
959 Ga0496111_0160691 3300048914 Bacteria 1668
960 Ga0496111_0192486 3300048914 Bacteria 1516
961 Ga0496112_0001147 3300048915 Bacteria 19779
962 Ga0496112_0009893 3300048915 Bacteria 8621
963 Ga0496112_0026382 3300048915 Bacteria 5589
964 Ga0496112_0062499 3300048915 Bacteria 3673
965 Ga0496112_0068233 3300048915 Bacteria 3511
966 Ga0496112_0078518 3300048915 Bacteria 3264
967 Ga0496112_0098819 3300048915 Bacteria 2888
968 Ga0496112_0108236 3300048915 Bacteria 2750
969 Ga0496112_0157518 3300048915 Bacteria 2238
970 Ga0496113_0002968 3300048916 Bacteria 10034
971 Ga0496113_0010955 3300048916 Bacteria 6022
972 Ga0496113_0094109 3300048916 Bacteria 2314
973 Ga0496113_0096997 3300048916 Bacteria 2280
974 Ga0496113_0162980 3300048916 Bacteria 1763
975 Ga0496113_0175229 3300048916 Bacteria 1699
976 Ga0496114_0000003 3300048917 Bacteria 630981
977 Ga0496114_0001583 3300048917 Bacteria 17261
978 Ga0496114_0003903 3300048917 Bacteria 11499
979 Ga0496114_0006313 3300048917 Bacteria 9328
980 Ga0496114_0008959 3300048917 Bacteria 7934
981 Ga0496114_0013045 3300048917 Bacteria 6659
982 Ga0496114_0046563 3300048917 Unclassified 3604
983 Ga0496114_0132957 3300048917 Bacteria 2150
984 Ga0496115_0001724 3300048918 Bacteria 15676
985 Ga0496115_0016518 3300048918 Bacteria 5622
986 Ga0496115_0022266 3300048918 Bacteria 4908
987 Ga0496115_0032311 3300048918 Bacteria 4128
988 Ga0496115_0037757 3300048918 Bacteria 3829
989 Ga0496115_0134780 3300048918 Bacteria 2036
990 Ga0496115_0215009 3300048918 Bacteria 1587
991 Ga0496116_0000138 3300048919 Bacteria 151606
992 Ga0496117_0002715 3300048920 Bacteria 21760
993 Ga0496118_0000424 3300048921 Bacteria 70137
994 Ga0496119_0005703 3300048922 Bacteria 11807
995 Ga0496119_0007790 3300048922 Bacteria 9553
996 Ga0496119_0014904 3300048922 Bacteria 6043
997 Ga0496119_0021422 3300048922 Bacteria 4674
998 Ga0496119_0059615 3300048922 Bacteria 2291
999 Ga0496120_0002506 3300048923 Bacteria 18404
1000 Ga0496121_0008090 3300048924 Bacteria 12514
1001 Ga0496121_0111864 3300048924 Bacteria 2081
1002 Ga0496121_0161553 3300048924 Bacteria 1637
1003 Ga0496125_0022767 3300048928 Bacteria 5808
1004 Ga0501032_0004690 3300049569 Bacteria 10261
1005 Ga0501033_0099214 3300049570 Bacteria 2126
1006 Ga0501034_0009420 3300049571 Bacteria 10222
1007 Ga0501034_0128786 3300049571 Bacteria 2515
1008 Ga0501036_0046408 3300049572 Bacteria 3679
1009 Ga0501038_0016446 3300049574 Bacteria 6704
1010 Ga0501039_0030969 3300049575 Bacteria 4124
1011 Ga0501039_0190209 3300049575 Bacteria 1614
1012 Ga0501042_0007340 3300049578 Bacteria 7215
1013 Ga0501042_0194806 3300049578 Bacteria 1461
1014 Ga0501046_0045753 3300049580 Bacteria 3475
1015 Ga0501047_0053952 3300049581 Bacteria 3889
1016 Ga0501047_0182365 3300049581 Bacteria 1965
1017 Ga0501069_0000387 3300049585 Bacteria 19897
1018 Ga0501070_0006896 3300049586 Bacteria 9665
1019 Ga0501070_0017234 3300049586 Bacteria 6065
1020 Ga0501249_003280 3300049679 Bacteria 3255
1021 Ga0501079_0071732 3300049741 Bacteria 2676
1022 nmdc:mga06z11_55717_c1 3300050494 Bacteria 2042
1023 nmdc:mga05p37_10540_c1 3300050507 Bacteria 10961
1024 nmdc:mga05p37_27122_c1 3300050507 Bacteria 6972
1025 nmdc:mga05p37_29021_c1 3300050507 Bacteria 6751
1026 nmdc:mga05p37_38141_c1 3300050507 Bacteria 5893
1027 nmdc:mga09592_111263_c1 3300050508 Bacteria 2350
1028 nmdc:mga09592_31516_c1 3300050508 Bacteria 4418
1029 nmdc:mga0qj67_100862_c1 3300050509 Bacteria 2327
1030 nmdc:mga0qj67_105601_c1 3300050509 Bacteria 2272
1031 nmdc:mga0qj67_126806_c1 3300050509 Bacteria 2065
1032 nmdc:mga0qj67_18732_c1 3300050509 Bacteria 5278
1033 nmdc:mga0qj67_21097_c1 3300050509 Bacteria 4995
1034 nmdc:mga0qj67_241184_c1 3300050509 Bacteria 1467
1035 nmdc:mga0qj67_70731_c1 3300050509 Bacteria 2784
1036 nmdc:mga06r32_11724_c1 3300050510 Bacteria 7890
1037 nmdc:mga06r32_217756_c1 3300050510 Bacteria 1897
1038 nmdc:mga06r32_26545_c1 3300050510 Bacteria 5401
1039 nmdc:mga08y16_1438_c1 3300050511 Bacteria 23849
1040 nmdc:mga08y16_27181_c1 3300050511 Bacteria 6029
1041 nmdc:mga08y16_51543_c1 3300050511 Bacteria 4305
1042 nmdc:mga08y16_62383_c1 3300050511 Bacteria 3893
1043 nmdc:mga0n895_103767_c1 3300050512 Bacteria 2855
1044 nmdc:mga0n895_147475_c1 3300050512 Bacteria 2383
1045 nmdc:mga0n895_191761_c1 3300050512 Bacteria 2075
1046 nmdc:mga0n895_38576_c1 3300050512 Bacteria 4630
1047 nmdc:mga0n895_4006_c1 3300050512 Bacteria 11980
1048 nmdc:mga0n895_51772_c1 3300050512 Bacteria 4029
1049 nmdc:mga0n895_52902_c1 3300050512 Bacteria 3988
1050 nmdc:mga0n895_6500_c1 3300050512 Bacteria 9938
1051 nmdc:mga0rr50_10917_c1 3300050513 Bacteria 5792
1052 nmdc:mga0rr50_13008_c1 3300050513 Bacteria 5401
1053 nmdc:mga0rr50_24764_c1 3300050513 Bacteria 4162
1054 nmdc:mga0rr50_26236_c1 3300050513 Bacteria 4062
1055 nmdc:mga0rr50_5422_c1 3300050513 Bacteria 7606
1056 nmdc:mga0rr50_60781_c1 3300050513 Bacteria 2844
1057 nmdc:mga0rr50_69963_c1 3300050513 Bacteria 2673
1058 nmdc:mga08x19_38054_c1 3300050514 Bacteria 3055
1059 nmdc:mga0a205_18213_c1 3300050515 Bacteria 6598
1060 nmdc:mga0a205_185303_c1 3300050515 Bacteria 1974
1061 nmdc:mga0a205_21593_c1 3300050515 Bacteria 6089
1062 nmdc:mga0a205_25548_c1 3300050515 Bacteria 5627
1063 nmdc:mga0a205_271288_c1 3300050515 Bacteria 1573
1064 nmdc:mga0a205_3610_c1 3300050515 Bacteria 13853
1065 nmdc:mga0a205_62187_c1 3300050515 Bacteria 3607
1066 nmdc:mga0a205_679_c1 3300050515 Bacteria 27196
1067 nmdc:mga0a205_69143_c1 3300050515 Bacteria 3411
1068 nmdc:mga0sz30_56499_c2 3300050516 Bacteria 1381
1069 Ga0495601_0000110 3300053077 Bacteria 44959
1070 Ga0495601_0000124 3300053077 Bacteria 43205
1071 Ga0495601_0003438 3300053077 Bacteria 9074
1072 Ga0495601_0013142 3300053077 Bacteria 4977
1073 Ga0495601_0020740 3300053077 Bacteria 4017
1074 Ga0495601_0048222 3300053077 Bacteria 2683
1075 Ga0495612_0003172 3300053078 Bacteria 6811
1076 Ga0495612_0010699 3300053078 Bacteria 3707
1077 Ga0495612_0010857 3300053078 Bacteria 3680
1078 Ga0495612_0023356 3300053078 Bacteria 2481
1079 Ga0495655_0000008 3300053083 Bacteria 153535
1080 Ga0495595_0001178 3300053084 Bacteria 10157
1081 Ga0495595_0016809 3300053084 Bacteria 3136
1082 Ga0495595_0038686 3300053084 Bacteria 2174
1083 Ga0495619_0000025 3300053085 Bacteria 167905
1084 Ga0495619_0001863 3300053085 Bacteria 14045
1085 Ga0495619_0009701 3300053085 Bacteria 6070
1086 Ga0495619_0021921 3300053085 Bacteria 4084
1087 Ga0495619_0025437 3300053085 Bacteria 3802
1088 Ga0495619_0042642 3300053085 Bacteria 2972
1089 Ga0495619_0107445 3300053085 Bacteria 1904
1090 Ga0500566_0002923 3300053094 Bacteria 10195
1091 Ga0500556_0001512 3300053104 Bacteria 9592
1092 Ga0500572_001267 3300053111 Bacteria 7103
1093 Ga0500614_000117 3300053123 Bacteria 19001
1094 Ga0500628_000023 3300053129 Bacteria 77818
1095 Ga0500658_0000015 3300053134 Bacteria 151134
1096 Ga0500559_0010654 3300053136 Bacteria 3941
1097 Ga0500616_0011561 3300053153 Bacteria 5203
1098 Ga0501082_0056838 3300060353 Bacteria 3371
1099 2523385192 2523231044 Bacteria 6434991
1100 2687238119 2684623219 Bacteria 8442773
1101 2738886880 2738541308 Bacteria 7020677
1102 2740000265 2739367857 Bacteria 5433684
1103 2740005081 2739367858 Bacteria 5432813
1104 2758225509 2757320536 Bacteria 3629334
1105 2812372081 2811994882 Bacteria 4688362
1106 2819667620 2818991458 Bacteria 4794049
1107 2819690921 2818991462 Bacteria 4320267
1108 2819727738 2818991469 Bacteria 4644110
1109 2857621489 2857618242 Bacteria 5635925
1110 2870628812 2870628048 Bacteria 3696012
1111 2919036786 2919034639 Bacteria 4763403
1112 2919192496 2919191525 Bacteria 5765973
1113 2939658176 2939657138 Bacteria 3740283
1114 8054309405 8054307821 Bacteria 5212224
1115 Ga0075433_10016860
1116 JGI24740J21852_10000802
1117 JGI25151J46595_10000166
1118 JGI25407J50210_10006261
1119 Ga0058863_11944294
1120 Ga0058861_10082651
1121 Ga0070683_100000558
1122 Ga0070683_100002533
1123 Ga0070683_100028383
1124 Ga0070683_100039126
1125 Ga0070683_100149948
1126 Ga0068869_100021699
1127 Ga0070680_100059941
1128 Ga0070682_100000013
1129 Ga0070682_100020489
1130 Ga0070682_100062599
1131 Ga0070682_100134408
1132 Ga0070682_100143366
1133 Ga0068868_100132802
1134 Ga0068868_100180700
1135 Ga0070660_100011436
1136 Ga0070689_100033350
1137 Ga0070691_10000100
1138 Ga0070691_10012578
1139 Ga0070691_10014628
1140 Ga0070692_10011129
1141 Ga0070692_10018220
1142 Ga0070692_10107762
1143 Ga0070668_100015399
1144 Ga0070668_100027645
1145 Ga0070668_100037245
1146 Ga0070668_100065222
1147 Ga0070669_100014929
1148 Ga0070669_100104806
1149 Ga0070675_100001463
1150 Ga0070675_100013342
1151 Ga0070675_100086774
1152 Ga0070674_100139241
1153 Ga0070674_100150710
1154 Ga0070688_100038237
1155 Ga0070659_100000852
1156 Ga0070659_100012095
1157 Ga0070659_100012543
1158 Ga0070659_100065148
1159 Ga0070659_100132928
1160 Ga0070659_100183191
1161 Ga0070667_100000597
1162 Ga0070667_100183131
1163 Ga0070714_100001300
1164 Ga0070714_100003174
1165 Ga0070714_100004997
1166 Ga0070714_100006732
1167 Ga0070714_100019304
1168 Ga0070714_100019464
1169 Ga0070714_100042155
1170 Ga0070714_100046135
1171 Ga0070714_100133144
1172 Ga0070713_100001413
1173 Ga0070713_100005405
1174 Ga0070713_100032866
1175 Ga0070713_100044804
1176 Ga0070710_10000002
1177 Ga0070710_10000267
1178 Ga0070710_10022888
1179 Ga0070710_10028899
1180 Ga0070701_10010033
1181 Ga0070701_10073309
1182 Ga0070711_100000788
1183 Ga0070711_100003451
1184 Ga0070711_100011244
1185 Ga0070711_100025477
1186 Ga0070711_100031448
1187 Ga0070711_100049324
1188 Ga0070711_100050791
1189 Ga0070711_100054959
1190 Ga0070711_100077818
1191 Ga0070711_100107448
1192 Ga0070705_100009341
1193 Ga0070700_100005283
1194 Ga0070700_100010097
1195 Ga0070700_100018773
1196 Ga0070700_100052626
1197 Ga0070694_100004651
1198 Ga0070694_100076615
1199 Ga0070708_100184572
1200 Ga0070663_100002472
1201 Ga0070663_100036784
1202 Ga0070663_100132944
1203 Ga0070663_100134704
1204 Ga0070678_100040934
1205 Ga0070678_100183952
1206 Ga0070662_100013035
1207 Ga0070662_100047016
1208 Ga0070662_100049611
1209 Ga0070662_100063899
1210 Ga0070662_100137455
1211 Ga0070662_100154358
1212 Ga0070681_10014198
1213 Ga0068867_100002154
1214 Ga0068867_100008485
1215 Ga0070685_10007229
1216 Ga0070706_100025104
1217 Ga0070707_100138905
1218 Ga0070698_100031035
1219 Ga0070698_100037283
1220 Ga0070698_100259376
1221 Ga0070699_100000043
1222 Ga0070679_100041121
1223 Ga0070679_100122463
1224 Ga0070684_100006264
1225 Ga0070684_100010636
1226 Ga0070684_100011666
1227 Ga0070684_100062282
1228 Ga0070697_100021855
1229 Ga0068853_100007231
1230 Ga0068853_100063625
1231 Ga0068853_100074408
1232 Ga0068853_100093895
1233 Ga0070672_100013162
1234 Ga0070686_100029552
1235 Ga0070686_100076181
1236 Ga0070686_100111680
1237 Ga0070695_100139300
1238 Ga0070696_100088208
1239 Ga0070696_100107322
1240 Ga0070693_100009311
1241 Ga0070665_100000106
1242 Ga0070665_100006680
1243 Ga0070665_100018108
1244 Ga0070665_100131441
1245 Ga0070665_100144277
1246 Ga0068855_100016708
1247 Ga0068855_100045286
1248 Ga0070664_100013358
1249 Ga0070664_100017902
1250 Ga0070664_100154820
1251 Ga0070664_100163711
1252 Ga0068857_100017156
1253 Ga0068857_100115106
1254 Ga0068854_100004234
1255 Ga0068854_100024072
1256 Ga0068856_100003506
1257 Ga0068856_100009718
1258 Ga0068856_100014872
1259 Ga0068856_100066493
1260 Ga0068856_100109819
1261 Ga0070702_100003799
1262 Ga0070702_100005715
1263 Ga0070702_100123530
1264 Ga0068852_100008106
1265 Ga0068852_100080517
1266 Ga0068852_100091270
1267 Ga0068852_100119796
1268 Ga0068864_100000024
1269 Ga0068864_100047627
1270 Ga0068866_10016127
1271 Ga0068861_100014414
1272 Ga0068861_100055131
1273 Ga0068861_100176098
1274 Ga0068870_10062911
1275 Ga0068870_10079616
1276 Ga0068863_100016249
1277 Ga0068863_100055706
1278 Ga0068863_100079728
1279 Ga0068858_100031114
1280 Ga0068858_100081825
1281 Ga0068860_100078060
1282 Ga0068860_100128723
1283 Ga0068860_100234091
1284 Ga0068862_100000366
1285 Ga0068862_100062940
1286 Ga0068862_100087848
1287 Ga0068862_100132971
1288 Ga0068862_100200344
1289 Ga0081455_10013896
1290 Ga0081455_10016343
1291 Ga0081538_10000023
1292 Ga0081540_1000181
1293 Ga0081540_1000757
1294 Ga0081540_1007808
1295 Ga0081540_1037492
1296 Ga0081539_10001052
1297 Ga0070717_10000006
1298 Ga0070717_10002252
1299 Ga0070717_10003906
1300 Ga0070717_10008176
1301 Ga0070717_10026014
1302 Ga0070717_10053450
1303 Ga0075363_100021934
1304 Ga0075364_10017590
1305 Ga0070715_10001599
1306 Ga0070716_100001363
1307 Ga0070716_100003719
1308 Ga0070712_100000003
1309 Ga0070712_100003227
1310 Ga0070712_100019601
1311 Ga0070712_100024148
1312 Ga0070712_100027943
1313 Ga0070712_100069626
1314 Ga0070712_100158695
1315 Ga0097621_100011114
1316 Ga0097621_100140573
1317 Ga0068871_100032952
1318 Ga0068871_100034036
1319 Ga0068871_100040731
1320 Ga0068871_100041886
1321 Ga0068871_100075188
1322 Ga0075428_100022812
1323 Ga0075428_100028236
1324 Ga0075428_100079512
1325 Ga0075428_100081909
1326 Ga0075428_100134561
1327 Ga0075430_100011868
1328 Ga0075430_100041483
1329 Ga0075430_100041844
1330 Ga0075430_100113457
1331 Ga0075431_100000685
1332 Ga0075431_100065005
1333 Ga0075431_100082299
1334 Ga0075433_10004165
1335 Ga0075433_10031502
1336 Ga0075433_10042932
1337 Ga0075433_10063711
1338 Ga0075434_100004695
1339 Ga0075434_100030794
1340 Ga0075434_100077166
1341 Ga0075434_100144366
1342 Ga0075434_100225994
1343 Ga0075434_100228529
1344 Ga0075429_100116021
1345 Ga0068865_100003061
1346 Ga0068865_100005688
1347 Ga0068865_100094754
1348 Ga0075436_100006626
1349 Ga0075436_100009259
1350 Ga0099824_1000332
1351 Ga0075435_100010048
1352 Ga0075435_100010366
1353 Ga0075435_100014025
1354 Ga0075435_100082894
1355 Ga0075435_100122502
1356 Ga0105240_10032970
1357 Ga0105240_10094357
1358 Ga0105240_10192408
1359 Ga0111539_10002534
1360 Ga0111539_10002876
1361 Ga0111539_10030024
1362 Ga0111539_10108769
1363 Ga0111539_10164550
1364 Ga0111539_10343497
1365 Ga0105245_10010376
1366 Ga0105245_10013722
1367 Ga0105245_10047423
1368 Ga0105245_10069086
1369 Ga0105245_10073817
1370 Ga0105245_10108511
1371 Ga0105245_10236092
1372 Ga0105247_10000369
1373 Ga0114129_10036368
1374 Ga0114129_10079769
1375 Ga0105243_10003685
1376 Ga0105243_10005915
1377 Ga0105243_10017401
1378 Ga0105243_10041665
1379 Ga0105243_10048351
1380 Ga0105243_10071064
1381 Ga0105243_10085160
1382 Ga0105241_10068171
1383 Ga0105242_10001159
1384 Ga0105242_10008877
1385 Ga0105242_10016636
1386 Ga0105242_10018440
1387 Ga0105242_10060082
1388 Ga0105242_10091633
1389 Ga0105242_10176318
1390 Ga0105242_10194217
1391 Ga0105242_10238791
1392 Ga0105248_10009406
1393 Ga0105248_10066247
1394 Ga0105248_10127493
1395 Ga0105248_10296632
1396 Ga0105237_10028453
1397 Ga0105237_10226999
1398 Ga0105238_10019629
1399 Ga0105238_10152433
1400 Ga0105238_10262486
1401 Ga0105249_10000916
1402 Ga0105249_10002508
1403 Ga0105249_10009694
1404 Ga0105249_10107528
1405 Ga0105249_10150221
1406 Ga0105239_10009449
1407 Ga0105239_10033703
1408 Ga0105239_10103632
1409 Ga0105239_10112707
1410 Ga0105246_10018236
1411 Ga0105246_10033619
1412 Ga0157373_10000003
1413 Ga0157373_10075674
1414 Ga0157371_10049289
1415 Ga0157370_10033202
1416 Ga0157370_10151057
1417 Ga0157369_10009457
1418 Ga0157369_10033435
1419 Ga0157369_10069460
1420 Ga0157374_10322458
1421 Ga0157378_10217413
1422 Ga0157378_10271297
1423 Ga0163162_10014212
1424 Ga0163162_10014551
1425 Ga0163162_10025640
1426 Ga0163162_10026336
1427 Ga0163162_10030239
1428 Ga0163162_10205614
1429 Ga0163162_10236293
1430 Ga0163162_10339249
1431 Ga0157372_10008824
1432 Ga0157372_10309031
1433 Ga0157375_10003892
1434 Ga0157375_10004006
1435 Ga0157375_10016208
1436 Ga0157375_10086370
1437 Ga0157375_10103526
1438 Ga0157375_10247796
1439 Ga0157375_10427895
1440 Ga0163163_10007110
1441 Ga0163163_10043622
1442 Ga0157380_10018093
1443 Ga0157380_10032636
1444 Ga0157380_10039774
1445 Ga0157380_10080362
1446 Ga0157380_10136826
1447 Ga0157380_10177339
1448 Ga0157377_10001163
1449 Ga0157377_10005504
1450 Ga0157377_10126072
1451 Ga0157379_10018892
1452 Ga0157379_10140789
1453 Ga0157376_10004119
1454 Ga0182006_1041690
1455 Ga0163161_10017674
1456 Ga0163161_10047150
1457 Ga0163161_10055314
1458 Ga0163161_10078165
1459 Ga0197907_10292294
1460 Ga0206355_1195442
1461 Ga0206351_10206386
1462 Ga0206351_10855698
1463 Ga0206352_10111744
1464 Ga0206352_11357117
1465 Ga0206353_11863956
1466 Ga0154015_1332211
1467 Ga0213872_10023559
1468 Ga0224712_10004327
1469 Ga0209025_1000053
1470 Ga0209758_1001127
1471 Ga0207692_10000005
1472 Ga0207692_10004714
1473 Ga0207692_10006213
1474 Ga0207642_10021960
1475 Ga0207710_10000227
1476 Ga0207688_10006721
1477 Ga0207688_10069458
1478 Ga0207647_10008001
1479 Ga0207647_10051955
1480 Ga0207647_10055729
1481 Ga0207685_10010684
1482 Ga0207685_10031309
1483 Ga0207699_10003875
1484 Ga0207645_10039419
1485 Ga0207705_10013443
1486 Ga0207684_10208636
1487 Ga0207654_10091040
1488 Ga0207707_10017087
1489 Ga0207707_10017437
1490 Ga0207695_10003637
1491 Ga0207693_10000009
1492 Ga0207693_10001273
1493 Ga0207693_10002186
1494 Ga0207693_10002493
1495 Ga0207693_10003950
1496 Ga0207693_10015101
1497 Ga0207693_10083758
1498 Ga0207693_10131025
1499 Ga0207663_10005201
1500 Ga0207663_10005313
1501 Ga0207663_10016114
1502 Ga0207663_10023197
1503 Ga0207663_10066960
1504 Ga0207663_10080764
1505 Ga0207663_10128601
1506 Ga0207660_10085054
1507 Ga0207662_10056488
1508 Ga0207657_10005677
1509 Ga0207657_10012567
1510 Ga0207657_10093682
1511 Ga0207649_10116054
1512 Ga0207652_10051270
1513 Ga0207646_10082643
1514 Ga0207646_10104150
1515 Ga0207681_10045347
1516 Ga0207681_10086256
1517 Ga0207694_10076077
1518 Ga0207659_10003884
1519 Ga0207659_10040587
1520 Ga0207687_10027279
1521 Ga0207687_10037166
1522 Ga0207687_10053621
1523 Ga0207687_10176006
1524 Ga0207700_10005015
1525 Ga0207700_10012605
1526 Ga0207700_10112071
1527 Ga0207664_10003838
1528 Ga0207664_10005028
1529 Ga0207664_10007360
1530 Ga0207664_10008030
1531 Ga0207664_10012014
1532 Ga0207664_10022821
1533 Ga0207664_10051885
1534 Ga0207664_10053517
1535 Ga0207664_10070425
1536 Ga0207664_10097511
1537 Ga0207690_10029423
1538 Ga0207690_10039765
1539 Ga0207690_10071111
1540 Ga0207706_10002554
1541 Ga0207706_10003441
1542 Ga0207706_10005339
1543 Ga0207706_10015246
1544 Ga0207706_10018736
1545 Ga0207706_10040269
1546 Ga0207706_10099242
1547 Ga0207686_10000035
1548 Ga0207686_10001551
1549 Ga0207686_10053260
1550 Ga0207709_10001318
1551 Ga0207709_10035002
1552 Ga0207709_10068835
1553 Ga0207709_10117364
1554 Ga0207670_10021496
1555 Ga0207669_10020443
1556 Ga0207704_10006123
1557 Ga0207704_10016620
1558 Ga0207704_10102160
1559 Ga0207665_10001498
1560 Ga0207665_10004626
1561 Ga0207665_10039692
1562 Ga0207665_10043840
1563 Ga0207691_10003769
1564 Ga0207691_10178554
1565 Ga0207711_10018257
1566 Ga0207711_10162875
1567 Ga0207689_10028298
1568 Ga0207689_10036645
1569 Ga0207689_10071506
1570 Ga0207689_10150840
1571 Ga0207661_10000896
1572 Ga0207661_10005047
1573 Ga0207661_10017682
1574 Ga0207661_10023477
1575 Ga0207661_10060629
1576 Ga0207661_10181926
1577 Ga0207679_10033544
1578 Ga0207712_10018506
1579 Ga0207712_10064710
1580 Ga0207712_10111032
1581 Ga0207712_10120762
1582 Ga0207668_10007005
1583 Ga0207668_10137382
1584 Ga0207668_10142092
1585 Ga0207640_10109174
1586 Ga0207658_10000465
1587 Ga0207677_10044985
1588 Ga0207677_10087065
1589 Ga0207677_10140050
1590 Ga0207703_10121530
1591 Ga0207703_10246477
1592 Ga0207639_10005344
1593 Ga0207639_10075794
1594 Ga0207678_10003330
1595 Ga0207678_10013416
1596 Ga0207678_10016969
1597 Ga0207678_10098105
1598 Ga0207678_10145917
1599 Ga0207708_10002772
1600 Ga0207708_10013121
1601 Ga0207708_10017990
1602 Ga0207708_10020425
1603 Ga0207708_10058018
1604 Ga0207702_10028773
1605 Ga0207702_10044134
1606 Ga0207702_10050195
1607 Ga0207702_10063186
1608 Ga0207702_10085384
1609 Ga0207641_10011889
1610 Ga0207641_10042529
1611 Ga0207641_10084193
1612 Ga0207648_10003623
1613 Ga0207648_10003682
1614 Ga0207648_10005519
1615 Ga0207648_10074878
1616 Ga0207676_10000048
1617 Ga0207676_10056628
1618 Ga0207674_10001090
1619 Ga0207674_10025958
1620 Ga0207675_100036180
1621 Ga0207675_100088285
1622 Ga0207675_100213549
1623 Ga0207675_100234454
1624 Ga0207683_10000941
1625 Ga0207683_10020763
1626 Ga0207683_10102639
1627 Ga0207683_10125432
1628 Ga0207698_10008521
1629 Ga0207698_10059113
1630 Ga0207698_10099693
1631 Ga0207698_10122177
1632 Ga0207428_10001212
1633 Ga0207428_10014005
1634 Ga0207428_10080458
1635 Ga0268266_10161541
1636 Ga0268266_10167727
1637 Ga0268265_10001048
1638 Ga0268264_10110101
1639 Ga0268264_10175727
1640 Ga0268264_10212271
1641 Ga0268264_10220509
1642 Ga0265337_1000060
1643 Ga0265326_10000056
1644 Ga0265319_1000037
1645 Ga0265322_10000017
1646 Ga0265338_10000051
1647 Ga0265338_10175064
1648 Ga0265324_10000196
1649 Ga0307511_10020634
1650 Ga0265332_10022481
1651 Ga0265328_10000258
1652 Ga0265320_10000068
1653 Ga0265329_10001686
1654 Ga0265331_10000606
1655 Ga0265331_10004016
1656 Ga0265327_10000018
1657 Ga0265327_10000317
1658 Ga0265327_10063849
1659 Ga0265316_10034806
1660 Ga0307513_10006242
1661 Ga0307513_10201135
1662 Ga0307408_100020500
1663 Ga0265313_10006987
1664 Ga0307508_10150367
1665 Ga0316575_10001075
1666 Ga0316575_10002167
1667 Ga0316579_10005583
1668 Ga0265314_10000973
1669 Ga0265314_10064755
1670 Ga0265342_10094047
1671 Ga0316576_10001067
1672 Ga0316576_10012627
1673 Ga0316576_10028532
1674 Ga0316576_10108327
1675 Ga0316578_10014810
1676 Ga0316577_10011476
1677 Ga0316577_10033831
1678 Ga0307413_10000272
1679 Ga0307410_10002547
1680 Ga0307406_10014287
1681 Ga0307407_10001800
1682 Ga0307412_10017513
1683 Ga0307409_100011608
1684 Ga0307416_100139478
1685 Ga0307414_10003567
1686 Ga0307411_10000003
1687 Ga0307411_10047461
1688 Ga0307415_100009645
1689 Ga0316585_10003725
1690 Ga0316585_10005770
1691 Ga0316580_10001868
1692 Ga0373926_0000085
1693 Ga0373934_0004651
1694 Ga0373940_0038524
1695 Ga0373944_0000201
1696 Ga0373951_0012974
1697 Ga0373923_0000654
1698 Ga0373932_0022750
1699 Ga0373936_0001199
1700 Ga0373936_0019069
1701 Ga0373941_0011532
1702 Ga0373945_0000115
1703 Ga0373945_0000374
1704 Ga0373953_0000290
1705 Ga0373953_0001319
1706 Ga0373954_0000277
1707 Ga0373954_0006958
1708 Ga0373956_0000733
1709 Ga0373956_0012653
1710 Ga0373957_0000032
1711 Ga0373957_0009644
1712 Ga0373943_0000129
1713 Ga0373943_0003042
1714 Ga0373943_0023348
1715 Ga0373943_0076020
1716 Ga0373946_0000428
1717 Ga0373946_0000709
1718 Ga0373955_0000092
1719 Ga0373955_0026927
1720 Ga0373955_0030615
1721 Ga0316574_0000052
1722 Ga0316574_0036378
1723 Ga0316574_0074281
1724 Ga0373924_0000555
1725 Ga0373924_0009457
1726 Ga0373931_0018769
1727 Ga0373935_0000628
1728 Ga0373935_0003273
1729 Ga0373935_0168636
1730 Ga0373927_0002848
1731 Ga0373927_0004146
1732 Ga0373927_0074168
1733 Ga0373933_0000121
1734 Ga0373947_0000901
1735 Ga0373947_0003331
1736 Ga0373947_0038902
1737 Ga0373947_0057317
1738 Ga0373947_0058616
1739 Ga0373947_0120244
1740 Ga0373947_0142491
1741 Ga0373937_0000169
1742 Ga0373937_0018127
1743 Ga0373937_0018778
1744 Ga0373937_0021306
1745 Ga0373937_0048404
1746 Ga0373937_0057773
1747 Ga0373937_0116738
1748 Ga0316582_0000166
1749 Ga0316584_0005054
1750 Ga0316584_0007826
1751 Ga0316584_0026524
1752 Ga0316584_0029469
1753 Ga0316584_0051911
1754 Ga0316584_0091485
1755 Ga0316584_0139184
1756 Ga0373925_0002434
1757 Ga0373925_0003472
1758 Ga0373925_0034931
1759 Ga0373925_0037510
1760 Ga0373925_0140157
1761 Ga0395900_0111834
1762 Ga0395900_0233340
1763 Ga0395898_0028626
1764 Ga0395898_0190730
1765 Ga0316581_0001663
1766 Ga0395901_0018262
1767 Ga0395901_0161922
1768 Ga0395901_0193477
1769 Ga0242420_000347
1770 Ga0436360_0633769
1771 Ga0436361_0002000
1772 Ga0436361_0035073
1773 Ga0436361_0336407
1774 Ga0436361_0510461
1775 Ga0436361_0735490
1776 Ga0436363_0472667
1777 Ga0436362_0003157
1778 Ga0439447_000024
1779 Ga0451853_1257484
1780 Ga0466963_0000281
1781 Ga0466963_0004575
1782 Ga0466958_0007766
1783 Ga0466967_0003703
1784 Ga0466967_0015423
1785 Ga0466967_0052298
1786 Ga0466967_0077622
1787 Ga0495592_0000070
1788 Ga0495592_0000220
1789 Ga0495592_0003048
1790 Ga0495603_0023570
1791 Ga0495603_0033679
1792 Ga0495629_0009244
1793 Ga0495629_0041398
1794 Ga0495629_0088760
1795 Ga0495629_0177689
1796 Ga0495641_0000044
1797 Ga0495641_0000742
1798 Ga0495641_0004675
1799 Ga0495641_0018240
1800 Ga0495641_0038696
1801 Ga0495651_0000034
1802 Ga0495651_0000042
1803 Ga0495651_0002437
1804 Ga0495651_0009283
1805 Ga0495651_0012581
1806 Ga0495651_0066441
1807 Ga0495651_0126539
1808 Ga0495653_0000416
1809 Ga0495653_0000669
1810 Ga0495653_0013842
1811 Ga0495653_0039619
1812 Ga0495653_0089525
1813 Ga0495582_0007328
1814 Ga0495582_0019734
1815 Ga0495582_0025352
1816 Ga0495662_0001224
1817 Ga0495662_0035185
1818 Ga0495664_0001885
1819 Ga0495664_0006030
1820 Ga0495664_0018691
1821 Ga0495664_0095018
1822 Ga0495584_0050343
1823 Ga0495594_0000001
1824 Ga0495594_0037340
1825 Ga0495608_0000054
1826 Ga0495608_0000584
1827 Ga0495608_0005192
1828 Ga0495608_0018319
1829 Ga0495608_0027634
1830 Ga0495608_0050745
1831 Ga0495608_0093071
1832 Ga0495618_0002174
1833 Ga0495620_0000144
1834 Ga0495628_0000040
1835 Ga0495628_0000106
1836 Ga0495628_0000548
1837 Ga0495628_0008134
1838 Ga0495628_0026747
1839 Ga0495628_0076419
1840 Ga0495628_0077467
1841 Ga0495628_0089313
1842 Ga0495628_0095682
1843 Ga0495628_0143245
1844 Ga0495630_0007970
1845 Ga0495630_0027711
1846 Ga0495630_0218180
1847 Ga0495666_0001713
1848 Ga0495652_0000119
1849 Ga0495652_0002645
1850 Ga0495652_0006599
1851 Ga0495652_0012958
1852 Ga0495652_0024428
1853 Ga0495652_0036500
1854 Ga0495652_0057114
1855 Ga0495652_0079778
1856 Ga0495665_0001874
1857 Ga0495665_0025665
1858 Ga0495640_0002238
1859 Ga0495640_0012252
1860 Ga0495640_0069624
1861 Ga0495586_0011461
1862 Ga0495586_0028610
1863 Ga0495587_0000055
1864 Ga0495587_0000119
1865 Ga0495587_0000208
1866 Ga0495587_0021986
1867 Ga0495587_0076226
1868 Ga0495645_0000073
1869 Ga0495645_0004517
1870 Ga0495645_0009728
1871 Ga0495645_0014243
1872 Ga0495645_0025818
1873 Ga0495645_0027180
1874 Ga0495645_0050054
1875 Ga0495645_0087386
1876 Ga0495645_0150754
1877 Ga0495622_0000033
1878 Ga0495667_0000019
1879 Ga0495667_0000253
1880 Ga0495667_0000786
1881 Ga0495667_0004224
1882 Ga0495667_0004526
1883 Ga0495667_0024978
1884 Ga0495634_0000018
1885 Ga0495634_0001902
1886 Ga0495634_0003663
1887 Ga0495625_0000109
1888 Ga0495635_0006237
1889 Ga0495635_0007795
1890 Ga0495635_0104834
1891 Ga0495657_0000067
1892 Ga0495657_0027438
1893 Ga0495657_0032893
1894 Ga0495657_0109621
1895 Ga0495599_0000042
1896 Ga0495599_0000173
1897 Ga0495599_0003417
1898 Ga0495599_0023499
1899 Ga0495599_0031788
1900 Ga0495599_0054268
1901 Ga0495623_0000101
1902 Ga0495623_0035821
1903 Ga0495623_0047400
1904 Ga0495623_0054890
1905 Ga0495623_0074173
1906 Ga0495623_0097522
1907 Ga0495646_0005486
1908 Ga0495646_0009050
1909 Ga0495646_0010006
1910 Ga0495646_0014587
1911 Ga0495646_0026385
1912 Ga0495646_0028953
1913 Ga0495647_0013226
1914 Ga0495647_0044345
1915 Ga0495658_0001583
1916 Ga0495658_0002011
1917 Ga0495613_0007629
1918 Ga0495613_0107403
1919 Ga0495613_0201242
1920 Ga0495624_0002113
1921 Ga0495624_0018620
1922 Ga0495624_0032751
1923 Ga0495600_0003523
1924 Ga0495600_0005898
1925 Ga0495600_0012266
1926 Ga0495600_0057945
1927 Ga0495581_0000642
1928 Ga0495581_0001959
1929 Ga0495581_0010170
1930 Ga0495604_0000120
1931 Ga0495604_0000121
1932 Ga0495604_0006362
1933 Ga0495604_0011115
1934 Ga0495674_0005612
1935 Ga0495674_0011270
1936 Ga0495674_0019676
1937 Ga0495674_0059367
1938 Ga0495674_0123969
1939 Ga0495676_0000928
1940 Ga0495676_0003693
1941 Ga0495676_0004043
1942 Ga0495676_0006190
1943 Ga0495676_0066007
1944 Ga0495676_0147446
1945 Ga0495680_0000054
1946 Ga0495680_0001641
1947 Ga0495680_0001765
1948 Ga0495680_0002289
1949 Ga0495680_0005698
1950 Ga0495680_0009533
1951 Ga0495680_0018763
1952 Ga0495680_0020072
1953 Ga0495680_0037660
1954 Ga0495680_0084308
1955 Ga0495675_0000029
1956 Ga0495675_0000176
1957 Ga0495675_0071560
1958 Ga0495675_0077140
1959 Ga0495684_0000562
1960 Ga0495684_0001716
1961 Ga0495684_0001870
1962 Ga0495684_0008951
1963 Ga0495684_0010104
1964 Ga0495684_0010681
1965 Ga0495684_0052690
1966 Ga0495686_0000020
1967 Ga0495686_0104501
1968 Ga0495593_0004833
1969 Ga0495602_0000083
1970 Ga0495602_0001081
1971 Ga0495602_0004291
1972 Ga0495602_0004572
1973 Ga0495602_0034960
1974 Ga0495602_0038087
1975 Ga0495602_0050130
1976 Ga0496100_0000019
1977 Ga0496100_0003734
1978 Ga0496100_0005515
1979 Ga0496100_0006389
1980 Ga0496100_0011308
1981 Ga0496100_0023604
1982 Ga0496100_0050281
1983 Ga0496101_0000005
1984 Ga0496101_0025969
1985 Ga0496101_0057627
1986 Ga0496101_0089632
1987 Ga0496101_0284127
1988 Ga0496102_0000021
1989 Ga0496102_0024895
1990 Ga0496102_0029102
1991 Ga0496102_0031693
1992 Ga0496102_0037880
1993 Ga0496102_0066504
1994 Ga0496102_0128068
1995 Ga0496102_0167077
1996 Ga0496102_0285040
1997 Ga0496103_0000001
1998 Ga0496103_0007179
1999 Ga0496103_0053282
2000 Ga0496103_0064679
2001 Ga0496103_0074041
2002 Ga0496104_0000029
2003 Ga0496104_0000551
2004 Ga0496104_0008695
2005 Ga0496104_0018535
2006 Ga0496104_0029165
2007 Ga0496104_0153399
2008 Ga0496104_0154114
2009 Ga0496104_0181132
2010 Ga0496104_0219752
2011 Ga0496105_0000002
2012 Ga0496105_0007317
2013 Ga0496105_0007781
2014 Ga0496105_0011873
2015 Ga0496105_0013858
2016 Ga0496105_0037207
2017 Ga0496105_0106059
2018 Ga0496105_0123184
2019 Ga0496105_0132247
2020 Ga0496106_0000033
2021 Ga0496106_0001620
2022 Ga0496106_0002498
2023 Ga0496106_0005382
2024 Ga0496106_0011536
2025 Ga0496106_0032180
2026 Ga0496106_0087764
2027 Ga0496106_0215607
2028 Ga0496106_0231732
2029 Ga0496107_0000004
2030 Ga0496107_0001120
2031 Ga0496107_0009391
2032 Ga0496107_0010207
2033 Ga0496107_0074309
2034 Ga0496107_0108244
2035 Ga0496107_0195020
2036 Ga0496108_0000187
2037 Ga0496108_0006174
2038 Ga0496108_0012519
2039 Ga0496108_0015305
2040 Ga0496108_0029554
2041 Ga0496108_0045410
2042 Ga0496108_0045656
2043 Ga0496108_0050063
2044 Ga0496108_0065269
2045 Ga0496108_0097162
2046 Ga0496108_0107050
2047 Ga0496109_0000636
2048 Ga0496109_0011911
2049 Ga0496109_0015902
2050 Ga0496109_0057804
2051 Ga0496109_0060773
2052 Ga0496109_0066426
2053 Ga0496109_0085910
2054 Ga0496109_0128724
2055 Ga0496110_0009948
2056 Ga0496110_0010762
2057 Ga0496110_0013223
2058 Ga0496110_0014802
2059 Ga0496110_0026382
2060 Ga0496110_0035902
2061 Ga0496110_0048112
2062 Ga0496110_0068392
2063 Ga0496110_0182004
2064 Ga0496110_0187494
2065 Ga0496110_0231352
2066 Ga0496111_0004675
2067 Ga0496111_0014526
2068 Ga0496111_0014676
2069 Ga0496111_0041217
2070 Ga0496111_0047847
2071 Ga0496111_0057454
2072 Ga0496111_0101851
2073 Ga0496111_0160691
2074 Ga0496111_0192486
2075 Ga0496112_0001147
2076 Ga0496112_0009893
2077 Ga0496112_0026382
2078 Ga0496112_0062499
2079 Ga0496112_0068233
2080 Ga0496112_0078518
2081 Ga0496112_0098819
2082 Ga0496112_0108236
2083 Ga0496112_0157518
2084 Ga0496113_0002968
2085 Ga0496113_0010955
2086 Ga0496113_0094109
2087 Ga0496113_0096997
2088 Ga0496113_0162980
2089 Ga0496113_0175229
2090 Ga0496114_0000003
2091 Ga0496114_0001583
2092 Ga0496114_0003903
2093 Ga0496114_0006313
2094 Ga0496114_0008959
2095 Ga0496114_0013045
2096 Ga0496114_0046563
2097 Ga0496114_0132957
2098 Ga0496115_0001724
2099 Ga0496115_0016518
2100 Ga0496115_0022266
2101 Ga0496115_0032311
2102 Ga0496115_0037757
2103 Ga0496115_0134780
2104 Ga0496115_0215009
2105 Ga0496116_0000138
2106 Ga0496117_0002715
2107 Ga0496118_0000424
2108 Ga0496119_0005703
2109 Ga0496119_0007790
2110 Ga0496119_0014904
2111 Ga0496119_0021422
2112 Ga0496119_0059615
2113 Ga0496120_0002506
2114 Ga0496121_0008090
2115 Ga0496121_0111864
2116 Ga0496121_0161553
2117 Ga0496125_0022767
2118 Ga0501032_0004690
2119 Ga0501033_0099214
2120 Ga0501034_0009420
2121 Ga0501034_0128786
2122 Ga0501036_0046408
2123 Ga0501038_0016446
2124 Ga0501039_0030969
2125 Ga0501039_0190209
2126 Ga0501042_0007340
2127 Ga0501042_0194806
2128 Ga0501046_0045753
2129 Ga0501047_0053952
2130 Ga0501047_0182365
2131 Ga0501069_0000387
2132 Ga0501070_0006896
2133 Ga0501070_0017234
2134 Ga0501249_003280
2135 Ga0501079_0071732
2136 nmdc:mga06z11_55717_c1
2137 nmdc:mga05p37_10540_c1
2138 nmdc:mga05p37_27122_c1
2139 nmdc:mga05p37_29021_c1
2140 nmdc:mga05p37_38141_c1
2141 nmdc:mga09592_111263_c1
2142 nmdc:mga09592_31516_c1
2143 nmdc:mga0qj67_100862_c1
2144 nmdc:mga0qj67_105601_c1
2145 nmdc:mga0qj67_126806_c1
2146 nmdc:mga0qj67_18732_c1
2147 nmdc:mga0qj67_21097_c1
2148 nmdc:mga0qj67_241184_c1
2149 nmdc:mga0qj67_70731_c1
2150 nmdc:mga06r32_11724_c1
2151 nmdc:mga06r32_217756_c1
2152 nmdc:mga06r32_26545_c1
2153 nmdc:mga08y16_1438_c1
2154 nmdc:mga08y16_27181_c1
2155 nmdc:mga08y16_51543_c1
2156 nmdc:mga08y16_62383_c1
2157 nmdc:mga0n895_103767_c1
2158 nmdc:mga0n895_147475_c1
2159 nmdc:mga0n895_191761_c1
2160 nmdc:mga0n895_38576_c1
2161 nmdc:mga0n895_4006_c1
2162 nmdc:mga0n895_51772_c1
2163 nmdc:mga0n895_52902_c1
2164 nmdc:mga0n895_6500_c1
2165 nmdc:mga0rr50_10917_c1
2166 nmdc:mga0rr50_13008_c1
2167 nmdc:mga0rr50_24764_c1
2168 nmdc:mga0rr50_26236_c1
2169 nmdc:mga0rr50_5422_c1
2170 nmdc:mga0rr50_60781_c1
2171 nmdc:mga0rr50_69963_c1
2172 nmdc:mga08x19_38054_c1
2173 nmdc:mga0a205_18213_c1
2174 nmdc:mga0a205_185303_c1
2175 nmdc:mga0a205_21593_c1
2176 nmdc:mga0a205_25548_c1
2177 nmdc:mga0a205_271288_c1
2178 nmdc:mga0a205_3610_c1
2179 nmdc:mga0a205_62187_c1
2180 nmdc:mga0a205_679_c1
2181 nmdc:mga0a205_69143_c1
2182 nmdc:mga0sz30_56499_c2
2183 Ga0495601_0000110
2184 Ga0495601_0000124
2185 Ga0495601_0003438
2186 Ga0495601_0013142
2187 Ga0495601_0020740
2188 Ga0495601_0048222
2189 Ga0495612_0003172
2190 Ga0495612_0010699
2191 Ga0495612_0010857
2192 Ga0495612_0023356
2193 Ga0495655_0000008
2194 Ga0495595_0001178
2195 Ga0495595_0016809
2196 Ga0495595_0038686
2197 Ga0495619_0000025
2198 Ga0495619_0001863
2199 Ga0495619_0009701
2200 Ga0495619_0021921
2201 Ga0495619_0025437
2202 Ga0495619_0042642
2203 Ga0495619_0107445
2204 Ga0500566_0002923
2205 Ga0500556_0001512
2206 Ga0500572_001267
2207 Ga0500614_000117
2208 Ga0500628_000023
2209 Ga0500658_0000015
2210 Ga0500559_0010654
2211 Ga0500616_0011561
2212 Ga0501082_0056838
2213 2523385192
2214 2687238119
2215 2738886880
2216 2740000265
2217 2740005081
2218 2758225509
2219 2812372081
2220 2819667620
2221 2819690921
2222 2819727738
2223 2857621489
2224 2870628812
2225 2919036786
2226 2919192496
2227 2939658176
2228 8054309405

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10009

DUF2252

Uncharacterized protein conserved in bacteria (DUF2252)

114

522

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dm8-assembly1.cif.gz_A-2 crystal structure of putative isomerase from rhodopseudomonas palustris 0.5083 269 314
3i4b-assembly1.cif.gz_A crystal structure of gsk3b in complex with a pyrimidylpyrrole inhibitor 0.4662 277 370
3rcd-assembly1.cif.gz_A her2 kinase domain complexed with tak-285 0.4403 277 371
5jeb-assembly1.cif.gz_A crystal structure of egfr tyrosine kinase domain with novel inhibitor of active state of her2 0.4272 273 371
4cyi-assembly2.cif.gz_C chaetomium thermophilum pan3 0.4212 291 369
ID Description Score Start End Superfamily
af_Q9VIG3_1_153_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.5294 274 316 3.30.200.20
3dm8A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.5083 269 314 3.10.450.50
af_Q2FWK3_394_500_3.30.160.270 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Alpha-isopropylmalate synthase LeuA, regulatory domain 0.4762 275 326 3.30.160.270
3attA01 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.4634 279 370 3.30.200.20
af_Q12222_39_128_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.446 275 370 3.30.200.20
ID Description Score Start End GO Terms
AF-A0A1P8YCJ8-F1-model_v4 DUF2252 domain-containing protein 0.9812 1 458 GO:0016020
AF-A0A359A5M1-F1-model_v4 deleted 0.9811 1 458
AF-A0A401WF67-F1-model_v4 DUF2252 domain-containing protein 0.979 1 458
AF-A0A359A5M1-F1-model_v4 deleted 0.979 1 458
AF-A0A6B2XTZ6-F1-model_v4 DUF2252 domain-containing protein 0.9788 26 146

Map