F490287
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1114 | 424 | 2228 | 267 |
Family's Representative Sequence
| Representative Sequence | 3300053085|Ga0495619_0180341|Ga0495619_0180341_194_1093 |
| Length | 299 |
| Sequence | MLLCGPIAHVECNWVSFWSHNKTMLGALIIVFREVIEAGLIVGIVMAATRGVLGRGRWVGFGIGAGVLGAAVVAIFAGAISQAFEGAGQELFNASVLGIAVVMLMWHNAWMARHGREIAEEMQSIGVAVSEGAKPLTALAIVVGLAVLREGSEVVLFLYGIFASGTSGAALLVGGLLGIAAGAAFTGLTYVGLLAIPTRYIFSVTSWLIALLAAGMAAQSVQFLNNAGVVVALDRTVWDTSWMLSEGSLFGKLLHTLIGYSERPTELQLMTYIATLFLMFLLMRLARPAPRARVSAAAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 4 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 6 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 7 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 8 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 9 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 10 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 11 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 12 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 13 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 14 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 15 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 16 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 17 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 18 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 19 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 20 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 21 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 22 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 23 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 24 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 34 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 38 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 51 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 68 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 69 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 71 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 74 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 82 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 84 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 85 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 86 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 88 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 89 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 90 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 91 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 92 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 93 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 94 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 95 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 96 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 97 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 98 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 100 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 101 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 102 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 103 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 104 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 105 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 106 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 108 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 109 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 110 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 111 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 112 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 113 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 114 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 115 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 117 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 134 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 135 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 147 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 152 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 153 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 154 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 226 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 230 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 231 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 232 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 233 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 234 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 235 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 236 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 237 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 238 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 239 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 240 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 241 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 242 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 243 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 244 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 245 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 246 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 247 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 248 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 249 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 250 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 251 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 252 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 253 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 254 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 255 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 256 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 257 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 258 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 259 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 260 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 261 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 262 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 263 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 264 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 265 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 266 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 267 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 268 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 269 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 270 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 271 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 272 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 273 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 274 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 275 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 276 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 277 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 278 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 279 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 280 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 281 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 282 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 283 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 284 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 285 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 286 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 287 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 288 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 289 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 356 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 357 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 358 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 359 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 360 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 361 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 362 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 363 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 364 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 365 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 366 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 367 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 368 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 369 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 370 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 371 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 372 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 401 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 402 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 403 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 404 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 409 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 411 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 412 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 416 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 417 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 418 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 419 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 420 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 421 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 422 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 423 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 424 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.82 |
| Metatranscriptomes | 0.09 |
| Isolates | 0.09 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.44 |
| Nodule | 0 |
| Rhizoplane | 7.81 |
| Rhizosphere | 89.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495619_0180341 | 3300053085 | Bacteria | 1461 |
| 2 | 2214544953 | 2209111006 | Bacteria | 6053 |
| 3 | ARSoilYngRDRAFT_c00268 | 3300000042 | Bacteria | 7919 |
| 4 | ARcpr5yngRDRAFT_c000083 | 3300000043 | Bacteria | 15543 |
| 5 | ARcpr5yngRDRAFT_c000130 | 3300000043 | Bacteria | 11824 |
| 6 | ARSoilOldRDRAFT_c000077 | 3300000044 | Bacteria | 18706 |
| 7 | ARCol0oldRDRAFT_c00168 | 3300000045 | Bacteria | 5941 |
| 8 | ARCol0yngRDRAFT_1000003 | 3300000652 | Bacteria | 53041 |
| 9 | JGI24752J21851_1001016 | 3300001976 | Bacteria | 3820 |
| 10 | JGI24746J21847_1000172 | 3300001977 | Bacteria | 8495 |
| 11 | JGI24747J21853_1000145 | 3300001978 | Bacteria | 3451 |
| 12 | JGI24739J22299_10002161 | 3300001989 | Bacteria | 7538 |
| 13 | JGI24737J22298_10002588 | 3300001990 | Bacteria | 6411 |
| 14 | JGI24737J22298_10002605 | 3300001990 | Bacteria | 6382 |
| 15 | JGI24737J22298_10072039 | 3300001990 | Bacteria | 1031 |
| 16 | JGI24743J22301_10021190 | 3300001991 | Bacteria | 1240 |
| 17 | JGI24750J21931_1000256 | 3300002070 | Bacteria | 9041 |
| 18 | JGI24750J21931_1006618 | 3300002070 | Unclassified | 1445 |
| 19 | JGI24745J21846_1000121 | 3300002073 | Bacteria | 5975 |
| 20 | JGI24738J21930_10000425 | 3300002075 | Bacteria | 11873 |
| 21 | JGI24749J21850_1002381 | 3300002076 | Bacteria | 2646 |
| 22 | JGI24744J21845_10000665 | 3300002077 | Bacteria | 6286 |
| 23 | JGI24035J26624_1000008 | 3300002126 | Bacteria | 13965 |
| 24 | JGI24035J26624_1000030 | 3300002126 | Bacteria | 10265 |
| 25 | JGI24033J26618_1000612 | 3300002155 | Bacteria | 3427 |
| 26 | JGI24034J26672_10000799 | 3300002239 | Bacteria | 4072 |
| 27 | JGI24742J22300_10000352 | 3300002244 | Bacteria | 6769 |
| 28 | JGI25405J52794_10001882 | 3300003911 | Bacteria | 3538 |
| 29 | Ga0065716_1001562 | 3300005277 | Bacteria | 6533 |
| 30 | Ga0065704_10274146 | 3300005289 | Unclassified | 936 |
| 31 | Ga0065715_10090800 | 3300005293 | Bacteria | 6445 |
| 32 | Ga0070658_10007097 | 3300005327 | Bacteria | 9043 |
| 33 | Ga0070658_10034171 | 3300005327 | Bacteria | 4091 |
| 34 | Ga0070658_10064284 | 3300005327 | Bacteria | 2993 |
| 35 | Ga0070676_10000036 | 3300005328 | Bacteria | 40368 |
| 36 | Ga0070676_10036183 | 3300005328 | Bacteria | 2843 |
| 37 | Ga0070676_10071872 | 3300005328 | Bacteria | 2079 |
| 38 | Ga0070676_10352611 | 3300005328 | Bacteria | 1012 |
| 39 | Ga0070683_100002049 | 3300005329 | Bacteria | 15883 |
| 40 | Ga0070683_100133634 | 3300005329 | Bacteria | 2348 |
| 41 | Ga0070683_100308029 | 3300005329 | Bacteria | 1507 |
| 42 | Ga0070690_100001849 | 3300005330 | Bacteria | 11234 |
| 43 | Ga0070690_100110205 | 3300005330 | Unclassified | 1836 |
| 44 | Ga0070670_100003778 | 3300005331 | Bacteria | 12606 |
| 45 | Ga0070670_100043490 | 3300005331 | Bacteria | 3861 |
| 46 | Ga0070677_10000104 | 3300005333 | Bacteria | 27953 |
| 47 | Ga0068869_100000087 | 3300005334 | Bacteria | 42211 |
| 48 | Ga0070666_10006798 | 3300005335 | Bacteria | 7046 |
| 49 | Ga0070666_10055355 | 3300005335 | Bacteria | 2677 |
| 50 | Ga0070680_100003276 | 3300005336 | Bacteria | 12068 |
| 51 | Ga0070680_100084340 | 3300005336 | Bacteria | 2624 |
| 52 | Ga0070680_100129012 | 3300005336 | Bacteria | 2114 |
| 53 | Ga0070682_100000341 | 3300005337 | Bacteria | 32124 |
| 54 | Ga0070682_100032217 | 3300005337 | Bacteria | 3176 |
| 55 | Ga0070682_100097794 | 3300005337 | Bacteria | 1932 |
| 56 | Ga0070682_100189368 | 3300005337 | Unclassified | 1443 |
| 57 | Ga0068868_100001826 | 3300005338 | Bacteria | 14641 |
| 58 | Ga0068868_100253462 | 3300005338 | Unclassified | 1482 |
| 59 | Ga0068868_100409597 | 3300005338 | Bacteria | 1171 |
| 60 | Ga0070660_100006206 | 3300005339 | Bacteria | 8272 |
| 61 | Ga0070660_100054032 | 3300005339 | Bacteria | 3099 |
| 62 | Ga0070660_100165984 | 3300005339 | Bacteria | 1781 |
| 63 | Ga0070660_100350593 | 3300005339 | Bacteria | 1215 |
| 64 | Ga0070689_100000963 | 3300005340 | Bacteria | 17950 |
| 65 | Ga0070689_100017974 | 3300005340 | Bacteria | 5200 |
| 66 | Ga0070689_100098820 | 3300005340 | Bacteria | 2309 |
| 67 | Ga0070691_10000518 | 3300005341 | Bacteria | 14537 |
| 68 | Ga0070687_100000245 | 3300005343 | Bacteria | 18566 |
| 69 | Ga0070687_100060180 | 3300005343 | Bacteria | 2002 |
| 70 | Ga0070687_100066302 | 3300005343 | Bacteria | 1923 |
| 71 | Ga0070661_100000017 | 3300005344 | Bacteria | 153232 |
| 72 | Ga0070661_100150902 | 3300005344 | Bacteria | 1757 |
| 73 | Ga0070692_10003367 | 3300005345 | Bacteria | 6470 |
| 74 | Ga0070668_100010066 | 3300005347 | Bacteria | 7008 |
| 75 | Ga0070668_100109771 | 3300005347 | Bacteria | 2195 |
| 76 | Ga0070668_100182409 | 3300005347 | Bacteria | 1715 |
| 77 | Ga0070669_100000217 | 3300005353 | Bacteria | 47833 |
| 78 | Ga0070669_100226474 | 3300005353 | Unclassified | 1480 |
| 79 | Ga0070675_100000088 | 3300005354 | Bacteria | 53698 |
| 80 | Ga0070675_100260527 | 3300005354 | Unclassified | 1519 |
| 81 | Ga0070675_100375653 | 3300005354 | Bacteria | 1264 |
| 82 | Ga0070675_100527369 | 3300005354 | Bacteria | 1066 |
| 83 | Ga0070671_100000768 | 3300005355 | Bacteria | 23064 |
| 84 | Ga0070671_100009332 | 3300005355 | Bacteria | 7877 |
| 85 | Ga0070671_100075563 | 3300005355 | Bacteria | 2815 |
| 86 | Ga0070671_100081683 | 3300005355 | Bacteria | 2702 |
| 87 | Ga0070671_100405405 | 3300005355 | Bacteria | 1167 |
| 88 | Ga0070671_100541185 | 3300005355 | Bacteria | 1004 |
| 89 | Ga0070674_100000623 | 3300005356 | Bacteria | 17847 |
| 90 | Ga0070674_100147460 | 3300005356 | Bacteria | 1772 |
| 91 | Ga0070674_100575237 | 3300005356 | Unclassified | 948 |
| 92 | Ga0070673_100000239 | 3300005364 | Bacteria | 27611 |
| 93 | Ga0070673_100015583 | 3300005364 | Bacteria | 5346 |
| 94 | Ga0070673_100273089 | 3300005364 | Bacteria | 1480 |
| 95 | Ga0070688_100000084 | 3300005365 | Bacteria | 47194 |
| 96 | Ga0070688_100113737 | 3300005365 | Bacteria | 1804 |
| 97 | Ga0070659_100000252 | 3300005366 | Bacteria | 42278 |
| 98 | Ga0070659_100189056 | 3300005366 | Unclassified | 1692 |
| 99 | Ga0070659_100364017 | 3300005366 | Bacteria | 1215 |
| 100 | Ga0070667_100003023 | 3300005367 | Bacteria | 14455 |
| 101 | Ga0070667_100053625 | 3300005367 | Bacteria | 3403 |
| 102 | Ga0070667_100267990 | 3300005367 | Unclassified | 1530 |
| 103 | Ga0070703_10014545 | 3300005406 | Bacteria | 2243 |
| 104 | Ga0070709_10000855 | 3300005434 | Bacteria | 17027 |
| 105 | Ga0070709_10024849 | 3300005434 | Bacteria | 3531 |
| 106 | Ga0070709_10113782 | 3300005434 | Bacteria | 1823 |
| 107 | Ga0070709_10121633 | 3300005434 | Bacteria | 1770 |
| 108 | Ga0070709_10169231 | 3300005434 | Bacteria | 1526 |
| 109 | Ga0070714_100029733 | 3300005435 | Bacteria | 4543 |
| 110 | Ga0070714_100051256 | 3300005435 | Bacteria | 3518 |
| 111 | Ga0070714_100181610 | 3300005435 | Unclassified | 1915 |
| 112 | Ga0070714_100192969 | 3300005435 | Bacteria | 1860 |
| 113 | Ga0070714_100471989 | 3300005435 | Bacteria | 1194 |
| 114 | Ga0070714_100478018 | 3300005435 | Bacteria | 1186 |
| 115 | Ga0070713_100004731 | 3300005436 | Bacteria | 9202 |
| 116 | Ga0070713_100017656 | 3300005436 | Bacteria | 5403 |
| 117 | Ga0070713_100082945 | 3300005436 | Bacteria | 2739 |
| 118 | Ga0070710_10005088 | 3300005437 | Bacteria | 6222 |
| 119 | Ga0070710_10074114 | 3300005437 | Bacteria | 1970 |
| 120 | Ga0070701_10000123 | 3300005438 | Bacteria | 22697 |
| 121 | Ga0070711_100049857 | 3300005439 | Bacteria | 2868 |
| 122 | Ga0070711_100087399 | 3300005439 | Bacteria | 2238 |
| 123 | Ga0070711_100564669 | 3300005439 | Bacteria | 945 |
| 124 | Ga0070705_100000425 | 3300005440 | Bacteria | 24231 |
| 125 | Ga0070705_100167617 | 3300005440 | Unclassified | 1475 |
| 126 | Ga0070700_100000370 | 3300005441 | Bacteria | 23064 |
| 127 | Ga0070700_100103200 | 3300005441 | Unclassified | 1883 |
| 128 | Ga0070700_100210196 | 3300005441 | Bacteria | 1372 |
| 129 | Ga0070694_100000401 | 3300005444 | Bacteria | 23534 |
| 130 | Ga0070694_100057633 | 3300005444 | Bacteria | 2641 |
| 131 | Ga0070708_100004439 | 3300005445 | Bacteria | 11027 |
| 132 | Ga0070708_100259148 | 3300005445 | Bacteria | 1635 |
| 133 | Ga0070708_100324350 | 3300005445 | Bacteria | 1451 |
| 134 | Ga0070663_100000415 | 3300005455 | Bacteria | 22408 |
| 135 | Ga0070663_100021614 | 3300005455 | Bacteria | 4283 |
| 136 | Ga0070663_100030699 | 3300005455 | Bacteria | 3686 |
| 137 | Ga0070663_100113586 | 3300005455 | Bacteria | 2038 |
| 138 | Ga0070663_100203995 | 3300005455 | Unclassified | 1544 |
| 139 | Ga0070678_100000053 | 3300005456 | Bacteria | 40418 |
| 140 | Ga0070678_100009449 | 3300005456 | Bacteria | 5911 |
| 141 | Ga0070678_100093664 | 3300005456 | Bacteria | 2310 |
| 142 | Ga0070662_100003931 | 3300005457 | Bacteria | 9321 |
| 143 | Ga0070662_100011655 | 3300005457 | Bacteria | 5804 |
| 144 | Ga0070662_100052752 | 3300005457 | Bacteria | 2941 |
| 145 | Ga0070662_100127715 | 3300005457 | Bacteria | 1956 |
| 146 | Ga0070681_10000493 | 3300005458 | Bacteria | 32198 |
| 147 | Ga0070681_10048975 | 3300005458 | Bacteria | 4220 |
| 148 | Ga0070681_10163411 | 3300005458 | Bacteria | 2150 |
| 149 | Ga0070681_10675002 | 3300005458 | Unclassified | 948 |
| 150 | Ga0068867_100001581 | 3300005459 | Bacteria | 15837 |
| 151 | Ga0068867_100221007 | 3300005459 | Unclassified | 1527 |
| 152 | Ga0070685_10017206 | 3300005466 | Bacteria | 3866 |
| 153 | Ga0070679_100005631 | 3300005530 | Bacteria | 11605 |
| 154 | Ga0070679_100058723 | 3300005530 | Bacteria | 3833 |
| 155 | Ga0070679_100104483 | 3300005530 | Bacteria | 2819 |
| 156 | Ga0070679_100104990 | 3300005530 | Bacteria | 2811 |
| 157 | Ga0070679_100247957 | 3300005530 | Bacteria | 1737 |
| 158 | Ga0070679_100379206 | 3300005530 | Bacteria | 1361 |
| 159 | Ga0070684_100010354 | 3300005535 | Bacteria | 7383 |
| 160 | Ga0070684_100085580 | 3300005535 | Bacteria | 2796 |
| 161 | Ga0070684_100123706 | 3300005535 | Bacteria | 2328 |
| 162 | Ga0070684_100570957 | 3300005535 | Bacteria | 1050 |
| 163 | Ga0070697_100328785 | 3300005536 | Bacteria | 1317 |
| 164 | Ga0068853_100005864 | 3300005539 | Bacteria | 9680 |
| 165 | Ga0070672_100000014 | 3300005543 | Bacteria | 72627 |
| 166 | Ga0070672_100216713 | 3300005543 | Bacteria | 1604 |
| 167 | Ga0070672_100265402 | 3300005543 | Bacteria | 1449 |
| 168 | Ga0070672_100335519 | 3300005543 | Bacteria | 1287 |
| 169 | Ga0070686_100000754 | 3300005544 | Bacteria | 18754 |
| 170 | Ga0070686_100014000 | 3300005544 | Bacteria | 4610 |
| 171 | Ga0070686_100061154 | 3300005544 | Bacteria | 2432 |
| 172 | Ga0070686_100070670 | 3300005544 | Bacteria | 2283 |
| 173 | Ga0070695_100000743 | 3300005545 | Bacteria | 17429 |
| 174 | Ga0070695_100070169 | 3300005545 | Bacteria | 2291 |
| 175 | Ga0070695_100170359 | 3300005545 | Bacteria | 1535 |
| 176 | Ga0070696_100000918 | 3300005546 | Bacteria | 19157 |
| 177 | Ga0070696_100037902 | 3300005546 | Bacteria | 3325 |
| 178 | Ga0070693_100000141 | 3300005547 | Bacteria | 32426 |
| 179 | Ga0070693_100158494 | 3300005547 | Bacteria | 1439 |
| 180 | Ga0070693_100191458 | 3300005547 | Unclassified | 1323 |
| 181 | Ga0070693_100305363 | 3300005547 | Bacteria | 1074 |
| 182 | Ga0070665_100019687 | 3300005548 | Bacteria | 6775 |
| 183 | Ga0070665_100326210 | 3300005548 | Bacteria | 1539 |
| 184 | Ga0070665_100363516 | 3300005548 | Bacteria | 1453 |
| 185 | Ga0070665_100693443 | 3300005548 | Unclassified | 1031 |
| 186 | Ga0070704_100019420 | 3300005549 | Bacteria | 4366 |
| 187 | Ga0070704_100254263 | 3300005549 | Bacteria | 1444 |
| 188 | Ga0068855_100009106 | 3300005563 | Bacteria | 11994 |
| 189 | Ga0068855_100011304 | 3300005563 | Bacteria | 10779 |
| 190 | Ga0068855_100166621 | 3300005563 | Bacteria | 2497 |
| 191 | Ga0068855_100243917 | 3300005563 | Bacteria | 2006 |
| 192 | Ga0068855_100276365 | 3300005563 | Bacteria | 1867 |
| 193 | Ga0070664_100000816 | 3300005564 | Bacteria | 23970 |
| 194 | Ga0070664_100182779 | 3300005564 | Bacteria | 1864 |
| 195 | Ga0070664_100189122 | 3300005564 | Bacteria | 1834 |
| 196 | Ga0068857_100000567 | 3300005577 | Bacteria | 26993 |
| 197 | Ga0068857_100140358 | 3300005577 | Bacteria | 2184 |
| 198 | Ga0068854_100000168 | 3300005578 | Bacteria | 44522 |
| 199 | Ga0068854_100045835 | 3300005578 | Bacteria | 3110 |
| 200 | Ga0068854_100230453 | 3300005578 | Bacteria | 1470 |
| 201 | Ga0068856_100015543 | 3300005614 | Bacteria | 7357 |
| 202 | Ga0068856_100033238 | 3300005614 | Bacteria | 5050 |
| 203 | Ga0068856_100091613 | 3300005614 | Bacteria | 3024 |
| 204 | Ga0068856_100126264 | 3300005614 | Bacteria | 2561 |
| 205 | Ga0070702_100000857 | 3300005615 | Bacteria | 11750 |
| 206 | Ga0070702_100083296 | 3300005615 | Bacteria | 1921 |
| 207 | Ga0070702_100097380 | 3300005615 | Bacteria | 1797 |
| 208 | Ga0068852_100002066 | 3300005616 | Bacteria | 13707 |
| 209 | Ga0068852_100075443 | 3300005616 | Bacteria | 2974 |
| 210 | Ga0068852_100175185 | 3300005616 | Bacteria | 2013 |
| 211 | Ga0068859_100025021 | 3300005617 | Bacteria | 5992 |
| 212 | Ga0068859_100043742 | 3300005617 | Bacteria | 4501 |
| 213 | Ga0068859_100340926 | 3300005617 | Bacteria | 1593 |
| 214 | Ga0068864_100000980 | 3300005618 | Bacteria | 23924 |
| 215 | Ga0068864_100012023 | 3300005618 | Bacteria | 7148 |
| 216 | Ga0068866_10000264 | 3300005718 | Bacteria | 24776 |
| 217 | Ga0068861_100048215 | 3300005719 | Bacteria | 3219 |
| 218 | Ga0068861_100375101 | 3300005719 | Bacteria | 1255 |
| 219 | Ga0068870_10000002 | 3300005840 | Bacteria | 91107 |
| 220 | Ga0068870_10023276 | 3300005840 | Bacteria | 3053 |
| 221 | Ga0068863_100001290 | 3300005841 | Bacteria | 25007 |
| 222 | Ga0068863_100160400 | 3300005841 | Bacteria | 2154 |
| 223 | Ga0068863_100267996 | 3300005841 | Unclassified | 1652 |
| 224 | Ga0068858_100000356 | 3300005842 | Bacteria | 48189 |
| 225 | Ga0068858_100008336 | 3300005842 | Bacteria | 9972 |
| 226 | Ga0068858_100031420 | 3300005842 | Bacteria | 4932 |
| 227 | Ga0068858_100110588 | 3300005842 | Bacteria | 2566 |
| 228 | Ga0068860_100000747 | 3300005843 | Bacteria | 36976 |
| 229 | Ga0068860_100110091 | 3300005843 | Unclassified | 2632 |
| 230 | Ga0068860_100459002 | 3300005843 | Bacteria | 1267 |
| 231 | Ga0068862_100002002 | 3300005844 | Bacteria | 18476 |
| 232 | Ga0068862_100063239 | 3300005844 | Bacteria | 3185 |
| 233 | Ga0068862_100360193 | 3300005844 | Bacteria | 1351 |
| 234 | Ga0068862_100419162 | 3300005844 | Bacteria | 1256 |
| 235 | Ga0081455_10000048 | 3300005937 | Bacteria | 126551 |
| 236 | Ga0081455_10036386 | 3300005937 | Bacteria | 4384 |
| 237 | Ga0081455_10109094 | 3300005937 | Bacteria | 2203 |
| 238 | Ga0070717_10000150 | 3300006028 | Bacteria | 51802 |
| 239 | Ga0070717_10256933 | 3300006028 | Bacteria | 1545 |
| 240 | Ga0070717_10320379 | 3300006028 | Bacteria | 1381 |
| 241 | Ga0075365_10002448 | 3300006038 | Bacteria | 9108 |
| 242 | Ga0075365_10026234 | 3300006038 | Bacteria | 3697 |
| 243 | Ga0075432_10007512 | 3300006058 | Bacteria | 3713 |
| 244 | Ga0070715_10012192 | 3300006163 | Bacteria | 3120 |
| 245 | Ga0070716_100020197 | 3300006173 | Bacteria | 3494 |
| 246 | Ga0070716_100167516 | 3300006173 | Bacteria | 1430 |
| 247 | Ga0070712_100017131 | 3300006175 | Bacteria | 4686 |
| 248 | Ga0070712_100047906 | 3300006175 | Bacteria | 2960 |
| 249 | Ga0070712_100079311 | 3300006175 | Bacteria | 2372 |
| 250 | Ga0070712_100081094 | 3300006175 | Bacteria | 2350 |
| 251 | Ga0070712_100121889 | 3300006175 | Bacteria | 1963 |
| 252 | Ga0070712_100277761 | 3300006175 | Bacteria | 1348 |
| 253 | Ga0075367_10044499 | 3300006178 | Bacteria | 2603 |
| 254 | Ga0075427_10000042 | 3300006194 | Bacteria | 9085 |
| 255 | Ga0097621_100000144 | 3300006237 | Bacteria | 43169 |
| 256 | Ga0097621_100163371 | 3300006237 | Unclassified | 1915 |
| 257 | Ga0068871_100000110 | 3300006358 | Bacteria | 49756 |
| 258 | Ga0068871_100045891 | 3300006358 | Bacteria | 3518 |
| 259 | Ga0068871_100077839 | 3300006358 | Bacteria | 2741 |
| 260 | Ga0068871_100113826 | 3300006358 | Bacteria | 2278 |
| 261 | Ga0068871_100313925 | 3300006358 | Unclassified | 1378 |
| 262 | Ga0075428_100005798 | 3300006844 | Bacteria | 13717 |
| 263 | Ga0075430_100000627 | 3300006846 | Bacteria | 26908 |
| 264 | Ga0075431_100004676 | 3300006847 | Bacteria | 13440 |
| 265 | Ga0075433_10000615 | 3300006852 | Bacteria | 23766 |
| 266 | Ga0075433_10014612 | 3300006852 | Bacteria | 6418 |
| 267 | Ga0075433_10162511 | 3300006852 | Bacteria | 1987 |
| 268 | Ga0075434_100000084 | 3300006871 | Bacteria | 50928 |
| 269 | Ga0075434_100082669 | 3300006871 | Bacteria | 3209 |
| 270 | Ga0075434_100086680 | 3300006871 | Bacteria | 3131 |
| 271 | Ga0075434_100101394 | 3300006871 | Bacteria | 2885 |
| 272 | Ga0075434_100392587 | 3300006871 | Bacteria | 1408 |
| 273 | Ga0075434_100844731 | 3300006871 | Bacteria | 931 |
| 274 | Ga0075429_100000877 | 3300006880 | Bacteria | 23746 |
| 275 | Ga0068865_100000066 | 3300006881 | Bacteria | 54564 |
| 276 | Ga0068865_100079566 | 3300006881 | Bacteria | 2348 |
| 277 | Ga0068865_100229896 | 3300006881 | Bacteria | 1454 |
| 278 | Ga0097620_100025020 | 3300006931 | Bacteria | 5992 |
| 279 | Ga0097620_100043743 | 3300006931 | Bacteria | 4501 |
| 280 | Ga0097620_100340966 | 3300006931 | Bacteria | 1593 |
| 281 | Ga0075435_100018081 | 3300007076 | Bacteria | 5350 |
| 282 | Ga0075435_100028762 | 3300007076 | Bacteria | 4360 |
| 283 | Ga0075435_100089495 | 3300007076 | Bacteria | 2538 |
| 284 | Ga0075435_100109690 | 3300007076 | Bacteria | 2294 |
| 285 | Ga0075435_100119375 | 3300007076 | Bacteria | 2199 |
| 286 | Ga0075435_100396347 | 3300007076 | Bacteria | 1187 |
| 287 | Ga0105251_10024513 | 3300009011 | Bacteria | 3097 |
| 288 | Ga0105250_10058608 | 3300009092 | Bacteria | 1546 |
| 289 | Ga0105240_10114236 | 3300009093 | Bacteria | 3262 |
| 290 | Ga0105240_10157229 | 3300009093 | Bacteria | 2702 |
| 291 | Ga0105240_10182013 | 3300009093 | Bacteria | 2479 |
| 292 | Ga0105240_10184284 | 3300009093 | Bacteria | 2460 |
| 293 | Ga0105240_10672126 | 3300009093 | Bacteria | 1133 |
| 294 | Ga0111539_10000423 | 3300009094 | Bacteria | 53050 |
| 295 | Ga0111539_10000652 | 3300009094 | Bacteria | 44828 |
| 296 | Ga0111539_10001255 | 3300009094 | Bacteria | 33804 |
| 297 | Ga0111539_10041376 | 3300009094 | Bacteria | 5540 |
| 298 | Ga0111539_10451752 | 3300009094 | Bacteria | 1496 |
| 299 | Ga0105245_10000287 | 3300009098 | Bacteria | 48204 |
| 300 | Ga0105245_10151112 | 3300009098 | Bacteria | 2196 |
| 301 | Ga0105245_10270117 | 3300009098 | Bacteria | 1658 |
| 302 | Ga0105245_10772030 | 3300009098 | Bacteria | 998 |
| 303 | Ga0105245_10772031 | 3300009098 | Bacteria | 998 |
| 304 | Ga0105247_10001223 | 3300009101 | Bacteria | 19057 |
| 305 | Ga0114129_10005652 | 3300009147 | Bacteria | 17703 |
| 306 | Ga0114129_10014653 | 3300009147 | Bacteria | 11169 |
| 307 | Ga0114129_10016700 | 3300009147 | Bacteria | 10455 |
| 308 | Ga0105243_10000695 | 3300009148 | Bacteria | 32613 |
| 309 | Ga0105243_10003814 | 3300009148 | Bacteria | 12061 |
| 310 | Ga0105243_10042456 | 3300009148 | Bacteria | 3560 |
| 311 | Ga0105243_10279702 | 3300009148 | Bacteria | 1502 |
| 312 | Ga0105241_10002331 | 3300009174 | Bacteria | 14262 |
| 313 | Ga0105241_10050152 | 3300009174 | Bacteria | 3180 |
| 314 | Ga0105241_10077871 | 3300009174 | Bacteria | 2589 |
| 315 | Ga0105241_10089324 | 3300009174 | Unclassified | 2427 |
| 316 | Ga0105241_10435075 | 3300009174 | Bacteria | 1157 |
| 317 | Ga0105242_10013046 | 3300009176 | Bacteria | 6412 |
| 318 | Ga0105242_10021242 | 3300009176 | Bacteria | 5094 |
| 319 | Ga0105242_10027855 | 3300009176 | Bacteria | 4492 |
| 320 | Ga0105242_10463740 | 3300009176 | Unclassified | 1197 |
| 321 | Ga0105248_10000535 | 3300009177 | Bacteria | 43210 |
| 322 | Ga0105248_10017864 | 3300009177 | Bacteria | 7827 |
| 323 | Ga0105248_10054802 | 3300009177 | Bacteria | 4472 |
| 324 | Ga0105248_10217704 | 3300009177 | Bacteria | 2150 |
| 325 | Ga0105248_10230495 | 3300009177 | Bacteria | 2085 |
| 326 | Ga0105237_10001499 | 3300009545 | Bacteria | 30715 |
| 327 | Ga0105237_10060545 | 3300009545 | Bacteria | 3787 |
| 328 | Ga0105238_10024354 | 3300009551 | Bacteria | 6170 |
| 329 | Ga0105238_10129759 | 3300009551 | Bacteria | 2499 |
| 330 | Ga0105238_10271473 | 3300009551 | Bacteria | 1676 |
| 331 | Ga0105249_10000279 | 3300009553 | Bacteria | 53594 |
| 332 | Ga0105249_10127265 | 3300009553 | Bacteria | 2427 |
| 333 | Ga0105249_10131049 | 3300009553 | Bacteria | 2394 |
| 334 | Ga0105249_10531674 | 3300009553 | Unclassified | 1224 |
| 335 | Ga0105239_10001686 | 3300010375 | Bacteria | 29130 |
| 336 | Ga0105239_10273347 | 3300010375 | Bacteria | 1901 |
| 337 | Ga0105239_10411292 | 3300010375 | Unclassified | 1532 |
| 338 | Ga0105239_10993354 | 3300010375 | Bacteria | 965 |
| 339 | Ga0105246_10000095 | 3300011119 | Bacteria | 38417 |
| 340 | Ga0105246_10055476 | 3300011119 | Unclassified | 2734 |
| 341 | Ga0105246_10245586 | 3300011119 | Bacteria | 1418 |
| 342 | Ga0105246_10448086 | 3300011119 | Bacteria | 1084 |
| 343 | Ga0105246_10452299 | 3300011119 | Bacteria | 1079 |
| 344 | Ga0157345_1002874 | 3300012498 | Bacteria | 1234 |
| 345 | Ga0157347_1008400 | 3300012502 | Bacteria | 1048 |
| 346 | Ga0157373_10022698 | 3300013100 | Bacteria | 4551 |
| 347 | Ga0157371_10042162 | 3300013102 | Bacteria | 3254 |
| 348 | Ga0157370_10020087 | 3300013104 | Bacteria | 6680 |
| 349 | Ga0157370_10152263 | 3300013104 | Bacteria | 2152 |
| 350 | Ga0157370_10172208 | 3300013104 | Bacteria | 2012 |
| 351 | Ga0157369_10109236 | 3300013105 | Bacteria | 2941 |
| 352 | Ga0157369_10287426 | 3300013105 | Bacteria | 1712 |
| 353 | Ga0157374_10001348 | 3300013296 | Bacteria | 20895 |
| 354 | Ga0157374_10125535 | 3300013296 | Bacteria | 2480 |
| 355 | Ga0157374_10415715 | 3300013296 | Bacteria | 1343 |
| 356 | Ga0157378_10000956 | 3300013297 | Bacteria | 26502 |
| 357 | Ga0157378_10111481 | 3300013297 | Bacteria | 2509 |
| 358 | Ga0157378_10307366 | 3300013297 | Bacteria | 1537 |
| 359 | Ga0157378_10473048 | 3300013297 | Unclassified | 1247 |
| 360 | Ga0157378_10626880 | 3300013297 | Unclassified | 1089 |
| 361 | Ga0163162_10003174 | 3300013306 | Bacteria | 15714 |
| 362 | Ga0163162_10032167 | 3300013306 | Bacteria | 5208 |
| 363 | Ga0163162_10048100 | 3300013306 | Bacteria | 4273 |
| 364 | Ga0163162_10360605 | 3300013306 | Bacteria | 1586 |
| 365 | Ga0163162_10915450 | 3300013306 | Bacteria | 989 |
| 366 | Ga0163162_11108907 | 3300013306 | Bacteria | 897 |
| 367 | Ga0157372_10038947 | 3300013307 | Bacteria | 5247 |
| 368 | Ga0157372_10378267 | 3300013307 | Bacteria | 1650 |
| 369 | Ga0157372_10669520 | 3300013307 | Bacteria | 1208 |
| 370 | Ga0157375_10001973 | 3300013308 | Bacteria | 17692 |
| 371 | Ga0157375_10228127 | 3300013308 | Bacteria | 2021 |
| 372 | Ga0157375_10534860 | 3300013308 | Bacteria | 1335 |
| 373 | Ga0163163_10002399 | 3300014325 | Bacteria | 15859 |
| 374 | Ga0163163_10008535 | 3300014325 | Bacteria | 9106 |
| 375 | Ga0163163_10011378 | 3300014325 | Bacteria | 8065 |
| 376 | Ga0163163_10142726 | 3300014325 | Bacteria | 2437 |
| 377 | Ga0163163_10176916 | 3300014325 | Bacteria | 2180 |
| 378 | Ga0157380_10000052 | 3300014326 | Bacteria | 67030 |
| 379 | Ga0157380_10542621 | 3300014326 | Unclassified | 1139 |
| 380 | Ga0157380_10897278 | 3300014326 | Unclassified | 912 |
| 381 | Ga0182008_10220955 | 3300014497 | Unclassified | 969 |
| 382 | Ga0157377_10000076 | 3300014745 | Bacteria | 75835 |
| 383 | Ga0157377_10001911 | 3300014745 | Bacteria | 9115 |
| 384 | Ga0157377_10286769 | 3300014745 | Bacteria | 1081 |
| 385 | Ga0157379_10000060 | 3300014968 | Bacteria | 69312 |
| 386 | Ga0157379_10023835 | 3300014968 | Bacteria | 5432 |
| 387 | Ga0157379_10035407 | 3300014968 | Bacteria | 4451 |
| 388 | Ga0157379_10158119 | 3300014968 | Bacteria | 2045 |
| 389 | Ga0157376_10000141 | 3300014969 | Bacteria | 49288 |
| 390 | Ga0157376_10021304 | 3300014969 | Bacteria | 5033 |
| 391 | Ga0157376_10026235 | 3300014969 | Bacteria | 4601 |
| 392 | Ga0157376_10056864 | 3300014969 | Bacteria | 3271 |
| 393 | Ga0157376_10125466 | 3300014969 | Bacteria | 2282 |
| 394 | Ga0157376_10862517 | 3300014969 | Bacteria | 921 |
| 395 | Ga0163161_10000739 | 3300017792 | Bacteria | 25660 |
| 396 | Ga0163161_10006741 | 3300017792 | Bacteria | 7940 |
| 397 | Ga0206353_10179351 | 3300020082 | Bacteria | 1219 |
| 398 | Ga0213876_10006713 | 3300021384 | Bacteria | 6281 |
| 399 | Ga0213876_10232052 | 3300021384 | Bacteria | 981 |
| 400 | Ga0213875_10032870 | 3300021388 | Bacteria | 2450 |
| 401 | Ga0209233_1019457 | 3300025261 | Bacteria | 1804 |
| 402 | Ga0207666_1000005 | 3300025271 | Bacteria | 54011 |
| 403 | Ga0207673_1000211 | 3300025290 | Bacteria | 5838 |
| 404 | Ga0207697_10000011 | 3300025315 | Bacteria | 65035 |
| 405 | Ga0207696_1038787 | 3300025711 | Bacteria | 1404 |
| 406 | Ga0207713_1070490 | 3300025735 | Bacteria | 1292 |
| 407 | Ga0207682_10000332 | 3300025893 | Bacteria | 21608 |
| 408 | Ga0207692_10001915 | 3300025898 | Bacteria | 7920 |
| 409 | Ga0207692_10020267 | 3300025898 | Bacteria | 3021 |
| 410 | Ga0207692_10070486 | 3300025898 | Bacteria | 1840 |
| 411 | Ga0207642_10000176 | 3300025899 | Bacteria | 18394 |
| 412 | Ga0207710_10007209 | 3300025900 | Bacteria | 4715 |
| 413 | Ga0207710_10013629 | 3300025900 | Bacteria | 3420 |
| 414 | Ga0207688_10000001 | 3300025901 | Bacteria | 107505 |
| 415 | Ga0207688_10027120 | 3300025901 | Bacteria | 3151 |
| 416 | Ga0207680_10027835 | 3300025903 | Bacteria | 3154 |
| 417 | Ga0207680_10236085 | 3300025903 | Bacteria | 1258 |
| 418 | Ga0207647_10001714 | 3300025904 | Bacteria | 16833 |
| 419 | Ga0207647_10125880 | 3300025904 | Bacteria | 1508 |
| 420 | Ga0207699_10042390 | 3300025906 | Bacteria | 2636 |
| 421 | Ga0207699_10120248 | 3300025906 | Bacteria | 1697 |
| 422 | Ga0207699_10155970 | 3300025906 | Bacteria | 1515 |
| 423 | Ga0207645_10001831 | 3300025907 | Bacteria | 17142 |
| 424 | Ga0207645_10023006 | 3300025907 | Bacteria | 4050 |
| 425 | Ga0207645_10155368 | 3300025907 | Bacteria | 1494 |
| 426 | Ga0207645_10204363 | 3300025907 | Bacteria | 1300 |
| 427 | Ga0207643_10000009 | 3300025908 | Bacteria | 160496 |
| 428 | Ga0207643_10022969 | 3300025908 | Bacteria | 3438 |
| 429 | Ga0207705_10045462 | 3300025909 | Bacteria | 3155 |
| 430 | Ga0207705_10131472 | 3300025909 | Bacteria | 1863 |
| 431 | Ga0207705_10204139 | 3300025909 | Bacteria | 1498 |
| 432 | Ga0207654_10001894 | 3300025911 | Bacteria | 10849 |
| 433 | Ga0207654_10033396 | 3300025911 | Bacteria | 2852 |
| 434 | Ga0207654_10037929 | 3300025911 | Unclassified | 2700 |
| 435 | Ga0207707_10000840 | 3300025912 | Bacteria | 30189 |
| 436 | Ga0207707_10044915 | 3300025912 | Bacteria | 3850 |
| 437 | Ga0207707_10051775 | 3300025912 | Bacteria | 3576 |
| 438 | Ga0207707_10093874 | 3300025912 | Bacteria | 2621 |
| 439 | Ga0207707_10338233 | 3300025912 | Bacteria | 1298 |
| 440 | Ga0207695_10075974 | 3300025913 | Bacteria | 3416 |
| 441 | Ga0207695_10095483 | 3300025913 | Bacteria | 2977 |
| 442 | Ga0207695_10338077 | 3300025913 | Bacteria | 1394 |
| 443 | Ga0207671_10075409 | 3300025914 | Bacteria | 2522 |
| 444 | Ga0207671_10127891 | 3300025914 | Bacteria | 1948 |
| 445 | Ga0207693_10012127 | 3300025915 | Bacteria | 6966 |
| 446 | Ga0207693_10012139 | 3300025915 | Bacteria | 6961 |
| 447 | Ga0207693_10133351 | 3300025915 | Bacteria | 1952 |
| 448 | Ga0207693_10166025 | 3300025915 | Bacteria | 1738 |
| 449 | Ga0207693_10204019 | 3300025915 | Unclassified | 1554 |
| 450 | Ga0207663_10005694 | 3300025916 | Bacteria | 6303 |
| 451 | Ga0207663_10012585 | 3300025916 | Bacteria | 4580 |
| 452 | Ga0207663_10068424 | 3300025916 | Bacteria | 2280 |
| 453 | Ga0207663_10198315 | 3300025916 | Bacteria | 1446 |
| 454 | Ga0207660_10000775 | 3300025917 | Bacteria | 21240 |
| 455 | Ga0207660_10038650 | 3300025917 | Bacteria | 3332 |
| 456 | Ga0207660_10063567 | 3300025917 | Bacteria | 2662 |
| 457 | Ga0207660_10335304 | 3300025917 | Bacteria | 1210 |
| 458 | Ga0207662_10000645 | 3300025918 | Bacteria | 15745 |
| 459 | Ga0207657_10004673 | 3300025919 | Bacteria | 14459 |
| 460 | Ga0207657_10009807 | 3300025919 | Bacteria | 9598 |
| 461 | Ga0207657_10086831 | 3300025919 | Bacteria | 2618 |
| 462 | Ga0207657_10098755 | 3300025919 | Bacteria | 2426 |
| 463 | Ga0207657_10140684 | 3300025919 | Bacteria | 1972 |
| 464 | Ga0207657_10150638 | 3300025919 | Bacteria | 1895 |
| 465 | Ga0207657_10368191 | 3300025919 | Bacteria | 1132 |
| 466 | Ga0207649_10000052 | 3300025920 | Bacteria | 106800 |
| 467 | Ga0207649_10082132 | 3300025920 | Bacteria | 2089 |
| 468 | Ga0207649_10104150 | 3300025920 | Bacteria | 1883 |
| 469 | Ga0207652_10000508 | 3300025921 | Bacteria | 39568 |
| 470 | Ga0207652_10042874 | 3300025921 | Bacteria | 3852 |
| 471 | Ga0207652_10099968 | 3300025921 | Bacteria | 2560 |
| 472 | Ga0207652_10141852 | 3300025921 | Bacteria | 2149 |
| 473 | Ga0207652_10241182 | 3300025921 | Bacteria | 1630 |
| 474 | Ga0207681_10000035 | 3300025923 | Bacteria | 161792 |
| 475 | Ga0207681_10216857 | 3300025923 | Bacteria | 1478 |
| 476 | Ga0207694_10013689 | 3300025924 | Bacteria | 6112 |
| 477 | Ga0207694_10280026 | 3300025924 | Bacteria | 1370 |
| 478 | Ga0207694_10613509 | 3300025924 | Bacteria | 915 |
| 479 | Ga0207650_10004006 | 3300025925 | Bacteria | 10077 |
| 480 | Ga0207650_10029712 | 3300025925 | Bacteria | 3931 |
| 481 | Ga0207650_10152127 | 3300025925 | Unclassified | 1827 |
| 482 | Ga0207659_10000027 | 3300025926 | Bacteria | 135454 |
| 483 | Ga0207659_10062431 | 3300025926 | Bacteria | 2689 |
| 484 | Ga0207659_10516412 | 3300025926 | Unclassified | 1013 |
| 485 | Ga0207687_10000231 | 3300025927 | Bacteria | 38087 |
| 486 | Ga0207687_10121439 | 3300025927 | Bacteria | 1955 |
| 487 | Ga0207687_10269396 | 3300025927 | Unclassified | 1361 |
| 488 | Ga0207700_10000917 | 3300025928 | Bacteria | 16892 |
| 489 | Ga0207700_10018837 | 3300025928 | Bacteria | 4650 |
| 490 | Ga0207664_10050032 | 3300025929 | Bacteria | 3293 |
| 491 | Ga0207664_10068903 | 3300025929 | Bacteria | 2844 |
| 492 | Ga0207664_10160417 | 3300025929 | Unclassified | 1918 |
| 493 | Ga0207664_10238850 | 3300025929 | Bacteria | 1582 |
| 494 | Ga0207644_10000676 | 3300025931 | Bacteria | 21510 |
| 495 | Ga0207644_10001814 | 3300025931 | Bacteria | 13865 |
| 496 | Ga0207644_10277087 | 3300025931 | Bacteria | 1346 |
| 497 | Ga0207690_10000148 | 3300025932 | Bacteria | 56244 |
| 498 | Ga0207690_10005705 | 3300025932 | Bacteria | 7354 |
| 499 | Ga0207690_10272583 | 3300025932 | Bacteria | 1315 |
| 500 | Ga0207706_10000261 | 3300025933 | Bacteria | 57530 |
| 501 | Ga0207706_10009549 | 3300025933 | Bacteria | 8908 |
| 502 | Ga0207706_10011544 | 3300025933 | Bacteria | 8044 |
| 503 | Ga0207706_10079975 | 3300025933 | Bacteria | 2874 |
| 504 | Ga0207706_10091374 | 3300025933 | Bacteria | 2676 |
| 505 | Ga0207686_10000171 | 3300025934 | Bacteria | 49624 |
| 506 | Ga0207686_10142585 | 3300025934 | Bacteria | 1658 |
| 507 | Ga0207686_10177549 | 3300025934 | Bacteria | 1508 |
| 508 | Ga0207709_10000087 | 3300025935 | Bacteria | 155019 |
| 509 | Ga0207709_10338600 | 3300025935 | Bacteria | 1131 |
| 510 | Ga0207670_10000169 | 3300025936 | Bacteria | 43470 |
| 511 | Ga0207670_10061140 | 3300025936 | Bacteria | 2569 |
| 512 | Ga0207670_10084942 | 3300025936 | Bacteria | 2223 |
| 513 | Ga0207669_10000351 | 3300025937 | Bacteria | 20924 |
| 514 | Ga0207704_10000392 | 3300025938 | Bacteria | 19977 |
| 515 | Ga0207704_10080565 | 3300025938 | Bacteria | 2102 |
| 516 | Ga0207665_10006980 | 3300025939 | Bacteria | 7473 |
| 517 | Ga0207665_10014334 | 3300025939 | Bacteria | 5219 |
| 518 | Ga0207691_10000106 | 3300025940 | Bacteria | 74290 |
| 519 | Ga0207691_10003240 | 3300025940 | Bacteria | 15858 |
| 520 | Ga0207691_10276908 | 3300025940 | Bacteria | 1444 |
| 521 | Ga0207691_10339613 | 3300025940 | Bacteria | 1286 |
| 522 | Ga0207711_10002556 | 3300025941 | Bacteria | 16214 |
| 523 | Ga0207711_10190386 | 3300025941 | Bacteria | 1869 |
| 524 | Ga0207689_10000031 | 3300025942 | Bacteria | 97131 |
| 525 | Ga0207689_10058339 | 3300025942 | Bacteria | 3175 |
| 526 | Ga0207661_10000219 | 3300025944 | Bacteria | 37298 |
| 527 | Ga0207661_10042920 | 3300025944 | Bacteria | 3568 |
| 528 | Ga0207661_10219707 | 3300025944 | Bacteria | 1679 |
| 529 | Ga0207661_10356449 | 3300025944 | Bacteria | 1321 |
| 530 | Ga0207679_10000493 | 3300025945 | Bacteria | 27242 |
| 531 | Ga0207679_10208995 | 3300025945 | Bacteria | 1635 |
| 532 | Ga0207667_10006216 | 3300025949 | Bacteria | 14494 |
| 533 | Ga0207667_10056791 | 3300025949 | Bacteria | 4111 |
| 534 | Ga0207667_10135517 | 3300025949 | Bacteria | 2535 |
| 535 | Ga0207667_10253791 | 3300025949 | Unclassified | 1799 |
| 536 | Ga0207667_10396727 | 3300025949 | Bacteria | 1405 |
| 537 | Ga0207651_10001402 | 3300025960 | Bacteria | 10939 |
| 538 | Ga0207651_10042171 | 3300025960 | Bacteria | 3035 |
| 539 | Ga0207651_10109644 | 3300025960 | Bacteria | 2069 |
| 540 | Ga0207712_10000176 | 3300025961 | Bacteria | 66116 |
| 541 | Ga0207712_10084235 | 3300025961 | Bacteria | 2323 |
| 542 | Ga0207668_10000191 | 3300025972 | Bacteria | 41901 |
| 543 | Ga0207640_10000126 | 3300025981 | Bacteria | 58432 |
| 544 | Ga0207640_10048911 | 3300025981 | Bacteria | 2736 |
| 545 | Ga0207658_10007487 | 3300025986 | Bacteria | 7438 |
| 546 | Ga0207658_10039587 | 3300025986 | Bacteria | 3401 |
| 547 | Ga0207658_10146888 | 3300025986 | Unclassified | 1916 |
| 548 | Ga0207658_10158151 | 3300025986 | Unclassified | 1854 |
| 549 | Ga0207658_10467002 | 3300025986 | Bacteria | 1119 |
| 550 | Ga0207677_10008615 | 3300026023 | Bacteria | 5710 |
| 551 | Ga0207677_10011116 | 3300026023 | Bacteria | 5118 |
| 552 | Ga0207703_10006871 | 3300026035 | Bacteria | 9061 |
| 553 | Ga0207639_10000515 | 3300026041 | Bacteria | 26655 |
| 554 | Ga0207639_10153092 | 3300026041 | Bacteria | 1934 |
| 555 | Ga0207639_10297240 | 3300026041 | Bacteria | 1426 |
| 556 | Ga0207678_10003344 | 3300026067 | Bacteria | 14464 |
| 557 | Ga0207678_10018565 | 3300026067 | Bacteria | 6107 |
| 558 | Ga0207678_10130554 | 3300026067 | Unclassified | 2143 |
| 559 | Ga0207708_10002176 | 3300026075 | Bacteria | 14459 |
| 560 | Ga0207708_10004315 | 3300026075 | Bacteria | 10470 |
| 561 | Ga0207708_10005555 | 3300026075 | Bacteria | 9306 |
| 562 | Ga0207708_10058968 | 3300026075 | Bacteria | 2929 |
| 563 | Ga0207708_10519634 | 3300026075 | Bacteria | 1000 |
| 564 | Ga0207702_10093843 | 3300026078 | Bacteria | 2633 |
| 565 | Ga0207702_10127863 | 3300026078 | Bacteria | 2283 |
| 566 | Ga0207702_10161072 | 3300026078 | Bacteria | 2049 |
| 567 | Ga0207702_10166863 | 3300026078 | Bacteria | 2015 |
| 568 | Ga0207702_10174061 | 3300026078 | Bacteria | 1976 |
| 569 | Ga0207702_10201285 | 3300026078 | Bacteria | 1846 |
| 570 | Ga0207702_10716468 | 3300026078 | Bacteria | 986 |
| 571 | Ga0207641_10000937 | 3300026088 | Bacteria | 30095 |
| 572 | Ga0207641_10319240 | 3300026088 | Bacteria | 1472 |
| 573 | Ga0207648_10000125 | 3300026089 | Bacteria | 75547 |
| 574 | Ga0207648_10004855 | 3300026089 | Bacteria | 13713 |
| 575 | Ga0207648_10101634 | 3300026089 | Bacteria | 2519 |
| 576 | Ga0207676_10001547 | 3300026095 | Bacteria | 16966 |
| 577 | Ga0207676_10021875 | 3300026095 | Bacteria | 4696 |
| 578 | Ga0207674_10000095 | 3300026116 | Bacteria | 99278 |
| 579 | Ga0207674_10037855 | 3300026116 | Bacteria | 5012 |
| 580 | Ga0207674_10277435 | 3300026116 | Bacteria | 1624 |
| 581 | Ga0207674_10510457 | 3300026116 | Unclassified | 1161 |
| 582 | Ga0207675_100000140 | 3300026118 | Bacteria | 62058 |
| 583 | Ga0207675_100178450 | 3300026118 | Bacteria | 2033 |
| 584 | Ga0207683_10000178 | 3300026121 | Bacteria | 54648 |
| 585 | Ga0207683_10001447 | 3300026121 | Bacteria | 21461 |
| 586 | Ga0207683_10006604 | 3300026121 | Bacteria | 9927 |
| 587 | Ga0207683_10093752 | 3300026121 | Bacteria | 2676 |
| 588 | Ga0207698_10055129 | 3300026142 | Bacteria | 3061 |
| 589 | Ga0207698_10179775 | 3300026142 | Bacteria | 1873 |
| 590 | Ga0210002_1010222 | 3300027617 | Bacteria | 1439 |
| 591 | Ga0209998_10001420 | 3300027717 | Bacteria | 5803 |
| 592 | Ga0209998_10007968 | 3300027717 | Bacteria | 2198 |
| 593 | Ga0209974_10001253 | 3300027876 | Bacteria | 9106 |
| 594 | Ga0207428_10000037 | 3300027907 | Bacteria | 218857 |
| 595 | Ga0207428_10000188 | 3300027907 | Bacteria | 85820 |
| 596 | Ga0207428_10001468 | 3300027907 | Bacteria | 24676 |
| 597 | Ga0207428_10208475 | 3300027907 | Bacteria | 1469 |
| 598 | Ga0268266_10058547 | 3300028379 | Bacteria | 3317 |
| 599 | Ga0268266_10072157 | 3300028379 | Bacteria | 2993 |
| 600 | Ga0268265_10003265 | 3300028380 | Bacteria | 11753 |
| 601 | Ga0268265_10210048 | 3300028380 | Bacteria | 1695 |
| 602 | Ga0268264_10000467 | 3300028381 | Bacteria | 54925 |
| 603 | Ga0268264_10146328 | 3300028381 | Unclassified | 2113 |
| 604 | Ga0268264_10621572 | 3300028381 | Bacteria | 1067 |
| 605 | Ga0265318_10028860 | 3300028577 | Bacteria | 2166 |
| 606 | Ga0265338_10109014 | 3300028800 | Bacteria | 2235 |
| 607 | Ga0265330_10011740 | 3300031235 | Bacteria | 4104 |
| 608 | Ga0265325_10000049 | 3300031241 | Bacteria | 80854 |
| 609 | Ga0265325_10026895 | 3300031241 | Bacteria | 3113 |
| 610 | Ga0265325_10104861 | 3300031241 | Bacteria | 1380 |
| 611 | Ga0265340_10008615 | 3300031247 | Bacteria | 5498 |
| 612 | Ga0265340_10010149 | 3300031247 | Bacteria | 5044 |
| 613 | Ga0265339_10008341 | 3300031249 | Bacteria | 6596 |
| 614 | Ga0265313_10000367 | 3300031595 | Bacteria | 48929 |
| 615 | Ga0265313_10016043 | 3300031595 | Bacteria | 4329 |
| 616 | Ga0265313_10023470 | 3300031595 | Bacteria | 3321 |
| 617 | Ga0316579_10029032 | 3300031691 | Bacteria | 2522 |
| 618 | Ga0265314_10002604 | 3300031711 | Bacteria | 18249 |
| 619 | Ga0265314_10080527 | 3300031711 | Bacteria | 2150 |
| 620 | Ga0265342_10000131 | 3300031712 | Bacteria | 82968 |
| 621 | Ga0265342_10043803 | 3300031712 | Bacteria | 2699 |
| 622 | Ga0373930_0004830 | 3300034816 | Bacteria | 2213 |
| 623 | Ga0373948_0000573 | 3300034817 | Bacteria | 4677 |
| 624 | Ga0373948_0008845 | 3300034817 | Bacteria | 1725 |
| 625 | Ga0373948_0013917 | 3300034817 | Bacteria | 1460 |
| 626 | Ga0373950_0008136 | 3300034818 | Bacteria | 1642 |
| 627 | Ga0373958_0002000 | 3300034819 | Bacteria | 2810 |
| 628 | Ga0373958_0005551 | 3300034819 | Bacteria | 1923 |
| 629 | Ga0373959_0008049 | 3300034820 | Bacteria | 1784 |
| 630 | Ga0373938_0001280 | 3300034957 | Bacteria | 4036 |
| 631 | Ga0373938_0001567 | 3300034957 | Bacteria | 3675 |
| 632 | Ga0373926_0059285 | 3300035083 | Bacteria | 1393 |
| 633 | Ga0373928_0000298 | 3300035084 | Bacteria | 9863 |
| 634 | Ga0373928_0001394 | 3300035084 | Bacteria | 4714 |
| 635 | Ga0373929_0001337 | 3300035085 | Bacteria | 4738 |
| 636 | Ga0373929_0003771 | 3300035085 | Bacteria | 2716 |
| 637 | Ga0373929_0009503 | 3300035085 | Bacteria | 1804 |
| 638 | Ga0373934_0071793 | 3300035086 | Bacteria | 1385 |
| 639 | Ga0373940_0000080 | 3300035088 | Bacteria | 11517 |
| 640 | Ga0373944_0005697 | 3300035089 | Bacteria | 3286 |
| 641 | Ga0373944_0036995 | 3300035089 | Bacteria | 1493 |
| 642 | Ga0373949_0000470 | 3300035090 | Bacteria | 13802 |
| 643 | Ga0373949_0001211 | 3300035090 | Bacteria | 7642 |
| 644 | Ga0373949_0004945 | 3300035090 | Bacteria | 3008 |
| 645 | Ga0373949_0015141 | 3300035090 | Bacteria | 1720 |
| 646 | Ga0373951_0001678 | 3300035091 | Bacteria | 5789 |
| 647 | Ga0373951_0003802 | 3300035091 | Bacteria | 3636 |
| 648 | Ga0373952_0001024 | 3300035092 | Bacteria | 5106 |
| 649 | Ga0373952_0003807 | 3300035092 | Bacteria | 2733 |
| 650 | Ga0373923_0062601 | 3300035111 | Bacteria | 1583 |
| 651 | Ga0373932_0004055 | 3300035112 | Bacteria | 3483 |
| 652 | Ga0373932_0013240 | 3300035112 | Bacteria | 2046 |
| 653 | Ga0373932_0019612 | 3300035112 | Bacteria | 1765 |
| 654 | Ga0373932_0022936 | 3300035112 | Bacteria | 1663 |
| 655 | Ga0373936_0008887 | 3300035113 | Bacteria | 3786 |
| 656 | Ga0373936_0014438 | 3300035113 | Bacteria | 3020 |
| 657 | Ga0373936_0064415 | 3300035113 | Bacteria | 1502 |
| 658 | Ga0373939_0002126 | 3300035114 | Bacteria | 4715 |
| 659 | Ga0373939_0045719 | 3300035114 | Bacteria | 1337 |
| 660 | Ga0373941_0002163 | 3300035115 | Bacteria | 4289 |
| 661 | Ga0373941_0002809 | 3300035115 | Bacteria | 3873 |
| 662 | Ga0373945_0006376 | 3300035116 | Bacteria | 3805 |
| 663 | Ga0373945_0007998 | 3300035116 | Bacteria | 3434 |
| 664 | Ga0373945_0009643 | 3300035116 | Bacteria | 3166 |
| 665 | Ga0373945_0013167 | 3300035116 | Bacteria | 2757 |
| 666 | Ga0373953_0001317 | 3300035117 | Bacteria | 7117 |
| 667 | Ga0373953_0065362 | 3300035117 | Bacteria | 1493 |
| 668 | Ga0373954_0017961 | 3300035118 | Bacteria | 3180 |
| 669 | Ga0373956_0056276 | 3300035119 | Bacteria | 1775 |
| 670 | Ga0373956_0135016 | 3300035119 | Bacteria | 1157 |
| 671 | Ga0373957_0041803 | 3300035120 | Bacteria | 1727 |
| 672 | Ga0373960_0001537 | 3300035121 | Bacteria | 5138 |
| 673 | Ga0373960_0001555 | 3300035121 | Bacteria | 5117 |
| 674 | Ga0373960_0005815 | 3300035121 | Bacteria | 2869 |
| 675 | Ga0373960_0044318 | 3300035121 | Bacteria | 1299 |
| 676 | Ga0373943_0005425 | 3300035170 | Bacteria | 5738 |
| 677 | Ga0373943_0090690 | 3300035170 | Bacteria | 1582 |
| 678 | Ga0373946_0005557 | 3300035171 | Bacteria | 4549 |
| 679 | Ga0373946_0056845 | 3300035171 | Bacteria | 1653 |
| 680 | Ga0373955_0021578 | 3300035172 | Bacteria | 3254 |
| 681 | Ga0373955_0023579 | 3300035172 | Bacteria | 3137 |
| 682 | Ga0373955_0117434 | 3300035172 | Bacteria | 1543 |
| 683 | Ga0373942_0001029 | 3300035207 | Bacteria | 7582 |
| 684 | Ga0373942_0001201 | 3300035207 | Bacteria | 6829 |
| 685 | Ga0373942_0024547 | 3300035207 | Bacteria | 1546 |
| 686 | Ga0373961_0003450 | 3300035241 | Bacteria | 3909 |
| 687 | Ga0373961_0024002 | 3300035241 | Bacteria | 1646 |
| 688 | Ga0373962_0002652 | 3300035242 | Bacteria | 4253 |
| 689 | Ga0373962_0016004 | 3300035242 | Bacteria | 1929 |
| 690 | Ga0373962_0029953 | 3300035242 | Bacteria | 1486 |
| 691 | Ga0373924_0024148 | 3300035410 | Bacteria | 2393 |
| 692 | Ga0373931_0007106 | 3300035691 | Bacteria | 5264 |
| 693 | Ga0373931_0015678 | 3300035691 | Bacteria | 3719 |
| 694 | Ga0373931_0036025 | 3300035691 | Unclassified | 2577 |
| 695 | Ga0373931_0059714 | 3300035691 | Bacteria | 2051 |
| 696 | Ga0373931_0064570 | 3300035691 | Bacteria | 1982 |
| 697 | Ga0373931_0171393 | 3300035691 | Bacteria | 1279 |
| 698 | Ga0373935_0019509 | 3300035692 | Bacteria | 4135 |
| 699 | Ga0373935_0075913 | 3300035692 | Bacteria | 2175 |
| 700 | Ga0373935_0202191 | 3300035692 | Bacteria | 1373 |
| 701 | Ga0373927_0041744 | 3300035695 | Bacteria | 2974 |
| 702 | Ga0373927_0169372 | 3300035695 | Bacteria | 1431 |
| 703 | Ga0373933_0018347 | 3300035724 | Bacteria | 3933 |
| 704 | Ga0373933_0039204 | 3300035724 | Bacteria | 2786 |
| 705 | Ga0373933_0047510 | 3300035724 | Bacteria | 2553 |
| 706 | Ga0373947_0002717 | 3300035725 | Bacteria | 10620 |
| 707 | Ga0373947_0004057 | 3300035725 | Bacteria | 8615 |
| 708 | Ga0373947_0004916 | 3300035725 | Bacteria | 7815 |
| 709 | Ga0373937_0163301 | 3300036401 | Bacteria | 2088 |
| 710 | Ga0373937_0324524 | 3300036401 | Bacteria | 1457 |
| 711 | Ga0373925_0004221 | 3300037068 | Bacteria | 10908 |
| 712 | Ga0373925_0019424 | 3300037068 | Bacteria | 4941 |
| 713 | Ga0373925_0150943 | 3300037068 | Bacteria | 1825 |
| 714 | Ga0373925_0292983 | 3300037068 | Bacteria | 1312 |
| 715 | Ga0436364_0615504 | 3300037853 | Bacteria | 6023 |
| 716 | Ga0436364_0857978 | 3300037853 | Bacteria | 5089 |
| 717 | Ga0436364_0907772 | 3300037853 | Bacteria | 5950 |
| 718 | Ga0395901_0418326 | 3300038443 | Bacteria | 1375 |
| 719 | Ga0436365_0663409 | 3300039437 | Bacteria | 8926 |
| 720 | Ga0436365_1143395 | 3300039437 | Bacteria | 12928 |
| 721 | Ga0439437_012409 | 3300042000 | Bacteria | 984 |
| 722 | Ga0439450_016535 | 3300042008 | Bacteria | 1527 |
| 723 | Ga0439455_0035143 | 3300042012 | Bacteria | 1264 |
| 724 | Ga0439464_0011066 | 3300042439 | Bacteria | 2385 |
| 725 | Ga0453684_0079918 | 3300044712 | Bacteria | 4086 |
| 726 | Ga0466971_0040592 | 3300044719 | Bacteria | 2090 |
| 727 | Ga0451576_0033526 | 3300045051 | Bacteria | 5458 |
| 728 | Ga0495617_023457 | 3300046452 | Bacteria | 2085 |
| 729 | Ga0495592_0109182 | 3300046454 | Unclassified | 1960 |
| 730 | Ga0495592_0141022 | 3300046454 | Bacteria | 1676 |
| 731 | Ga0495592_0226694 | 3300046454 | Unclassified | 1246 |
| 732 | Ga0495603_0003594 | 3300046455 | Bacteria | 9221 |
| 733 | Ga0495603_0013678 | 3300046455 | Bacteria | 4909 |
| 734 | Ga0495603_0055086 | 3300046455 | Bacteria | 2356 |
| 735 | Ga0495603_0071018 | 3300046455 | Bacteria | 2046 |
| 736 | Ga0495603_0079680 | 3300046455 | Bacteria | 1920 |
| 737 | Ga0495603_0273626 | 3300046455 | Bacteria | 971 |
| 738 | Ga0495590_0056108 | 3300046457 | Bacteria | 1377 |
| 739 | Ga0495629_0000269 | 3300046459 | Bacteria | 45206 |
| 740 | Ga0495629_0023056 | 3300046459 | Bacteria | 4436 |
| 741 | Ga0495629_0049305 | 3300046459 | Bacteria | 2951 |
| 742 | Ga0495638_0193721 | 3300046460 | Bacteria | 1152 |
| 743 | Ga0495651_0007532 | 3300046462 | Bacteria | 8327 |
| 744 | Ga0495651_0080911 | 3300046462 | Bacteria | 2453 |
| 745 | Ga0495651_0114392 | 3300046462 | Bacteria | 1991 |
| 746 | Ga0495653_0035845 | 3300046463 | Bacteria | 3912 |
| 747 | Ga0495653_0172577 | 3300046463 | Bacteria | 1491 |
| 748 | Ga0495653_0185576 | 3300046463 | Bacteria | 1423 |
| 749 | Ga0495580_0009185 | 3300046472 | Bacteria | 7793 |
| 750 | Ga0495580_0009445 | 3300046472 | Bacteria | 7670 |
| 751 | Ga0495580_0071534 | 3300046472 | Bacteria | 2423 |
| 752 | Ga0495580_0082936 | 3300046472 | Unclassified | 2234 |
| 753 | Ga0495582_0016677 | 3300046473 | Bacteria | 4022 |
| 754 | Ga0495582_0020095 | 3300046473 | Bacteria | 3654 |
| 755 | Ga0495582_0280407 | 3300046473 | Bacteria | 957 |
| 756 | Ga0495605_0059533 | 3300046474 | Bacteria | 1834 |
| 757 | Ga0495639_0065081 | 3300046475 | Bacteria | 1676 |
| 758 | Ga0495662_0073420 | 3300046476 | Bacteria | 1659 |
| 759 | Ga0495664_0020688 | 3300046477 | Bacteria | 3797 |
| 760 | Ga0495584_0036956 | 3300046491 | Bacteria | 2467 |
| 761 | Ga0495585_0006605 | 3300046492 | Bacteria | 7171 |
| 762 | Ga0495585_0059774 | 3300046492 | Bacteria | 2099 |
| 763 | Ga0495594_0004830 | 3300046499 | Bacteria | 6942 |
| 764 | Ga0495594_0045852 | 3300046499 | Bacteria | 2400 |
| 765 | Ga0495594_0047164 | 3300046499 | Bacteria | 2366 |
| 766 | Ga0495607_0018075 | 3300046501 | Bacteria | 4505 |
| 767 | Ga0495583_0074909 | 3300046506 | Bacteria | 1481 |
| 768 | Ga0495608_0001268 | 3300046511 | Bacteria | 17936 |
| 769 | Ga0495608_0030282 | 3300046511 | Bacteria | 3665 |
| 770 | Ga0495608_0033948 | 3300046511 | Bacteria | 3445 |
| 771 | Ga0495608_0256603 | 3300046511 | Unclassified | 1089 |
| 772 | Ga0495618_0028539 | 3300046514 | Bacteria | 3478 |
| 773 | Ga0495618_0215509 | 3300046514 | Bacteria | 1212 |
| 774 | Ga0495628_0028500 | 3300046516 | Bacteria | 4536 |
| 775 | Ga0495628_0057215 | 3300046516 | Bacteria | 3067 |
| 776 | Ga0495628_0078789 | 3300046516 | Bacteria | 2562 |
| 777 | Ga0495630_0174739 | 3300046517 | Bacteria | 1637 |
| 778 | Ga0495631_0045516 | 3300046518 | Bacteria | 1932 |
| 779 | Ga0495632_0039255 | 3300046519 | Bacteria | 2391 |
| 780 | Ga0495644_0001996 | 3300046523 | Bacteria | 8199 |
| 781 | Ga0495666_0032197 | 3300046526 | Bacteria | 2567 |
| 782 | Ga0495642_0054101 | 3300046528 | Bacteria | 1655 |
| 783 | Ga0495652_0030704 | 3300046529 | Bacteria | 4710 |
| 784 | Ga0495652_0077110 | 3300046529 | Bacteria | 2763 |
| 785 | Ga0495652_0095962 | 3300046529 | Bacteria | 2415 |
| 786 | Ga0495640_0002019 | 3300046533 | Bacteria | 16194 |
| 787 | Ga0495640_0008735 | 3300046533 | Bacteria | 7939 |
| 788 | Ga0495640_0138826 | 3300046533 | Bacteria | 1568 |
| 789 | Ga0495586_0108046 | 3300046535 | Bacteria | 1547 |
| 790 | Ga0495587_0000620 | 3300046536 | Bacteria | 24097 |
| 791 | Ga0495587_0037944 | 3300046536 | Bacteria | 2891 |
| 792 | Ga0495587_0092138 | 3300046536 | Bacteria | 1750 |
| 793 | Ga0495598_0001380 | 3300046537 | Bacteria | 4786 |
| 794 | Ga0495598_0005318 | 3300046537 | Bacteria | 2845 |
| 795 | Ga0495598_0021021 | 3300046537 | Bacteria | 1731 |
| 796 | Ga0495645_0000640 | 3300046543 | Bacteria | 24122 |
| 797 | Ga0495645_0075824 | 3300046543 | Bacteria | 2421 |
| 798 | Ga0495622_0010250 | 3300046557 | Bacteria | 4333 |
| 799 | Ga0495622_0088991 | 3300046557 | Bacteria | 1419 |
| 800 | Ga0495633_0054001 | 3300046558 | Bacteria | 1890 |
| 801 | Ga0495667_0001254 | 3300046559 | Bacteria | 16638 |
| 802 | Ga0495667_0041608 | 3300046559 | Bacteria | 3047 |
| 803 | Ga0495656_0043604 | 3300046615 | Bacteria | 1884 |
| 804 | Ga0495634_0021860 | 3300046642 | Bacteria | 4514 |
| 805 | Ga0495634_0127179 | 3300046642 | Unclassified | 1628 |
| 806 | Ga0495635_0052540 | 3300046663 | Bacteria | 2807 |
| 807 | Ga0495635_0054794 | 3300046663 | Bacteria | 2746 |
| 808 | Ga0495659_0003206 | 3300046664 | Bacteria | 5238 |
| 809 | Ga0495661_0120176 | 3300046665 | Bacteria | 1452 |
| 810 | Ga0495588_0038087 | 3300046674 | Bacteria | 2445 |
| 811 | Ga0495657_0012096 | 3300046675 | Bacteria | 6421 |
| 812 | Ga0495657_0050495 | 3300046675 | Bacteria | 2796 |
| 813 | Ga0495657_0098151 | 3300046675 | Unclassified | 1870 |
| 814 | Ga0495657_0235905 | 3300046675 | Bacteria | 1105 |
| 815 | Ga0495599_0097738 | 3300046678 | Bacteria | 1830 |
| 816 | Ga0495599_0153477 | 3300046678 | Unclassified | 1425 |
| 817 | Ga0495599_0280465 | 3300046678 | Bacteria | 1009 |
| 818 | Ga0495646_0076963 | 3300046680 | Bacteria | 1952 |
| 819 | Ga0495646_0133887 | 3300046680 | Unclassified | 1393 |
| 820 | Ga0495647_0003055 | 3300046681 | Bacteria | 5337 |
| 821 | Ga0495647_0008588 | 3300046681 | Bacteria | 3436 |
| 822 | Ga0495647_0045895 | 3300046681 | Bacteria | 1680 |
| 823 | Ga0495658_0000762 | 3300046683 | Bacteria | 17418 |
| 824 | Ga0495658_0023837 | 3300046683 | Bacteria | 3252 |
| 825 | Ga0495658_0024491 | 3300046683 | Bacteria | 3216 |
| 826 | Ga0495658_0028009 | 3300046683 | Bacteria | 3037 |
| 827 | Ga0495658_0086269 | 3300046683 | Bacteria | 1851 |
| 828 | Ga0495669_0004555 | 3300046684 | Bacteria | 5737 |
| 829 | Ga0495669_0080388 | 3300046684 | Bacteria | 1496 |
| 830 | Ga0495613_0001384 | 3300046689 | Bacteria | 18433 |
| 831 | Ga0495613_0063564 | 3300046689 | Bacteria | 2700 |
| 832 | Ga0495613_0091126 | 3300046689 | Bacteria | 2208 |
| 833 | Ga0495624_0118510 | 3300046690 | Bacteria | 1626 |
| 834 | Ga0495624_0291068 | 3300046690 | Unclassified | 985 |
| 835 | Ga0495670_0003495 | 3300046691 | Bacteria | 7714 |
| 836 | Ga0495670_0015860 | 3300046691 | Bacteria | 3702 |
| 837 | Ga0495671_0022017 | 3300046692 | Bacteria | 3343 |
| 838 | Ga0495589_0029287 | 3300046794 | Bacteria | 2776 |
| 839 | Ga0495589_0035660 | 3300046794 | Bacteria | 2494 |
| 840 | Ga0495589_0042440 | 3300046794 | Bacteria | 2267 |
| 841 | Ga0495600_0043323 | 3300046809 | Bacteria | 2935 |
| 842 | Ga0495581_0021839 | 3300047315 | Bacteria | 3709 |
| 843 | Ga0495581_0065239 | 3300047315 | Bacteria | 2105 |
| 844 | Ga0495581_0073089 | 3300047315 | Bacteria | 1984 |
| 845 | Ga0495581_0193860 | 3300047315 | Bacteria | 1189 |
| 846 | Ga0495604_0082001 | 3300047317 | Bacteria | 2413 |
| 847 | Ga0495674_0013976 | 3300047319 | Bacteria | 7529 |
| 848 | Ga0495674_0018881 | 3300047319 | Bacteria | 6412 |
| 849 | Ga0495676_0045000 | 3300047321 | Bacteria | 3597 |
| 850 | Ga0495676_0051640 | 3300047321 | Bacteria | 3287 |
| 851 | Ga0495676_0068514 | 3300047321 | Bacteria | 2741 |
| 852 | Ga0495680_0001472 | 3300047322 | Bacteria | 25404 |
| 853 | Ga0495680_0013659 | 3300047322 | Bacteria | 7073 |
| 854 | Ga0495680_0020287 | 3300047322 | Bacteria | 5594 |
| 855 | Ga0495680_0029631 | 3300047322 | Bacteria | 4480 |
| 856 | Ga0495680_0091982 | 3300047322 | Bacteria | 2273 |
| 857 | Ga0495680_0185171 | 3300047322 | Unclassified | 1500 |
| 858 | Ga0495675_0003746 | 3300047444 | Bacteria | 9193 |
| 859 | Ga0495679_019911 | 3300047446 | Bacteria | 2347 |
| 860 | Ga0495684_0041682 | 3300047471 | Bacteria | 3518 |
| 861 | Ga0495684_0308218 | 3300047471 | Bacteria | 1135 |
| 862 | Ga0495593_0048089 | 3300047673 | Bacteria | 2267 |
| 863 | Ga0495593_0064186 | 3300047673 | Bacteria | 1917 |
| 864 | Ga0495593_0072585 | 3300047673 | Bacteria | 1786 |
| 865 | Ga0495602_0002664 | 3300048088 | Bacteria | 18252 |
| 866 | Ga0495602_0115545 | 3300048088 | Bacteria | 2171 |
| 867 | Ga0495602_0302985 | 3300048088 | Bacteria | 1169 |
| 868 | Ga0495614_0013503 | 3300048089 | Bacteria | 3581 |
| 869 | Ga0495614_0112712 | 3300048089 | Unclassified | 1195 |
| 870 | Ga0495614_0134943 | 3300048089 | Bacteria | 1094 |
| 871 | Ga0496100_0000400 | 3300048903 | Bacteria | 20959 |
| 872 | Ga0496100_0016309 | 3300048903 | Bacteria | 4359 |
| 873 | Ga0496100_0018627 | 3300048903 | Bacteria | 4122 |
| 874 | Ga0496101_0000151 | 3300048904 | Bacteria | 59751 |
| 875 | Ga0496101_0008813 | 3300048904 | Bacteria | 6599 |
| 876 | Ga0496101_0010331 | 3300048904 | Bacteria | 6165 |
| 877 | Ga0496101_0065475 | 3300048904 | Bacteria | 2649 |
| 878 | Ga0496101_0081444 | 3300048904 | Bacteria | 2394 |
| 879 | Ga0496101_0084728 | 3300048904 | Bacteria | 2348 |
| 880 | Ga0496101_0126706 | 3300048904 | Bacteria | 1935 |
| 881 | Ga0496101_0140407 | 3300048904 | Bacteria | 1841 |
| 882 | Ga0496102_0002633 | 3300048905 | Bacteria | 15255 |
| 883 | Ga0496102_0005538 | 3300048905 | Bacteria | 10724 |
| 884 | Ga0496102_0020449 | 3300048905 | Bacteria | 5848 |
| 885 | Ga0496102_0093373 | 3300048905 | Bacteria | 2787 |
| 886 | Ga0496102_0308265 | 3300048905 | Bacteria | 1492 |
| 887 | Ga0496102_0353022 | 3300048905 | Bacteria | 1384 |
| 888 | Ga0496103_0000589 | 3300048906 | Bacteria | 28631 |
| 889 | Ga0496103_0013289 | 3300048906 | Bacteria | 4880 |
| 890 | Ga0496103_0204934 | 3300048906 | Unclassified | 1268 |
| 891 | Ga0496104_0000215 | 3300048907 | Bacteria | 50960 |
| 892 | Ga0496104_0000495 | 3300048907 | Bacteria | 34041 |
| 893 | Ga0496104_0011067 | 3300048907 | Bacteria | 8072 |
| 894 | Ga0496104_0023324 | 3300048907 | Bacteria | 5688 |
| 895 | Ga0496104_0023761 | 3300048907 | Bacteria | 5636 |
| 896 | Ga0496104_0128558 | 3300048907 | Bacteria | 2433 |
| 897 | Ga0496104_0345943 | 3300048907 | Bacteria | 1399 |
| 898 | Ga0496105_0007307 | 3300048908 | Bacteria | 8532 |
| 899 | Ga0496105_0016050 | 3300048908 | Bacteria | 5974 |
| 900 | Ga0496105_0031047 | 3300048908 | Bacteria | 4379 |
| 901 | Ga0496105_0068612 | 3300048908 | Bacteria | 2929 |
| 902 | Ga0496105_0216143 | 3300048908 | Bacteria | 1561 |
| 903 | Ga0496106_0005086 | 3300048909 | Bacteria | 9737 |
| 904 | Ga0496106_0005428 | 3300048909 | Bacteria | 9431 |
| 905 | Ga0496106_0013672 | 3300048909 | Bacteria | 5993 |
| 906 | Ga0496106_0237676 | 3300048909 | Bacteria | 1455 |
| 907 | Ga0496107_0000959 | 3300048910 | Bacteria | 17091 |
| 908 | Ga0496107_0014487 | 3300048910 | Bacteria | 5521 |
| 909 | Ga0496107_0232589 | 3300048910 | Bacteria | 1371 |
| 910 | Ga0496107_0258068 | 3300048910 | Bacteria | 1297 |
| 911 | Ga0496108_0001228 | 3300048911 | Bacteria | 20100 |
| 912 | Ga0496108_0004314 | 3300048911 | Bacteria | 11435 |
| 913 | Ga0496108_0008895 | 3300048911 | Bacteria | 8140 |
| 914 | Ga0496108_0126358 | 3300048911 | Bacteria | 2195 |
| 915 | Ga0496108_0382756 | 3300048911 | Bacteria | 1228 |
| 916 | Ga0496108_0429557 | 3300048911 | Bacteria | 1154 |
| 917 | Ga0496108_0446066 | 3300048911 | Bacteria | 1130 |
| 918 | Ga0496108_0716046 | 3300048911 | Bacteria | 867 |
| 919 | Ga0496109_0001567 | 3300048912 | Bacteria | 19049 |
| 920 | Ga0496109_0001702 | 3300048912 | Bacteria | 18343 |
| 921 | Ga0496109_0011935 | 3300048912 | Bacteria | 7481 |
| 922 | Ga0496109_0012979 | 3300048912 | Bacteria | 7201 |
| 923 | Ga0496109_0069272 | 3300048912 | Bacteria | 3235 |
| 924 | Ga0496109_0359065 | 3300048912 | Bacteria | 1376 |
| 925 | Ga0496110_0000540 | 3300048913 | Bacteria | 25786 |
| 926 | Ga0496110_0003055 | 3300048913 | Bacteria | 12692 |
| 927 | Ga0496110_0014154 | 3300048913 | Bacteria | 6617 |
| 928 | Ga0496110_0026449 | 3300048913 | Bacteria | 4966 |
| 929 | Ga0496110_0097739 | 3300048913 | Bacteria | 2630 |
| 930 | Ga0496110_0109076 | 3300048913 | Unclassified | 2486 |
| 931 | Ga0496110_0133039 | 3300048913 | Bacteria | 2246 |
| 932 | Ga0496111_0013301 | 3300048914 | Bacteria | 5596 |
| 933 | Ga0496111_0015042 | 3300048914 | Bacteria | 5300 |
| 934 | Ga0496111_0059527 | 3300048914 | Bacteria | 2767 |
| 935 | Ga0496111_0105553 | 3300048914 | Bacteria | 2073 |
| 936 | Ga0496111_0125455 | 3300048914 | Bacteria | 1897 |
| 937 | Ga0496112_0001465 | 3300048915 | Bacteria | 18127 |
| 938 | Ga0496112_0016056 | 3300048915 | Bacteria | 7001 |
| 939 | Ga0496112_0049192 | 3300048915 | Bacteria | 4133 |
| 940 | Ga0496112_0115939 | 3300048915 | Bacteria | 2649 |
| 941 | Ga0496112_0314659 | 3300048915 | Bacteria | 1510 |
| 942 | Ga0496113_0001102 | 3300048916 | Bacteria | 14628 |
| 943 | Ga0496113_0001787 | 3300048916 | Bacteria | 12193 |
| 944 | Ga0496113_0009826 | 3300048916 | Bacteria | 6297 |
| 945 | Ga0496113_0038078 | 3300048916 | Bacteria | 3533 |
| 946 | Ga0496113_0065445 | 3300048916 | Bacteria | 2751 |
| 947 | Ga0496113_0220815 | 3300048916 | Bacteria | 1510 |
| 948 | Ga0496113_0247630 | 3300048916 | Bacteria | 1422 |
| 949 | Ga0496113_0482096 | 3300048916 | Unclassified | 996 |
| 950 | Ga0496114_0005496 | 3300048917 | Bacteria | 9922 |
| 951 | Ga0496114_0054545 | 3300048917 | Bacteria | 3333 |
| 952 | Ga0496114_0197631 | 3300048917 | Bacteria | 1760 |
| 953 | Ga0496115_0002326 | 3300048918 | Bacteria | 13618 |
| 954 | Ga0496115_0010696 | 3300048918 | Bacteria | 6863 |
| 955 | Ga0496115_0018857 | 3300048918 | Bacteria | 5304 |
| 956 | Ga0496115_0110557 | 3300048918 | Bacteria | 2257 |
| 957 | Ga0496115_0136026 | 3300048918 | Bacteria | 2026 |
| 958 | Ga0496126_0083241 | 3300048929 | Bacteria | 2825 |
| 959 | Ga0501031_0143396 | 3300049568 | Bacteria | 1561 |
| 960 | Ga0501032_0046233 | 3300049569 | Bacteria | 2942 |
| 961 | Ga0501033_0001317 | 3300049570 | Bacteria | 22076 |
| 962 | Ga0501033_0096227 | 3300049570 | Bacteria | 2163 |
| 963 | Ga0501034_0024355 | 3300049571 | Bacteria | 6156 |
| 964 | Ga0501034_0031258 | 3300049571 | Bacteria | 5408 |
| 965 | Ga0501034_0127163 | 3300049571 | Bacteria | 2533 |
| 966 | Ga0501034_0259797 | 3300049571 | Bacteria | 1680 |
| 967 | Ga0501034_0522080 | 3300049571 | Bacteria | 1099 |
| 968 | Ga0501034_0529278 | 3300049571 | Bacteria | 1090 |
| 969 | Ga0501036_0001725 | 3300049572 | Bacteria | 16998 |
| 970 | Ga0501036_0025685 | 3300049572 | Bacteria | 4971 |
| 971 | Ga0501036_0032950 | 3300049572 | Bacteria | 4380 |
| 972 | Ga0501036_0163636 | 3300049572 | Bacteria | 1875 |
| 973 | Ga0501036_0347168 | 3300049572 | Bacteria | 1239 |
| 974 | Ga0501037_0013915 | 3300049573 | Bacteria | 5929 |
| 975 | Ga0501037_0015078 | 3300049573 | Bacteria | 5684 |
| 976 | Ga0501037_0088098 | 3300049573 | Bacteria | 2246 |
| 977 | Ga0501037_0109960 | 3300049573 | Bacteria | 1986 |
| 978 | Ga0501038_0007569 | 3300049574 | Bacteria | 10014 |
| 979 | Ga0501038_0022847 | 3300049574 | Bacteria | 5598 |
| 980 | Ga0501038_0452097 | 3300049574 | Bacteria | 987 |
| 981 | Ga0501039_0024187 | 3300049575 | Bacteria | 4664 |
| 982 | Ga0501039_0158686 | 3300049575 | Bacteria | 1777 |
| 983 | Ga0501042_0249298 | 3300049578 | Bacteria | 1281 |
| 984 | Ga0501043_0017342 | 3300049579 | Bacteria | 5647 |
| 985 | Ga0501043_0091370 | 3300049579 | Bacteria | 2393 |
| 986 | Ga0501043_0222532 | 3300049579 | Bacteria | 1459 |
| 987 | Ga0501043_0230540 | 3300049579 | Bacteria | 1430 |
| 988 | Ga0501046_0113928 | 3300049580 | Bacteria | 2063 |
| 989 | Ga0501047_0000235 | 3300049581 | Bacteria | 65603 |
| 990 | Ga0501047_0034834 | 3300049581 | Bacteria | 4861 |
| 991 | Ga0501047_0056705 | 3300049581 | Bacteria | 3789 |
| 992 | Ga0501047_0185000 | 3300049581 | Bacteria | 1949 |
| 993 | Ga0501047_0201780 | 3300049581 | Bacteria | 1850 |
| 994 | Ga0501047_0253717 | 3300049581 | Bacteria | 1607 |
| 995 | Ga0501047_0271877 | 3300049581 | Bacteria | 1541 |
| 996 | Ga0501048_0001647 | 3300049582 | Bacteria | 17021 |
| 997 | Ga0501048_0019321 | 3300049582 | Bacteria | 5000 |
| 998 | Ga0501048_0194074 | 3300049582 | Bacteria | 1439 |
| 999 | Ga0501067_0102715 | 3300049583 | Bacteria | 1588 |
| 1000 | Ga0501067_0147741 | 3300049583 | Bacteria | 1309 |
| 1001 | Ga0501068_0099157 | 3300049584 | Bacteria | 1805 |
| 1002 | Ga0501069_0039688 | 3300049585 | Bacteria | 2600 |
| 1003 | Ga0501069_0041814 | 3300049585 | Bacteria | 2534 |
| 1004 | Ga0501070_0029936 | 3300049586 | Bacteria | 4561 |
| 1005 | Ga0501070_0034556 | 3300049586 | Bacteria | 4226 |
| 1006 | Ga0501070_0051376 | 3300049586 | Bacteria | 3422 |
| 1007 | Ga0501070_0063362 | 3300049586 | Bacteria | 3062 |
| 1008 | Ga0501070_0101978 | 3300049586 | Bacteria | 2373 |
| 1009 | Ga0501070_0168561 | 3300049586 | Bacteria | 1804 |
| 1010 | Ga0501070_0223134 | 3300049586 | Bacteria | 1545 |
| 1011 | Ga0501070_0313662 | 3300049586 | Bacteria | 1276 |
| 1012 | Ga0501071_0122946 | 3300049587 | Bacteria | 1924 |
| 1013 | Ga0501071_0137884 | 3300049587 | Bacteria | 1816 |
| 1014 | Ga0501071_0520352 | 3300049587 | Bacteria | 913 |
| 1015 | Ga0501072_0158128 | 3300049588 | Bacteria | 1807 |
| 1016 | Ga0501073_0014326 | 3300049589 | Bacteria | 5760 |
| 1017 | Ga0501073_0041016 | 3300049589 | Bacteria | 3272 |
| 1018 | Ga0501073_0061401 | 3300049589 | Bacteria | 2622 |
| 1019 | Ga0501073_0139677 | 3300049589 | Bacteria | 1679 |
| 1020 | Ga0501073_0404420 | 3300049589 | Bacteria | 943 |
| 1021 | Ga0501074_0025365 | 3300049590 | Bacteria | 4305 |
| 1022 | Ga0501074_0035472 | 3300049590 | Bacteria | 3613 |
| 1023 | Ga0501074_0048058 | 3300049590 | Bacteria | 3082 |
| 1024 | Ga0501074_0068742 | 3300049590 | Bacteria | 2547 |
| 1025 | Ga0501074_0170314 | 3300049590 | Bacteria | 1554 |
| 1026 | Ga0501076_0021925 | 3300049592 | Bacteria | 4905 |
| 1027 | Ga0501077_0032307 | 3300049593 | Bacteria | 3332 |
| 1028 | Ga0501077_0144974 | 3300049593 | Bacteria | 1506 |
| 1029 | Ga0501079_0006960 | 3300049741 | Bacteria | 8524 |
| 1030 | Ga0501079_0049087 | 3300049741 | Bacteria | 3257 |
| 1031 | Ga0501080_0000409 | 3300049742 | Bacteria | 33000 |
| 1032 | Ga0501080_0010799 | 3300049742 | Bacteria | 8358 |
| 1033 | Ga0501080_0011504 | 3300049742 | Bacteria | 8102 |
| 1034 | Ga0501080_0053928 | 3300049742 | Bacteria | 3744 |
| 1035 | Ga0501083_0016908 | 3300049744 | Bacteria | 5095 |
| 1036 | Ga0501083_0097255 | 3300049744 | Bacteria | 1942 |
| 1037 | Ga0501083_0105536 | 3300049744 | Bacteria | 1855 |
| 1038 | Ga0501083_0304519 | 3300049744 | Bacteria | 1036 |
| 1039 | Ga0501035_0001984 | 3300049822 | Bacteria | 20462 |
| 1040 | Ga0501035_0003589 | 3300049822 | Bacteria | 14819 |
| 1041 | Ga0501035_0014410 | 3300049822 | Bacteria | 7297 |
| 1042 | Ga0501035_0023515 | 3300049822 | Bacteria | 5653 |
| 1043 | Ga0501035_0051572 | 3300049822 | Bacteria | 3683 |
| 1044 | Ga0501035_0310819 | 3300049822 | Bacteria | 1326 |
| 1045 | Ga0501044_0009294 | 3300049823 | Bacteria | 10727 |
| 1046 | Ga0501044_0136902 | 3300049823 | Bacteria | 2440 |
| 1047 | Ga0501044_0197710 | 3300049823 | Bacteria | 1970 |
| 1048 | Ga0501044_0200747 | 3300049823 | Bacteria | 1952 |
| 1049 | Ga0501044_0215828 | 3300049823 | Bacteria | 1871 |
| 1050 | Ga0501044_0317166 | 3300049823 | Bacteria | 1484 |
| 1051 | nmdc:mga0yw44_120814_c1 | 3300050492 | Bacteria | 1687 |
| 1052 | nmdc:mga0yw44_19836_c1 | 3300050492 | Bacteria | 3716 |
| 1053 | nmdc:mga0yw44_2230_c1 | 3300050492 | Bacteria | 8169 |
| 1054 | nmdc:mga06z11_37376_c1 | 3300050494 | Bacteria | 2076 |
| 1055 | nmdc:mga07m45_25395_c1 | 3300050496 | Bacteria | 2475 |
| 1056 | nmdc:mga05p37_1888_c1 | 3300050507 | Bacteria | 24396 |
| 1057 | nmdc:mga05p37_2212_c1 | 3300050507 | Bacteria | 22652 |
| 1058 | nmdc:mga05p37_315514_c1 | 3300050507 | Bacteria | 1852 |
| 1059 | nmdc:mga09592_1729_c1 | 3300050508 | Bacteria | 17579 |
| 1060 | nmdc:mga09592_274670_c1 | 3300050508 | Bacteria | 1462 |
| 1061 | nmdc:mga0qj67_2690_c1 | 3300050509 | Bacteria | 12744 |
| 1062 | nmdc:mga06r32_18400_c1 | 3300050510 | Bacteria | 6398 |
| 1063 | nmdc:mga08y16_178686_c1 | 3300050511 | Bacteria | 2204 |
| 1064 | nmdc:mga08y16_27251_c1 | 3300050511 | Bacteria | 6021 |
| 1065 | nmdc:mga08y16_311_c1 | 3300050511 | Bacteria | 43954 |
| 1066 | nmdc:mga08y16_5010_c1 | 3300050511 | Bacteria | 13856 |
| 1067 | nmdc:mga0n895_1869_c1 | 3300050512 | Bacteria | 16078 |
| 1068 | nmdc:mga0n895_21771_c1 | 3300050512 | Bacteria | 6001 |
| 1069 | nmdc:mga0n895_373568_c1 | 3300050512 | Bacteria | 1443 |
| 1070 | nmdc:mga0n895_455195_c1 | 3300050512 | Bacteria | 1292 |
| 1071 | nmdc:mga0n895_62_c1 | 3300050512 | Bacteria | 62891 |
| 1072 | nmdc:mga0n895_68658_c1 | 3300050512 | Bacteria | 3511 |
| 1073 | nmdc:mga0n895_748976_c1 | 3300050512 | Bacteria | 970 |
| 1074 | nmdc:mga0rr50_25217_c1 | 3300050513 | Bacteria | 4130 |
| 1075 | nmdc:mga0rr50_80666_c1 | 3300050513 | Bacteria | 2509 |
| 1076 | nmdc:mga08x19_280104_c1 | 3300050514 | Bacteria | 1155 |
| 1077 | nmdc:mga0a205_1191_c1 | 3300050515 | Bacteria | 21722 |
| 1078 | nmdc:mga0a205_29763_c1 | 3300050515 | Bacteria | 5226 |
| 1079 | nmdc:mga0a205_58781_c1 | 3300050515 | Bacteria | 3714 |
| 1080 | nmdc:mga0a205_78059_c1 | 3300050515 | Bacteria | 3199 |
| 1081 | Ga0495601_0006785 | 3300053077 | Bacteria | 6705 |
| 1082 | Ga0495601_0010538 | 3300053077 | Bacteria | 5504 |
| 1083 | Ga0495601_0017856 | 3300053077 | Bacteria | 4311 |
| 1084 | Ga0495601_0047580 | 3300053077 | Bacteria | 2700 |
| 1085 | Ga0495601_0093654 | 3300053077 | Bacteria | 1935 |
| 1086 | Ga0495601_0131282 | 3300053077 | Bacteria | 1631 |
| 1087 | Ga0495601_0152775 | 3300053077 | Bacteria | 1507 |
| 1088 | Ga0495601_0230535 | 3300053077 | Bacteria | 1209 |
| 1089 | Ga0495612_0005219 | 3300053078 | Bacteria | 5367 |
| 1090 | Ga0495612_0006433 | 3300053078 | Bacteria | 4828 |
| 1091 | Ga0495612_0052969 | 3300053078 | Bacteria | 1670 |
| 1092 | Ga0495595_0001369 | 3300053084 | Bacteria | 9461 |
| 1093 | Ga0495595_0002003 | 3300053084 | Bacteria | 7927 |
| 1094 | Ga0495595_0025646 | 3300053084 | Bacteria | 2614 |
| 1095 | Ga0495619_0000289 | 3300053085 | Bacteria | 35778 |
| 1096 | Ga0495619_0000662 | 3300053085 | Bacteria | 22563 |
| 1097 | Ga0495619_0027020 | 3300053085 | Bacteria | 3696 |
| 1098 | Ga0495619_0028745 | 3300053085 | Bacteria | 3588 |
| 1099 | Ga0495619_0044446 | 3300053085 | Bacteria | 2915 |
| 1100 | Ga0495619_0111061 | 3300053085 | Bacteria | 1873 |
| 1101 | Ga0495619_0186720 | 3300053085 | Bacteria | 1435 |
| 1102 | Ga0500643_005637 | 3300053087 | Bacteria | 5358 |
| 1103 | Ga0500644_0000980 | 3300053088 | Bacteria | 8899 |
| 1104 | Ga0500566_0117057 | 3300053094 | Bacteria | 1441 |
| 1105 | Ga0500650_0007014 | 3300053098 | Bacteria | 4351 |
| 1106 | Ga0500595_000016 | 3300053119 | Bacteria | 211397 |
| 1107 | Ga0500616_0000006 | 3300053153 | Bacteria | 944738 |
| 1108 | Ga0500645_000033 | 3300053730 | Bacteria | 119279 |
| 1109 | Ga0501084_0099687 | 3300054114 | Bacteria | 2439 |
| 1110 | Ga0501084_0222733 | 3300054114 | Bacteria | 1592 |
| 1111 | Ga0501082_0038565 | 3300060353 | Bacteria | 4122 |
| 1112 | Ga0501082_0190333 | 3300060353 | Bacteria | 1785 |
| 1113 | Ga0501082_0363880 | 3300060353 | Bacteria | 1261 |
| 1114 | 2643755880 | 2643221547 | Bacteria | 4740017 |
| 1115 | Ga0495619_0180341 | |||
| 1116 | 2214544953 | |||
| 1117 | ARSoilYngRDRAFT_c00268 | |||
| 1118 | ARcpr5yngRDRAFT_c000083 | |||
| 1119 | ARcpr5yngRDRAFT_c000130 | |||
| 1120 | ARSoilOldRDRAFT_c000077 | |||
| 1121 | ARCol0oldRDRAFT_c00168 | |||
| 1122 | ARCol0yngRDRAFT_1000003 | |||
| 1123 | JGI24752J21851_1001016 | |||
| 1124 | JGI24746J21847_1000172 | |||
| 1125 | JGI24747J21853_1000145 | |||
| 1126 | JGI24739J22299_10002161 | |||
| 1127 | JGI24737J22298_10002588 | |||
| 1128 | JGI24737J22298_10002605 | |||
| 1129 | JGI24737J22298_10072039 | |||
| 1130 | JGI24743J22301_10021190 | |||
| 1131 | JGI24750J21931_1000256 | |||
| 1132 | JGI24750J21931_1006618 | |||
| 1133 | JGI24745J21846_1000121 | |||
| 1134 | JGI24738J21930_10000425 | |||
| 1135 | JGI24749J21850_1002381 | |||
| 1136 | JGI24744J21845_10000665 | |||
| 1137 | JGI24035J26624_1000008 | |||
| 1138 | JGI24035J26624_1000030 | |||
| 1139 | JGI24033J26618_1000612 | |||
| 1140 | JGI24034J26672_10000799 | |||
| 1141 | JGI24742J22300_10000352 | |||
| 1142 | JGI25405J52794_10001882 | |||
| 1143 | Ga0065716_1001562 | |||
| 1144 | Ga0065704_10274146 | |||
| 1145 | Ga0065715_10090800 | |||
| 1146 | Ga0070658_10007097 | |||
| 1147 | Ga0070658_10034171 | |||
| 1148 | Ga0070658_10064284 | |||
| 1149 | Ga0070676_10000036 | |||
| 1150 | Ga0070676_10036183 | |||
| 1151 | Ga0070676_10071872 | |||
| 1152 | Ga0070676_10352611 | |||
| 1153 | Ga0070683_100002049 | |||
| 1154 | Ga0070683_100133634 | |||
| 1155 | Ga0070683_100308029 | |||
| 1156 | Ga0070690_100001849 | |||
| 1157 | Ga0070690_100110205 | |||
| 1158 | Ga0070670_100003778 | |||
| 1159 | Ga0070670_100043490 | |||
| 1160 | Ga0070677_10000104 | |||
| 1161 | Ga0068869_100000087 | |||
| 1162 | Ga0070666_10006798 | |||
| 1163 | Ga0070666_10055355 | |||
| 1164 | Ga0070680_100003276 | |||
| 1165 | Ga0070680_100084340 | |||
| 1166 | Ga0070680_100129012 | |||
| 1167 | Ga0070682_100000341 | |||
| 1168 | Ga0070682_100032217 | |||
| 1169 | Ga0070682_100097794 | |||
| 1170 | Ga0070682_100189368 | |||
| 1171 | Ga0068868_100001826 | |||
| 1172 | Ga0068868_100253462 | |||
| 1173 | Ga0068868_100409597 | |||
| 1174 | Ga0070660_100006206 | |||
| 1175 | Ga0070660_100054032 | |||
| 1176 | Ga0070660_100165984 | |||
| 1177 | Ga0070660_100350593 | |||
| 1178 | Ga0070689_100000963 | |||
| 1179 | Ga0070689_100017974 | |||
| 1180 | Ga0070689_100098820 | |||
| 1181 | Ga0070691_10000518 | |||
| 1182 | Ga0070687_100000245 | |||
| 1183 | Ga0070687_100060180 | |||
| 1184 | Ga0070687_100066302 | |||
| 1185 | Ga0070661_100000017 | |||
| 1186 | Ga0070661_100150902 | |||
| 1187 | Ga0070692_10003367 | |||
| 1188 | Ga0070668_100010066 | |||
| 1189 | Ga0070668_100109771 | |||
| 1190 | Ga0070668_100182409 | |||
| 1191 | Ga0070669_100000217 | |||
| 1192 | Ga0070669_100226474 | |||
| 1193 | Ga0070675_100000088 | |||
| 1194 | Ga0070675_100260527 | |||
| 1195 | Ga0070675_100375653 | |||
| 1196 | Ga0070675_100527369 | |||
| 1197 | Ga0070671_100000768 | |||
| 1198 | Ga0070671_100009332 | |||
| 1199 | Ga0070671_100075563 | |||
| 1200 | Ga0070671_100081683 | |||
| 1201 | Ga0070671_100405405 | |||
| 1202 | Ga0070671_100541185 | |||
| 1203 | Ga0070674_100000623 | |||
| 1204 | Ga0070674_100147460 | |||
| 1205 | Ga0070674_100575237 | |||
| 1206 | Ga0070673_100000239 | |||
| 1207 | Ga0070673_100015583 | |||
| 1208 | Ga0070673_100273089 | |||
| 1209 | Ga0070688_100000084 | |||
| 1210 | Ga0070688_100113737 | |||
| 1211 | Ga0070659_100000252 | |||
| 1212 | Ga0070659_100189056 | |||
| 1213 | Ga0070659_100364017 | |||
| 1214 | Ga0070667_100003023 | |||
| 1215 | Ga0070667_100053625 | |||
| 1216 | Ga0070667_100267990 | |||
| 1217 | Ga0070703_10014545 | |||
| 1218 | Ga0070709_10000855 | |||
| 1219 | Ga0070709_10024849 | |||
| 1220 | Ga0070709_10113782 | |||
| 1221 | Ga0070709_10121633 | |||
| 1222 | Ga0070709_10169231 | |||
| 1223 | Ga0070714_100029733 | |||
| 1224 | Ga0070714_100051256 | |||
| 1225 | Ga0070714_100181610 | |||
| 1226 | Ga0070714_100192969 | |||
| 1227 | Ga0070714_100471989 | |||
| 1228 | Ga0070714_100478018 | |||
| 1229 | Ga0070713_100004731 | |||
| 1230 | Ga0070713_100017656 | |||
| 1231 | Ga0070713_100082945 | |||
| 1232 | Ga0070710_10005088 | |||
| 1233 | Ga0070710_10074114 | |||
| 1234 | Ga0070701_10000123 | |||
| 1235 | Ga0070711_100049857 | |||
| 1236 | Ga0070711_100087399 | |||
| 1237 | Ga0070711_100564669 | |||
| 1238 | Ga0070705_100000425 | |||
| 1239 | Ga0070705_100167617 | |||
| 1240 | Ga0070700_100000370 | |||
| 1241 | Ga0070700_100103200 | |||
| 1242 | Ga0070700_100210196 | |||
| 1243 | Ga0070694_100000401 | |||
| 1244 | Ga0070694_100057633 | |||
| 1245 | Ga0070708_100004439 | |||
| 1246 | Ga0070708_100259148 | |||
| 1247 | Ga0070708_100324350 | |||
| 1248 | Ga0070663_100000415 | |||
| 1249 | Ga0070663_100021614 | |||
| 1250 | Ga0070663_100030699 | |||
| 1251 | Ga0070663_100113586 | |||
| 1252 | Ga0070663_100203995 | |||
| 1253 | Ga0070678_100000053 | |||
| 1254 | Ga0070678_100009449 | |||
| 1255 | Ga0070678_100093664 | |||
| 1256 | Ga0070662_100003931 | |||
| 1257 | Ga0070662_100011655 | |||
| 1258 | Ga0070662_100052752 | |||
| 1259 | Ga0070662_100127715 | |||
| 1260 | Ga0070681_10000493 | |||
| 1261 | Ga0070681_10048975 | |||
| 1262 | Ga0070681_10163411 | |||
| 1263 | Ga0070681_10675002 | |||
| 1264 | Ga0068867_100001581 | |||
| 1265 | Ga0068867_100221007 | |||
| 1266 | Ga0070685_10017206 | |||
| 1267 | Ga0070679_100005631 | |||
| 1268 | Ga0070679_100058723 | |||
| 1269 | Ga0070679_100104483 | |||
| 1270 | Ga0070679_100104990 | |||
| 1271 | Ga0070679_100247957 | |||
| 1272 | Ga0070679_100379206 | |||
| 1273 | Ga0070684_100010354 | |||
| 1274 | Ga0070684_100085580 | |||
| 1275 | Ga0070684_100123706 | |||
| 1276 | Ga0070684_100570957 | |||
| 1277 | Ga0070697_100328785 | |||
| 1278 | Ga0068853_100005864 | |||
| 1279 | Ga0070672_100000014 | |||
| 1280 | Ga0070672_100216713 | |||
| 1281 | Ga0070672_100265402 | |||
| 1282 | Ga0070672_100335519 | |||
| 1283 | Ga0070686_100000754 | |||
| 1284 | Ga0070686_100014000 | |||
| 1285 | Ga0070686_100061154 | |||
| 1286 | Ga0070686_100070670 | |||
| 1287 | Ga0070695_100000743 | |||
| 1288 | Ga0070695_100070169 | |||
| 1289 | Ga0070695_100170359 | |||
| 1290 | Ga0070696_100000918 | |||
| 1291 | Ga0070696_100037902 | |||
| 1292 | Ga0070693_100000141 | |||
| 1293 | Ga0070693_100158494 | |||
| 1294 | Ga0070693_100191458 | |||
| 1295 | Ga0070693_100305363 | |||
| 1296 | Ga0070665_100019687 | |||
| 1297 | Ga0070665_100326210 | |||
| 1298 | Ga0070665_100363516 | |||
| 1299 | Ga0070665_100693443 | |||
| 1300 | Ga0070704_100019420 | |||
| 1301 | Ga0070704_100254263 | |||
| 1302 | Ga0068855_100009106 | |||
| 1303 | Ga0068855_100011304 | |||
| 1304 | Ga0068855_100166621 | |||
| 1305 | Ga0068855_100243917 | |||
| 1306 | Ga0068855_100276365 | |||
| 1307 | Ga0070664_100000816 | |||
| 1308 | Ga0070664_100182779 | |||
| 1309 | Ga0070664_100189122 | |||
| 1310 | Ga0068857_100000567 | |||
| 1311 | Ga0068857_100140358 | |||
| 1312 | Ga0068854_100000168 | |||
| 1313 | Ga0068854_100045835 | |||
| 1314 | Ga0068854_100230453 | |||
| 1315 | Ga0068856_100015543 | |||
| 1316 | Ga0068856_100033238 | |||
| 1317 | Ga0068856_100091613 | |||
| 1318 | Ga0068856_100126264 | |||
| 1319 | Ga0070702_100000857 | |||
| 1320 | Ga0070702_100083296 | |||
| 1321 | Ga0070702_100097380 | |||
| 1322 | Ga0068852_100002066 | |||
| 1323 | Ga0068852_100075443 | |||
| 1324 | Ga0068852_100175185 | |||
| 1325 | Ga0068859_100025021 | |||
| 1326 | Ga0068859_100043742 | |||
| 1327 | Ga0068859_100340926 | |||
| 1328 | Ga0068864_100000980 | |||
| 1329 | Ga0068864_100012023 | |||
| 1330 | Ga0068866_10000264 | |||
| 1331 | Ga0068861_100048215 | |||
| 1332 | Ga0068861_100375101 | |||
| 1333 | Ga0068870_10000002 | |||
| 1334 | Ga0068870_10023276 | |||
| 1335 | Ga0068863_100001290 | |||
| 1336 | Ga0068863_100160400 | |||
| 1337 | Ga0068863_100267996 | |||
| 1338 | Ga0068858_100000356 | |||
| 1339 | Ga0068858_100008336 | |||
| 1340 | Ga0068858_100031420 | |||
| 1341 | Ga0068858_100110588 | |||
| 1342 | Ga0068860_100000747 | |||
| 1343 | Ga0068860_100110091 | |||
| 1344 | Ga0068860_100459002 | |||
| 1345 | Ga0068862_100002002 | |||
| 1346 | Ga0068862_100063239 | |||
| 1347 | Ga0068862_100360193 | |||
| 1348 | Ga0068862_100419162 | |||
| 1349 | Ga0081455_10000048 | |||
| 1350 | Ga0081455_10036386 | |||
| 1351 | Ga0081455_10109094 | |||
| 1352 | Ga0070717_10000150 | |||
| 1353 | Ga0070717_10256933 | |||
| 1354 | Ga0070717_10320379 | |||
| 1355 | Ga0075365_10002448 | |||
| 1356 | Ga0075365_10026234 | |||
| 1357 | Ga0075432_10007512 | |||
| 1358 | Ga0070715_10012192 | |||
| 1359 | Ga0070716_100020197 | |||
| 1360 | Ga0070716_100167516 | |||
| 1361 | Ga0070712_100017131 | |||
| 1362 | Ga0070712_100047906 | |||
| 1363 | Ga0070712_100079311 | |||
| 1364 | Ga0070712_100081094 | |||
| 1365 | Ga0070712_100121889 | |||
| 1366 | Ga0070712_100277761 | |||
| 1367 | Ga0075367_10044499 | |||
| 1368 | Ga0075427_10000042 | |||
| 1369 | Ga0097621_100000144 | |||
| 1370 | Ga0097621_100163371 | |||
| 1371 | Ga0068871_100000110 | |||
| 1372 | Ga0068871_100045891 | |||
| 1373 | Ga0068871_100077839 | |||
| 1374 | Ga0068871_100113826 | |||
| 1375 | Ga0068871_100313925 | |||
| 1376 | Ga0075428_100005798 | |||
| 1377 | Ga0075430_100000627 | |||
| 1378 | Ga0075431_100004676 | |||
| 1379 | Ga0075433_10000615 | |||
| 1380 | Ga0075433_10014612 | |||
| 1381 | Ga0075433_10162511 | |||
| 1382 | Ga0075434_100000084 | |||
| 1383 | Ga0075434_100082669 | |||
| 1384 | Ga0075434_100086680 | |||
| 1385 | Ga0075434_100101394 | |||
| 1386 | Ga0075434_100392587 | |||
| 1387 | Ga0075434_100844731 | |||
| 1388 | Ga0075429_100000877 | |||
| 1389 | Ga0068865_100000066 | |||
| 1390 | Ga0068865_100079566 | |||
| 1391 | Ga0068865_100229896 | |||
| 1392 | Ga0097620_100025020 | |||
| 1393 | Ga0097620_100043743 | |||
| 1394 | Ga0097620_100340966 | |||
| 1395 | Ga0075435_100018081 | |||
| 1396 | Ga0075435_100028762 | |||
| 1397 | Ga0075435_100089495 | |||
| 1398 | Ga0075435_100109690 | |||
| 1399 | Ga0075435_100119375 | |||
| 1400 | Ga0075435_100396347 | |||
| 1401 | Ga0105251_10024513 | |||
| 1402 | Ga0105250_10058608 | |||
| 1403 | Ga0105240_10114236 | |||
| 1404 | Ga0105240_10157229 | |||
| 1405 | Ga0105240_10182013 | |||
| 1406 | Ga0105240_10184284 | |||
| 1407 | Ga0105240_10672126 | |||
| 1408 | Ga0111539_10000423 | |||
| 1409 | Ga0111539_10000652 | |||
| 1410 | Ga0111539_10001255 | |||
| 1411 | Ga0111539_10041376 | |||
| 1412 | Ga0111539_10451752 | |||
| 1413 | Ga0105245_10000287 | |||
| 1414 | Ga0105245_10151112 | |||
| 1415 | Ga0105245_10270117 | |||
| 1416 | Ga0105245_10772030 | |||
| 1417 | Ga0105245_10772031 | |||
| 1418 | Ga0105247_10001223 | |||
| 1419 | Ga0114129_10005652 | |||
| 1420 | Ga0114129_10014653 | |||
| 1421 | Ga0114129_10016700 | |||
| 1422 | Ga0105243_10000695 | |||
| 1423 | Ga0105243_10003814 | |||
| 1424 | Ga0105243_10042456 | |||
| 1425 | Ga0105243_10279702 | |||
| 1426 | Ga0105241_10002331 | |||
| 1427 | Ga0105241_10050152 | |||
| 1428 | Ga0105241_10077871 | |||
| 1429 | Ga0105241_10089324 | |||
| 1430 | Ga0105241_10435075 | |||
| 1431 | Ga0105242_10013046 | |||
| 1432 | Ga0105242_10021242 | |||
| 1433 | Ga0105242_10027855 | |||
| 1434 | Ga0105242_10463740 | |||
| 1435 | Ga0105248_10000535 | |||
| 1436 | Ga0105248_10017864 | |||
| 1437 | Ga0105248_10054802 | |||
| 1438 | Ga0105248_10217704 | |||
| 1439 | Ga0105248_10230495 | |||
| 1440 | Ga0105237_10001499 | |||
| 1441 | Ga0105237_10060545 | |||
| 1442 | Ga0105238_10024354 | |||
| 1443 | Ga0105238_10129759 | |||
| 1444 | Ga0105238_10271473 | |||
| 1445 | Ga0105249_10000279 | |||
| 1446 | Ga0105249_10127265 | |||
| 1447 | Ga0105249_10131049 | |||
| 1448 | Ga0105249_10531674 | |||
| 1449 | Ga0105239_10001686 | |||
| 1450 | Ga0105239_10273347 | |||
| 1451 | Ga0105239_10411292 | |||
| 1452 | Ga0105239_10993354 | |||
| 1453 | Ga0105246_10000095 | |||
| 1454 | Ga0105246_10055476 | |||
| 1455 | Ga0105246_10245586 | |||
| 1456 | Ga0105246_10448086 | |||
| 1457 | Ga0105246_10452299 | |||
| 1458 | Ga0157345_1002874 | |||
| 1459 | Ga0157347_1008400 | |||
| 1460 | Ga0157373_10022698 | |||
| 1461 | Ga0157371_10042162 | |||
| 1462 | Ga0157370_10020087 | |||
| 1463 | Ga0157370_10152263 | |||
| 1464 | Ga0157370_10172208 | |||
| 1465 | Ga0157369_10109236 | |||
| 1466 | Ga0157369_10287426 | |||
| 1467 | Ga0157374_10001348 | |||
| 1468 | Ga0157374_10125535 | |||
| 1469 | Ga0157374_10415715 | |||
| 1470 | Ga0157378_10000956 | |||
| 1471 | Ga0157378_10111481 | |||
| 1472 | Ga0157378_10307366 | |||
| 1473 | Ga0157378_10473048 | |||
| 1474 | Ga0157378_10626880 | |||
| 1475 | Ga0163162_10003174 | |||
| 1476 | Ga0163162_10032167 | |||
| 1477 | Ga0163162_10048100 | |||
| 1478 | Ga0163162_10360605 | |||
| 1479 | Ga0163162_10915450 | |||
| 1480 | Ga0163162_11108907 | |||
| 1481 | Ga0157372_10038947 | |||
| 1482 | Ga0157372_10378267 | |||
| 1483 | Ga0157372_10669520 | |||
| 1484 | Ga0157375_10001973 | |||
| 1485 | Ga0157375_10228127 | |||
| 1486 | Ga0157375_10534860 | |||
| 1487 | Ga0163163_10002399 | |||
| 1488 | Ga0163163_10008535 | |||
| 1489 | Ga0163163_10011378 | |||
| 1490 | Ga0163163_10142726 | |||
| 1491 | Ga0163163_10176916 | |||
| 1492 | Ga0157380_10000052 | |||
| 1493 | Ga0157380_10542621 | |||
| 1494 | Ga0157380_10897278 | |||
| 1495 | Ga0182008_10220955 | |||
| 1496 | Ga0157377_10000076 | |||
| 1497 | Ga0157377_10001911 | |||
| 1498 | Ga0157377_10286769 | |||
| 1499 | Ga0157379_10000060 | |||
| 1500 | Ga0157379_10023835 | |||
| 1501 | Ga0157379_10035407 | |||
| 1502 | Ga0157379_10158119 | |||
| 1503 | Ga0157376_10000141 | |||
| 1504 | Ga0157376_10021304 | |||
| 1505 | Ga0157376_10026235 | |||
| 1506 | Ga0157376_10056864 | |||
| 1507 | Ga0157376_10125466 | |||
| 1508 | Ga0157376_10862517 | |||
| 1509 | Ga0163161_10000739 | |||
| 1510 | Ga0163161_10006741 | |||
| 1511 | Ga0206353_10179351 | |||
| 1512 | Ga0213876_10006713 | |||
| 1513 | Ga0213876_10232052 | |||
| 1514 | Ga0213875_10032870 | |||
| 1515 | Ga0209233_1019457 | |||
| 1516 | Ga0207666_1000005 | |||
| 1517 | Ga0207673_1000211 | |||
| 1518 | Ga0207697_10000011 | |||
| 1519 | Ga0207696_1038787 | |||
| 1520 | Ga0207713_1070490 | |||
| 1521 | Ga0207682_10000332 | |||
| 1522 | Ga0207692_10001915 | |||
| 1523 | Ga0207692_10020267 | |||
| 1524 | Ga0207692_10070486 | |||
| 1525 | Ga0207642_10000176 | |||
| 1526 | Ga0207710_10007209 | |||
| 1527 | Ga0207710_10013629 | |||
| 1528 | Ga0207688_10000001 | |||
| 1529 | Ga0207688_10027120 | |||
| 1530 | Ga0207680_10027835 | |||
| 1531 | Ga0207680_10236085 | |||
| 1532 | Ga0207647_10001714 | |||
| 1533 | Ga0207647_10125880 | |||
| 1534 | Ga0207699_10042390 | |||
| 1535 | Ga0207699_10120248 | |||
| 1536 | Ga0207699_10155970 | |||
| 1537 | Ga0207645_10001831 | |||
| 1538 | Ga0207645_10023006 | |||
| 1539 | Ga0207645_10155368 | |||
| 1540 | Ga0207645_10204363 | |||
| 1541 | Ga0207643_10000009 | |||
| 1542 | Ga0207643_10022969 | |||
| 1543 | Ga0207705_10045462 | |||
| 1544 | Ga0207705_10131472 | |||
| 1545 | Ga0207705_10204139 | |||
| 1546 | Ga0207654_10001894 | |||
| 1547 | Ga0207654_10033396 | |||
| 1548 | Ga0207654_10037929 | |||
| 1549 | Ga0207707_10000840 | |||
| 1550 | Ga0207707_10044915 | |||
| 1551 | Ga0207707_10051775 | |||
| 1552 | Ga0207707_10093874 | |||
| 1553 | Ga0207707_10338233 | |||
| 1554 | Ga0207695_10075974 | |||
| 1555 | Ga0207695_10095483 | |||
| 1556 | Ga0207695_10338077 | |||
| 1557 | Ga0207671_10075409 | |||
| 1558 | Ga0207671_10127891 | |||
| 1559 | Ga0207693_10012127 | |||
| 1560 | Ga0207693_10012139 | |||
| 1561 | Ga0207693_10133351 | |||
| 1562 | Ga0207693_10166025 | |||
| 1563 | Ga0207693_10204019 | |||
| 1564 | Ga0207663_10005694 | |||
| 1565 | Ga0207663_10012585 | |||
| 1566 | Ga0207663_10068424 | |||
| 1567 | Ga0207663_10198315 | |||
| 1568 | Ga0207660_10000775 | |||
| 1569 | Ga0207660_10038650 | |||
| 1570 | Ga0207660_10063567 | |||
| 1571 | Ga0207660_10335304 | |||
| 1572 | Ga0207662_10000645 | |||
| 1573 | Ga0207657_10004673 | |||
| 1574 | Ga0207657_10009807 | |||
| 1575 | Ga0207657_10086831 | |||
| 1576 | Ga0207657_10098755 | |||
| 1577 | Ga0207657_10140684 | |||
| 1578 | Ga0207657_10150638 | |||
| 1579 | Ga0207657_10368191 | |||
| 1580 | Ga0207649_10000052 | |||
| 1581 | Ga0207649_10082132 | |||
| 1582 | Ga0207649_10104150 | |||
| 1583 | Ga0207652_10000508 | |||
| 1584 | Ga0207652_10042874 | |||
| 1585 | Ga0207652_10099968 | |||
| 1586 | Ga0207652_10141852 | |||
| 1587 | Ga0207652_10241182 | |||
| 1588 | Ga0207681_10000035 | |||
| 1589 | Ga0207681_10216857 | |||
| 1590 | Ga0207694_10013689 | |||
| 1591 | Ga0207694_10280026 | |||
| 1592 | Ga0207694_10613509 | |||
| 1593 | Ga0207650_10004006 | |||
| 1594 | Ga0207650_10029712 | |||
| 1595 | Ga0207650_10152127 | |||
| 1596 | Ga0207659_10000027 | |||
| 1597 | Ga0207659_10062431 | |||
| 1598 | Ga0207659_10516412 | |||
| 1599 | Ga0207687_10000231 | |||
| 1600 | Ga0207687_10121439 | |||
| 1601 | Ga0207687_10269396 | |||
| 1602 | Ga0207700_10000917 | |||
| 1603 | Ga0207700_10018837 | |||
| 1604 | Ga0207664_10050032 | |||
| 1605 | Ga0207664_10068903 | |||
| 1606 | Ga0207664_10160417 | |||
| 1607 | Ga0207664_10238850 | |||
| 1608 | Ga0207644_10000676 | |||
| 1609 | Ga0207644_10001814 | |||
| 1610 | Ga0207644_10277087 | |||
| 1611 | Ga0207690_10000148 | |||
| 1612 | Ga0207690_10005705 | |||
| 1613 | Ga0207690_10272583 | |||
| 1614 | Ga0207706_10000261 | |||
| 1615 | Ga0207706_10009549 | |||
| 1616 | Ga0207706_10011544 | |||
| 1617 | Ga0207706_10079975 | |||
| 1618 | Ga0207706_10091374 | |||
| 1619 | Ga0207686_10000171 | |||
| 1620 | Ga0207686_10142585 | |||
| 1621 | Ga0207686_10177549 | |||
| 1622 | Ga0207709_10000087 | |||
| 1623 | Ga0207709_10338600 | |||
| 1624 | Ga0207670_10000169 | |||
| 1625 | Ga0207670_10061140 | |||
| 1626 | Ga0207670_10084942 | |||
| 1627 | Ga0207669_10000351 | |||
| 1628 | Ga0207704_10000392 | |||
| 1629 | Ga0207704_10080565 | |||
| 1630 | Ga0207665_10006980 | |||
| 1631 | Ga0207665_10014334 | |||
| 1632 | Ga0207691_10000106 | |||
| 1633 | Ga0207691_10003240 | |||
| 1634 | Ga0207691_10276908 | |||
| 1635 | Ga0207691_10339613 | |||
| 1636 | Ga0207711_10002556 | |||
| 1637 | Ga0207711_10190386 | |||
| 1638 | Ga0207689_10000031 | |||
| 1639 | Ga0207689_10058339 | |||
| 1640 | Ga0207661_10000219 | |||
| 1641 | Ga0207661_10042920 | |||
| 1642 | Ga0207661_10219707 | |||
| 1643 | Ga0207661_10356449 | |||
| 1644 | Ga0207679_10000493 | |||
| 1645 | Ga0207679_10208995 | |||
| 1646 | Ga0207667_10006216 | |||
| 1647 | Ga0207667_10056791 | |||
| 1648 | Ga0207667_10135517 | |||
| 1649 | Ga0207667_10253791 | |||
| 1650 | Ga0207667_10396727 | |||
| 1651 | Ga0207651_10001402 | |||
| 1652 | Ga0207651_10042171 | |||
| 1653 | Ga0207651_10109644 | |||
| 1654 | Ga0207712_10000176 | |||
| 1655 | Ga0207712_10084235 | |||
| 1656 | Ga0207668_10000191 | |||
| 1657 | Ga0207640_10000126 | |||
| 1658 | Ga0207640_10048911 | |||
| 1659 | Ga0207658_10007487 | |||
| 1660 | Ga0207658_10039587 | |||
| 1661 | Ga0207658_10146888 | |||
| 1662 | Ga0207658_10158151 | |||
| 1663 | Ga0207658_10467002 | |||
| 1664 | Ga0207677_10008615 | |||
| 1665 | Ga0207677_10011116 | |||
| 1666 | Ga0207703_10006871 | |||
| 1667 | Ga0207639_10000515 | |||
| 1668 | Ga0207639_10153092 | |||
| 1669 | Ga0207639_10297240 | |||
| 1670 | Ga0207678_10003344 | |||
| 1671 | Ga0207678_10018565 | |||
| 1672 | Ga0207678_10130554 | |||
| 1673 | Ga0207708_10002176 | |||
| 1674 | Ga0207708_10004315 | |||
| 1675 | Ga0207708_10005555 | |||
| 1676 | Ga0207708_10058968 | |||
| 1677 | Ga0207708_10519634 | |||
| 1678 | Ga0207702_10093843 | |||
| 1679 | Ga0207702_10127863 | |||
| 1680 | Ga0207702_10161072 | |||
| 1681 | Ga0207702_10166863 | |||
| 1682 | Ga0207702_10174061 | |||
| 1683 | Ga0207702_10201285 | |||
| 1684 | Ga0207702_10716468 | |||
| 1685 | Ga0207641_10000937 | |||
| 1686 | Ga0207641_10319240 | |||
| 1687 | Ga0207648_10000125 | |||
| 1688 | Ga0207648_10004855 | |||
| 1689 | Ga0207648_10101634 | |||
| 1690 | Ga0207676_10001547 | |||
| 1691 | Ga0207676_10021875 | |||
| 1692 | Ga0207674_10000095 | |||
| 1693 | Ga0207674_10037855 | |||
| 1694 | Ga0207674_10277435 | |||
| 1695 | Ga0207674_10510457 | |||
| 1696 | Ga0207675_100000140 | |||
| 1697 | Ga0207675_100178450 | |||
| 1698 | Ga0207683_10000178 | |||
| 1699 | Ga0207683_10001447 | |||
| 1700 | Ga0207683_10006604 | |||
| 1701 | Ga0207683_10093752 | |||
| 1702 | Ga0207698_10055129 | |||
| 1703 | Ga0207698_10179775 | |||
| 1704 | Ga0210002_1010222 | |||
| 1705 | Ga0209998_10001420 | |||
| 1706 | Ga0209998_10007968 | |||
| 1707 | Ga0209974_10001253 | |||
| 1708 | Ga0207428_10000037 | |||
| 1709 | Ga0207428_10000188 | |||
| 1710 | Ga0207428_10001468 | |||
| 1711 | Ga0207428_10208475 | |||
| 1712 | Ga0268266_10058547 | |||
| 1713 | Ga0268266_10072157 | |||
| 1714 | Ga0268265_10003265 | |||
| 1715 | Ga0268265_10210048 | |||
| 1716 | Ga0268264_10000467 | |||
| 1717 | Ga0268264_10146328 | |||
| 1718 | Ga0268264_10621572 | |||
| 1719 | Ga0265318_10028860 | |||
| 1720 | Ga0265338_10109014 | |||
| 1721 | Ga0265330_10011740 | |||
| 1722 | Ga0265325_10000049 | |||
| 1723 | Ga0265325_10026895 | |||
| 1724 | Ga0265325_10104861 | |||
| 1725 | Ga0265340_10008615 | |||
| 1726 | Ga0265340_10010149 | |||
| 1727 | Ga0265339_10008341 | |||
| 1728 | Ga0265313_10000367 | |||
| 1729 | Ga0265313_10016043 | |||
| 1730 | Ga0265313_10023470 | |||
| 1731 | Ga0316579_10029032 | |||
| 1732 | Ga0265314_10002604 | |||
| 1733 | Ga0265314_10080527 | |||
| 1734 | Ga0265342_10000131 | |||
| 1735 | Ga0265342_10043803 | |||
| 1736 | Ga0373930_0004830 | |||
| 1737 | Ga0373948_0000573 | |||
| 1738 | Ga0373948_0008845 | |||
| 1739 | Ga0373948_0013917 | |||
| 1740 | Ga0373950_0008136 | |||
| 1741 | Ga0373958_0002000 | |||
| 1742 | Ga0373958_0005551 | |||
| 1743 | Ga0373959_0008049 | |||
| 1744 | Ga0373938_0001280 | |||
| 1745 | Ga0373938_0001567 | |||
| 1746 | Ga0373926_0059285 | |||
| 1747 | Ga0373928_0000298 | |||
| 1748 | Ga0373928_0001394 | |||
| 1749 | Ga0373929_0001337 | |||
| 1750 | Ga0373929_0003771 | |||
| 1751 | Ga0373929_0009503 | |||
| 1752 | Ga0373934_0071793 | |||
| 1753 | Ga0373940_0000080 | |||
| 1754 | Ga0373944_0005697 | |||
| 1755 | Ga0373944_0036995 | |||
| 1756 | Ga0373949_0000470 | |||
| 1757 | Ga0373949_0001211 | |||
| 1758 | Ga0373949_0004945 | |||
| 1759 | Ga0373949_0015141 | |||
| 1760 | Ga0373951_0001678 | |||
| 1761 | Ga0373951_0003802 | |||
| 1762 | Ga0373952_0001024 | |||
| 1763 | Ga0373952_0003807 | |||
| 1764 | Ga0373923_0062601 | |||
| 1765 | Ga0373932_0004055 | |||
| 1766 | Ga0373932_0013240 | |||
| 1767 | Ga0373932_0019612 | |||
| 1768 | Ga0373932_0022936 | |||
| 1769 | Ga0373936_0008887 | |||
| 1770 | Ga0373936_0014438 | |||
| 1771 | Ga0373936_0064415 | |||
| 1772 | Ga0373939_0002126 | |||
| 1773 | Ga0373939_0045719 | |||
| 1774 | Ga0373941_0002163 | |||
| 1775 | Ga0373941_0002809 | |||
| 1776 | Ga0373945_0006376 | |||
| 1777 | Ga0373945_0007998 | |||
| 1778 | Ga0373945_0009643 | |||
| 1779 | Ga0373945_0013167 | |||
| 1780 | Ga0373953_0001317 | |||
| 1781 | Ga0373953_0065362 | |||
| 1782 | Ga0373954_0017961 | |||
| 1783 | Ga0373956_0056276 | |||
| 1784 | Ga0373956_0135016 | |||
| 1785 | Ga0373957_0041803 | |||
| 1786 | Ga0373960_0001537 | |||
| 1787 | Ga0373960_0001555 | |||
| 1788 | Ga0373960_0005815 | |||
| 1789 | Ga0373960_0044318 | |||
| 1790 | Ga0373943_0005425 | |||
| 1791 | Ga0373943_0090690 | |||
| 1792 | Ga0373946_0005557 | |||
| 1793 | Ga0373946_0056845 | |||
| 1794 | Ga0373955_0021578 | |||
| 1795 | Ga0373955_0023579 | |||
| 1796 | Ga0373955_0117434 | |||
| 1797 | Ga0373942_0001029 | |||
| 1798 | Ga0373942_0001201 | |||
| 1799 | Ga0373942_0024547 | |||
| 1800 | Ga0373961_0003450 | |||
| 1801 | Ga0373961_0024002 | |||
| 1802 | Ga0373962_0002652 | |||
| 1803 | Ga0373962_0016004 | |||
| 1804 | Ga0373962_0029953 | |||
| 1805 | Ga0373924_0024148 | |||
| 1806 | Ga0373931_0007106 | |||
| 1807 | Ga0373931_0015678 | |||
| 1808 | Ga0373931_0036025 | |||
| 1809 | Ga0373931_0059714 | |||
| 1810 | Ga0373931_0064570 | |||
| 1811 | Ga0373931_0171393 | |||
| 1812 | Ga0373935_0019509 | |||
| 1813 | Ga0373935_0075913 | |||
| 1814 | Ga0373935_0202191 | |||
| 1815 | Ga0373927_0041744 | |||
| 1816 | Ga0373927_0169372 | |||
| 1817 | Ga0373933_0018347 | |||
| 1818 | Ga0373933_0039204 | |||
| 1819 | Ga0373933_0047510 | |||
| 1820 | Ga0373947_0002717 | |||
| 1821 | Ga0373947_0004057 | |||
| 1822 | Ga0373947_0004916 | |||
| 1823 | Ga0373937_0163301 | |||
| 1824 | Ga0373937_0324524 | |||
| 1825 | Ga0373925_0004221 | |||
| 1826 | Ga0373925_0019424 | |||
| 1827 | Ga0373925_0150943 | |||
| 1828 | Ga0373925_0292983 | |||
| 1829 | Ga0436364_0615504 | |||
| 1830 | Ga0436364_0857978 | |||
| 1831 | Ga0436364_0907772 | |||
| 1832 | Ga0395901_0418326 | |||
| 1833 | Ga0436365_0663409 | |||
| 1834 | Ga0436365_1143395 | |||
| 1835 | Ga0439437_012409 | |||
| 1836 | Ga0439450_016535 | |||
| 1837 | Ga0439455_0035143 | |||
| 1838 | Ga0439464_0011066 | |||
| 1839 | Ga0453684_0079918 | |||
| 1840 | Ga0466971_0040592 | |||
| 1841 | Ga0451576_0033526 | |||
| 1842 | Ga0495617_023457 | |||
| 1843 | Ga0495592_0109182 | |||
| 1844 | Ga0495592_0141022 | |||
| 1845 | Ga0495592_0226694 | |||
| 1846 | Ga0495603_0003594 | |||
| 1847 | Ga0495603_0013678 | |||
| 1848 | Ga0495603_0055086 | |||
| 1849 | Ga0495603_0071018 | |||
| 1850 | Ga0495603_0079680 | |||
| 1851 | Ga0495603_0273626 | |||
| 1852 | Ga0495590_0056108 | |||
| 1853 | Ga0495629_0000269 | |||
| 1854 | Ga0495629_0023056 | |||
| 1855 | Ga0495629_0049305 | |||
| 1856 | Ga0495638_0193721 | |||
| 1857 | Ga0495651_0007532 | |||
| 1858 | Ga0495651_0080911 | |||
| 1859 | Ga0495651_0114392 | |||
| 1860 | Ga0495653_0035845 | |||
| 1861 | Ga0495653_0172577 | |||
| 1862 | Ga0495653_0185576 | |||
| 1863 | Ga0495580_0009185 | |||
| 1864 | Ga0495580_0009445 | |||
| 1865 | Ga0495580_0071534 | |||
| 1866 | Ga0495580_0082936 | |||
| 1867 | Ga0495582_0016677 | |||
| 1868 | Ga0495582_0020095 | |||
| 1869 | Ga0495582_0280407 | |||
| 1870 | Ga0495605_0059533 | |||
| 1871 | Ga0495639_0065081 | |||
| 1872 | Ga0495662_0073420 | |||
| 1873 | Ga0495664_0020688 | |||
| 1874 | Ga0495584_0036956 | |||
| 1875 | Ga0495585_0006605 | |||
| 1876 | Ga0495585_0059774 | |||
| 1877 | Ga0495594_0004830 | |||
| 1878 | Ga0495594_0045852 | |||
| 1879 | Ga0495594_0047164 | |||
| 1880 | Ga0495607_0018075 | |||
| 1881 | Ga0495583_0074909 | |||
| 1882 | Ga0495608_0001268 | |||
| 1883 | Ga0495608_0030282 | |||
| 1884 | Ga0495608_0033948 | |||
| 1885 | Ga0495608_0256603 | |||
| 1886 | Ga0495618_0028539 | |||
| 1887 | Ga0495618_0215509 | |||
| 1888 | Ga0495628_0028500 | |||
| 1889 | Ga0495628_0057215 | |||
| 1890 | Ga0495628_0078789 | |||
| 1891 | Ga0495630_0174739 | |||
| 1892 | Ga0495631_0045516 | |||
| 1893 | Ga0495632_0039255 | |||
| 1894 | Ga0495644_0001996 | |||
| 1895 | Ga0495666_0032197 | |||
| 1896 | Ga0495642_0054101 | |||
| 1897 | Ga0495652_0030704 | |||
| 1898 | Ga0495652_0077110 | |||
| 1899 | Ga0495652_0095962 | |||
| 1900 | Ga0495640_0002019 | |||
| 1901 | Ga0495640_0008735 | |||
| 1902 | Ga0495640_0138826 | |||
| 1903 | Ga0495586_0108046 | |||
| 1904 | Ga0495587_0000620 | |||
| 1905 | Ga0495587_0037944 | |||
| 1906 | Ga0495587_0092138 | |||
| 1907 | Ga0495598_0001380 | |||
| 1908 | Ga0495598_0005318 | |||
| 1909 | Ga0495598_0021021 | |||
| 1910 | Ga0495645_0000640 | |||
| 1911 | Ga0495645_0075824 | |||
| 1912 | Ga0495622_0010250 | |||
| 1913 | Ga0495622_0088991 | |||
| 1914 | Ga0495633_0054001 | |||
| 1915 | Ga0495667_0001254 | |||
| 1916 | Ga0495667_0041608 | |||
| 1917 | Ga0495656_0043604 | |||
| 1918 | Ga0495634_0021860 | |||
| 1919 | Ga0495634_0127179 | |||
| 1920 | Ga0495635_0052540 | |||
| 1921 | Ga0495635_0054794 | |||
| 1922 | Ga0495659_0003206 | |||
| 1923 | Ga0495661_0120176 | |||
| 1924 | Ga0495588_0038087 | |||
| 1925 | Ga0495657_0012096 | |||
| 1926 | Ga0495657_0050495 | |||
| 1927 | Ga0495657_0098151 | |||
| 1928 | Ga0495657_0235905 | |||
| 1929 | Ga0495599_0097738 | |||
| 1930 | Ga0495599_0153477 | |||
| 1931 | Ga0495599_0280465 | |||
| 1932 | Ga0495646_0076963 | |||
| 1933 | Ga0495646_0133887 | |||
| 1934 | Ga0495647_0003055 | |||
| 1935 | Ga0495647_0008588 | |||
| 1936 | Ga0495647_0045895 | |||
| 1937 | Ga0495658_0000762 | |||
| 1938 | Ga0495658_0023837 | |||
| 1939 | Ga0495658_0024491 | |||
| 1940 | Ga0495658_0028009 | |||
| 1941 | Ga0495658_0086269 | |||
| 1942 | Ga0495669_0004555 | |||
| 1943 | Ga0495669_0080388 | |||
| 1944 | Ga0495613_0001384 | |||
| 1945 | Ga0495613_0063564 | |||
| 1946 | Ga0495613_0091126 | |||
| 1947 | Ga0495624_0118510 | |||
| 1948 | Ga0495624_0291068 | |||
| 1949 | Ga0495670_0003495 | |||
| 1950 | Ga0495670_0015860 | |||
| 1951 | Ga0495671_0022017 | |||
| 1952 | Ga0495589_0029287 | |||
| 1953 | Ga0495589_0035660 | |||
| 1954 | Ga0495589_0042440 | |||
| 1955 | Ga0495600_0043323 | |||
| 1956 | Ga0495581_0021839 | |||
| 1957 | Ga0495581_0065239 | |||
| 1958 | Ga0495581_0073089 | |||
| 1959 | Ga0495581_0193860 | |||
| 1960 | Ga0495604_0082001 | |||
| 1961 | Ga0495674_0013976 | |||
| 1962 | Ga0495674_0018881 | |||
| 1963 | Ga0495676_0045000 | |||
| 1964 | Ga0495676_0051640 | |||
| 1965 | Ga0495676_0068514 | |||
| 1966 | Ga0495680_0001472 | |||
| 1967 | Ga0495680_0013659 | |||
| 1968 | Ga0495680_0020287 | |||
| 1969 | Ga0495680_0029631 | |||
| 1970 | Ga0495680_0091982 | |||
| 1971 | Ga0495680_0185171 | |||
| 1972 | Ga0495675_0003746 | |||
| 1973 | Ga0495679_019911 | |||
| 1974 | Ga0495684_0041682 | |||
| 1975 | Ga0495684_0308218 | |||
| 1976 | Ga0495593_0048089 | |||
| 1977 | Ga0495593_0064186 | |||
| 1978 | Ga0495593_0072585 | |||
| 1979 | Ga0495602_0002664 | |||
| 1980 | Ga0495602_0115545 | |||
| 1981 | Ga0495602_0302985 | |||
| 1982 | Ga0495614_0013503 | |||
| 1983 | Ga0495614_0112712 | |||
| 1984 | Ga0495614_0134943 | |||
| 1985 | Ga0496100_0000400 | |||
| 1986 | Ga0496100_0016309 | |||
| 1987 | Ga0496100_0018627 | |||
| 1988 | Ga0496101_0000151 | |||
| 1989 | Ga0496101_0008813 | |||
| 1990 | Ga0496101_0010331 | |||
| 1991 | Ga0496101_0065475 | |||
| 1992 | Ga0496101_0081444 | |||
| 1993 | Ga0496101_0084728 | |||
| 1994 | Ga0496101_0126706 | |||
| 1995 | Ga0496101_0140407 | |||
| 1996 | Ga0496102_0002633 | |||
| 1997 | Ga0496102_0005538 | |||
| 1998 | Ga0496102_0020449 | |||
| 1999 | Ga0496102_0093373 | |||
| 2000 | Ga0496102_0308265 | |||
| 2001 | Ga0496102_0353022 | |||
| 2002 | Ga0496103_0000589 | |||
| 2003 | Ga0496103_0013289 | |||
| 2004 | Ga0496103_0204934 | |||
| 2005 | Ga0496104_0000215 | |||
| 2006 | Ga0496104_0000495 | |||
| 2007 | Ga0496104_0011067 | |||
| 2008 | Ga0496104_0023324 | |||
| 2009 | Ga0496104_0023761 | |||
| 2010 | Ga0496104_0128558 | |||
| 2011 | Ga0496104_0345943 | |||
| 2012 | Ga0496105_0007307 | |||
| 2013 | Ga0496105_0016050 | |||
| 2014 | Ga0496105_0031047 | |||
| 2015 | Ga0496105_0068612 | |||
| 2016 | Ga0496105_0216143 | |||
| 2017 | Ga0496106_0005086 | |||
| 2018 | Ga0496106_0005428 | |||
| 2019 | Ga0496106_0013672 | |||
| 2020 | Ga0496106_0237676 | |||
| 2021 | Ga0496107_0000959 | |||
| 2022 | Ga0496107_0014487 | |||
| 2023 | Ga0496107_0232589 | |||
| 2024 | Ga0496107_0258068 | |||
| 2025 | Ga0496108_0001228 | |||
| 2026 | Ga0496108_0004314 | |||
| 2027 | Ga0496108_0008895 | |||
| 2028 | Ga0496108_0126358 | |||
| 2029 | Ga0496108_0382756 | |||
| 2030 | Ga0496108_0429557 | |||
| 2031 | Ga0496108_0446066 | |||
| 2032 | Ga0496108_0716046 | |||
| 2033 | Ga0496109_0001567 | |||
| 2034 | Ga0496109_0001702 | |||
| 2035 | Ga0496109_0011935 | |||
| 2036 | Ga0496109_0012979 | |||
| 2037 | Ga0496109_0069272 | |||
| 2038 | Ga0496109_0359065 | |||
| 2039 | Ga0496110_0000540 | |||
| 2040 | Ga0496110_0003055 | |||
| 2041 | Ga0496110_0014154 | |||
| 2042 | Ga0496110_0026449 | |||
| 2043 | Ga0496110_0097739 | |||
| 2044 | Ga0496110_0109076 | |||
| 2045 | Ga0496110_0133039 | |||
| 2046 | Ga0496111_0013301 | |||
| 2047 | Ga0496111_0015042 | |||
| 2048 | Ga0496111_0059527 | |||
| 2049 | Ga0496111_0105553 | |||
| 2050 | Ga0496111_0125455 | |||
| 2051 | Ga0496112_0001465 | |||
| 2052 | Ga0496112_0016056 | |||
| 2053 | Ga0496112_0049192 | |||
| 2054 | Ga0496112_0115939 | |||
| 2055 | Ga0496112_0314659 | |||
| 2056 | Ga0496113_0001102 | |||
| 2057 | Ga0496113_0001787 | |||
| 2058 | Ga0496113_0009826 | |||
| 2059 | Ga0496113_0038078 | |||
| 2060 | Ga0496113_0065445 | |||
| 2061 | Ga0496113_0220815 | |||
| 2062 | Ga0496113_0247630 | |||
| 2063 | Ga0496113_0482096 | |||
| 2064 | Ga0496114_0005496 | |||
| 2065 | Ga0496114_0054545 | |||
| 2066 | Ga0496114_0197631 | |||
| 2067 | Ga0496115_0002326 | |||
| 2068 | Ga0496115_0010696 | |||
| 2069 | Ga0496115_0018857 | |||
| 2070 | Ga0496115_0110557 | |||
| 2071 | Ga0496115_0136026 | |||
| 2072 | Ga0496126_0083241 | |||
| 2073 | Ga0501031_0143396 | |||
| 2074 | Ga0501032_0046233 | |||
| 2075 | Ga0501033_0001317 | |||
| 2076 | Ga0501033_0096227 | |||
| 2077 | Ga0501034_0024355 | |||
| 2078 | Ga0501034_0031258 | |||
| 2079 | Ga0501034_0127163 | |||
| 2080 | Ga0501034_0259797 | |||
| 2081 | Ga0501034_0522080 | |||
| 2082 | Ga0501034_0529278 | |||
| 2083 | Ga0501036_0001725 | |||
| 2084 | Ga0501036_0025685 | |||
| 2085 | Ga0501036_0032950 | |||
| 2086 | Ga0501036_0163636 | |||
| 2087 | Ga0501036_0347168 | |||
| 2088 | Ga0501037_0013915 | |||
| 2089 | Ga0501037_0015078 | |||
| 2090 | Ga0501037_0088098 | |||
| 2091 | Ga0501037_0109960 | |||
| 2092 | Ga0501038_0007569 | |||
| 2093 | Ga0501038_0022847 | |||
| 2094 | Ga0501038_0452097 | |||
| 2095 | Ga0501039_0024187 | |||
| 2096 | Ga0501039_0158686 | |||
| 2097 | Ga0501042_0249298 | |||
| 2098 | Ga0501043_0017342 | |||
| 2099 | Ga0501043_0091370 | |||
| 2100 | Ga0501043_0222532 | |||
| 2101 | Ga0501043_0230540 | |||
| 2102 | Ga0501046_0113928 | |||
| 2103 | Ga0501047_0000235 | |||
| 2104 | Ga0501047_0034834 | |||
| 2105 | Ga0501047_0056705 | |||
| 2106 | Ga0501047_0185000 | |||
| 2107 | Ga0501047_0201780 | |||
| 2108 | Ga0501047_0253717 | |||
| 2109 | Ga0501047_0271877 | |||
| 2110 | Ga0501048_0001647 | |||
| 2111 | Ga0501048_0019321 | |||
| 2112 | Ga0501048_0194074 | |||
| 2113 | Ga0501067_0102715 | |||
| 2114 | Ga0501067_0147741 | |||
| 2115 | Ga0501068_0099157 | |||
| 2116 | Ga0501069_0039688 | |||
| 2117 | Ga0501069_0041814 | |||
| 2118 | Ga0501070_0029936 | |||
| 2119 | Ga0501070_0034556 | |||
| 2120 | Ga0501070_0051376 | |||
| 2121 | Ga0501070_0063362 | |||
| 2122 | Ga0501070_0101978 | |||
| 2123 | Ga0501070_0168561 | |||
| 2124 | Ga0501070_0223134 | |||
| 2125 | Ga0501070_0313662 | |||
| 2126 | Ga0501071_0122946 | |||
| 2127 | Ga0501071_0137884 | |||
| 2128 | Ga0501071_0520352 | |||
| 2129 | Ga0501072_0158128 | |||
| 2130 | Ga0501073_0014326 | |||
| 2131 | Ga0501073_0041016 | |||
| 2132 | Ga0501073_0061401 | |||
| 2133 | Ga0501073_0139677 | |||
| 2134 | Ga0501073_0404420 | |||
| 2135 | Ga0501074_0025365 | |||
| 2136 | Ga0501074_0035472 | |||
| 2137 | Ga0501074_0048058 | |||
| 2138 | Ga0501074_0068742 | |||
| 2139 | Ga0501074_0170314 | |||
| 2140 | Ga0501076_0021925 | |||
| 2141 | Ga0501077_0032307 | |||
| 2142 | Ga0501077_0144974 | |||
| 2143 | Ga0501079_0006960 | |||
| 2144 | Ga0501079_0049087 | |||
| 2145 | Ga0501080_0000409 | |||
| 2146 | Ga0501080_0010799 | |||
| 2147 | Ga0501080_0011504 | |||
| 2148 | Ga0501080_0053928 | |||
| 2149 | Ga0501083_0016908 | |||
| 2150 | Ga0501083_0097255 | |||
| 2151 | Ga0501083_0105536 | |||
| 2152 | Ga0501083_0304519 | |||
| 2153 | Ga0501035_0001984 | |||
| 2154 | Ga0501035_0003589 | |||
| 2155 | Ga0501035_0014410 | |||
| 2156 | Ga0501035_0023515 | |||
| 2157 | Ga0501035_0051572 | |||
| 2158 | Ga0501035_0310819 | |||
| 2159 | Ga0501044_0009294 | |||
| 2160 | Ga0501044_0136902 | |||
| 2161 | Ga0501044_0197710 | |||
| 2162 | Ga0501044_0200747 | |||
| 2163 | Ga0501044_0215828 | |||
| 2164 | Ga0501044_0317166 | |||
| 2165 | nmdc:mga0yw44_120814_c1 | |||
| 2166 | nmdc:mga0yw44_19836_c1 | |||
| 2167 | nmdc:mga0yw44_2230_c1 | |||
| 2168 | nmdc:mga06z11_37376_c1 | |||
| 2169 | nmdc:mga07m45_25395_c1 | |||
| 2170 | nmdc:mga05p37_1888_c1 | |||
| 2171 | nmdc:mga05p37_2212_c1 | |||
| 2172 | nmdc:mga05p37_315514_c1 | |||
| 2173 | nmdc:mga09592_1729_c1 | |||
| 2174 | nmdc:mga09592_274670_c1 | |||
| 2175 | nmdc:mga0qj67_2690_c1 | |||
| 2176 | nmdc:mga06r32_18400_c1 | |||
| 2177 | nmdc:mga08y16_178686_c1 | |||
| 2178 | nmdc:mga08y16_27251_c1 | |||
| 2179 | nmdc:mga08y16_311_c1 | |||
| 2180 | nmdc:mga08y16_5010_c1 | |||
| 2181 | nmdc:mga0n895_1869_c1 | |||
| 2182 | nmdc:mga0n895_21771_c1 | |||
| 2183 | nmdc:mga0n895_373568_c1 | |||
| 2184 | nmdc:mga0n895_455195_c1 | |||
| 2185 | nmdc:mga0n895_62_c1 | |||
| 2186 | nmdc:mga0n895_68658_c1 | |||
| 2187 | nmdc:mga0n895_748976_c1 | |||
| 2188 | nmdc:mga0rr50_25217_c1 | |||
| 2189 | nmdc:mga0rr50_80666_c1 | |||
| 2190 | nmdc:mga08x19_280104_c1 | |||
| 2191 | nmdc:mga0a205_1191_c1 | |||
| 2192 | nmdc:mga0a205_29763_c1 | |||
| 2193 | nmdc:mga0a205_58781_c1 | |||
| 2194 | nmdc:mga0a205_78059_c1 | |||
| 2195 | Ga0495601_0006785 | |||
| 2196 | Ga0495601_0010538 | |||
| 2197 | Ga0495601_0017856 | |||
| 2198 | Ga0495601_0047580 | |||
| 2199 | Ga0495601_0093654 | |||
| 2200 | Ga0495601_0131282 | |||
| 2201 | Ga0495601_0152775 | |||
| 2202 | Ga0495601_0230535 | |||
| 2203 | Ga0495612_0005219 | |||
| 2204 | Ga0495612_0006433 | |||
| 2205 | Ga0495612_0052969 | |||
| 2206 | Ga0495595_0001369 | |||
| 2207 | Ga0495595_0002003 | |||
| 2208 | Ga0495595_0025646 | |||
| 2209 | Ga0495619_0000289 | |||
| 2210 | Ga0495619_0000662 | |||
| 2211 | Ga0495619_0027020 | |||
| 2212 | Ga0495619_0028745 | |||
| 2213 | Ga0495619_0044446 | |||
| 2214 | Ga0495619_0111061 | |||
| 2215 | Ga0495619_0186720 | |||
| 2216 | Ga0500643_005637 | |||
| 2217 | Ga0500644_0000980 | |||
| 2218 | Ga0500566_0117057 | |||
| 2219 | Ga0500650_0007014 | |||
| 2220 | Ga0500595_000016 | |||
| 2221 | Ga0500616_0000006 | |||
| 2222 | Ga0500645_000033 | |||
| 2223 | Ga0501084_0099687 | |||
| 2224 | Ga0501084_0222733 | |||
| 2225 | Ga0501082_0038565 | |||
| 2226 | Ga0501082_0190333 | |||
| 2227 | Ga0501082_0363880 | |||
| 2228 | 2643755880 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8dwi-assembly1.cif.gz_A | molecular mechanism of sialic acid transport mediated by sialin | 0.4523 | 2 | 231 |
| 6zgu-assembly2.cif.gz_B | crystal structure of a mfs transporter with bound 3-(2-methylphenyl)propanoic acid at 2.41 angstroem resolution | 0.4389 | 2 | 201 |
| 8dwi-assembly1.cif.gz_A | molecular mechanism of sialic acid transport mediated by sialin | 0.3533 | 2 | 231 |
| 4iu9-assembly2.cif.gz_A | crystal structure of a membrane transporter | 0.3399 | 3 | 264 |
| 7nqk-assembly1.cif.gz_A | cryo-em structure of the mammalian peptide transporter pept2 | 0.3378 | 1 | 199 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_C6KSY4_77_351_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.5663 | 3 | 193 | 1.20.1250.20 |
| af_C0RSI9_6_184_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.5358 | 3 | 199 | 1.20.1250.20 |
| af_Q2FVB9_1_200_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.5235 | 3 | 194 | 1.20.1250.20 |
| af_P17583_1_184_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.5207 | 5 | 199 | 1.20.1250.20 |
| af_C0RSI9_6_184_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.5131 | 3 | 199 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3M1VVU0-F1-model_v4 | Iron permease | 0.9518 | 1 | 267 |
GO:0015093
GO:0033573 |
| AF-A0A1J4VN90-F1-model_v4 | Iron permease | 0.9474 | 1 | 262 |
GO:0015093
GO:0033573 |
| AF-A0A536TFK8-F1-model_v4 | Iron permease | 0.9472 | 1 | 253 |
GO:0015093
GO:0033573 |
| AF-K2CI29-F1-model_v4 | Iron permease | 0.9465 | 1 | 264 |
GO:0015093
GO:0033573 |
| AF-A0A7Y8B6T5-F1-model_v4 | deleted | 0.9443 | 1 | 165 |
|