F490287

General Info

Members Datasets Scaffolds Average Seq Length
1114 424 2228 267

Family's Representative Sequence

Representative Sequence 3300053085|Ga0495619_0180341|Ga0495619_0180341_194_1093
Length 299
Sequence MLLCGPIAHVECNWVSFWSHNKTMLGALIIVFREVIEAGLIVGIVMAATRGVLGRGRWVGFGIGAGVLGAAVVAIFAGAISQAFEGAGQELFNASVLGIAVVMLMWHNAWMARHGREIAEEMQSIGVAVSEGAKPLTALAIVVGLAVLREGSEVVLFLYGIFASGTSGAALLVGGLLGIAAGAAFTGLTYVGLLAIPTRYIFSVTSWLIALLAAGMAAQSVQFLNNAGVVVALDRTVWDTSWMLSEGSLFGKLLHTLIGYSERPTELQLMTYIATLFLMFLLMRLARPAPRARVSAAAE

Samples

Sample ID Description Type Environment
1 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
6 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
7 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
8 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
9 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
10 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
11 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
12 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
13 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
14 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
15 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
16 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
17 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
18 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
19 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
20 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
21 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
22 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
23 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
25 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
26 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
33 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
36 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
37 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
40 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
41 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
42 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
43 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
44 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
45 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
46 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
47 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
48 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
49 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
50 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
51 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
52 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
53 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
54 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
55 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
56 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
57 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
58 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
59 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
60 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
61 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
62 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
63 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
64 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
65 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
66 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
67 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
68 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
69 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
70 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
71 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
72 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
73 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
74 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
75 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
76 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
77 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
78 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
79 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
80 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
81 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
82 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
83 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
84 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
85 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
86 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
87 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
88 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
89 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
90 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
91 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
92 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
93 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
94 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
95 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
96 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
97 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
98 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
99 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
100 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
101 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
102 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
103 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
104 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
105 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
106 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
108 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
109 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
110 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
111 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
112 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
113 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
114 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
115 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
116 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
117 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
118 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
119 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
120 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
121 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
122 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
123 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
124 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
125 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
126 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
127 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
128 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
129 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
130 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
131 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
132 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
133 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
134 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
135 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
136 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
137 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
138 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
139 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
140 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
141 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
142 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
143 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
144 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
145 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
146 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
147 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
148 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
149 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
150 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
151 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
152 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
153 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
154 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
155 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
157 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
226 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
230 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
231 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
232 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
233 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
234 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
235 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
236 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
237 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
238 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
239 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
240 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
241 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
242 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
243 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
244 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
245 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
246 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
247 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
248 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
249 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
250 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
251 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
252 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
253 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
254 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
255 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
256 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
257 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
258 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
259 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
260 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
261 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
262 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
263 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
264 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
265 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
266 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
267 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
268 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
269 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
270 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
271 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
272 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
273 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
274 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
275 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
276 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
277 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
278 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
279 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
280 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
281 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
282 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
283 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
284 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
285 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
286 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
287 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
288 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
289 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
290 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
291 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
292 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
293 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
294 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
295 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
296 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
297 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
298 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
299 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
300 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
301 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
302 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
303 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
304 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
305 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
306 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
307 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
308 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
309 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
310 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
311 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
312 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
313 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
314 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
315 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
316 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
317 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
318 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
319 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
320 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
321 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
322 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
323 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
324 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
325 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
326 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
327 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
328 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
329 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
330 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
331 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
332 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
333 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
334 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
335 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
336 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
337 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
338 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
339 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
340 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
341 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
342 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
343 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
344 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
345 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
346 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
347 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
348 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
349 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
350 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
351 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
352 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
353 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
354 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
355 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
356 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
357 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
358 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
359 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
360 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
361 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
362 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
363 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
364 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
365 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
366 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
367 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
368 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
369 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
370 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
371 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
372 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
373 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
375 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
377 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
378 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
379 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
380 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
381 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
382 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
383 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
385 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
386 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
387 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
388 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
389 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
390 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
391 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
392 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
393 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
394 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
395 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
396 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
397 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
398 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
399 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
400 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
401 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
402 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
403 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
404 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
405 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
406 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
407 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
408 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
409 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
410 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
411 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
412 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
413 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
414 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
415 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
416 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
417 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
418 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
419 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
420 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
421 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
422 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
423 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
424 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0.09
Isolates 0.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.44
Nodule 0
Rhizoplane 7.81
Rhizosphere 89.86
Stem 0
Stem Tuber 0
Unclassified 5.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495619_0180341 3300053085 Bacteria 1461
2 2214544953 2209111006 Bacteria 6053
3 ARSoilYngRDRAFT_c00268 3300000042 Bacteria 7919
4 ARcpr5yngRDRAFT_c000083 3300000043 Bacteria 15543
5 ARcpr5yngRDRAFT_c000130 3300000043 Bacteria 11824
6 ARSoilOldRDRAFT_c000077 3300000044 Bacteria 18706
7 ARCol0oldRDRAFT_c00168 3300000045 Bacteria 5941
8 ARCol0yngRDRAFT_1000003 3300000652 Bacteria 53041
9 JGI24752J21851_1001016 3300001976 Bacteria 3820
10 JGI24746J21847_1000172 3300001977 Bacteria 8495
11 JGI24747J21853_1000145 3300001978 Bacteria 3451
12 JGI24739J22299_10002161 3300001989 Bacteria 7538
13 JGI24737J22298_10002588 3300001990 Bacteria 6411
14 JGI24737J22298_10002605 3300001990 Bacteria 6382
15 JGI24737J22298_10072039 3300001990 Bacteria 1031
16 JGI24743J22301_10021190 3300001991 Bacteria 1240
17 JGI24750J21931_1000256 3300002070 Bacteria 9041
18 JGI24750J21931_1006618 3300002070 Unclassified 1445
19 JGI24745J21846_1000121 3300002073 Bacteria 5975
20 JGI24738J21930_10000425 3300002075 Bacteria 11873
21 JGI24749J21850_1002381 3300002076 Bacteria 2646
22 JGI24744J21845_10000665 3300002077 Bacteria 6286
23 JGI24035J26624_1000008 3300002126 Bacteria 13965
24 JGI24035J26624_1000030 3300002126 Bacteria 10265
25 JGI24033J26618_1000612 3300002155 Bacteria 3427
26 JGI24034J26672_10000799 3300002239 Bacteria 4072
27 JGI24742J22300_10000352 3300002244 Bacteria 6769
28 JGI25405J52794_10001882 3300003911 Bacteria 3538
29 Ga0065716_1001562 3300005277 Bacteria 6533
30 Ga0065704_10274146 3300005289 Unclassified 936
31 Ga0065715_10090800 3300005293 Bacteria 6445
32 Ga0070658_10007097 3300005327 Bacteria 9043
33 Ga0070658_10034171 3300005327 Bacteria 4091
34 Ga0070658_10064284 3300005327 Bacteria 2993
35 Ga0070676_10000036 3300005328 Bacteria 40368
36 Ga0070676_10036183 3300005328 Bacteria 2843
37 Ga0070676_10071872 3300005328 Bacteria 2079
38 Ga0070676_10352611 3300005328 Bacteria 1012
39 Ga0070683_100002049 3300005329 Bacteria 15883
40 Ga0070683_100133634 3300005329 Bacteria 2348
41 Ga0070683_100308029 3300005329 Bacteria 1507
42 Ga0070690_100001849 3300005330 Bacteria 11234
43 Ga0070690_100110205 3300005330 Unclassified 1836
44 Ga0070670_100003778 3300005331 Bacteria 12606
45 Ga0070670_100043490 3300005331 Bacteria 3861
46 Ga0070677_10000104 3300005333 Bacteria 27953
47 Ga0068869_100000087 3300005334 Bacteria 42211
48 Ga0070666_10006798 3300005335 Bacteria 7046
49 Ga0070666_10055355 3300005335 Bacteria 2677
50 Ga0070680_100003276 3300005336 Bacteria 12068
51 Ga0070680_100084340 3300005336 Bacteria 2624
52 Ga0070680_100129012 3300005336 Bacteria 2114
53 Ga0070682_100000341 3300005337 Bacteria 32124
54 Ga0070682_100032217 3300005337 Bacteria 3176
55 Ga0070682_100097794 3300005337 Bacteria 1932
56 Ga0070682_100189368 3300005337 Unclassified 1443
57 Ga0068868_100001826 3300005338 Bacteria 14641
58 Ga0068868_100253462 3300005338 Unclassified 1482
59 Ga0068868_100409597 3300005338 Bacteria 1171
60 Ga0070660_100006206 3300005339 Bacteria 8272
61 Ga0070660_100054032 3300005339 Bacteria 3099
62 Ga0070660_100165984 3300005339 Bacteria 1781
63 Ga0070660_100350593 3300005339 Bacteria 1215
64 Ga0070689_100000963 3300005340 Bacteria 17950
65 Ga0070689_100017974 3300005340 Bacteria 5200
66 Ga0070689_100098820 3300005340 Bacteria 2309
67 Ga0070691_10000518 3300005341 Bacteria 14537
68 Ga0070687_100000245 3300005343 Bacteria 18566
69 Ga0070687_100060180 3300005343 Bacteria 2002
70 Ga0070687_100066302 3300005343 Bacteria 1923
71 Ga0070661_100000017 3300005344 Bacteria 153232
72 Ga0070661_100150902 3300005344 Bacteria 1757
73 Ga0070692_10003367 3300005345 Bacteria 6470
74 Ga0070668_100010066 3300005347 Bacteria 7008
75 Ga0070668_100109771 3300005347 Bacteria 2195
76 Ga0070668_100182409 3300005347 Bacteria 1715
77 Ga0070669_100000217 3300005353 Bacteria 47833
78 Ga0070669_100226474 3300005353 Unclassified 1480
79 Ga0070675_100000088 3300005354 Bacteria 53698
80 Ga0070675_100260527 3300005354 Unclassified 1519
81 Ga0070675_100375653 3300005354 Bacteria 1264
82 Ga0070675_100527369 3300005354 Bacteria 1066
83 Ga0070671_100000768 3300005355 Bacteria 23064
84 Ga0070671_100009332 3300005355 Bacteria 7877
85 Ga0070671_100075563 3300005355 Bacteria 2815
86 Ga0070671_100081683 3300005355 Bacteria 2702
87 Ga0070671_100405405 3300005355 Bacteria 1167
88 Ga0070671_100541185 3300005355 Bacteria 1004
89 Ga0070674_100000623 3300005356 Bacteria 17847
90 Ga0070674_100147460 3300005356 Bacteria 1772
91 Ga0070674_100575237 3300005356 Unclassified 948
92 Ga0070673_100000239 3300005364 Bacteria 27611
93 Ga0070673_100015583 3300005364 Bacteria 5346
94 Ga0070673_100273089 3300005364 Bacteria 1480
95 Ga0070688_100000084 3300005365 Bacteria 47194
96 Ga0070688_100113737 3300005365 Bacteria 1804
97 Ga0070659_100000252 3300005366 Bacteria 42278
98 Ga0070659_100189056 3300005366 Unclassified 1692
99 Ga0070659_100364017 3300005366 Bacteria 1215
100 Ga0070667_100003023 3300005367 Bacteria 14455
101 Ga0070667_100053625 3300005367 Bacteria 3403
102 Ga0070667_100267990 3300005367 Unclassified 1530
103 Ga0070703_10014545 3300005406 Bacteria 2243
104 Ga0070709_10000855 3300005434 Bacteria 17027
105 Ga0070709_10024849 3300005434 Bacteria 3531
106 Ga0070709_10113782 3300005434 Bacteria 1823
107 Ga0070709_10121633 3300005434 Bacteria 1770
108 Ga0070709_10169231 3300005434 Bacteria 1526
109 Ga0070714_100029733 3300005435 Bacteria 4543
110 Ga0070714_100051256 3300005435 Bacteria 3518
111 Ga0070714_100181610 3300005435 Unclassified 1915
112 Ga0070714_100192969 3300005435 Bacteria 1860
113 Ga0070714_100471989 3300005435 Bacteria 1194
114 Ga0070714_100478018 3300005435 Bacteria 1186
115 Ga0070713_100004731 3300005436 Bacteria 9202
116 Ga0070713_100017656 3300005436 Bacteria 5403
117 Ga0070713_100082945 3300005436 Bacteria 2739
118 Ga0070710_10005088 3300005437 Bacteria 6222
119 Ga0070710_10074114 3300005437 Bacteria 1970
120 Ga0070701_10000123 3300005438 Bacteria 22697
121 Ga0070711_100049857 3300005439 Bacteria 2868
122 Ga0070711_100087399 3300005439 Bacteria 2238
123 Ga0070711_100564669 3300005439 Bacteria 945
124 Ga0070705_100000425 3300005440 Bacteria 24231
125 Ga0070705_100167617 3300005440 Unclassified 1475
126 Ga0070700_100000370 3300005441 Bacteria 23064
127 Ga0070700_100103200 3300005441 Unclassified 1883
128 Ga0070700_100210196 3300005441 Bacteria 1372
129 Ga0070694_100000401 3300005444 Bacteria 23534
130 Ga0070694_100057633 3300005444 Bacteria 2641
131 Ga0070708_100004439 3300005445 Bacteria 11027
132 Ga0070708_100259148 3300005445 Bacteria 1635
133 Ga0070708_100324350 3300005445 Bacteria 1451
134 Ga0070663_100000415 3300005455 Bacteria 22408
135 Ga0070663_100021614 3300005455 Bacteria 4283
136 Ga0070663_100030699 3300005455 Bacteria 3686
137 Ga0070663_100113586 3300005455 Bacteria 2038
138 Ga0070663_100203995 3300005455 Unclassified 1544
139 Ga0070678_100000053 3300005456 Bacteria 40418
140 Ga0070678_100009449 3300005456 Bacteria 5911
141 Ga0070678_100093664 3300005456 Bacteria 2310
142 Ga0070662_100003931 3300005457 Bacteria 9321
143 Ga0070662_100011655 3300005457 Bacteria 5804
144 Ga0070662_100052752 3300005457 Bacteria 2941
145 Ga0070662_100127715 3300005457 Bacteria 1956
146 Ga0070681_10000493 3300005458 Bacteria 32198
147 Ga0070681_10048975 3300005458 Bacteria 4220
148 Ga0070681_10163411 3300005458 Bacteria 2150
149 Ga0070681_10675002 3300005458 Unclassified 948
150 Ga0068867_100001581 3300005459 Bacteria 15837
151 Ga0068867_100221007 3300005459 Unclassified 1527
152 Ga0070685_10017206 3300005466 Bacteria 3866
153 Ga0070679_100005631 3300005530 Bacteria 11605
154 Ga0070679_100058723 3300005530 Bacteria 3833
155 Ga0070679_100104483 3300005530 Bacteria 2819
156 Ga0070679_100104990 3300005530 Bacteria 2811
157 Ga0070679_100247957 3300005530 Bacteria 1737
158 Ga0070679_100379206 3300005530 Bacteria 1361
159 Ga0070684_100010354 3300005535 Bacteria 7383
160 Ga0070684_100085580 3300005535 Bacteria 2796
161 Ga0070684_100123706 3300005535 Bacteria 2328
162 Ga0070684_100570957 3300005535 Bacteria 1050
163 Ga0070697_100328785 3300005536 Bacteria 1317
164 Ga0068853_100005864 3300005539 Bacteria 9680
165 Ga0070672_100000014 3300005543 Bacteria 72627
166 Ga0070672_100216713 3300005543 Bacteria 1604
167 Ga0070672_100265402 3300005543 Bacteria 1449
168 Ga0070672_100335519 3300005543 Bacteria 1287
169 Ga0070686_100000754 3300005544 Bacteria 18754
170 Ga0070686_100014000 3300005544 Bacteria 4610
171 Ga0070686_100061154 3300005544 Bacteria 2432
172 Ga0070686_100070670 3300005544 Bacteria 2283
173 Ga0070695_100000743 3300005545 Bacteria 17429
174 Ga0070695_100070169 3300005545 Bacteria 2291
175 Ga0070695_100170359 3300005545 Bacteria 1535
176 Ga0070696_100000918 3300005546 Bacteria 19157
177 Ga0070696_100037902 3300005546 Bacteria 3325
178 Ga0070693_100000141 3300005547 Bacteria 32426
179 Ga0070693_100158494 3300005547 Bacteria 1439
180 Ga0070693_100191458 3300005547 Unclassified 1323
181 Ga0070693_100305363 3300005547 Bacteria 1074
182 Ga0070665_100019687 3300005548 Bacteria 6775
183 Ga0070665_100326210 3300005548 Bacteria 1539
184 Ga0070665_100363516 3300005548 Bacteria 1453
185 Ga0070665_100693443 3300005548 Unclassified 1031
186 Ga0070704_100019420 3300005549 Bacteria 4366
187 Ga0070704_100254263 3300005549 Bacteria 1444
188 Ga0068855_100009106 3300005563 Bacteria 11994
189 Ga0068855_100011304 3300005563 Bacteria 10779
190 Ga0068855_100166621 3300005563 Bacteria 2497
191 Ga0068855_100243917 3300005563 Bacteria 2006
192 Ga0068855_100276365 3300005563 Bacteria 1867
193 Ga0070664_100000816 3300005564 Bacteria 23970
194 Ga0070664_100182779 3300005564 Bacteria 1864
195 Ga0070664_100189122 3300005564 Bacteria 1834
196 Ga0068857_100000567 3300005577 Bacteria 26993
197 Ga0068857_100140358 3300005577 Bacteria 2184
198 Ga0068854_100000168 3300005578 Bacteria 44522
199 Ga0068854_100045835 3300005578 Bacteria 3110
200 Ga0068854_100230453 3300005578 Bacteria 1470
201 Ga0068856_100015543 3300005614 Bacteria 7357
202 Ga0068856_100033238 3300005614 Bacteria 5050
203 Ga0068856_100091613 3300005614 Bacteria 3024
204 Ga0068856_100126264 3300005614 Bacteria 2561
205 Ga0070702_100000857 3300005615 Bacteria 11750
206 Ga0070702_100083296 3300005615 Bacteria 1921
207 Ga0070702_100097380 3300005615 Bacteria 1797
208 Ga0068852_100002066 3300005616 Bacteria 13707
209 Ga0068852_100075443 3300005616 Bacteria 2974
210 Ga0068852_100175185 3300005616 Bacteria 2013
211 Ga0068859_100025021 3300005617 Bacteria 5992
212 Ga0068859_100043742 3300005617 Bacteria 4501
213 Ga0068859_100340926 3300005617 Bacteria 1593
214 Ga0068864_100000980 3300005618 Bacteria 23924
215 Ga0068864_100012023 3300005618 Bacteria 7148
216 Ga0068866_10000264 3300005718 Bacteria 24776
217 Ga0068861_100048215 3300005719 Bacteria 3219
218 Ga0068861_100375101 3300005719 Bacteria 1255
219 Ga0068870_10000002 3300005840 Bacteria 91107
220 Ga0068870_10023276 3300005840 Bacteria 3053
221 Ga0068863_100001290 3300005841 Bacteria 25007
222 Ga0068863_100160400 3300005841 Bacteria 2154
223 Ga0068863_100267996 3300005841 Unclassified 1652
224 Ga0068858_100000356 3300005842 Bacteria 48189
225 Ga0068858_100008336 3300005842 Bacteria 9972
226 Ga0068858_100031420 3300005842 Bacteria 4932
227 Ga0068858_100110588 3300005842 Bacteria 2566
228 Ga0068860_100000747 3300005843 Bacteria 36976
229 Ga0068860_100110091 3300005843 Unclassified 2632
230 Ga0068860_100459002 3300005843 Bacteria 1267
231 Ga0068862_100002002 3300005844 Bacteria 18476
232 Ga0068862_100063239 3300005844 Bacteria 3185
233 Ga0068862_100360193 3300005844 Bacteria 1351
234 Ga0068862_100419162 3300005844 Bacteria 1256
235 Ga0081455_10000048 3300005937 Bacteria 126551
236 Ga0081455_10036386 3300005937 Bacteria 4384
237 Ga0081455_10109094 3300005937 Bacteria 2203
238 Ga0070717_10000150 3300006028 Bacteria 51802
239 Ga0070717_10256933 3300006028 Bacteria 1545
240 Ga0070717_10320379 3300006028 Bacteria 1381
241 Ga0075365_10002448 3300006038 Bacteria 9108
242 Ga0075365_10026234 3300006038 Bacteria 3697
243 Ga0075432_10007512 3300006058 Bacteria 3713
244 Ga0070715_10012192 3300006163 Bacteria 3120
245 Ga0070716_100020197 3300006173 Bacteria 3494
246 Ga0070716_100167516 3300006173 Bacteria 1430
247 Ga0070712_100017131 3300006175 Bacteria 4686
248 Ga0070712_100047906 3300006175 Bacteria 2960
249 Ga0070712_100079311 3300006175 Bacteria 2372
250 Ga0070712_100081094 3300006175 Bacteria 2350
251 Ga0070712_100121889 3300006175 Bacteria 1963
252 Ga0070712_100277761 3300006175 Bacteria 1348
253 Ga0075367_10044499 3300006178 Bacteria 2603
254 Ga0075427_10000042 3300006194 Bacteria 9085
255 Ga0097621_100000144 3300006237 Bacteria 43169
256 Ga0097621_100163371 3300006237 Unclassified 1915
257 Ga0068871_100000110 3300006358 Bacteria 49756
258 Ga0068871_100045891 3300006358 Bacteria 3518
259 Ga0068871_100077839 3300006358 Bacteria 2741
260 Ga0068871_100113826 3300006358 Bacteria 2278
261 Ga0068871_100313925 3300006358 Unclassified 1378
262 Ga0075428_100005798 3300006844 Bacteria 13717
263 Ga0075430_100000627 3300006846 Bacteria 26908
264 Ga0075431_100004676 3300006847 Bacteria 13440
265 Ga0075433_10000615 3300006852 Bacteria 23766
266 Ga0075433_10014612 3300006852 Bacteria 6418
267 Ga0075433_10162511 3300006852 Bacteria 1987
268 Ga0075434_100000084 3300006871 Bacteria 50928
269 Ga0075434_100082669 3300006871 Bacteria 3209
270 Ga0075434_100086680 3300006871 Bacteria 3131
271 Ga0075434_100101394 3300006871 Bacteria 2885
272 Ga0075434_100392587 3300006871 Bacteria 1408
273 Ga0075434_100844731 3300006871 Bacteria 931
274 Ga0075429_100000877 3300006880 Bacteria 23746
275 Ga0068865_100000066 3300006881 Bacteria 54564
276 Ga0068865_100079566 3300006881 Bacteria 2348
277 Ga0068865_100229896 3300006881 Bacteria 1454
278 Ga0097620_100025020 3300006931 Bacteria 5992
279 Ga0097620_100043743 3300006931 Bacteria 4501
280 Ga0097620_100340966 3300006931 Bacteria 1593
281 Ga0075435_100018081 3300007076 Bacteria 5350
282 Ga0075435_100028762 3300007076 Bacteria 4360
283 Ga0075435_100089495 3300007076 Bacteria 2538
284 Ga0075435_100109690 3300007076 Bacteria 2294
285 Ga0075435_100119375 3300007076 Bacteria 2199
286 Ga0075435_100396347 3300007076 Bacteria 1187
287 Ga0105251_10024513 3300009011 Bacteria 3097
288 Ga0105250_10058608 3300009092 Bacteria 1546
289 Ga0105240_10114236 3300009093 Bacteria 3262
290 Ga0105240_10157229 3300009093 Bacteria 2702
291 Ga0105240_10182013 3300009093 Bacteria 2479
292 Ga0105240_10184284 3300009093 Bacteria 2460
293 Ga0105240_10672126 3300009093 Bacteria 1133
294 Ga0111539_10000423 3300009094 Bacteria 53050
295 Ga0111539_10000652 3300009094 Bacteria 44828
296 Ga0111539_10001255 3300009094 Bacteria 33804
297 Ga0111539_10041376 3300009094 Bacteria 5540
298 Ga0111539_10451752 3300009094 Bacteria 1496
299 Ga0105245_10000287 3300009098 Bacteria 48204
300 Ga0105245_10151112 3300009098 Bacteria 2196
301 Ga0105245_10270117 3300009098 Bacteria 1658
302 Ga0105245_10772030 3300009098 Bacteria 998
303 Ga0105245_10772031 3300009098 Bacteria 998
304 Ga0105247_10001223 3300009101 Bacteria 19057
305 Ga0114129_10005652 3300009147 Bacteria 17703
306 Ga0114129_10014653 3300009147 Bacteria 11169
307 Ga0114129_10016700 3300009147 Bacteria 10455
308 Ga0105243_10000695 3300009148 Bacteria 32613
309 Ga0105243_10003814 3300009148 Bacteria 12061
310 Ga0105243_10042456 3300009148 Bacteria 3560
311 Ga0105243_10279702 3300009148 Bacteria 1502
312 Ga0105241_10002331 3300009174 Bacteria 14262
313 Ga0105241_10050152 3300009174 Bacteria 3180
314 Ga0105241_10077871 3300009174 Bacteria 2589
315 Ga0105241_10089324 3300009174 Unclassified 2427
316 Ga0105241_10435075 3300009174 Bacteria 1157
317 Ga0105242_10013046 3300009176 Bacteria 6412
318 Ga0105242_10021242 3300009176 Bacteria 5094
319 Ga0105242_10027855 3300009176 Bacteria 4492
320 Ga0105242_10463740 3300009176 Unclassified 1197
321 Ga0105248_10000535 3300009177 Bacteria 43210
322 Ga0105248_10017864 3300009177 Bacteria 7827
323 Ga0105248_10054802 3300009177 Bacteria 4472
324 Ga0105248_10217704 3300009177 Bacteria 2150
325 Ga0105248_10230495 3300009177 Bacteria 2085
326 Ga0105237_10001499 3300009545 Bacteria 30715
327 Ga0105237_10060545 3300009545 Bacteria 3787
328 Ga0105238_10024354 3300009551 Bacteria 6170
329 Ga0105238_10129759 3300009551 Bacteria 2499
330 Ga0105238_10271473 3300009551 Bacteria 1676
331 Ga0105249_10000279 3300009553 Bacteria 53594
332 Ga0105249_10127265 3300009553 Bacteria 2427
333 Ga0105249_10131049 3300009553 Bacteria 2394
334 Ga0105249_10531674 3300009553 Unclassified 1224
335 Ga0105239_10001686 3300010375 Bacteria 29130
336 Ga0105239_10273347 3300010375 Bacteria 1901
337 Ga0105239_10411292 3300010375 Unclassified 1532
338 Ga0105239_10993354 3300010375 Bacteria 965
339 Ga0105246_10000095 3300011119 Bacteria 38417
340 Ga0105246_10055476 3300011119 Unclassified 2734
341 Ga0105246_10245586 3300011119 Bacteria 1418
342 Ga0105246_10448086 3300011119 Bacteria 1084
343 Ga0105246_10452299 3300011119 Bacteria 1079
344 Ga0157345_1002874 3300012498 Bacteria 1234
345 Ga0157347_1008400 3300012502 Bacteria 1048
346 Ga0157373_10022698 3300013100 Bacteria 4551
347 Ga0157371_10042162 3300013102 Bacteria 3254
348 Ga0157370_10020087 3300013104 Bacteria 6680
349 Ga0157370_10152263 3300013104 Bacteria 2152
350 Ga0157370_10172208 3300013104 Bacteria 2012
351 Ga0157369_10109236 3300013105 Bacteria 2941
352 Ga0157369_10287426 3300013105 Bacteria 1712
353 Ga0157374_10001348 3300013296 Bacteria 20895
354 Ga0157374_10125535 3300013296 Bacteria 2480
355 Ga0157374_10415715 3300013296 Bacteria 1343
356 Ga0157378_10000956 3300013297 Bacteria 26502
357 Ga0157378_10111481 3300013297 Bacteria 2509
358 Ga0157378_10307366 3300013297 Bacteria 1537
359 Ga0157378_10473048 3300013297 Unclassified 1247
360 Ga0157378_10626880 3300013297 Unclassified 1089
361 Ga0163162_10003174 3300013306 Bacteria 15714
362 Ga0163162_10032167 3300013306 Bacteria 5208
363 Ga0163162_10048100 3300013306 Bacteria 4273
364 Ga0163162_10360605 3300013306 Bacteria 1586
365 Ga0163162_10915450 3300013306 Bacteria 989
366 Ga0163162_11108907 3300013306 Bacteria 897
367 Ga0157372_10038947 3300013307 Bacteria 5247
368 Ga0157372_10378267 3300013307 Bacteria 1650
369 Ga0157372_10669520 3300013307 Bacteria 1208
370 Ga0157375_10001973 3300013308 Bacteria 17692
371 Ga0157375_10228127 3300013308 Bacteria 2021
372 Ga0157375_10534860 3300013308 Bacteria 1335
373 Ga0163163_10002399 3300014325 Bacteria 15859
374 Ga0163163_10008535 3300014325 Bacteria 9106
375 Ga0163163_10011378 3300014325 Bacteria 8065
376 Ga0163163_10142726 3300014325 Bacteria 2437
377 Ga0163163_10176916 3300014325 Bacteria 2180
378 Ga0157380_10000052 3300014326 Bacteria 67030
379 Ga0157380_10542621 3300014326 Unclassified 1139
380 Ga0157380_10897278 3300014326 Unclassified 912
381 Ga0182008_10220955 3300014497 Unclassified 969
382 Ga0157377_10000076 3300014745 Bacteria 75835
383 Ga0157377_10001911 3300014745 Bacteria 9115
384 Ga0157377_10286769 3300014745 Bacteria 1081
385 Ga0157379_10000060 3300014968 Bacteria 69312
386 Ga0157379_10023835 3300014968 Bacteria 5432
387 Ga0157379_10035407 3300014968 Bacteria 4451
388 Ga0157379_10158119 3300014968 Bacteria 2045
389 Ga0157376_10000141 3300014969 Bacteria 49288
390 Ga0157376_10021304 3300014969 Bacteria 5033
391 Ga0157376_10026235 3300014969 Bacteria 4601
392 Ga0157376_10056864 3300014969 Bacteria 3271
393 Ga0157376_10125466 3300014969 Bacteria 2282
394 Ga0157376_10862517 3300014969 Bacteria 921
395 Ga0163161_10000739 3300017792 Bacteria 25660
396 Ga0163161_10006741 3300017792 Bacteria 7940
397 Ga0206353_10179351 3300020082 Bacteria 1219
398 Ga0213876_10006713 3300021384 Bacteria 6281
399 Ga0213876_10232052 3300021384 Bacteria 981
400 Ga0213875_10032870 3300021388 Bacteria 2450
401 Ga0209233_1019457 3300025261 Bacteria 1804
402 Ga0207666_1000005 3300025271 Bacteria 54011
403 Ga0207673_1000211 3300025290 Bacteria 5838
404 Ga0207697_10000011 3300025315 Bacteria 65035
405 Ga0207696_1038787 3300025711 Bacteria 1404
406 Ga0207713_1070490 3300025735 Bacteria 1292
407 Ga0207682_10000332 3300025893 Bacteria 21608
408 Ga0207692_10001915 3300025898 Bacteria 7920
409 Ga0207692_10020267 3300025898 Bacteria 3021
410 Ga0207692_10070486 3300025898 Bacteria 1840
411 Ga0207642_10000176 3300025899 Bacteria 18394
412 Ga0207710_10007209 3300025900 Bacteria 4715
413 Ga0207710_10013629 3300025900 Bacteria 3420
414 Ga0207688_10000001 3300025901 Bacteria 107505
415 Ga0207688_10027120 3300025901 Bacteria 3151
416 Ga0207680_10027835 3300025903 Bacteria 3154
417 Ga0207680_10236085 3300025903 Bacteria 1258
418 Ga0207647_10001714 3300025904 Bacteria 16833
419 Ga0207647_10125880 3300025904 Bacteria 1508
420 Ga0207699_10042390 3300025906 Bacteria 2636
421 Ga0207699_10120248 3300025906 Bacteria 1697
422 Ga0207699_10155970 3300025906 Bacteria 1515
423 Ga0207645_10001831 3300025907 Bacteria 17142
424 Ga0207645_10023006 3300025907 Bacteria 4050
425 Ga0207645_10155368 3300025907 Bacteria 1494
426 Ga0207645_10204363 3300025907 Bacteria 1300
427 Ga0207643_10000009 3300025908 Bacteria 160496
428 Ga0207643_10022969 3300025908 Bacteria 3438
429 Ga0207705_10045462 3300025909 Bacteria 3155
430 Ga0207705_10131472 3300025909 Bacteria 1863
431 Ga0207705_10204139 3300025909 Bacteria 1498
432 Ga0207654_10001894 3300025911 Bacteria 10849
433 Ga0207654_10033396 3300025911 Bacteria 2852
434 Ga0207654_10037929 3300025911 Unclassified 2700
435 Ga0207707_10000840 3300025912 Bacteria 30189
436 Ga0207707_10044915 3300025912 Bacteria 3850
437 Ga0207707_10051775 3300025912 Bacteria 3576
438 Ga0207707_10093874 3300025912 Bacteria 2621
439 Ga0207707_10338233 3300025912 Bacteria 1298
440 Ga0207695_10075974 3300025913 Bacteria 3416
441 Ga0207695_10095483 3300025913 Bacteria 2977
442 Ga0207695_10338077 3300025913 Bacteria 1394
443 Ga0207671_10075409 3300025914 Bacteria 2522
444 Ga0207671_10127891 3300025914 Bacteria 1948
445 Ga0207693_10012127 3300025915 Bacteria 6966
446 Ga0207693_10012139 3300025915 Bacteria 6961
447 Ga0207693_10133351 3300025915 Bacteria 1952
448 Ga0207693_10166025 3300025915 Bacteria 1738
449 Ga0207693_10204019 3300025915 Unclassified 1554
450 Ga0207663_10005694 3300025916 Bacteria 6303
451 Ga0207663_10012585 3300025916 Bacteria 4580
452 Ga0207663_10068424 3300025916 Bacteria 2280
453 Ga0207663_10198315 3300025916 Bacteria 1446
454 Ga0207660_10000775 3300025917 Bacteria 21240
455 Ga0207660_10038650 3300025917 Bacteria 3332
456 Ga0207660_10063567 3300025917 Bacteria 2662
457 Ga0207660_10335304 3300025917 Bacteria 1210
458 Ga0207662_10000645 3300025918 Bacteria 15745
459 Ga0207657_10004673 3300025919 Bacteria 14459
460 Ga0207657_10009807 3300025919 Bacteria 9598
461 Ga0207657_10086831 3300025919 Bacteria 2618
462 Ga0207657_10098755 3300025919 Bacteria 2426
463 Ga0207657_10140684 3300025919 Bacteria 1972
464 Ga0207657_10150638 3300025919 Bacteria 1895
465 Ga0207657_10368191 3300025919 Bacteria 1132
466 Ga0207649_10000052 3300025920 Bacteria 106800
467 Ga0207649_10082132 3300025920 Bacteria 2089
468 Ga0207649_10104150 3300025920 Bacteria 1883
469 Ga0207652_10000508 3300025921 Bacteria 39568
470 Ga0207652_10042874 3300025921 Bacteria 3852
471 Ga0207652_10099968 3300025921 Bacteria 2560
472 Ga0207652_10141852 3300025921 Bacteria 2149
473 Ga0207652_10241182 3300025921 Bacteria 1630
474 Ga0207681_10000035 3300025923 Bacteria 161792
475 Ga0207681_10216857 3300025923 Bacteria 1478
476 Ga0207694_10013689 3300025924 Bacteria 6112
477 Ga0207694_10280026 3300025924 Bacteria 1370
478 Ga0207694_10613509 3300025924 Bacteria 915
479 Ga0207650_10004006 3300025925 Bacteria 10077
480 Ga0207650_10029712 3300025925 Bacteria 3931
481 Ga0207650_10152127 3300025925 Unclassified 1827
482 Ga0207659_10000027 3300025926 Bacteria 135454
483 Ga0207659_10062431 3300025926 Bacteria 2689
484 Ga0207659_10516412 3300025926 Unclassified 1013
485 Ga0207687_10000231 3300025927 Bacteria 38087
486 Ga0207687_10121439 3300025927 Bacteria 1955
487 Ga0207687_10269396 3300025927 Unclassified 1361
488 Ga0207700_10000917 3300025928 Bacteria 16892
489 Ga0207700_10018837 3300025928 Bacteria 4650
490 Ga0207664_10050032 3300025929 Bacteria 3293
491 Ga0207664_10068903 3300025929 Bacteria 2844
492 Ga0207664_10160417 3300025929 Unclassified 1918
493 Ga0207664_10238850 3300025929 Bacteria 1582
494 Ga0207644_10000676 3300025931 Bacteria 21510
495 Ga0207644_10001814 3300025931 Bacteria 13865
496 Ga0207644_10277087 3300025931 Bacteria 1346
497 Ga0207690_10000148 3300025932 Bacteria 56244
498 Ga0207690_10005705 3300025932 Bacteria 7354
499 Ga0207690_10272583 3300025932 Bacteria 1315
500 Ga0207706_10000261 3300025933 Bacteria 57530
501 Ga0207706_10009549 3300025933 Bacteria 8908
502 Ga0207706_10011544 3300025933 Bacteria 8044
503 Ga0207706_10079975 3300025933 Bacteria 2874
504 Ga0207706_10091374 3300025933 Bacteria 2676
505 Ga0207686_10000171 3300025934 Bacteria 49624
506 Ga0207686_10142585 3300025934 Bacteria 1658
507 Ga0207686_10177549 3300025934 Bacteria 1508
508 Ga0207709_10000087 3300025935 Bacteria 155019
509 Ga0207709_10338600 3300025935 Bacteria 1131
510 Ga0207670_10000169 3300025936 Bacteria 43470
511 Ga0207670_10061140 3300025936 Bacteria 2569
512 Ga0207670_10084942 3300025936 Bacteria 2223
513 Ga0207669_10000351 3300025937 Bacteria 20924
514 Ga0207704_10000392 3300025938 Bacteria 19977
515 Ga0207704_10080565 3300025938 Bacteria 2102
516 Ga0207665_10006980 3300025939 Bacteria 7473
517 Ga0207665_10014334 3300025939 Bacteria 5219
518 Ga0207691_10000106 3300025940 Bacteria 74290
519 Ga0207691_10003240 3300025940 Bacteria 15858
520 Ga0207691_10276908 3300025940 Bacteria 1444
521 Ga0207691_10339613 3300025940 Bacteria 1286
522 Ga0207711_10002556 3300025941 Bacteria 16214
523 Ga0207711_10190386 3300025941 Bacteria 1869
524 Ga0207689_10000031 3300025942 Bacteria 97131
525 Ga0207689_10058339 3300025942 Bacteria 3175
526 Ga0207661_10000219 3300025944 Bacteria 37298
527 Ga0207661_10042920 3300025944 Bacteria 3568
528 Ga0207661_10219707 3300025944 Bacteria 1679
529 Ga0207661_10356449 3300025944 Bacteria 1321
530 Ga0207679_10000493 3300025945 Bacteria 27242
531 Ga0207679_10208995 3300025945 Bacteria 1635
532 Ga0207667_10006216 3300025949 Bacteria 14494
533 Ga0207667_10056791 3300025949 Bacteria 4111
534 Ga0207667_10135517 3300025949 Bacteria 2535
535 Ga0207667_10253791 3300025949 Unclassified 1799
536 Ga0207667_10396727 3300025949 Bacteria 1405
537 Ga0207651_10001402 3300025960 Bacteria 10939
538 Ga0207651_10042171 3300025960 Bacteria 3035
539 Ga0207651_10109644 3300025960 Bacteria 2069
540 Ga0207712_10000176 3300025961 Bacteria 66116
541 Ga0207712_10084235 3300025961 Bacteria 2323
542 Ga0207668_10000191 3300025972 Bacteria 41901
543 Ga0207640_10000126 3300025981 Bacteria 58432
544 Ga0207640_10048911 3300025981 Bacteria 2736
545 Ga0207658_10007487 3300025986 Bacteria 7438
546 Ga0207658_10039587 3300025986 Bacteria 3401
547 Ga0207658_10146888 3300025986 Unclassified 1916
548 Ga0207658_10158151 3300025986 Unclassified 1854
549 Ga0207658_10467002 3300025986 Bacteria 1119
550 Ga0207677_10008615 3300026023 Bacteria 5710
551 Ga0207677_10011116 3300026023 Bacteria 5118
552 Ga0207703_10006871 3300026035 Bacteria 9061
553 Ga0207639_10000515 3300026041 Bacteria 26655
554 Ga0207639_10153092 3300026041 Bacteria 1934
555 Ga0207639_10297240 3300026041 Bacteria 1426
556 Ga0207678_10003344 3300026067 Bacteria 14464
557 Ga0207678_10018565 3300026067 Bacteria 6107
558 Ga0207678_10130554 3300026067 Unclassified 2143
559 Ga0207708_10002176 3300026075 Bacteria 14459
560 Ga0207708_10004315 3300026075 Bacteria 10470
561 Ga0207708_10005555 3300026075 Bacteria 9306
562 Ga0207708_10058968 3300026075 Bacteria 2929
563 Ga0207708_10519634 3300026075 Bacteria 1000
564 Ga0207702_10093843 3300026078 Bacteria 2633
565 Ga0207702_10127863 3300026078 Bacteria 2283
566 Ga0207702_10161072 3300026078 Bacteria 2049
567 Ga0207702_10166863 3300026078 Bacteria 2015
568 Ga0207702_10174061 3300026078 Bacteria 1976
569 Ga0207702_10201285 3300026078 Bacteria 1846
570 Ga0207702_10716468 3300026078 Bacteria 986
571 Ga0207641_10000937 3300026088 Bacteria 30095
572 Ga0207641_10319240 3300026088 Bacteria 1472
573 Ga0207648_10000125 3300026089 Bacteria 75547
574 Ga0207648_10004855 3300026089 Bacteria 13713
575 Ga0207648_10101634 3300026089 Bacteria 2519
576 Ga0207676_10001547 3300026095 Bacteria 16966
577 Ga0207676_10021875 3300026095 Bacteria 4696
578 Ga0207674_10000095 3300026116 Bacteria 99278
579 Ga0207674_10037855 3300026116 Bacteria 5012
580 Ga0207674_10277435 3300026116 Bacteria 1624
581 Ga0207674_10510457 3300026116 Unclassified 1161
582 Ga0207675_100000140 3300026118 Bacteria 62058
583 Ga0207675_100178450 3300026118 Bacteria 2033
584 Ga0207683_10000178 3300026121 Bacteria 54648
585 Ga0207683_10001447 3300026121 Bacteria 21461
586 Ga0207683_10006604 3300026121 Bacteria 9927
587 Ga0207683_10093752 3300026121 Bacteria 2676
588 Ga0207698_10055129 3300026142 Bacteria 3061
589 Ga0207698_10179775 3300026142 Bacteria 1873
590 Ga0210002_1010222 3300027617 Bacteria 1439
591 Ga0209998_10001420 3300027717 Bacteria 5803
592 Ga0209998_10007968 3300027717 Bacteria 2198
593 Ga0209974_10001253 3300027876 Bacteria 9106
594 Ga0207428_10000037 3300027907 Bacteria 218857
595 Ga0207428_10000188 3300027907 Bacteria 85820
596 Ga0207428_10001468 3300027907 Bacteria 24676
597 Ga0207428_10208475 3300027907 Bacteria 1469
598 Ga0268266_10058547 3300028379 Bacteria 3317
599 Ga0268266_10072157 3300028379 Bacteria 2993
600 Ga0268265_10003265 3300028380 Bacteria 11753
601 Ga0268265_10210048 3300028380 Bacteria 1695
602 Ga0268264_10000467 3300028381 Bacteria 54925
603 Ga0268264_10146328 3300028381 Unclassified 2113
604 Ga0268264_10621572 3300028381 Bacteria 1067
605 Ga0265318_10028860 3300028577 Bacteria 2166
606 Ga0265338_10109014 3300028800 Bacteria 2235
607 Ga0265330_10011740 3300031235 Bacteria 4104
608 Ga0265325_10000049 3300031241 Bacteria 80854
609 Ga0265325_10026895 3300031241 Bacteria 3113
610 Ga0265325_10104861 3300031241 Bacteria 1380
611 Ga0265340_10008615 3300031247 Bacteria 5498
612 Ga0265340_10010149 3300031247 Bacteria 5044
613 Ga0265339_10008341 3300031249 Bacteria 6596
614 Ga0265313_10000367 3300031595 Bacteria 48929
615 Ga0265313_10016043 3300031595 Bacteria 4329
616 Ga0265313_10023470 3300031595 Bacteria 3321
617 Ga0316579_10029032 3300031691 Bacteria 2522
618 Ga0265314_10002604 3300031711 Bacteria 18249
619 Ga0265314_10080527 3300031711 Bacteria 2150
620 Ga0265342_10000131 3300031712 Bacteria 82968
621 Ga0265342_10043803 3300031712 Bacteria 2699
622 Ga0373930_0004830 3300034816 Bacteria 2213
623 Ga0373948_0000573 3300034817 Bacteria 4677
624 Ga0373948_0008845 3300034817 Bacteria 1725
625 Ga0373948_0013917 3300034817 Bacteria 1460
626 Ga0373950_0008136 3300034818 Bacteria 1642
627 Ga0373958_0002000 3300034819 Bacteria 2810
628 Ga0373958_0005551 3300034819 Bacteria 1923
629 Ga0373959_0008049 3300034820 Bacteria 1784
630 Ga0373938_0001280 3300034957 Bacteria 4036
631 Ga0373938_0001567 3300034957 Bacteria 3675
632 Ga0373926_0059285 3300035083 Bacteria 1393
633 Ga0373928_0000298 3300035084 Bacteria 9863
634 Ga0373928_0001394 3300035084 Bacteria 4714
635 Ga0373929_0001337 3300035085 Bacteria 4738
636 Ga0373929_0003771 3300035085 Bacteria 2716
637 Ga0373929_0009503 3300035085 Bacteria 1804
638 Ga0373934_0071793 3300035086 Bacteria 1385
639 Ga0373940_0000080 3300035088 Bacteria 11517
640 Ga0373944_0005697 3300035089 Bacteria 3286
641 Ga0373944_0036995 3300035089 Bacteria 1493
642 Ga0373949_0000470 3300035090 Bacteria 13802
643 Ga0373949_0001211 3300035090 Bacteria 7642
644 Ga0373949_0004945 3300035090 Bacteria 3008
645 Ga0373949_0015141 3300035090 Bacteria 1720
646 Ga0373951_0001678 3300035091 Bacteria 5789
647 Ga0373951_0003802 3300035091 Bacteria 3636
648 Ga0373952_0001024 3300035092 Bacteria 5106
649 Ga0373952_0003807 3300035092 Bacteria 2733
650 Ga0373923_0062601 3300035111 Bacteria 1583
651 Ga0373932_0004055 3300035112 Bacteria 3483
652 Ga0373932_0013240 3300035112 Bacteria 2046
653 Ga0373932_0019612 3300035112 Bacteria 1765
654 Ga0373932_0022936 3300035112 Bacteria 1663
655 Ga0373936_0008887 3300035113 Bacteria 3786
656 Ga0373936_0014438 3300035113 Bacteria 3020
657 Ga0373936_0064415 3300035113 Bacteria 1502
658 Ga0373939_0002126 3300035114 Bacteria 4715
659 Ga0373939_0045719 3300035114 Bacteria 1337
660 Ga0373941_0002163 3300035115 Bacteria 4289
661 Ga0373941_0002809 3300035115 Bacteria 3873
662 Ga0373945_0006376 3300035116 Bacteria 3805
663 Ga0373945_0007998 3300035116 Bacteria 3434
664 Ga0373945_0009643 3300035116 Bacteria 3166
665 Ga0373945_0013167 3300035116 Bacteria 2757
666 Ga0373953_0001317 3300035117 Bacteria 7117
667 Ga0373953_0065362 3300035117 Bacteria 1493
668 Ga0373954_0017961 3300035118 Bacteria 3180
669 Ga0373956_0056276 3300035119 Bacteria 1775
670 Ga0373956_0135016 3300035119 Bacteria 1157
671 Ga0373957_0041803 3300035120 Bacteria 1727
672 Ga0373960_0001537 3300035121 Bacteria 5138
673 Ga0373960_0001555 3300035121 Bacteria 5117
674 Ga0373960_0005815 3300035121 Bacteria 2869
675 Ga0373960_0044318 3300035121 Bacteria 1299
676 Ga0373943_0005425 3300035170 Bacteria 5738
677 Ga0373943_0090690 3300035170 Bacteria 1582
678 Ga0373946_0005557 3300035171 Bacteria 4549
679 Ga0373946_0056845 3300035171 Bacteria 1653
680 Ga0373955_0021578 3300035172 Bacteria 3254
681 Ga0373955_0023579 3300035172 Bacteria 3137
682 Ga0373955_0117434 3300035172 Bacteria 1543
683 Ga0373942_0001029 3300035207 Bacteria 7582
684 Ga0373942_0001201 3300035207 Bacteria 6829
685 Ga0373942_0024547 3300035207 Bacteria 1546
686 Ga0373961_0003450 3300035241 Bacteria 3909
687 Ga0373961_0024002 3300035241 Bacteria 1646
688 Ga0373962_0002652 3300035242 Bacteria 4253
689 Ga0373962_0016004 3300035242 Bacteria 1929
690 Ga0373962_0029953 3300035242 Bacteria 1486
691 Ga0373924_0024148 3300035410 Bacteria 2393
692 Ga0373931_0007106 3300035691 Bacteria 5264
693 Ga0373931_0015678 3300035691 Bacteria 3719
694 Ga0373931_0036025 3300035691 Unclassified 2577
695 Ga0373931_0059714 3300035691 Bacteria 2051
696 Ga0373931_0064570 3300035691 Bacteria 1982
697 Ga0373931_0171393 3300035691 Bacteria 1279
698 Ga0373935_0019509 3300035692 Bacteria 4135
699 Ga0373935_0075913 3300035692 Bacteria 2175
700 Ga0373935_0202191 3300035692 Bacteria 1373
701 Ga0373927_0041744 3300035695 Bacteria 2974
702 Ga0373927_0169372 3300035695 Bacteria 1431
703 Ga0373933_0018347 3300035724 Bacteria 3933
704 Ga0373933_0039204 3300035724 Bacteria 2786
705 Ga0373933_0047510 3300035724 Bacteria 2553
706 Ga0373947_0002717 3300035725 Bacteria 10620
707 Ga0373947_0004057 3300035725 Bacteria 8615
708 Ga0373947_0004916 3300035725 Bacteria 7815
709 Ga0373937_0163301 3300036401 Bacteria 2088
710 Ga0373937_0324524 3300036401 Bacteria 1457
711 Ga0373925_0004221 3300037068 Bacteria 10908
712 Ga0373925_0019424 3300037068 Bacteria 4941
713 Ga0373925_0150943 3300037068 Bacteria 1825
714 Ga0373925_0292983 3300037068 Bacteria 1312
715 Ga0436364_0615504 3300037853 Bacteria 6023
716 Ga0436364_0857978 3300037853 Bacteria 5089
717 Ga0436364_0907772 3300037853 Bacteria 5950
718 Ga0395901_0418326 3300038443 Bacteria 1375
719 Ga0436365_0663409 3300039437 Bacteria 8926
720 Ga0436365_1143395 3300039437 Bacteria 12928
721 Ga0439437_012409 3300042000 Bacteria 984
722 Ga0439450_016535 3300042008 Bacteria 1527
723 Ga0439455_0035143 3300042012 Bacteria 1264
724 Ga0439464_0011066 3300042439 Bacteria 2385
725 Ga0453684_0079918 3300044712 Bacteria 4086
726 Ga0466971_0040592 3300044719 Bacteria 2090
727 Ga0451576_0033526 3300045051 Bacteria 5458
728 Ga0495617_023457 3300046452 Bacteria 2085
729 Ga0495592_0109182 3300046454 Unclassified 1960
730 Ga0495592_0141022 3300046454 Bacteria 1676
731 Ga0495592_0226694 3300046454 Unclassified 1246
732 Ga0495603_0003594 3300046455 Bacteria 9221
733 Ga0495603_0013678 3300046455 Bacteria 4909
734 Ga0495603_0055086 3300046455 Bacteria 2356
735 Ga0495603_0071018 3300046455 Bacteria 2046
736 Ga0495603_0079680 3300046455 Bacteria 1920
737 Ga0495603_0273626 3300046455 Bacteria 971
738 Ga0495590_0056108 3300046457 Bacteria 1377
739 Ga0495629_0000269 3300046459 Bacteria 45206
740 Ga0495629_0023056 3300046459 Bacteria 4436
741 Ga0495629_0049305 3300046459 Bacteria 2951
742 Ga0495638_0193721 3300046460 Bacteria 1152
743 Ga0495651_0007532 3300046462 Bacteria 8327
744 Ga0495651_0080911 3300046462 Bacteria 2453
745 Ga0495651_0114392 3300046462 Bacteria 1991
746 Ga0495653_0035845 3300046463 Bacteria 3912
747 Ga0495653_0172577 3300046463 Bacteria 1491
748 Ga0495653_0185576 3300046463 Bacteria 1423
749 Ga0495580_0009185 3300046472 Bacteria 7793
750 Ga0495580_0009445 3300046472 Bacteria 7670
751 Ga0495580_0071534 3300046472 Bacteria 2423
752 Ga0495580_0082936 3300046472 Unclassified 2234
753 Ga0495582_0016677 3300046473 Bacteria 4022
754 Ga0495582_0020095 3300046473 Bacteria 3654
755 Ga0495582_0280407 3300046473 Bacteria 957
756 Ga0495605_0059533 3300046474 Bacteria 1834
757 Ga0495639_0065081 3300046475 Bacteria 1676
758 Ga0495662_0073420 3300046476 Bacteria 1659
759 Ga0495664_0020688 3300046477 Bacteria 3797
760 Ga0495584_0036956 3300046491 Bacteria 2467
761 Ga0495585_0006605 3300046492 Bacteria 7171
762 Ga0495585_0059774 3300046492 Bacteria 2099
763 Ga0495594_0004830 3300046499 Bacteria 6942
764 Ga0495594_0045852 3300046499 Bacteria 2400
765 Ga0495594_0047164 3300046499 Bacteria 2366
766 Ga0495607_0018075 3300046501 Bacteria 4505
767 Ga0495583_0074909 3300046506 Bacteria 1481
768 Ga0495608_0001268 3300046511 Bacteria 17936
769 Ga0495608_0030282 3300046511 Bacteria 3665
770 Ga0495608_0033948 3300046511 Bacteria 3445
771 Ga0495608_0256603 3300046511 Unclassified 1089
772 Ga0495618_0028539 3300046514 Bacteria 3478
773 Ga0495618_0215509 3300046514 Bacteria 1212
774 Ga0495628_0028500 3300046516 Bacteria 4536
775 Ga0495628_0057215 3300046516 Bacteria 3067
776 Ga0495628_0078789 3300046516 Bacteria 2562
777 Ga0495630_0174739 3300046517 Bacteria 1637
778 Ga0495631_0045516 3300046518 Bacteria 1932
779 Ga0495632_0039255 3300046519 Bacteria 2391
780 Ga0495644_0001996 3300046523 Bacteria 8199
781 Ga0495666_0032197 3300046526 Bacteria 2567
782 Ga0495642_0054101 3300046528 Bacteria 1655
783 Ga0495652_0030704 3300046529 Bacteria 4710
784 Ga0495652_0077110 3300046529 Bacteria 2763
785 Ga0495652_0095962 3300046529 Bacteria 2415
786 Ga0495640_0002019 3300046533 Bacteria 16194
787 Ga0495640_0008735 3300046533 Bacteria 7939
788 Ga0495640_0138826 3300046533 Bacteria 1568
789 Ga0495586_0108046 3300046535 Bacteria 1547
790 Ga0495587_0000620 3300046536 Bacteria 24097
791 Ga0495587_0037944 3300046536 Bacteria 2891
792 Ga0495587_0092138 3300046536 Bacteria 1750
793 Ga0495598_0001380 3300046537 Bacteria 4786
794 Ga0495598_0005318 3300046537 Bacteria 2845
795 Ga0495598_0021021 3300046537 Bacteria 1731
796 Ga0495645_0000640 3300046543 Bacteria 24122
797 Ga0495645_0075824 3300046543 Bacteria 2421
798 Ga0495622_0010250 3300046557 Bacteria 4333
799 Ga0495622_0088991 3300046557 Bacteria 1419
800 Ga0495633_0054001 3300046558 Bacteria 1890
801 Ga0495667_0001254 3300046559 Bacteria 16638
802 Ga0495667_0041608 3300046559 Bacteria 3047
803 Ga0495656_0043604 3300046615 Bacteria 1884
804 Ga0495634_0021860 3300046642 Bacteria 4514
805 Ga0495634_0127179 3300046642 Unclassified 1628
806 Ga0495635_0052540 3300046663 Bacteria 2807
807 Ga0495635_0054794 3300046663 Bacteria 2746
808 Ga0495659_0003206 3300046664 Bacteria 5238
809 Ga0495661_0120176 3300046665 Bacteria 1452
810 Ga0495588_0038087 3300046674 Bacteria 2445
811 Ga0495657_0012096 3300046675 Bacteria 6421
812 Ga0495657_0050495 3300046675 Bacteria 2796
813 Ga0495657_0098151 3300046675 Unclassified 1870
814 Ga0495657_0235905 3300046675 Bacteria 1105
815 Ga0495599_0097738 3300046678 Bacteria 1830
816 Ga0495599_0153477 3300046678 Unclassified 1425
817 Ga0495599_0280465 3300046678 Bacteria 1009
818 Ga0495646_0076963 3300046680 Bacteria 1952
819 Ga0495646_0133887 3300046680 Unclassified 1393
820 Ga0495647_0003055 3300046681 Bacteria 5337
821 Ga0495647_0008588 3300046681 Bacteria 3436
822 Ga0495647_0045895 3300046681 Bacteria 1680
823 Ga0495658_0000762 3300046683 Bacteria 17418
824 Ga0495658_0023837 3300046683 Bacteria 3252
825 Ga0495658_0024491 3300046683 Bacteria 3216
826 Ga0495658_0028009 3300046683 Bacteria 3037
827 Ga0495658_0086269 3300046683 Bacteria 1851
828 Ga0495669_0004555 3300046684 Bacteria 5737
829 Ga0495669_0080388 3300046684 Bacteria 1496
830 Ga0495613_0001384 3300046689 Bacteria 18433
831 Ga0495613_0063564 3300046689 Bacteria 2700
832 Ga0495613_0091126 3300046689 Bacteria 2208
833 Ga0495624_0118510 3300046690 Bacteria 1626
834 Ga0495624_0291068 3300046690 Unclassified 985
835 Ga0495670_0003495 3300046691 Bacteria 7714
836 Ga0495670_0015860 3300046691 Bacteria 3702
837 Ga0495671_0022017 3300046692 Bacteria 3343
838 Ga0495589_0029287 3300046794 Bacteria 2776
839 Ga0495589_0035660 3300046794 Bacteria 2494
840 Ga0495589_0042440 3300046794 Bacteria 2267
841 Ga0495600_0043323 3300046809 Bacteria 2935
842 Ga0495581_0021839 3300047315 Bacteria 3709
843 Ga0495581_0065239 3300047315 Bacteria 2105
844 Ga0495581_0073089 3300047315 Bacteria 1984
845 Ga0495581_0193860 3300047315 Bacteria 1189
846 Ga0495604_0082001 3300047317 Bacteria 2413
847 Ga0495674_0013976 3300047319 Bacteria 7529
848 Ga0495674_0018881 3300047319 Bacteria 6412
849 Ga0495676_0045000 3300047321 Bacteria 3597
850 Ga0495676_0051640 3300047321 Bacteria 3287
851 Ga0495676_0068514 3300047321 Bacteria 2741
852 Ga0495680_0001472 3300047322 Bacteria 25404
853 Ga0495680_0013659 3300047322 Bacteria 7073
854 Ga0495680_0020287 3300047322 Bacteria 5594
855 Ga0495680_0029631 3300047322 Bacteria 4480
856 Ga0495680_0091982 3300047322 Bacteria 2273
857 Ga0495680_0185171 3300047322 Unclassified 1500
858 Ga0495675_0003746 3300047444 Bacteria 9193
859 Ga0495679_019911 3300047446 Bacteria 2347
860 Ga0495684_0041682 3300047471 Bacteria 3518
861 Ga0495684_0308218 3300047471 Bacteria 1135
862 Ga0495593_0048089 3300047673 Bacteria 2267
863 Ga0495593_0064186 3300047673 Bacteria 1917
864 Ga0495593_0072585 3300047673 Bacteria 1786
865 Ga0495602_0002664 3300048088 Bacteria 18252
866 Ga0495602_0115545 3300048088 Bacteria 2171
867 Ga0495602_0302985 3300048088 Bacteria 1169
868 Ga0495614_0013503 3300048089 Bacteria 3581
869 Ga0495614_0112712 3300048089 Unclassified 1195
870 Ga0495614_0134943 3300048089 Bacteria 1094
871 Ga0496100_0000400 3300048903 Bacteria 20959
872 Ga0496100_0016309 3300048903 Bacteria 4359
873 Ga0496100_0018627 3300048903 Bacteria 4122
874 Ga0496101_0000151 3300048904 Bacteria 59751
875 Ga0496101_0008813 3300048904 Bacteria 6599
876 Ga0496101_0010331 3300048904 Bacteria 6165
877 Ga0496101_0065475 3300048904 Bacteria 2649
878 Ga0496101_0081444 3300048904 Bacteria 2394
879 Ga0496101_0084728 3300048904 Bacteria 2348
880 Ga0496101_0126706 3300048904 Bacteria 1935
881 Ga0496101_0140407 3300048904 Bacteria 1841
882 Ga0496102_0002633 3300048905 Bacteria 15255
883 Ga0496102_0005538 3300048905 Bacteria 10724
884 Ga0496102_0020449 3300048905 Bacteria 5848
885 Ga0496102_0093373 3300048905 Bacteria 2787
886 Ga0496102_0308265 3300048905 Bacteria 1492
887 Ga0496102_0353022 3300048905 Bacteria 1384
888 Ga0496103_0000589 3300048906 Bacteria 28631
889 Ga0496103_0013289 3300048906 Bacteria 4880
890 Ga0496103_0204934 3300048906 Unclassified 1268
891 Ga0496104_0000215 3300048907 Bacteria 50960
892 Ga0496104_0000495 3300048907 Bacteria 34041
893 Ga0496104_0011067 3300048907 Bacteria 8072
894 Ga0496104_0023324 3300048907 Bacteria 5688
895 Ga0496104_0023761 3300048907 Bacteria 5636
896 Ga0496104_0128558 3300048907 Bacteria 2433
897 Ga0496104_0345943 3300048907 Bacteria 1399
898 Ga0496105_0007307 3300048908 Bacteria 8532
899 Ga0496105_0016050 3300048908 Bacteria 5974
900 Ga0496105_0031047 3300048908 Bacteria 4379
901 Ga0496105_0068612 3300048908 Bacteria 2929
902 Ga0496105_0216143 3300048908 Bacteria 1561
903 Ga0496106_0005086 3300048909 Bacteria 9737
904 Ga0496106_0005428 3300048909 Bacteria 9431
905 Ga0496106_0013672 3300048909 Bacteria 5993
906 Ga0496106_0237676 3300048909 Bacteria 1455
907 Ga0496107_0000959 3300048910 Bacteria 17091
908 Ga0496107_0014487 3300048910 Bacteria 5521
909 Ga0496107_0232589 3300048910 Bacteria 1371
910 Ga0496107_0258068 3300048910 Bacteria 1297
911 Ga0496108_0001228 3300048911 Bacteria 20100
912 Ga0496108_0004314 3300048911 Bacteria 11435
913 Ga0496108_0008895 3300048911 Bacteria 8140
914 Ga0496108_0126358 3300048911 Bacteria 2195
915 Ga0496108_0382756 3300048911 Bacteria 1228
916 Ga0496108_0429557 3300048911 Bacteria 1154
917 Ga0496108_0446066 3300048911 Bacteria 1130
918 Ga0496108_0716046 3300048911 Bacteria 867
919 Ga0496109_0001567 3300048912 Bacteria 19049
920 Ga0496109_0001702 3300048912 Bacteria 18343
921 Ga0496109_0011935 3300048912 Bacteria 7481
922 Ga0496109_0012979 3300048912 Bacteria 7201
923 Ga0496109_0069272 3300048912 Bacteria 3235
924 Ga0496109_0359065 3300048912 Bacteria 1376
925 Ga0496110_0000540 3300048913 Bacteria 25786
926 Ga0496110_0003055 3300048913 Bacteria 12692
927 Ga0496110_0014154 3300048913 Bacteria 6617
928 Ga0496110_0026449 3300048913 Bacteria 4966
929 Ga0496110_0097739 3300048913 Bacteria 2630
930 Ga0496110_0109076 3300048913 Unclassified 2486
931 Ga0496110_0133039 3300048913 Bacteria 2246
932 Ga0496111_0013301 3300048914 Bacteria 5596
933 Ga0496111_0015042 3300048914 Bacteria 5300
934 Ga0496111_0059527 3300048914 Bacteria 2767
935 Ga0496111_0105553 3300048914 Bacteria 2073
936 Ga0496111_0125455 3300048914 Bacteria 1897
937 Ga0496112_0001465 3300048915 Bacteria 18127
938 Ga0496112_0016056 3300048915 Bacteria 7001
939 Ga0496112_0049192 3300048915 Bacteria 4133
940 Ga0496112_0115939 3300048915 Bacteria 2649
941 Ga0496112_0314659 3300048915 Bacteria 1510
942 Ga0496113_0001102 3300048916 Bacteria 14628
943 Ga0496113_0001787 3300048916 Bacteria 12193
944 Ga0496113_0009826 3300048916 Bacteria 6297
945 Ga0496113_0038078 3300048916 Bacteria 3533
946 Ga0496113_0065445 3300048916 Bacteria 2751
947 Ga0496113_0220815 3300048916 Bacteria 1510
948 Ga0496113_0247630 3300048916 Bacteria 1422
949 Ga0496113_0482096 3300048916 Unclassified 996
950 Ga0496114_0005496 3300048917 Bacteria 9922
951 Ga0496114_0054545 3300048917 Bacteria 3333
952 Ga0496114_0197631 3300048917 Bacteria 1760
953 Ga0496115_0002326 3300048918 Bacteria 13618
954 Ga0496115_0010696 3300048918 Bacteria 6863
955 Ga0496115_0018857 3300048918 Bacteria 5304
956 Ga0496115_0110557 3300048918 Bacteria 2257
957 Ga0496115_0136026 3300048918 Bacteria 2026
958 Ga0496126_0083241 3300048929 Bacteria 2825
959 Ga0501031_0143396 3300049568 Bacteria 1561
960 Ga0501032_0046233 3300049569 Bacteria 2942
961 Ga0501033_0001317 3300049570 Bacteria 22076
962 Ga0501033_0096227 3300049570 Bacteria 2163
963 Ga0501034_0024355 3300049571 Bacteria 6156
964 Ga0501034_0031258 3300049571 Bacteria 5408
965 Ga0501034_0127163 3300049571 Bacteria 2533
966 Ga0501034_0259797 3300049571 Bacteria 1680
967 Ga0501034_0522080 3300049571 Bacteria 1099
968 Ga0501034_0529278 3300049571 Bacteria 1090
969 Ga0501036_0001725 3300049572 Bacteria 16998
970 Ga0501036_0025685 3300049572 Bacteria 4971
971 Ga0501036_0032950 3300049572 Bacteria 4380
972 Ga0501036_0163636 3300049572 Bacteria 1875
973 Ga0501036_0347168 3300049572 Bacteria 1239
974 Ga0501037_0013915 3300049573 Bacteria 5929
975 Ga0501037_0015078 3300049573 Bacteria 5684
976 Ga0501037_0088098 3300049573 Bacteria 2246
977 Ga0501037_0109960 3300049573 Bacteria 1986
978 Ga0501038_0007569 3300049574 Bacteria 10014
979 Ga0501038_0022847 3300049574 Bacteria 5598
980 Ga0501038_0452097 3300049574 Bacteria 987
981 Ga0501039_0024187 3300049575 Bacteria 4664
982 Ga0501039_0158686 3300049575 Bacteria 1777
983 Ga0501042_0249298 3300049578 Bacteria 1281
984 Ga0501043_0017342 3300049579 Bacteria 5647
985 Ga0501043_0091370 3300049579 Bacteria 2393
986 Ga0501043_0222532 3300049579 Bacteria 1459
987 Ga0501043_0230540 3300049579 Bacteria 1430
988 Ga0501046_0113928 3300049580 Bacteria 2063
989 Ga0501047_0000235 3300049581 Bacteria 65603
990 Ga0501047_0034834 3300049581 Bacteria 4861
991 Ga0501047_0056705 3300049581 Bacteria 3789
992 Ga0501047_0185000 3300049581 Bacteria 1949
993 Ga0501047_0201780 3300049581 Bacteria 1850
994 Ga0501047_0253717 3300049581 Bacteria 1607
995 Ga0501047_0271877 3300049581 Bacteria 1541
996 Ga0501048_0001647 3300049582 Bacteria 17021
997 Ga0501048_0019321 3300049582 Bacteria 5000
998 Ga0501048_0194074 3300049582 Bacteria 1439
999 Ga0501067_0102715 3300049583 Bacteria 1588
1000 Ga0501067_0147741 3300049583 Bacteria 1309
1001 Ga0501068_0099157 3300049584 Bacteria 1805
1002 Ga0501069_0039688 3300049585 Bacteria 2600
1003 Ga0501069_0041814 3300049585 Bacteria 2534
1004 Ga0501070_0029936 3300049586 Bacteria 4561
1005 Ga0501070_0034556 3300049586 Bacteria 4226
1006 Ga0501070_0051376 3300049586 Bacteria 3422
1007 Ga0501070_0063362 3300049586 Bacteria 3062
1008 Ga0501070_0101978 3300049586 Bacteria 2373
1009 Ga0501070_0168561 3300049586 Bacteria 1804
1010 Ga0501070_0223134 3300049586 Bacteria 1545
1011 Ga0501070_0313662 3300049586 Bacteria 1276
1012 Ga0501071_0122946 3300049587 Bacteria 1924
1013 Ga0501071_0137884 3300049587 Bacteria 1816
1014 Ga0501071_0520352 3300049587 Bacteria 913
1015 Ga0501072_0158128 3300049588 Bacteria 1807
1016 Ga0501073_0014326 3300049589 Bacteria 5760
1017 Ga0501073_0041016 3300049589 Bacteria 3272
1018 Ga0501073_0061401 3300049589 Bacteria 2622
1019 Ga0501073_0139677 3300049589 Bacteria 1679
1020 Ga0501073_0404420 3300049589 Bacteria 943
1021 Ga0501074_0025365 3300049590 Bacteria 4305
1022 Ga0501074_0035472 3300049590 Bacteria 3613
1023 Ga0501074_0048058 3300049590 Bacteria 3082
1024 Ga0501074_0068742 3300049590 Bacteria 2547
1025 Ga0501074_0170314 3300049590 Bacteria 1554
1026 Ga0501076_0021925 3300049592 Bacteria 4905
1027 Ga0501077_0032307 3300049593 Bacteria 3332
1028 Ga0501077_0144974 3300049593 Bacteria 1506
1029 Ga0501079_0006960 3300049741 Bacteria 8524
1030 Ga0501079_0049087 3300049741 Bacteria 3257
1031 Ga0501080_0000409 3300049742 Bacteria 33000
1032 Ga0501080_0010799 3300049742 Bacteria 8358
1033 Ga0501080_0011504 3300049742 Bacteria 8102
1034 Ga0501080_0053928 3300049742 Bacteria 3744
1035 Ga0501083_0016908 3300049744 Bacteria 5095
1036 Ga0501083_0097255 3300049744 Bacteria 1942
1037 Ga0501083_0105536 3300049744 Bacteria 1855
1038 Ga0501083_0304519 3300049744 Bacteria 1036
1039 Ga0501035_0001984 3300049822 Bacteria 20462
1040 Ga0501035_0003589 3300049822 Bacteria 14819
1041 Ga0501035_0014410 3300049822 Bacteria 7297
1042 Ga0501035_0023515 3300049822 Bacteria 5653
1043 Ga0501035_0051572 3300049822 Bacteria 3683
1044 Ga0501035_0310819 3300049822 Bacteria 1326
1045 Ga0501044_0009294 3300049823 Bacteria 10727
1046 Ga0501044_0136902 3300049823 Bacteria 2440
1047 Ga0501044_0197710 3300049823 Bacteria 1970
1048 Ga0501044_0200747 3300049823 Bacteria 1952
1049 Ga0501044_0215828 3300049823 Bacteria 1871
1050 Ga0501044_0317166 3300049823 Bacteria 1484
1051 nmdc:mga0yw44_120814_c1 3300050492 Bacteria 1687
1052 nmdc:mga0yw44_19836_c1 3300050492 Bacteria 3716
1053 nmdc:mga0yw44_2230_c1 3300050492 Bacteria 8169
1054 nmdc:mga06z11_37376_c1 3300050494 Bacteria 2076
1055 nmdc:mga07m45_25395_c1 3300050496 Bacteria 2475
1056 nmdc:mga05p37_1888_c1 3300050507 Bacteria 24396
1057 nmdc:mga05p37_2212_c1 3300050507 Bacteria 22652
1058 nmdc:mga05p37_315514_c1 3300050507 Bacteria 1852
1059 nmdc:mga09592_1729_c1 3300050508 Bacteria 17579
1060 nmdc:mga09592_274670_c1 3300050508 Bacteria 1462
1061 nmdc:mga0qj67_2690_c1 3300050509 Bacteria 12744
1062 nmdc:mga06r32_18400_c1 3300050510 Bacteria 6398
1063 nmdc:mga08y16_178686_c1 3300050511 Bacteria 2204
1064 nmdc:mga08y16_27251_c1 3300050511 Bacteria 6021
1065 nmdc:mga08y16_311_c1 3300050511 Bacteria 43954
1066 nmdc:mga08y16_5010_c1 3300050511 Bacteria 13856
1067 nmdc:mga0n895_1869_c1 3300050512 Bacteria 16078
1068 nmdc:mga0n895_21771_c1 3300050512 Bacteria 6001
1069 nmdc:mga0n895_373568_c1 3300050512 Bacteria 1443
1070 nmdc:mga0n895_455195_c1 3300050512 Bacteria 1292
1071 nmdc:mga0n895_62_c1 3300050512 Bacteria 62891
1072 nmdc:mga0n895_68658_c1 3300050512 Bacteria 3511
1073 nmdc:mga0n895_748976_c1 3300050512 Bacteria 970
1074 nmdc:mga0rr50_25217_c1 3300050513 Bacteria 4130
1075 nmdc:mga0rr50_80666_c1 3300050513 Bacteria 2509
1076 nmdc:mga08x19_280104_c1 3300050514 Bacteria 1155
1077 nmdc:mga0a205_1191_c1 3300050515 Bacteria 21722
1078 nmdc:mga0a205_29763_c1 3300050515 Bacteria 5226
1079 nmdc:mga0a205_58781_c1 3300050515 Bacteria 3714
1080 nmdc:mga0a205_78059_c1 3300050515 Bacteria 3199
1081 Ga0495601_0006785 3300053077 Bacteria 6705
1082 Ga0495601_0010538 3300053077 Bacteria 5504
1083 Ga0495601_0017856 3300053077 Bacteria 4311
1084 Ga0495601_0047580 3300053077 Bacteria 2700
1085 Ga0495601_0093654 3300053077 Bacteria 1935
1086 Ga0495601_0131282 3300053077 Bacteria 1631
1087 Ga0495601_0152775 3300053077 Bacteria 1507
1088 Ga0495601_0230535 3300053077 Bacteria 1209
1089 Ga0495612_0005219 3300053078 Bacteria 5367
1090 Ga0495612_0006433 3300053078 Bacteria 4828
1091 Ga0495612_0052969 3300053078 Bacteria 1670
1092 Ga0495595_0001369 3300053084 Bacteria 9461
1093 Ga0495595_0002003 3300053084 Bacteria 7927
1094 Ga0495595_0025646 3300053084 Bacteria 2614
1095 Ga0495619_0000289 3300053085 Bacteria 35778
1096 Ga0495619_0000662 3300053085 Bacteria 22563
1097 Ga0495619_0027020 3300053085 Bacteria 3696
1098 Ga0495619_0028745 3300053085 Bacteria 3588
1099 Ga0495619_0044446 3300053085 Bacteria 2915
1100 Ga0495619_0111061 3300053085 Bacteria 1873
1101 Ga0495619_0186720 3300053085 Bacteria 1435
1102 Ga0500643_005637 3300053087 Bacteria 5358
1103 Ga0500644_0000980 3300053088 Bacteria 8899
1104 Ga0500566_0117057 3300053094 Bacteria 1441
1105 Ga0500650_0007014 3300053098 Bacteria 4351
1106 Ga0500595_000016 3300053119 Bacteria 211397
1107 Ga0500616_0000006 3300053153 Bacteria 944738
1108 Ga0500645_000033 3300053730 Bacteria 119279
1109 Ga0501084_0099687 3300054114 Bacteria 2439
1110 Ga0501084_0222733 3300054114 Bacteria 1592
1111 Ga0501082_0038565 3300060353 Bacteria 4122
1112 Ga0501082_0190333 3300060353 Bacteria 1785
1113 Ga0501082_0363880 3300060353 Bacteria 1261
1114 2643755880 2643221547 Bacteria 4740017
1115 Ga0495619_0180341
1116 2214544953
1117 ARSoilYngRDRAFT_c00268
1118 ARcpr5yngRDRAFT_c000083
1119 ARcpr5yngRDRAFT_c000130
1120 ARSoilOldRDRAFT_c000077
1121 ARCol0oldRDRAFT_c00168
1122 ARCol0yngRDRAFT_1000003
1123 JGI24752J21851_1001016
1124 JGI24746J21847_1000172
1125 JGI24747J21853_1000145
1126 JGI24739J22299_10002161
1127 JGI24737J22298_10002588
1128 JGI24737J22298_10002605
1129 JGI24737J22298_10072039
1130 JGI24743J22301_10021190
1131 JGI24750J21931_1000256
1132 JGI24750J21931_1006618
1133 JGI24745J21846_1000121
1134 JGI24738J21930_10000425
1135 JGI24749J21850_1002381
1136 JGI24744J21845_10000665
1137 JGI24035J26624_1000008
1138 JGI24035J26624_1000030
1139 JGI24033J26618_1000612
1140 JGI24034J26672_10000799
1141 JGI24742J22300_10000352
1142 JGI25405J52794_10001882
1143 Ga0065716_1001562
1144 Ga0065704_10274146
1145 Ga0065715_10090800
1146 Ga0070658_10007097
1147 Ga0070658_10034171
1148 Ga0070658_10064284
1149 Ga0070676_10000036
1150 Ga0070676_10036183
1151 Ga0070676_10071872
1152 Ga0070676_10352611
1153 Ga0070683_100002049
1154 Ga0070683_100133634
1155 Ga0070683_100308029
1156 Ga0070690_100001849
1157 Ga0070690_100110205
1158 Ga0070670_100003778
1159 Ga0070670_100043490
1160 Ga0070677_10000104
1161 Ga0068869_100000087
1162 Ga0070666_10006798
1163 Ga0070666_10055355
1164 Ga0070680_100003276
1165 Ga0070680_100084340
1166 Ga0070680_100129012
1167 Ga0070682_100000341
1168 Ga0070682_100032217
1169 Ga0070682_100097794
1170 Ga0070682_100189368
1171 Ga0068868_100001826
1172 Ga0068868_100253462
1173 Ga0068868_100409597
1174 Ga0070660_100006206
1175 Ga0070660_100054032
1176 Ga0070660_100165984
1177 Ga0070660_100350593
1178 Ga0070689_100000963
1179 Ga0070689_100017974
1180 Ga0070689_100098820
1181 Ga0070691_10000518
1182 Ga0070687_100000245
1183 Ga0070687_100060180
1184 Ga0070687_100066302
1185 Ga0070661_100000017
1186 Ga0070661_100150902
1187 Ga0070692_10003367
1188 Ga0070668_100010066
1189 Ga0070668_100109771
1190 Ga0070668_100182409
1191 Ga0070669_100000217
1192 Ga0070669_100226474
1193 Ga0070675_100000088
1194 Ga0070675_100260527
1195 Ga0070675_100375653
1196 Ga0070675_100527369
1197 Ga0070671_100000768
1198 Ga0070671_100009332
1199 Ga0070671_100075563
1200 Ga0070671_100081683
1201 Ga0070671_100405405
1202 Ga0070671_100541185
1203 Ga0070674_100000623
1204 Ga0070674_100147460
1205 Ga0070674_100575237
1206 Ga0070673_100000239
1207 Ga0070673_100015583
1208 Ga0070673_100273089
1209 Ga0070688_100000084
1210 Ga0070688_100113737
1211 Ga0070659_100000252
1212 Ga0070659_100189056
1213 Ga0070659_100364017
1214 Ga0070667_100003023
1215 Ga0070667_100053625
1216 Ga0070667_100267990
1217 Ga0070703_10014545
1218 Ga0070709_10000855
1219 Ga0070709_10024849
1220 Ga0070709_10113782
1221 Ga0070709_10121633
1222 Ga0070709_10169231
1223 Ga0070714_100029733
1224 Ga0070714_100051256
1225 Ga0070714_100181610
1226 Ga0070714_100192969
1227 Ga0070714_100471989
1228 Ga0070714_100478018
1229 Ga0070713_100004731
1230 Ga0070713_100017656
1231 Ga0070713_100082945
1232 Ga0070710_10005088
1233 Ga0070710_10074114
1234 Ga0070701_10000123
1235 Ga0070711_100049857
1236 Ga0070711_100087399
1237 Ga0070711_100564669
1238 Ga0070705_100000425
1239 Ga0070705_100167617
1240 Ga0070700_100000370
1241 Ga0070700_100103200
1242 Ga0070700_100210196
1243 Ga0070694_100000401
1244 Ga0070694_100057633
1245 Ga0070708_100004439
1246 Ga0070708_100259148
1247 Ga0070708_100324350
1248 Ga0070663_100000415
1249 Ga0070663_100021614
1250 Ga0070663_100030699
1251 Ga0070663_100113586
1252 Ga0070663_100203995
1253 Ga0070678_100000053
1254 Ga0070678_100009449
1255 Ga0070678_100093664
1256 Ga0070662_100003931
1257 Ga0070662_100011655
1258 Ga0070662_100052752
1259 Ga0070662_100127715
1260 Ga0070681_10000493
1261 Ga0070681_10048975
1262 Ga0070681_10163411
1263 Ga0070681_10675002
1264 Ga0068867_100001581
1265 Ga0068867_100221007
1266 Ga0070685_10017206
1267 Ga0070679_100005631
1268 Ga0070679_100058723
1269 Ga0070679_100104483
1270 Ga0070679_100104990
1271 Ga0070679_100247957
1272 Ga0070679_100379206
1273 Ga0070684_100010354
1274 Ga0070684_100085580
1275 Ga0070684_100123706
1276 Ga0070684_100570957
1277 Ga0070697_100328785
1278 Ga0068853_100005864
1279 Ga0070672_100000014
1280 Ga0070672_100216713
1281 Ga0070672_100265402
1282 Ga0070672_100335519
1283 Ga0070686_100000754
1284 Ga0070686_100014000
1285 Ga0070686_100061154
1286 Ga0070686_100070670
1287 Ga0070695_100000743
1288 Ga0070695_100070169
1289 Ga0070695_100170359
1290 Ga0070696_100000918
1291 Ga0070696_100037902
1292 Ga0070693_100000141
1293 Ga0070693_100158494
1294 Ga0070693_100191458
1295 Ga0070693_100305363
1296 Ga0070665_100019687
1297 Ga0070665_100326210
1298 Ga0070665_100363516
1299 Ga0070665_100693443
1300 Ga0070704_100019420
1301 Ga0070704_100254263
1302 Ga0068855_100009106
1303 Ga0068855_100011304
1304 Ga0068855_100166621
1305 Ga0068855_100243917
1306 Ga0068855_100276365
1307 Ga0070664_100000816
1308 Ga0070664_100182779
1309 Ga0070664_100189122
1310 Ga0068857_100000567
1311 Ga0068857_100140358
1312 Ga0068854_100000168
1313 Ga0068854_100045835
1314 Ga0068854_100230453
1315 Ga0068856_100015543
1316 Ga0068856_100033238
1317 Ga0068856_100091613
1318 Ga0068856_100126264
1319 Ga0070702_100000857
1320 Ga0070702_100083296
1321 Ga0070702_100097380
1322 Ga0068852_100002066
1323 Ga0068852_100075443
1324 Ga0068852_100175185
1325 Ga0068859_100025021
1326 Ga0068859_100043742
1327 Ga0068859_100340926
1328 Ga0068864_100000980
1329 Ga0068864_100012023
1330 Ga0068866_10000264
1331 Ga0068861_100048215
1332 Ga0068861_100375101
1333 Ga0068870_10000002
1334 Ga0068870_10023276
1335 Ga0068863_100001290
1336 Ga0068863_100160400
1337 Ga0068863_100267996
1338 Ga0068858_100000356
1339 Ga0068858_100008336
1340 Ga0068858_100031420
1341 Ga0068858_100110588
1342 Ga0068860_100000747
1343 Ga0068860_100110091
1344 Ga0068860_100459002
1345 Ga0068862_100002002
1346 Ga0068862_100063239
1347 Ga0068862_100360193
1348 Ga0068862_100419162
1349 Ga0081455_10000048
1350 Ga0081455_10036386
1351 Ga0081455_10109094
1352 Ga0070717_10000150
1353 Ga0070717_10256933
1354 Ga0070717_10320379
1355 Ga0075365_10002448
1356 Ga0075365_10026234
1357 Ga0075432_10007512
1358 Ga0070715_10012192
1359 Ga0070716_100020197
1360 Ga0070716_100167516
1361 Ga0070712_100017131
1362 Ga0070712_100047906
1363 Ga0070712_100079311
1364 Ga0070712_100081094
1365 Ga0070712_100121889
1366 Ga0070712_100277761
1367 Ga0075367_10044499
1368 Ga0075427_10000042
1369 Ga0097621_100000144
1370 Ga0097621_100163371
1371 Ga0068871_100000110
1372 Ga0068871_100045891
1373 Ga0068871_100077839
1374 Ga0068871_100113826
1375 Ga0068871_100313925
1376 Ga0075428_100005798
1377 Ga0075430_100000627
1378 Ga0075431_100004676
1379 Ga0075433_10000615
1380 Ga0075433_10014612
1381 Ga0075433_10162511
1382 Ga0075434_100000084
1383 Ga0075434_100082669
1384 Ga0075434_100086680
1385 Ga0075434_100101394
1386 Ga0075434_100392587
1387 Ga0075434_100844731
1388 Ga0075429_100000877
1389 Ga0068865_100000066
1390 Ga0068865_100079566
1391 Ga0068865_100229896
1392 Ga0097620_100025020
1393 Ga0097620_100043743
1394 Ga0097620_100340966
1395 Ga0075435_100018081
1396 Ga0075435_100028762
1397 Ga0075435_100089495
1398 Ga0075435_100109690
1399 Ga0075435_100119375
1400 Ga0075435_100396347
1401 Ga0105251_10024513
1402 Ga0105250_10058608
1403 Ga0105240_10114236
1404 Ga0105240_10157229
1405 Ga0105240_10182013
1406 Ga0105240_10184284
1407 Ga0105240_10672126
1408 Ga0111539_10000423
1409 Ga0111539_10000652
1410 Ga0111539_10001255
1411 Ga0111539_10041376
1412 Ga0111539_10451752
1413 Ga0105245_10000287
1414 Ga0105245_10151112
1415 Ga0105245_10270117
1416 Ga0105245_10772030
1417 Ga0105245_10772031
1418 Ga0105247_10001223
1419 Ga0114129_10005652
1420 Ga0114129_10014653
1421 Ga0114129_10016700
1422 Ga0105243_10000695
1423 Ga0105243_10003814
1424 Ga0105243_10042456
1425 Ga0105243_10279702
1426 Ga0105241_10002331
1427 Ga0105241_10050152
1428 Ga0105241_10077871
1429 Ga0105241_10089324
1430 Ga0105241_10435075
1431 Ga0105242_10013046
1432 Ga0105242_10021242
1433 Ga0105242_10027855
1434 Ga0105242_10463740
1435 Ga0105248_10000535
1436 Ga0105248_10017864
1437 Ga0105248_10054802
1438 Ga0105248_10217704
1439 Ga0105248_10230495
1440 Ga0105237_10001499
1441 Ga0105237_10060545
1442 Ga0105238_10024354
1443 Ga0105238_10129759
1444 Ga0105238_10271473
1445 Ga0105249_10000279
1446 Ga0105249_10127265
1447 Ga0105249_10131049
1448 Ga0105249_10531674
1449 Ga0105239_10001686
1450 Ga0105239_10273347
1451 Ga0105239_10411292
1452 Ga0105239_10993354
1453 Ga0105246_10000095
1454 Ga0105246_10055476
1455 Ga0105246_10245586
1456 Ga0105246_10448086
1457 Ga0105246_10452299
1458 Ga0157345_1002874
1459 Ga0157347_1008400
1460 Ga0157373_10022698
1461 Ga0157371_10042162
1462 Ga0157370_10020087
1463 Ga0157370_10152263
1464 Ga0157370_10172208
1465 Ga0157369_10109236
1466 Ga0157369_10287426
1467 Ga0157374_10001348
1468 Ga0157374_10125535
1469 Ga0157374_10415715
1470 Ga0157378_10000956
1471 Ga0157378_10111481
1472 Ga0157378_10307366
1473 Ga0157378_10473048
1474 Ga0157378_10626880
1475 Ga0163162_10003174
1476 Ga0163162_10032167
1477 Ga0163162_10048100
1478 Ga0163162_10360605
1479 Ga0163162_10915450
1480 Ga0163162_11108907
1481 Ga0157372_10038947
1482 Ga0157372_10378267
1483 Ga0157372_10669520
1484 Ga0157375_10001973
1485 Ga0157375_10228127
1486 Ga0157375_10534860
1487 Ga0163163_10002399
1488 Ga0163163_10008535
1489 Ga0163163_10011378
1490 Ga0163163_10142726
1491 Ga0163163_10176916
1492 Ga0157380_10000052
1493 Ga0157380_10542621
1494 Ga0157380_10897278
1495 Ga0182008_10220955
1496 Ga0157377_10000076
1497 Ga0157377_10001911
1498 Ga0157377_10286769
1499 Ga0157379_10000060
1500 Ga0157379_10023835
1501 Ga0157379_10035407
1502 Ga0157379_10158119
1503 Ga0157376_10000141
1504 Ga0157376_10021304
1505 Ga0157376_10026235
1506 Ga0157376_10056864
1507 Ga0157376_10125466
1508 Ga0157376_10862517
1509 Ga0163161_10000739
1510 Ga0163161_10006741
1511 Ga0206353_10179351
1512 Ga0213876_10006713
1513 Ga0213876_10232052
1514 Ga0213875_10032870
1515 Ga0209233_1019457
1516 Ga0207666_1000005
1517 Ga0207673_1000211
1518 Ga0207697_10000011
1519 Ga0207696_1038787
1520 Ga0207713_1070490
1521 Ga0207682_10000332
1522 Ga0207692_10001915
1523 Ga0207692_10020267
1524 Ga0207692_10070486
1525 Ga0207642_10000176
1526 Ga0207710_10007209
1527 Ga0207710_10013629
1528 Ga0207688_10000001
1529 Ga0207688_10027120
1530 Ga0207680_10027835
1531 Ga0207680_10236085
1532 Ga0207647_10001714
1533 Ga0207647_10125880
1534 Ga0207699_10042390
1535 Ga0207699_10120248
1536 Ga0207699_10155970
1537 Ga0207645_10001831
1538 Ga0207645_10023006
1539 Ga0207645_10155368
1540 Ga0207645_10204363
1541 Ga0207643_10000009
1542 Ga0207643_10022969
1543 Ga0207705_10045462
1544 Ga0207705_10131472
1545 Ga0207705_10204139
1546 Ga0207654_10001894
1547 Ga0207654_10033396
1548 Ga0207654_10037929
1549 Ga0207707_10000840
1550 Ga0207707_10044915
1551 Ga0207707_10051775
1552 Ga0207707_10093874
1553 Ga0207707_10338233
1554 Ga0207695_10075974
1555 Ga0207695_10095483
1556 Ga0207695_10338077
1557 Ga0207671_10075409
1558 Ga0207671_10127891
1559 Ga0207693_10012127
1560 Ga0207693_10012139
1561 Ga0207693_10133351
1562 Ga0207693_10166025
1563 Ga0207693_10204019
1564 Ga0207663_10005694
1565 Ga0207663_10012585
1566 Ga0207663_10068424
1567 Ga0207663_10198315
1568 Ga0207660_10000775
1569 Ga0207660_10038650
1570 Ga0207660_10063567
1571 Ga0207660_10335304
1572 Ga0207662_10000645
1573 Ga0207657_10004673
1574 Ga0207657_10009807
1575 Ga0207657_10086831
1576 Ga0207657_10098755
1577 Ga0207657_10140684
1578 Ga0207657_10150638
1579 Ga0207657_10368191
1580 Ga0207649_10000052
1581 Ga0207649_10082132
1582 Ga0207649_10104150
1583 Ga0207652_10000508
1584 Ga0207652_10042874
1585 Ga0207652_10099968
1586 Ga0207652_10141852
1587 Ga0207652_10241182
1588 Ga0207681_10000035
1589 Ga0207681_10216857
1590 Ga0207694_10013689
1591 Ga0207694_10280026
1592 Ga0207694_10613509
1593 Ga0207650_10004006
1594 Ga0207650_10029712
1595 Ga0207650_10152127
1596 Ga0207659_10000027
1597 Ga0207659_10062431
1598 Ga0207659_10516412
1599 Ga0207687_10000231
1600 Ga0207687_10121439
1601 Ga0207687_10269396
1602 Ga0207700_10000917
1603 Ga0207700_10018837
1604 Ga0207664_10050032
1605 Ga0207664_10068903
1606 Ga0207664_10160417
1607 Ga0207664_10238850
1608 Ga0207644_10000676
1609 Ga0207644_10001814
1610 Ga0207644_10277087
1611 Ga0207690_10000148
1612 Ga0207690_10005705
1613 Ga0207690_10272583
1614 Ga0207706_10000261
1615 Ga0207706_10009549
1616 Ga0207706_10011544
1617 Ga0207706_10079975
1618 Ga0207706_10091374
1619 Ga0207686_10000171
1620 Ga0207686_10142585
1621 Ga0207686_10177549
1622 Ga0207709_10000087
1623 Ga0207709_10338600
1624 Ga0207670_10000169
1625 Ga0207670_10061140
1626 Ga0207670_10084942
1627 Ga0207669_10000351
1628 Ga0207704_10000392
1629 Ga0207704_10080565
1630 Ga0207665_10006980
1631 Ga0207665_10014334
1632 Ga0207691_10000106
1633 Ga0207691_10003240
1634 Ga0207691_10276908
1635 Ga0207691_10339613
1636 Ga0207711_10002556
1637 Ga0207711_10190386
1638 Ga0207689_10000031
1639 Ga0207689_10058339
1640 Ga0207661_10000219
1641 Ga0207661_10042920
1642 Ga0207661_10219707
1643 Ga0207661_10356449
1644 Ga0207679_10000493
1645 Ga0207679_10208995
1646 Ga0207667_10006216
1647 Ga0207667_10056791
1648 Ga0207667_10135517
1649 Ga0207667_10253791
1650 Ga0207667_10396727
1651 Ga0207651_10001402
1652 Ga0207651_10042171
1653 Ga0207651_10109644
1654 Ga0207712_10000176
1655 Ga0207712_10084235
1656 Ga0207668_10000191
1657 Ga0207640_10000126
1658 Ga0207640_10048911
1659 Ga0207658_10007487
1660 Ga0207658_10039587
1661 Ga0207658_10146888
1662 Ga0207658_10158151
1663 Ga0207658_10467002
1664 Ga0207677_10008615
1665 Ga0207677_10011116
1666 Ga0207703_10006871
1667 Ga0207639_10000515
1668 Ga0207639_10153092
1669 Ga0207639_10297240
1670 Ga0207678_10003344
1671 Ga0207678_10018565
1672 Ga0207678_10130554
1673 Ga0207708_10002176
1674 Ga0207708_10004315
1675 Ga0207708_10005555
1676 Ga0207708_10058968
1677 Ga0207708_10519634
1678 Ga0207702_10093843
1679 Ga0207702_10127863
1680 Ga0207702_10161072
1681 Ga0207702_10166863
1682 Ga0207702_10174061
1683 Ga0207702_10201285
1684 Ga0207702_10716468
1685 Ga0207641_10000937
1686 Ga0207641_10319240
1687 Ga0207648_10000125
1688 Ga0207648_10004855
1689 Ga0207648_10101634
1690 Ga0207676_10001547
1691 Ga0207676_10021875
1692 Ga0207674_10000095
1693 Ga0207674_10037855
1694 Ga0207674_10277435
1695 Ga0207674_10510457
1696 Ga0207675_100000140
1697 Ga0207675_100178450
1698 Ga0207683_10000178
1699 Ga0207683_10001447
1700 Ga0207683_10006604
1701 Ga0207683_10093752
1702 Ga0207698_10055129
1703 Ga0207698_10179775
1704 Ga0210002_1010222
1705 Ga0209998_10001420
1706 Ga0209998_10007968
1707 Ga0209974_10001253
1708 Ga0207428_10000037
1709 Ga0207428_10000188
1710 Ga0207428_10001468
1711 Ga0207428_10208475
1712 Ga0268266_10058547
1713 Ga0268266_10072157
1714 Ga0268265_10003265
1715 Ga0268265_10210048
1716 Ga0268264_10000467
1717 Ga0268264_10146328
1718 Ga0268264_10621572
1719 Ga0265318_10028860
1720 Ga0265338_10109014
1721 Ga0265330_10011740
1722 Ga0265325_10000049
1723 Ga0265325_10026895
1724 Ga0265325_10104861
1725 Ga0265340_10008615
1726 Ga0265340_10010149
1727 Ga0265339_10008341
1728 Ga0265313_10000367
1729 Ga0265313_10016043
1730 Ga0265313_10023470
1731 Ga0316579_10029032
1732 Ga0265314_10002604
1733 Ga0265314_10080527
1734 Ga0265342_10000131
1735 Ga0265342_10043803
1736 Ga0373930_0004830
1737 Ga0373948_0000573
1738 Ga0373948_0008845
1739 Ga0373948_0013917
1740 Ga0373950_0008136
1741 Ga0373958_0002000
1742 Ga0373958_0005551
1743 Ga0373959_0008049
1744 Ga0373938_0001280
1745 Ga0373938_0001567
1746 Ga0373926_0059285
1747 Ga0373928_0000298
1748 Ga0373928_0001394
1749 Ga0373929_0001337
1750 Ga0373929_0003771
1751 Ga0373929_0009503
1752 Ga0373934_0071793
1753 Ga0373940_0000080
1754 Ga0373944_0005697
1755 Ga0373944_0036995
1756 Ga0373949_0000470
1757 Ga0373949_0001211
1758 Ga0373949_0004945
1759 Ga0373949_0015141
1760 Ga0373951_0001678
1761 Ga0373951_0003802
1762 Ga0373952_0001024
1763 Ga0373952_0003807
1764 Ga0373923_0062601
1765 Ga0373932_0004055
1766 Ga0373932_0013240
1767 Ga0373932_0019612
1768 Ga0373932_0022936
1769 Ga0373936_0008887
1770 Ga0373936_0014438
1771 Ga0373936_0064415
1772 Ga0373939_0002126
1773 Ga0373939_0045719
1774 Ga0373941_0002163
1775 Ga0373941_0002809
1776 Ga0373945_0006376
1777 Ga0373945_0007998
1778 Ga0373945_0009643
1779 Ga0373945_0013167
1780 Ga0373953_0001317
1781 Ga0373953_0065362
1782 Ga0373954_0017961
1783 Ga0373956_0056276
1784 Ga0373956_0135016
1785 Ga0373957_0041803
1786 Ga0373960_0001537
1787 Ga0373960_0001555
1788 Ga0373960_0005815
1789 Ga0373960_0044318
1790 Ga0373943_0005425
1791 Ga0373943_0090690
1792 Ga0373946_0005557
1793 Ga0373946_0056845
1794 Ga0373955_0021578
1795 Ga0373955_0023579
1796 Ga0373955_0117434
1797 Ga0373942_0001029
1798 Ga0373942_0001201
1799 Ga0373942_0024547
1800 Ga0373961_0003450
1801 Ga0373961_0024002
1802 Ga0373962_0002652
1803 Ga0373962_0016004
1804 Ga0373962_0029953
1805 Ga0373924_0024148
1806 Ga0373931_0007106
1807 Ga0373931_0015678
1808 Ga0373931_0036025
1809 Ga0373931_0059714
1810 Ga0373931_0064570
1811 Ga0373931_0171393
1812 Ga0373935_0019509
1813 Ga0373935_0075913
1814 Ga0373935_0202191
1815 Ga0373927_0041744
1816 Ga0373927_0169372
1817 Ga0373933_0018347
1818 Ga0373933_0039204
1819 Ga0373933_0047510
1820 Ga0373947_0002717
1821 Ga0373947_0004057
1822 Ga0373947_0004916
1823 Ga0373937_0163301
1824 Ga0373937_0324524
1825 Ga0373925_0004221
1826 Ga0373925_0019424
1827 Ga0373925_0150943
1828 Ga0373925_0292983
1829 Ga0436364_0615504
1830 Ga0436364_0857978
1831 Ga0436364_0907772
1832 Ga0395901_0418326
1833 Ga0436365_0663409
1834 Ga0436365_1143395
1835 Ga0439437_012409
1836 Ga0439450_016535
1837 Ga0439455_0035143
1838 Ga0439464_0011066
1839 Ga0453684_0079918
1840 Ga0466971_0040592
1841 Ga0451576_0033526
1842 Ga0495617_023457
1843 Ga0495592_0109182
1844 Ga0495592_0141022
1845 Ga0495592_0226694
1846 Ga0495603_0003594
1847 Ga0495603_0013678
1848 Ga0495603_0055086
1849 Ga0495603_0071018
1850 Ga0495603_0079680
1851 Ga0495603_0273626
1852 Ga0495590_0056108
1853 Ga0495629_0000269
1854 Ga0495629_0023056
1855 Ga0495629_0049305
1856 Ga0495638_0193721
1857 Ga0495651_0007532
1858 Ga0495651_0080911
1859 Ga0495651_0114392
1860 Ga0495653_0035845
1861 Ga0495653_0172577
1862 Ga0495653_0185576
1863 Ga0495580_0009185
1864 Ga0495580_0009445
1865 Ga0495580_0071534
1866 Ga0495580_0082936
1867 Ga0495582_0016677
1868 Ga0495582_0020095
1869 Ga0495582_0280407
1870 Ga0495605_0059533
1871 Ga0495639_0065081
1872 Ga0495662_0073420
1873 Ga0495664_0020688
1874 Ga0495584_0036956
1875 Ga0495585_0006605
1876 Ga0495585_0059774
1877 Ga0495594_0004830
1878 Ga0495594_0045852
1879 Ga0495594_0047164
1880 Ga0495607_0018075
1881 Ga0495583_0074909
1882 Ga0495608_0001268
1883 Ga0495608_0030282
1884 Ga0495608_0033948
1885 Ga0495608_0256603
1886 Ga0495618_0028539
1887 Ga0495618_0215509
1888 Ga0495628_0028500
1889 Ga0495628_0057215
1890 Ga0495628_0078789
1891 Ga0495630_0174739
1892 Ga0495631_0045516
1893 Ga0495632_0039255
1894 Ga0495644_0001996
1895 Ga0495666_0032197
1896 Ga0495642_0054101
1897 Ga0495652_0030704
1898 Ga0495652_0077110
1899 Ga0495652_0095962
1900 Ga0495640_0002019
1901 Ga0495640_0008735
1902 Ga0495640_0138826
1903 Ga0495586_0108046
1904 Ga0495587_0000620
1905 Ga0495587_0037944
1906 Ga0495587_0092138
1907 Ga0495598_0001380
1908 Ga0495598_0005318
1909 Ga0495598_0021021
1910 Ga0495645_0000640
1911 Ga0495645_0075824
1912 Ga0495622_0010250
1913 Ga0495622_0088991
1914 Ga0495633_0054001
1915 Ga0495667_0001254
1916 Ga0495667_0041608
1917 Ga0495656_0043604
1918 Ga0495634_0021860
1919 Ga0495634_0127179
1920 Ga0495635_0052540
1921 Ga0495635_0054794
1922 Ga0495659_0003206
1923 Ga0495661_0120176
1924 Ga0495588_0038087
1925 Ga0495657_0012096
1926 Ga0495657_0050495
1927 Ga0495657_0098151
1928 Ga0495657_0235905
1929 Ga0495599_0097738
1930 Ga0495599_0153477
1931 Ga0495599_0280465
1932 Ga0495646_0076963
1933 Ga0495646_0133887
1934 Ga0495647_0003055
1935 Ga0495647_0008588
1936 Ga0495647_0045895
1937 Ga0495658_0000762
1938 Ga0495658_0023837
1939 Ga0495658_0024491
1940 Ga0495658_0028009
1941 Ga0495658_0086269
1942 Ga0495669_0004555
1943 Ga0495669_0080388
1944 Ga0495613_0001384
1945 Ga0495613_0063564
1946 Ga0495613_0091126
1947 Ga0495624_0118510
1948 Ga0495624_0291068
1949 Ga0495670_0003495
1950 Ga0495670_0015860
1951 Ga0495671_0022017
1952 Ga0495589_0029287
1953 Ga0495589_0035660
1954 Ga0495589_0042440
1955 Ga0495600_0043323
1956 Ga0495581_0021839
1957 Ga0495581_0065239
1958 Ga0495581_0073089
1959 Ga0495581_0193860
1960 Ga0495604_0082001
1961 Ga0495674_0013976
1962 Ga0495674_0018881
1963 Ga0495676_0045000
1964 Ga0495676_0051640
1965 Ga0495676_0068514
1966 Ga0495680_0001472
1967 Ga0495680_0013659
1968 Ga0495680_0020287
1969 Ga0495680_0029631
1970 Ga0495680_0091982
1971 Ga0495680_0185171
1972 Ga0495675_0003746
1973 Ga0495679_019911
1974 Ga0495684_0041682
1975 Ga0495684_0308218
1976 Ga0495593_0048089
1977 Ga0495593_0064186
1978 Ga0495593_0072585
1979 Ga0495602_0002664
1980 Ga0495602_0115545
1981 Ga0495602_0302985
1982 Ga0495614_0013503
1983 Ga0495614_0112712
1984 Ga0495614_0134943
1985 Ga0496100_0000400
1986 Ga0496100_0016309
1987 Ga0496100_0018627
1988 Ga0496101_0000151
1989 Ga0496101_0008813
1990 Ga0496101_0010331
1991 Ga0496101_0065475
1992 Ga0496101_0081444
1993 Ga0496101_0084728
1994 Ga0496101_0126706
1995 Ga0496101_0140407
1996 Ga0496102_0002633
1997 Ga0496102_0005538
1998 Ga0496102_0020449
1999 Ga0496102_0093373
2000 Ga0496102_0308265
2001 Ga0496102_0353022
2002 Ga0496103_0000589
2003 Ga0496103_0013289
2004 Ga0496103_0204934
2005 Ga0496104_0000215
2006 Ga0496104_0000495
2007 Ga0496104_0011067
2008 Ga0496104_0023324
2009 Ga0496104_0023761
2010 Ga0496104_0128558
2011 Ga0496104_0345943
2012 Ga0496105_0007307
2013 Ga0496105_0016050
2014 Ga0496105_0031047
2015 Ga0496105_0068612
2016 Ga0496105_0216143
2017 Ga0496106_0005086
2018 Ga0496106_0005428
2019 Ga0496106_0013672
2020 Ga0496106_0237676
2021 Ga0496107_0000959
2022 Ga0496107_0014487
2023 Ga0496107_0232589
2024 Ga0496107_0258068
2025 Ga0496108_0001228
2026 Ga0496108_0004314
2027 Ga0496108_0008895
2028 Ga0496108_0126358
2029 Ga0496108_0382756
2030 Ga0496108_0429557
2031 Ga0496108_0446066
2032 Ga0496108_0716046
2033 Ga0496109_0001567
2034 Ga0496109_0001702
2035 Ga0496109_0011935
2036 Ga0496109_0012979
2037 Ga0496109_0069272
2038 Ga0496109_0359065
2039 Ga0496110_0000540
2040 Ga0496110_0003055
2041 Ga0496110_0014154
2042 Ga0496110_0026449
2043 Ga0496110_0097739
2044 Ga0496110_0109076
2045 Ga0496110_0133039
2046 Ga0496111_0013301
2047 Ga0496111_0015042
2048 Ga0496111_0059527
2049 Ga0496111_0105553
2050 Ga0496111_0125455
2051 Ga0496112_0001465
2052 Ga0496112_0016056
2053 Ga0496112_0049192
2054 Ga0496112_0115939
2055 Ga0496112_0314659
2056 Ga0496113_0001102
2057 Ga0496113_0001787
2058 Ga0496113_0009826
2059 Ga0496113_0038078
2060 Ga0496113_0065445
2061 Ga0496113_0220815
2062 Ga0496113_0247630
2063 Ga0496113_0482096
2064 Ga0496114_0005496
2065 Ga0496114_0054545
2066 Ga0496114_0197631
2067 Ga0496115_0002326
2068 Ga0496115_0010696
2069 Ga0496115_0018857
2070 Ga0496115_0110557
2071 Ga0496115_0136026
2072 Ga0496126_0083241
2073 Ga0501031_0143396
2074 Ga0501032_0046233
2075 Ga0501033_0001317
2076 Ga0501033_0096227
2077 Ga0501034_0024355
2078 Ga0501034_0031258
2079 Ga0501034_0127163
2080 Ga0501034_0259797
2081 Ga0501034_0522080
2082 Ga0501034_0529278
2083 Ga0501036_0001725
2084 Ga0501036_0025685
2085 Ga0501036_0032950
2086 Ga0501036_0163636
2087 Ga0501036_0347168
2088 Ga0501037_0013915
2089 Ga0501037_0015078
2090 Ga0501037_0088098
2091 Ga0501037_0109960
2092 Ga0501038_0007569
2093 Ga0501038_0022847
2094 Ga0501038_0452097
2095 Ga0501039_0024187
2096 Ga0501039_0158686
2097 Ga0501042_0249298
2098 Ga0501043_0017342
2099 Ga0501043_0091370
2100 Ga0501043_0222532
2101 Ga0501043_0230540
2102 Ga0501046_0113928
2103 Ga0501047_0000235
2104 Ga0501047_0034834
2105 Ga0501047_0056705
2106 Ga0501047_0185000
2107 Ga0501047_0201780
2108 Ga0501047_0253717
2109 Ga0501047_0271877
2110 Ga0501048_0001647
2111 Ga0501048_0019321
2112 Ga0501048_0194074
2113 Ga0501067_0102715
2114 Ga0501067_0147741
2115 Ga0501068_0099157
2116 Ga0501069_0039688
2117 Ga0501069_0041814
2118 Ga0501070_0029936
2119 Ga0501070_0034556
2120 Ga0501070_0051376
2121 Ga0501070_0063362
2122 Ga0501070_0101978
2123 Ga0501070_0168561
2124 Ga0501070_0223134
2125 Ga0501070_0313662
2126 Ga0501071_0122946
2127 Ga0501071_0137884
2128 Ga0501071_0520352
2129 Ga0501072_0158128
2130 Ga0501073_0014326
2131 Ga0501073_0041016
2132 Ga0501073_0061401
2133 Ga0501073_0139677
2134 Ga0501073_0404420
2135 Ga0501074_0025365
2136 Ga0501074_0035472
2137 Ga0501074_0048058
2138 Ga0501074_0068742
2139 Ga0501074_0170314
2140 Ga0501076_0021925
2141 Ga0501077_0032307
2142 Ga0501077_0144974
2143 Ga0501079_0006960
2144 Ga0501079_0049087
2145 Ga0501080_0000409
2146 Ga0501080_0010799
2147 Ga0501080_0011504
2148 Ga0501080_0053928
2149 Ga0501083_0016908
2150 Ga0501083_0097255
2151 Ga0501083_0105536
2152 Ga0501083_0304519
2153 Ga0501035_0001984
2154 Ga0501035_0003589
2155 Ga0501035_0014410
2156 Ga0501035_0023515
2157 Ga0501035_0051572
2158 Ga0501035_0310819
2159 Ga0501044_0009294
2160 Ga0501044_0136902
2161 Ga0501044_0197710
2162 Ga0501044_0200747
2163 Ga0501044_0215828
2164 Ga0501044_0317166
2165 nmdc:mga0yw44_120814_c1
2166 nmdc:mga0yw44_19836_c1
2167 nmdc:mga0yw44_2230_c1
2168 nmdc:mga06z11_37376_c1
2169 nmdc:mga07m45_25395_c1
2170 nmdc:mga05p37_1888_c1
2171 nmdc:mga05p37_2212_c1
2172 nmdc:mga05p37_315514_c1
2173 nmdc:mga09592_1729_c1
2174 nmdc:mga09592_274670_c1
2175 nmdc:mga0qj67_2690_c1
2176 nmdc:mga06r32_18400_c1
2177 nmdc:mga08y16_178686_c1
2178 nmdc:mga08y16_27251_c1
2179 nmdc:mga08y16_311_c1
2180 nmdc:mga08y16_5010_c1
2181 nmdc:mga0n895_1869_c1
2182 nmdc:mga0n895_21771_c1
2183 nmdc:mga0n895_373568_c1
2184 nmdc:mga0n895_455195_c1
2185 nmdc:mga0n895_62_c1
2186 nmdc:mga0n895_68658_c1
2187 nmdc:mga0n895_748976_c1
2188 nmdc:mga0rr50_25217_c1
2189 nmdc:mga0rr50_80666_c1
2190 nmdc:mga08x19_280104_c1
2191 nmdc:mga0a205_1191_c1
2192 nmdc:mga0a205_29763_c1
2193 nmdc:mga0a205_58781_c1
2194 nmdc:mga0a205_78059_c1
2195 Ga0495601_0006785
2196 Ga0495601_0010538
2197 Ga0495601_0017856
2198 Ga0495601_0047580
2199 Ga0495601_0093654
2200 Ga0495601_0131282
2201 Ga0495601_0152775
2202 Ga0495601_0230535
2203 Ga0495612_0005219
2204 Ga0495612_0006433
2205 Ga0495612_0052969
2206 Ga0495595_0001369
2207 Ga0495595_0002003
2208 Ga0495595_0025646
2209 Ga0495619_0000289
2210 Ga0495619_0000662
2211 Ga0495619_0027020
2212 Ga0495619_0028745
2213 Ga0495619_0044446
2214 Ga0495619_0111061
2215 Ga0495619_0186720
2216 Ga0500643_005637
2217 Ga0500644_0000980
2218 Ga0500566_0117057
2219 Ga0500650_0007014
2220 Ga0500595_000016
2221 Ga0500616_0000006
2222 Ga0500645_000033
2223 Ga0501084_0099687
2224 Ga0501084_0222733
2225 Ga0501082_0038565
2226 Ga0501082_0190333
2227 Ga0501082_0363880
2228 2643755880

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03239

FTR1

Iron permease FTR1 family

24

287

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8dwi-assembly1.cif.gz_A molecular mechanism of sialic acid transport mediated by sialin 0.4523 2 231
6zgu-assembly2.cif.gz_B crystal structure of a mfs transporter with bound 3-(2-methylphenyl)propanoic acid at 2.41 angstroem resolution 0.4389 2 201
8dwi-assembly1.cif.gz_A molecular mechanism of sialic acid transport mediated by sialin 0.3533 2 231
4iu9-assembly2.cif.gz_A crystal structure of a membrane transporter 0.3399 3 264
7nqk-assembly1.cif.gz_A cryo-em structure of the mammalian peptide transporter pept2 0.3378 1 199
ID Description Score Start End Superfamily
af_C6KSY4_77_351_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5663 3 193 1.20.1250.20
af_C0RSI9_6_184_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5358 3 199 1.20.1250.20
af_Q2FVB9_1_200_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5235 3 194 1.20.1250.20
af_P17583_1_184_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5207 5 199 1.20.1250.20
af_C0RSI9_6_184_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5131 3 199 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A3M1VVU0-F1-model_v4 Iron permease 0.9518 1 267 GO:0015093
GO:0033573
AF-A0A1J4VN90-F1-model_v4 Iron permease 0.9474 1 262 GO:0015093
GO:0033573
AF-A0A536TFK8-F1-model_v4 Iron permease 0.9472 1 253 GO:0015093
GO:0033573
AF-K2CI29-F1-model_v4 Iron permease 0.9465 1 264 GO:0015093
GO:0033573
AF-A0A7Y8B6T5-F1-model_v4 deleted 0.9443 1 165

Map