F490293
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1115 | 447 | 2230 | 217 |
Family's Representative Sequence
| Representative Sequence | 3300025927|Ga0207687_10392750|Ga0207687_103927501 |
| Length | 247 |
| Sequence | VNLDWSIVWIHRADLLHGALLTVLLTVLTMAVAVPAGIVLALMRLSNSKPLAFASQCFVEFFRNLPLILVVYWAFYVMPVLLHIEFSAFTTGLVALCLNVSAYNAETFRAGINSIRKGQMEAAVAIGMSRWQAMKQIIVPQAWRRVLPVLASTWVSLFKDTSLVSVIAVGELAHVALQIRSQSFRVLEMLTAMAVIYWLMGYPQAKLVDWIQKRFEVSLQRGIFVAGSLASATLFAHTSGCQRSGIL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 3 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 4 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 5 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 7 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 8 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 9 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 10 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 11 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 12 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 16 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 18 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 26 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 30 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 56 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 65 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 73 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 75 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 76 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 77 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 79 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 80 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 81 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 82 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 83 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 84 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 85 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 86 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 87 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 88 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 89 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 91 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 92 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 93 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 96 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 97 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 98 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 99 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 101 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 102 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 103 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 104 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 105 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 106 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 107 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 108 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 109 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 110 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 112 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 113 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 114 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 115 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 131 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 143 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 147 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 148 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 149 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 152 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 153 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 154 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 158 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 161 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 234 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 236 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 240 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 241 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 242 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 243 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 244 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 245 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 246 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 247 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 248 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 249 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 250 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 251 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 252 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 253 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 254 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 255 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 256 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 257 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 258 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 259 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 260 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 261 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 262 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 263 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 264 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 265 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 266 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 267 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 268 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 269 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 270 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 271 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 272 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 273 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 274 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 275 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 276 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 277 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 278 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 279 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 280 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 281 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 282 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 283 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 284 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 285 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 286 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 287 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 288 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 289 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 290 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 291 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 292 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 293 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 294 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 295 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 350 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 351 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 352 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 353 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 354 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 355 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 356 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 357 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 358 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 359 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 360 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 361 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 362 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 363 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 364 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 365 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 366 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 367 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 368 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 369 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 370 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 371 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 372 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 373 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 374 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 375 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 383 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 384 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 385 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 386 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 387 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 388 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 398 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 400 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 402 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 403 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 404 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 405 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 406 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 407 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 408 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 409 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 410 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 411 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 412 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 413 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 414 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 415 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 416 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 417 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 418 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 419 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 420 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 421 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 422 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 423 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 424 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 425 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 426 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 427 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 428 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 429 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 430 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 431 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 432 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 433 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 434 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 435 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 436 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 437 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 438 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 439 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 440 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 441 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 442 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 443 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 444 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 445 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 446 | 2941479691 | |||
| 447 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.21 |
| Metatranscriptomes | 0 |
| Isolates | 1.79 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.67 |
| Nodule | 0.54 |
| Rhizoplane | 4.48 |
| Rhizosphere | 79.28 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.08 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207687_10392750 | 3300025927 | Bacteria | 1139 |
| 2 | JGI25159J45721_1008928 | 3300002987 | Bacteria | 2695 |
| 3 | JGI25151J46595_10000460 | 3300003187 | Bacteria | 39097 |
| 4 | JGI25153J46596_10000228 | 3300003215 | Bacteria | 47831 |
| 5 | JGI25160J50197_1004251 | 3300003354 | Bacteria | 6216 |
| 6 | JGI25161J50226_1001723 | 3300003374 | Bacteria | 6211 |
| 7 | Ga0055529_1000705 | 3300003763 | Bacteria | 22343 |
| 8 | Ga0055537_1000190 | 3300003773 | Bacteria | 45820 |
| 9 | Ga0055536_1004906 | 3300003781 | Bacteria | 6678 |
| 10 | Ga0055534_1000244 | 3300003784 | Bacteria | 38722 |
| 11 | Ga0055534_1010940 | 3300003784 | Bacteria | 1869 |
| 12 | Ga0055528_1000244 | 3300003790 | Bacteria | 45820 |
| 13 | Ga0055528_1002980 | 3300003790 | Bacteria | 8771 |
| 14 | Ga0055540_1000365 | 3300003792 | Bacteria | 38078 |
| 15 | Ga0055540_1003214 | 3300003792 | Bacteria | 8018 |
| 16 | Ga0055531_10000454 | 3300003794 | Bacteria | 38078 |
| 17 | Ga0055543_1002319 | 3300004625 | Bacteria | 6384 |
| 18 | Ga0065165_1003670 | 3300005262 | Bacteria | 10463 |
| 19 | Ga0065165_1006190 | 3300005262 | Bacteria | 6384 |
| 20 | Ga0065714_10079601 | 3300005288 | Bacteria | 2478 |
| 21 | Ga0065714_10128417 | 3300005288 | Bacteria | 1273 |
| 22 | Ga0065712_10139642 | 3300005290 | Bacteria | 1462 |
| 23 | Ga0065715_10029996 | 3300005293 | Bacteria | 1544 |
| 24 | Ga0070658_10023452 | 3300005327 | Bacteria | 4952 |
| 25 | Ga0070658_10085564 | 3300005327 | Bacteria | 2593 |
| 26 | Ga0070658_10087738 | 3300005327 | Bacteria | 2561 |
| 27 | Ga0070658_10366548 | 3300005327 | Bacteria | 1234 |
| 28 | Ga0070676_10000429 | 3300005328 | Bacteria | 19932 |
| 29 | Ga0070676_10080157 | 3300005328 | Bacteria | 1978 |
| 30 | Ga0070676_10582460 | 3300005328 | Unclassified | 805 |
| 31 | Ga0070683_100017860 | 3300005329 | Bacteria | 6270 |
| 32 | Ga0070683_100118762 | 3300005329 | Bacteria | 2497 |
| 33 | Ga0070690_100047354 | 3300005330 | Bacteria | 2735 |
| 34 | Ga0070690_100213023 | 3300005330 | Bacteria | 1350 |
| 35 | Ga0070670_100015560 | 3300005331 | Bacteria | 6534 |
| 36 | Ga0070670_100061667 | 3300005331 | Bacteria | 3218 |
| 37 | Ga0070670_100108358 | 3300005331 | Bacteria | 2393 |
| 38 | Ga0070670_100227560 | 3300005331 | Bacteria | 1623 |
| 39 | Ga0070670_100579029 | 3300005331 | Bacteria | 1003 |
| 40 | Ga0070677_10000318 | 3300005333 | Bacteria | 16823 |
| 41 | Ga0070677_10090197 | 3300005333 | Bacteria | 1331 |
| 42 | Ga0070677_10255358 | 3300005333 | Unclassified | 872 |
| 43 | Ga0068869_100011628 | 3300005334 | Bacteria | 5781 |
| 44 | Ga0068869_100014878 | 3300005334 | Bacteria | 5202 |
| 45 | Ga0068869_100023109 | 3300005334 | Bacteria | 4290 |
| 46 | Ga0068869_100035853 | 3300005334 | Bacteria | 3519 |
| 47 | Ga0068869_100279164 | 3300005334 | Bacteria | 1343 |
| 48 | Ga0068869_100310054 | 3300005334 | Bacteria | 1277 |
| 49 | Ga0068869_100324701 | 3300005334 | Bacteria | 1249 |
| 50 | Ga0070666_10001248 | 3300005335 | Bacteria | 15392 |
| 51 | Ga0070666_10021254 | 3300005335 | Bacteria | 4204 |
| 52 | Ga0070666_10149192 | 3300005335 | Bacteria | 1631 |
| 53 | Ga0070680_100114148 | 3300005336 | Bacteria | 2250 |
| 54 | Ga0070682_100088725 | 3300005337 | Bacteria | 2019 |
| 55 | Ga0068868_100006699 | 3300005338 | Bacteria | 8174 |
| 56 | Ga0068868_100006918 | 3300005338 | Bacteria | 8059 |
| 57 | Ga0068868_100008681 | 3300005338 | Bacteria | 7277 |
| 58 | Ga0070660_100014237 | 3300005339 | Bacteria | 5728 |
| 59 | Ga0070689_100010843 | 3300005340 | Bacteria | 6513 |
| 60 | Ga0070687_100049122 | 3300005343 | Bacteria | 2173 |
| 61 | Ga0070661_100002482 | 3300005344 | Bacteria | 12643 |
| 62 | Ga0070661_100067497 | 3300005344 | Bacteria | 2628 |
| 63 | Ga0070661_100134314 | 3300005344 | Bacteria | 1860 |
| 64 | Ga0070661_100307813 | 3300005344 | Bacteria | 1235 |
| 65 | Ga0070692_10160889 | 3300005345 | Bacteria | 1286 |
| 66 | Ga0070668_100000600 | 3300005347 | Bacteria | 24135 |
| 67 | Ga0070668_100010699 | 3300005347 | Bacteria | 6823 |
| 68 | Ga0070668_100013049 | 3300005347 | Bacteria | 6189 |
| 69 | Ga0070668_100078656 | 3300005347 | Bacteria | 2580 |
| 70 | Ga0070668_100104229 | 3300005347 | Bacteria | 2251 |
| 71 | Ga0070668_100210502 | 3300005347 | Bacteria | 1599 |
| 72 | Ga0070668_100281157 | 3300005347 | Bacteria | 1390 |
| 73 | Ga0070669_100037985 | 3300005353 | Bacteria | 3495 |
| 74 | Ga0070669_100063953 | 3300005353 | Bacteria | 2709 |
| 75 | Ga0070669_100084149 | 3300005353 | Bacteria | 2373 |
| 76 | Ga0070669_100113971 | 3300005353 | Bacteria | 2055 |
| 77 | Ga0070669_100267640 | 3300005353 | Bacteria | 1365 |
| 78 | Ga0070669_100287944 | 3300005353 | Bacteria | 1318 |
| 79 | Ga0070675_100012243 | 3300005354 | Bacteria | 6723 |
| 80 | Ga0070675_100012605 | 3300005354 | Bacteria | 6630 |
| 81 | Ga0070675_100073164 | 3300005354 | Bacteria | 2845 |
| 82 | Ga0070675_100089289 | 3300005354 | Bacteria | 2580 |
| 83 | Ga0070675_100455744 | 3300005354 | Bacteria | 1147 |
| 84 | Ga0070671_100006670 | 3300005355 | Bacteria | 9230 |
| 85 | Ga0070671_100025462 | 3300005355 | Bacteria | 4855 |
| 86 | Ga0070671_100054790 | 3300005355 | Bacteria | 3316 |
| 87 | Ga0070671_100061058 | 3300005355 | Bacteria | 3139 |
| 88 | Ga0070671_100099246 | 3300005355 | Bacteria | 2442 |
| 89 | Ga0070671_100331127 | 3300005355 | Bacteria | 1298 |
| 90 | Ga0070674_100001769 | 3300005356 | Bacteria | 11718 |
| 91 | Ga0070674_100131810 | 3300005356 | Bacteria | 1864 |
| 92 | Ga0070674_100787867 | 3300005356 | Bacteria | 820 |
| 93 | Ga0070673_100000043 | 3300005364 | Bacteria | 52415 |
| 94 | Ga0070673_100009905 | 3300005364 | Bacteria | 6421 |
| 95 | Ga0070673_100028796 | 3300005364 | Bacteria | 4136 |
| 96 | Ga0070673_100098621 | 3300005364 | Bacteria | 2402 |
| 97 | Ga0070673_100638515 | 3300005364 | Bacteria | 974 |
| 98 | Ga0070688_100000219 | 3300005365 | Bacteria | 30246 |
| 99 | Ga0070688_100141545 | 3300005365 | Bacteria | 1634 |
| 100 | Ga0070659_100002063 | 3300005366 | Bacteria | 14337 |
| 101 | Ga0070659_100009634 | 3300005366 | Bacteria | 7099 |
| 102 | Ga0070659_100025142 | 3300005366 | Bacteria | 4571 |
| 103 | Ga0070667_100003833 | 3300005367 | Bacteria | 12775 |
| 104 | Ga0070667_100015102 | 3300005367 | Bacteria | 6378 |
| 105 | Ga0070667_100021260 | 3300005367 | Bacteria | 5391 |
| 106 | Ga0070667_100024756 | 3300005367 | Bacteria | 4987 |
| 107 | Ga0070667_100065001 | 3300005367 | Bacteria | 3097 |
| 108 | Ga0070667_100101894 | 3300005367 | Bacteria | 2480 |
| 109 | Ga0070703_10032329 | 3300005406 | Bacteria | 1589 |
| 110 | Ga0070709_10187448 | 3300005434 | Bacteria | 1457 |
| 111 | Ga0070709_10418566 | 3300005434 | Bacteria | 1004 |
| 112 | Ga0070714_100002832 | 3300005435 | Bacteria | 12798 |
| 113 | Ga0070714_100482821 | 3300005435 | Bacteria | 1180 |
| 114 | Ga0070713_100000018 | 3300005436 | Bacteria | 118409 |
| 115 | Ga0070713_100041293 | 3300005436 | Bacteria | 3758 |
| 116 | Ga0070713_100044375 | 3300005436 | Bacteria | 3639 |
| 117 | Ga0070713_100057945 | 3300005436 | Bacteria | 3228 |
| 118 | Ga0070713_100125793 | 3300005436 | Bacteria | 2254 |
| 119 | Ga0070713_100618253 | 3300005436 | Unclassified | 1030 |
| 120 | Ga0070710_10030569 | 3300005437 | Bacteria | 2899 |
| 121 | Ga0070711_100011188 | 3300005439 | Bacteria | 5564 |
| 122 | Ga0070711_100014390 | 3300005439 | Bacteria | 4986 |
| 123 | Ga0070711_100042541 | 3300005439 | Bacteria | 3071 |
| 124 | Ga0070711_100383736 | 3300005439 | Bacteria | 1137 |
| 125 | Ga0070700_100041397 | 3300005441 | Bacteria | 2824 |
| 126 | Ga0070700_100221428 | 3300005441 | Bacteria | 1341 |
| 127 | Ga0070708_100000053 | 3300005445 | Bacteria | 77258 |
| 128 | Ga0070708_100127942 | 3300005445 | Bacteria | 2349 |
| 129 | Ga0070708_100158407 | 3300005445 | Bacteria | 2109 |
| 130 | Ga0070708_100255356 | 3300005445 | Bacteria | 1647 |
| 131 | Ga0070708_100562992 | 3300005445 | Bacteria | 1075 |
| 132 | Ga0070708_100602538 | 3300005445 | Bacteria | 1036 |
| 133 | Ga0070663_100007766 | 3300005455 | Bacteria | 6551 |
| 134 | Ga0070663_100182206 | 3300005455 | Bacteria | 1630 |
| 135 | Ga0070663_100198919 | 3300005455 | Bacteria | 1563 |
| 136 | Ga0070678_100001872 | 3300005456 | Bacteria | 11358 |
| 137 | Ga0070678_100007077 | 3300005456 | Bacteria | 6632 |
| 138 | Ga0070678_100024049 | 3300005456 | Bacteria | 4071 |
| 139 | Ga0070662_100007746 | 3300005457 | Bacteria | 6975 |
| 140 | Ga0070662_100092227 | 3300005457 | Bacteria | 2276 |
| 141 | Ga0070662_100243915 | 3300005457 | Bacteria | 1442 |
| 142 | Ga0070662_100373797 | 3300005457 | Bacteria | 1172 |
| 143 | Ga0070662_100407611 | 3300005457 | Bacteria | 1123 |
| 144 | Ga0068867_100000983 | 3300005459 | Bacteria | 19454 |
| 145 | Ga0068867_100018676 | 3300005459 | Bacteria | 4929 |
| 146 | Ga0068867_100019770 | 3300005459 | Bacteria | 4799 |
| 147 | Ga0068867_100041932 | 3300005459 | Bacteria | 3345 |
| 148 | Ga0068867_100082898 | 3300005459 | Bacteria | 2420 |
| 149 | Ga0068867_100123023 | 3300005459 | Bacteria | 2007 |
| 150 | Ga0068867_100222844 | 3300005459 | Bacteria | 1521 |
| 151 | Ga0068867_100604302 | 3300005459 | Bacteria | 957 |
| 152 | Ga0070685_10000897 | 3300005466 | Bacteria | 15970 |
| 153 | Ga0070685_10016145 | 3300005466 | Bacteria | 3973 |
| 154 | Ga0070706_100009767 | 3300005467 | Bacteria | 8915 |
| 155 | Ga0070706_100018128 | 3300005467 | Bacteria | 6494 |
| 156 | Ga0070706_100027298 | 3300005467 | Bacteria | 5254 |
| 157 | Ga0070706_100152836 | 3300005467 | Bacteria | 2155 |
| 158 | Ga0070706_100227435 | 3300005467 | Bacteria | 1741 |
| 159 | Ga0070706_100569405 | 3300005467 | Bacteria | 1053 |
| 160 | Ga0070707_100014859 | 3300005468 | Bacteria | 7300 |
| 161 | Ga0070707_100029343 | 3300005468 | Bacteria | 5237 |
| 162 | Ga0070707_100031830 | 3300005468 | Bacteria | 5025 |
| 163 | Ga0070707_100046390 | 3300005468 | Bacteria | 4158 |
| 164 | Ga0070707_100116120 | 3300005468 | Bacteria | 2598 |
| 165 | Ga0070707_100391099 | 3300005468 | Bacteria | 1350 |
| 166 | Ga0070707_100511758 | 3300005468 | Bacteria | 1162 |
| 167 | Ga0070707_100526143 | 3300005468 | Bacteria | 1144 |
| 168 | Ga0070707_100763286 | 3300005468 | Bacteria | 930 |
| 169 | Ga0070698_100008351 | 3300005471 | Bacteria | 11192 |
| 170 | Ga0070698_100027258 | 3300005471 | Bacteria | 5944 |
| 171 | Ga0070698_100242247 | 3300005471 | Bacteria | 1736 |
| 172 | Ga0070698_100378755 | 3300005471 | Bacteria | 1347 |
| 173 | Ga0070698_100537725 | 3300005471 | Bacteria | 1107 |
| 174 | Ga0070699_100013545 | 3300005518 | Bacteria | 7020 |
| 175 | Ga0070699_100018721 | 3300005518 | Bacteria | 5946 |
| 176 | Ga0070699_100217887 | 3300005518 | Bacteria | 1700 |
| 177 | Ga0070699_100270239 | 3300005518 | Bacteria | 1521 |
| 178 | Ga0070679_100064406 | 3300005530 | Bacteria | 3654 |
| 179 | Ga0070679_100145229 | 3300005530 | Bacteria | 2350 |
| 180 | Ga0070679_100353113 | 3300005530 | Bacteria | 1418 |
| 181 | Ga0070684_100032906 | 3300005535 | Bacteria | 4423 |
| 182 | Ga0070684_100216169 | 3300005535 | Bacteria | 1748 |
| 183 | Ga0070697_100012228 | 3300005536 | Bacteria | 6722 |
| 184 | Ga0070697_100018433 | 3300005536 | Bacteria | 5501 |
| 185 | Ga0070697_100034401 | 3300005536 | Bacteria | 4085 |
| 186 | Ga0070697_100244489 | 3300005536 | Bacteria | 1533 |
| 187 | Ga0070697_100324172 | 3300005536 | Bacteria | 1327 |
| 188 | Ga0068853_100006747 | 3300005539 | Bacteria | 9146 |
| 189 | Ga0068853_100020924 | 3300005539 | Bacteria | 5444 |
| 190 | Ga0068853_100061370 | 3300005539 | Bacteria | 3251 |
| 191 | Ga0068853_100233001 | 3300005539 | Bacteria | 1685 |
| 192 | Ga0068853_100257261 | 3300005539 | Bacteria | 1604 |
| 193 | Ga0068853_100380669 | 3300005539 | Bacteria | 1318 |
| 194 | Ga0070672_100002787 | 3300005543 | Bacteria | 11206 |
| 195 | Ga0070672_100003389 | 3300005543 | Bacteria | 10332 |
| 196 | Ga0070672_100011101 | 3300005543 | Bacteria | 6273 |
| 197 | Ga0070672_100032687 | 3300005543 | Bacteria | 3930 |
| 198 | Ga0070672_100391600 | 3300005543 | Bacteria | 1190 |
| 199 | Ga0070686_100077739 | 3300005544 | Bacteria | 2189 |
| 200 | Ga0070695_100210812 | 3300005545 | Bacteria | 1394 |
| 201 | Ga0070696_100074437 | 3300005546 | Bacteria | 2395 |
| 202 | Ga0070696_100104327 | 3300005546 | Bacteria | 2035 |
| 203 | Ga0070696_100332829 | 3300005546 | Bacteria | 1172 |
| 204 | Ga0070693_100183002 | 3300005547 | Bacteria | 1350 |
| 205 | Ga0070693_100191343 | 3300005547 | Bacteria | 1323 |
| 206 | Ga0070665_100010279 | 3300005548 | Bacteria | 9470 |
| 207 | Ga0070665_100018064 | 3300005548 | Bacteria | 7078 |
| 208 | Ga0070665_100125882 | 3300005548 | Bacteria | 2565 |
| 209 | Ga0070665_100148184 | 3300005548 | Bacteria | 2349 |
| 210 | Ga0070665_100267344 | 3300005548 | Bacteria | 1711 |
| 211 | Ga0070665_100434151 | 3300005548 | Bacteria | 1322 |
| 212 | Ga0070704_100203921 | 3300005549 | Bacteria | 1598 |
| 213 | Ga0070704_100755110 | 3300005549 | Bacteria | 866 |
| 214 | Ga0068855_100001509 | 3300005563 | Bacteria | 29149 |
| 215 | Ga0068855_100011108 | 3300005563 | Bacteria | 10869 |
| 216 | Ga0068855_100131288 | 3300005563 | Bacteria | 2861 |
| 217 | Ga0068855_100901776 | 3300005563 | Bacteria | 934 |
| 218 | Ga0070664_100000382 | 3300005564 | Bacteria | 32943 |
| 219 | Ga0070664_100197339 | 3300005564 | Bacteria | 1794 |
| 220 | Ga0070664_100448106 | 3300005564 | Bacteria | 1185 |
| 221 | Ga0068857_100007158 | 3300005577 | Bacteria | 9611 |
| 222 | Ga0068857_100010100 | 3300005577 | Bacteria | 8200 |
| 223 | Ga0068857_100017326 | 3300005577 | Bacteria | 6310 |
| 224 | Ga0068857_100077510 | 3300005577 | Bacteria | 2966 |
| 225 | Ga0068854_100010442 | 3300005578 | Bacteria | 6023 |
| 226 | Ga0068856_100028014 | 3300005614 | Bacteria | 5497 |
| 227 | Ga0068856_100094449 | 3300005614 | Bacteria | 2977 |
| 228 | Ga0068856_100178068 | 3300005614 | Bacteria | 2139 |
| 229 | Ga0068856_100261514 | 3300005614 | Bacteria | 1746 |
| 230 | Ga0070702_100053956 | 3300005615 | Bacteria | 2310 |
| 231 | Ga0070702_100098708 | 3300005615 | Bacteria | 1787 |
| 232 | Ga0068852_100002701 | 3300005616 | Bacteria | 12253 |
| 233 | Ga0068852_100005218 | 3300005616 | Bacteria | 9264 |
| 234 | Ga0068852_100048369 | 3300005616 | Bacteria | 3633 |
| 235 | Ga0068852_100117088 | 3300005616 | Bacteria | 2432 |
| 236 | Ga0068852_100154509 | 3300005616 | Bacteria | 2136 |
| 237 | Ga0068852_100218881 | 3300005616 | Bacteria | 1810 |
| 238 | Ga0068852_100290955 | 3300005616 | Bacteria | 1578 |
| 239 | Ga0068859_100152522 | 3300005617 | Bacteria | 2386 |
| 240 | Ga0068859_100363034 | 3300005617 | Bacteria | 1543 |
| 241 | Ga0068859_100561597 | 3300005617 | Bacteria | 1235 |
| 242 | Ga0068859_100785938 | 3300005617 | Bacteria | 1040 |
| 243 | Ga0068864_100001799 | 3300005618 | Bacteria | 17604 |
| 244 | Ga0068864_100002340 | 3300005618 | Bacteria | 15669 |
| 245 | Ga0068864_100004987 | 3300005618 | Bacteria | 10876 |
| 246 | Ga0068864_100009580 | 3300005618 | Bacteria | 7986 |
| 247 | Ga0068864_100023249 | 3300005618 | Bacteria | 5203 |
| 248 | Ga0068864_100062625 | 3300005618 | Bacteria | 3223 |
| 249 | Ga0068864_100070196 | 3300005618 | Bacteria | 3048 |
| 250 | Ga0068866_10030573 | 3300005718 | Bacteria | 2586 |
| 251 | Ga0068861_100000216 | 3300005719 | Bacteria | 30988 |
| 252 | Ga0068861_100068209 | 3300005719 | Bacteria | 2748 |
| 253 | Ga0068861_100268643 | 3300005719 | Bacteria | 1464 |
| 254 | Ga0068861_100373578 | 3300005719 | Bacteria | 1257 |
| 255 | Ga0068851_10000318 | 3300005834 | Bacteria | 21772 |
| 256 | Ga0068851_10000574 | 3300005834 | Bacteria | 16016 |
| 257 | Ga0068851_10013088 | 3300005834 | Bacteria | 3924 |
| 258 | Ga0068870_10038013 | 3300005840 | Bacteria | 2483 |
| 259 | Ga0068870_10040151 | 3300005840 | Bacteria | 2425 |
| 260 | Ga0068863_100001833 | 3300005841 | Bacteria | 21137 |
| 261 | Ga0068863_100002646 | 3300005841 | Bacteria | 17718 |
| 262 | Ga0068863_100049794 | 3300005841 | Bacteria | 3972 |
| 263 | Ga0068863_100163531 | 3300005841 | Bacteria | 2133 |
| 264 | Ga0068863_100341123 | 3300005841 | Bacteria | 1457 |
| 265 | Ga0068863_100376061 | 3300005841 | Bacteria | 1387 |
| 266 | Ga0068863_100521071 | 3300005841 | Bacteria | 1172 |
| 267 | Ga0068863_101129285 | 3300005841 | Bacteria | 789 |
| 268 | Ga0068858_100010655 | 3300005842 | Bacteria | 8697 |
| 269 | Ga0068858_100038836 | 3300005842 | Bacteria | 4415 |
| 270 | Ga0068858_100049069 | 3300005842 | Bacteria | 3910 |
| 271 | Ga0068858_100066258 | 3300005842 | Bacteria | 3343 |
| 272 | Ga0068858_100161174 | 3300005842 | Bacteria | 2112 |
| 273 | Ga0068858_100217391 | 3300005842 | Bacteria | 1809 |
| 274 | Ga0068860_100004954 | 3300005843 | Bacteria | 13573 |
| 275 | Ga0068860_100008957 | 3300005843 | Bacteria | 9969 |
| 276 | Ga0068860_100015761 | 3300005843 | Bacteria | 7379 |
| 277 | Ga0068860_100056596 | 3300005843 | Bacteria | 3727 |
| 278 | Ga0068860_100130466 | 3300005843 | Bacteria | 2411 |
| 279 | Ga0068860_100136251 | 3300005843 | Bacteria | 2358 |
| 280 | Ga0068860_100193385 | 3300005843 | Bacteria | 1969 |
| 281 | Ga0068860_100203376 | 3300005843 | Bacteria | 1920 |
| 282 | Ga0068862_100002123 | 3300005844 | Bacteria | 17861 |
| 283 | Ga0068862_100002912 | 3300005844 | Bacteria | 14961 |
| 284 | Ga0068862_100013943 | 3300005844 | Bacteria | 6662 |
| 285 | Ga0068862_100171632 | 3300005844 | Bacteria | 1942 |
| 286 | Ga0068862_100305463 | 3300005844 | Bacteria | 1465 |
| 287 | Ga0070717_10104550 | 3300006028 | Bacteria | 2409 |
| 288 | Ga0070717_10160156 | 3300006028 | Bacteria | 1952 |
| 289 | Ga0075363_100163025 | 3300006048 | Bacteria | 1263 |
| 290 | Ga0075364_10147759 | 3300006051 | Bacteria | 1583 |
| 291 | Ga0075364_10422649 | 3300006051 | Bacteria | 910 |
| 292 | Ga0075432_10008595 | 3300006058 | Bacteria | 3485 |
| 293 | Ga0075432_10225068 | 3300006058 | Bacteria | 752 |
| 294 | Ga0070716_100012365 | 3300006173 | Bacteria | 4325 |
| 295 | Ga0070712_100002661 | 3300006175 | Bacteria | 11021 |
| 296 | Ga0070712_100012249 | 3300006175 | Bacteria | 5451 |
| 297 | Ga0070712_100054698 | 3300006175 | Bacteria | 2791 |
| 298 | Ga0070712_100203067 | 3300006175 | Bacteria | 1558 |
| 299 | Ga0070712_100294192 | 3300006175 | Bacteria | 1312 |
| 300 | Ga0075362_10003903 | 3300006177 | Bacteria | 5295 |
| 301 | Ga0075362_10008343 | 3300006177 | Bacteria | 3956 |
| 302 | Ga0075362_10197722 | 3300006177 | Bacteria | 978 |
| 303 | Ga0075367_10066906 | 3300006178 | Bacteria | 2154 |
| 304 | Ga0075369_10044743 | 3300006186 | Bacteria | 1902 |
| 305 | Ga0075366_10030351 | 3300006195 | Bacteria | 3178 |
| 306 | Ga0075366_10081232 | 3300006195 | Bacteria | 1936 |
| 307 | Ga0075366_10103685 | 3300006195 | Bacteria | 1708 |
| 308 | Ga0075366_10193715 | 3300006195 | Bacteria | 1235 |
| 309 | Ga0097621_100003909 | 3300006237 | Bacteria | 10328 |
| 310 | Ga0097621_100011838 | 3300006237 | Bacteria | 6446 |
| 311 | Ga0097621_100078767 | 3300006237 | Bacteria | 2738 |
| 312 | Ga0097621_100196056 | 3300006237 | Bacteria | 1751 |
| 313 | Ga0097621_100488748 | 3300006237 | Bacteria | 1114 |
| 314 | Ga0097621_100540325 | 3300006237 | Bacteria | 1060 |
| 315 | Ga0075370_10013523 | 3300006353 | Bacteria | 4342 |
| 316 | Ga0075370_10016809 | 3300006353 | Bacteria | 3942 |
| 317 | Ga0075370_10027764 | 3300006353 | Bacteria | 3143 |
| 318 | Ga0075370_10030332 | 3300006353 | Bacteria | 3016 |
| 319 | Ga0075370_10068530 | 3300006353 | Bacteria | 2026 |
| 320 | Ga0075370_10125410 | 3300006353 | Bacteria | 1497 |
| 321 | Ga0075370_10192013 | 3300006353 | Bacteria | 1204 |
| 322 | Ga0075370_10203835 | 3300006353 | Bacteria | 1167 |
| 323 | Ga0068871_100001413 | 3300006358 | Bacteria | 16060 |
| 324 | Ga0068871_100166479 | 3300006358 | Bacteria | 1887 |
| 325 | Ga0068871_100254010 | 3300006358 | Bacteria | 1532 |
| 326 | Ga0068871_100282397 | 3300006358 | Bacteria | 1453 |
| 327 | Ga0068871_100506484 | 3300006358 | Bacteria | 1089 |
| 328 | Ga0075428_100009152 | 3300006844 | Bacteria | 10991 |
| 329 | Ga0075430_100111486 | 3300006846 | Bacteria | 2281 |
| 330 | Ga0075430_100250639 | 3300006846 | Bacteria | 1467 |
| 331 | Ga0075431_100008054 | 3300006847 | Bacteria | 10516 |
| 332 | Ga0075431_100010310 | 3300006847 | Bacteria | 9388 |
| 333 | Ga0075431_100133961 | 3300006847 | Bacteria | 2554 |
| 334 | Ga0075433_10066103 | 3300006852 | Bacteria | 3172 |
| 335 | Ga0075433_10209260 | 3300006852 | Bacteria | 1733 |
| 336 | Ga0075433_10531303 | 3300006852 | Bacteria | 1034 |
| 337 | Ga0075434_100422065 | 3300006871 | Bacteria | 1355 |
| 338 | Ga0075434_100506023 | 3300006871 | Bacteria | 1228 |
| 339 | Ga0075434_101116484 | 3300006871 | Unclassified | 801 |
| 340 | Ga0075429_100015645 | 3300006880 | Bacteria | 6573 |
| 341 | Ga0075429_100118770 | 3300006880 | Bacteria | 2311 |
| 342 | Ga0068865_100065259 | 3300006881 | Bacteria | 2564 |
| 343 | Ga0075436_100052689 | 3300006914 | Bacteria | 2809 |
| 344 | Ga0075436_100083211 | 3300006914 | Bacteria | 2220 |
| 345 | Ga0075436_100434648 | 3300006914 | Bacteria | 954 |
| 346 | Ga0097620_100152504 | 3300006931 | Bacteria | 2386 |
| 347 | Ga0097620_100363051 | 3300006931 | Bacteria | 1543 |
| 348 | Ga0097620_100561619 | 3300006931 | Bacteria | 1235 |
| 349 | Ga0097620_100785884 | 3300006931 | Bacteria | 1040 |
| 350 | Ga0079104_1016194 | 3300006946 | Bacteria | 2188 |
| 351 | Ga0099826_10000044 | 3300006948 | Bacteria | 88060 |
| 352 | Ga0075435_100039068 | 3300007076 | Bacteria | 3786 |
| 353 | Ga0075435_100449259 | 3300007076 | Bacteria | 1111 |
| 354 | Ga0075435_100500504 | 3300007076 | Bacteria | 1050 |
| 355 | Ga0075435_100641038 | 3300007076 | Bacteria | 922 |
| 356 | Ga0099794_10017711 | 3300007265 | Bacteria | 3180 |
| 357 | Ga0099794_10020806 | 3300007265 | Bacteria | 2973 |
| 358 | Ga0099794_10067732 | 3300007265 | Archaea | 1744 |
| 359 | Ga0099794_10196723 | 3300007265 | Bacteria | 1032 |
| 360 | Ga0105244_10000642 | 3300009036 | Bacteria | 30808 |
| 361 | Ga0105240_10002759 | 3300009093 | Bacteria | 27745 |
| 362 | Ga0105240_10102699 | 3300009093 | Bacteria | 3474 |
| 363 | Ga0105240_10139138 | 3300009093 | Bacteria | 2904 |
| 364 | Ga0111539_10020068 | 3300009094 | Bacteria | 8233 |
| 365 | Ga0111539_10043530 | 3300009094 | Bacteria | 5381 |
| 366 | Ga0111539_10958203 | 3300009094 | Bacteria | 995 |
| 367 | Ga0105245_10001770 | 3300009098 | Bacteria | 19678 |
| 368 | Ga0105247_10129505 | 3300009101 | Bacteria | 1643 |
| 369 | Ga0105247_10433814 | 3300009101 | Bacteria | 943 |
| 370 | Ga0114129_10008075 | 3300009147 | Bacteria | 14994 |
| 371 | Ga0114129_10015344 | 3300009147 | Bacteria | 10900 |
| 372 | Ga0114129_10554708 | 3300009147 | Bacteria | 1494 |
| 373 | Ga0105243_10000674 | 3300009148 | Bacteria | 33388 |
| 374 | Ga0105243_10011504 | 3300009148 | Bacteria | 6695 |
| 375 | Ga0105243_10115449 | 3300009148 | Bacteria | 2254 |
| 376 | Ga0105243_10191629 | 3300009148 | Bacteria | 1786 |
| 377 | Ga0105243_10416468 | 3300009148 | Bacteria | 1252 |
| 378 | Ga0105241_10131169 | 3300009174 | Bacteria | 2029 |
| 379 | Ga0105241_10782368 | 3300009174 | Bacteria | 877 |
| 380 | Ga0105242_10080901 | 3300009176 | Bacteria | 2715 |
| 381 | Ga0105248_10000918 | 3300009177 | Bacteria | 32792 |
| 382 | Ga0105248_10088978 | 3300009177 | Bacteria | 3476 |
| 383 | Ga0105248_10124237 | 3300009177 | Bacteria | 2911 |
| 384 | Ga0105248_10350385 | 3300009177 | Bacteria | 1662 |
| 385 | Ga0105237_10011550 | 3300009545 | Bacteria | 9340 |
| 386 | Ga0105237_10057988 | 3300009545 | Bacteria | 3875 |
| 387 | Ga0105237_10150429 | 3300009545 | Bacteria | 2324 |
| 388 | Ga0105237_10215267 | 3300009545 | Bacteria | 1921 |
| 389 | Ga0105238_10001347 | 3300009551 | Bacteria | 24690 |
| 390 | Ga0105238_10255875 | 3300009551 | Bacteria | 1730 |
| 391 | Ga0105238_10467029 | 3300009551 | Bacteria | 1260 |
| 392 | Ga0105238_10601223 | 3300009551 | Bacteria | 1108 |
| 393 | Ga0105238_10889391 | 3300009551 | Bacteria | 909 |
| 394 | Ga0105249_10165386 | 3300009553 | Bacteria | 2141 |
| 395 | Ga0105249_10176225 | 3300009553 | Bacteria | 2077 |
| 396 | Ga0105249_10442333 | 3300009553 | Bacteria | 1337 |
| 397 | Ga0105249_10553627 | 3300009553 | Bacteria | 1201 |
| 398 | Ga0105239_10032488 | 3300010375 | Bacteria | 5733 |
| 399 | Ga0105239_10045063 | 3300010375 | Bacteria | 4834 |
| 400 | Ga0105239_10154415 | 3300010375 | Bacteria | 2563 |
| 401 | Ga0105239_10987921 | 3300010375 | Bacteria | 968 |
| 402 | Ga0105246_10002072 | 3300011119 | Bacteria | 12076 |
| 403 | Ga0105246_10126817 | 3300011119 | Bacteria | 1900 |
| 404 | Ga0105246_10392241 | 3300011119 | Bacteria | 1150 |
| 405 | Ga0157347_1014065 | 3300012502 | Bacteria | 879 |
| 406 | Ga0157373_10002009 | 3300013100 | Bacteria | 15416 |
| 407 | Ga0157373_10003095 | 3300013100 | Bacteria | 12569 |
| 408 | Ga0157373_10107785 | 3300013100 | Bacteria | 1959 |
| 409 | Ga0157373_10109619 | 3300013100 | Bacteria | 1941 |
| 410 | Ga0157373_10664144 | 3300013100 | Bacteria | 762 |
| 411 | Ga0157371_10014516 | 3300013102 | Bacteria | 5942 |
| 412 | Ga0157370_10004298 | 3300013104 | Bacteria | 16391 |
| 413 | Ga0157370_10026577 | 3300013104 | Bacteria | 5713 |
| 414 | Ga0157370_10324300 | 3300013104 | Bacteria | 1420 |
| 415 | Ga0157369_10001502 | 3300013105 | Bacteria | 28630 |
| 416 | Ga0157369_10181978 | 3300013105 | Bacteria | 2211 |
| 417 | Ga0157369_10675773 | 3300013105 | Bacteria | 1064 |
| 418 | Ga0157374_10000978 | 3300013296 | Bacteria | 24788 |
| 419 | Ga0157374_10016654 | 3300013296 | Bacteria | 6465 |
| 420 | Ga0157374_10194123 | 3300013296 | Bacteria | 1986 |
| 421 | Ga0157374_11125232 | 3300013296 | Bacteria | 806 |
| 422 | Ga0157378_10021855 | 3300013297 | Bacteria | 5626 |
| 423 | Ga0157378_10021940 | 3300013297 | Bacteria | 5615 |
| 424 | Ga0157378_10084625 | 3300013297 | Bacteria | 2872 |
| 425 | Ga0157378_10123429 | 3300013297 | Bacteria | 2390 |
| 426 | Ga0157378_10148252 | 3300013297 | Bacteria | 2184 |
| 427 | Ga0157378_10853989 | 3300013297 | Bacteria | 939 |
| 428 | Ga0163162_10055082 | 3300013306 | Bacteria | 4002 |
| 429 | Ga0163162_10071092 | 3300013306 | Bacteria | 3532 |
| 430 | Ga0163162_10093099 | 3300013306 | Bacteria | 3098 |
| 431 | Ga0163162_10346748 | 3300013306 | Bacteria | 1618 |
| 432 | Ga0163162_10487444 | 3300013306 | Bacteria | 1364 |
| 433 | Ga0157372_10003604 | 3300013307 | Bacteria | 16666 |
| 434 | Ga0157372_10057440 | 3300013307 | Bacteria | 4350 |
| 435 | Ga0157372_10100101 | 3300013307 | Bacteria | 3307 |
| 436 | Ga0157372_10628573 | 3300013307 | Bacteria | 1251 |
| 437 | Ga0157375_10022136 | 3300013308 | Bacteria | 5846 |
| 438 | Ga0157375_10307573 | 3300013308 | Bacteria | 1749 |
| 439 | Ga0163163_10001615 | 3300014325 | Bacteria | 18953 |
| 440 | Ga0163163_10022110 | 3300014325 | Bacteria | 6015 |
| 441 | Ga0163163_10050597 | 3300014325 | Bacteria | 4092 |
| 442 | Ga0163163_10119519 | 3300014325 | Bacteria | 2668 |
| 443 | Ga0163163_10247821 | 3300014325 | Bacteria | 1832 |
| 444 | Ga0157380_10069858 | 3300014326 | Bacteria | 2836 |
| 445 | Ga0157380_10249992 | 3300014326 | Bacteria | 1604 |
| 446 | Ga0157380_10423468 | 3300014326 | Bacteria | 1271 |
| 447 | Ga0182008_10000794 | 3300014497 | Bacteria | 22137 |
| 448 | Ga0182008_10026721 | 3300014497 | Bacteria | 2926 |
| 449 | Ga0157377_10000479 | 3300014745 | Bacteria | 17223 |
| 450 | Ga0157379_10000044 | 3300014968 | Bacteria | 75399 |
| 451 | Ga0157379_10054468 | 3300014968 | Bacteria | 3574 |
| 452 | Ga0157379_10057344 | 3300014968 | Bacteria | 3481 |
| 453 | Ga0157379_10113398 | 3300014968 | Bacteria | 2436 |
| 454 | Ga0157376_10042690 | 3300014969 | Bacteria | 3717 |
| 455 | Ga0157376_10201250 | 3300014969 | Bacteria | 1833 |
| 456 | Ga0157376_10333592 | 3300014969 | Bacteria | 1446 |
| 457 | Ga0157376_10409317 | 3300014969 | Bacteria | 1313 |
| 458 | Ga0157376_10834294 | 3300014969 | Bacteria | 936 |
| 459 | Ga0182006_1000690 | 3300015261 | Bacteria | 23537 |
| 460 | Ga0182006_1021734 | 3300015261 | Bacteria | 2672 |
| 461 | Ga0182007_10000223 | 3300015262 | Bacteria | 38011 |
| 462 | Ga0182007_10035384 | 3300015262 | Bacteria | 1683 |
| 463 | Ga0183362_10002 | 3300015683 | Bacteria | 1432711 |
| 464 | Ga0163161_10015411 | 3300017792 | Bacteria | 5329 |
| 465 | Ga0163161_10053380 | 3300017792 | Bacteria | 2931 |
| 466 | Ga0209672_108769 | 3300025228 | Bacteria | 1469 |
| 467 | Ga0207425_1003414 | 3300025245 | Bacteria | 5091 |
| 468 | Ga0207425_1012591 | 3300025245 | Bacteria | 1979 |
| 469 | Ga0209129_1000281 | 3300025258 | Bacteria | 48395 |
| 470 | Ga0209565_1000047 | 3300025263 | Bacteria | 225745 |
| 471 | Ga0209565_1000278 | 3300025263 | Bacteria | 51430 |
| 472 | Ga0209565_1006520 | 3300025263 | Bacteria | 3263 |
| 473 | Ga0209455_1002782 | 3300025272 | Bacteria | 6536 |
| 474 | Ga0209673_1000079 | 3300025273 | Bacteria | 225746 |
| 475 | Ga0209673_1000693 | 3300025273 | Bacteria | 48171 |
| 476 | Ga0209130_1000890 | 3300025284 | Bacteria | 24330 |
| 477 | Ga0209130_1003561 | 3300025284 | Bacteria | 6516 |
| 478 | Ga0209675_1000046 | 3300025291 | Bacteria | 225746 |
| 479 | Ga0209675_1000423 | 3300025291 | Bacteria | 34092 |
| 480 | Ga0209675_1010260 | 3300025291 | Bacteria | 3215 |
| 481 | Ga0209676_1000383 | 3300025292 | Bacteria | 81259 |
| 482 | Ga0209676_1018495 | 3300025292 | Bacteria | 2429 |
| 483 | Ga0209025_1001476 | 3300025294 | Bacteria | 30608 |
| 484 | Ga0209025_1016419 | 3300025294 | Bacteria | 4371 |
| 485 | Ga0209025_1020008 | 3300025294 | Bacteria | 3685 |
| 486 | Ga0209564_1002819 | 3300025295 | Bacteria | 12898 |
| 487 | Ga0209758_1000665 | 3300025297 | Bacteria | 51391 |
| 488 | Ga0209758_1010522 | 3300025297 | Bacteria | 5519 |
| 489 | Ga0209050_1065904 | 3300025298 | Bacteria | 832 |
| 490 | Ga0207426_1000076 | 3300025302 | Bacteria | 320851 |
| 491 | Ga0207426_1000591 | 3300025302 | Bacteria | 47966 |
| 492 | Ga0209051_1000213 | 3300025303 | Bacteria | 98755 |
| 493 | Ga0209051_1000259 | 3300025303 | Bacteria | 88311 |
| 494 | Ga0209257_1000116 | 3300025304 | Bacteria | 228733 |
| 495 | Ga0207697_10000793 | 3300025315 | Bacteria | 17916 |
| 496 | Ga0207697_10012348 | 3300025315 | Bacteria | 3583 |
| 497 | Ga0207656_10003496 | 3300025321 | Bacteria | 5407 |
| 498 | Ga0207656_10029837 | 3300025321 | Bacteria | 2249 |
| 499 | Ga0207655_1001085 | 3300025728 | Bacteria | 26850 |
| 500 | Ga0207653_10010810 | 3300025885 | Bacteria | 2848 |
| 501 | Ga0207682_10000397 | 3300025893 | Bacteria | 19996 |
| 502 | Ga0207682_10004865 | 3300025893 | Bacteria | 5544 |
| 503 | Ga0207682_10129294 | 3300025893 | Bacteria | 1126 |
| 504 | Ga0207692_10007269 | 3300025898 | Bacteria | 4530 |
| 505 | Ga0207692_10052005 | 3300025898 | Bacteria | 2079 |
| 506 | Ga0207692_10203999 | 3300025898 | Bacteria | 1164 |
| 507 | Ga0207688_10066617 | 3300025901 | Bacteria | 2037 |
| 508 | Ga0207688_10076615 | 3300025901 | Bacteria | 1905 |
| 509 | Ga0207688_10214732 | 3300025901 | Bacteria | 1157 |
| 510 | Ga0207680_10011740 | 3300025903 | Bacteria | 4437 |
| 511 | Ga0207680_10037749 | 3300025903 | Bacteria | 2791 |
| 512 | Ga0207680_10052629 | 3300025903 | Bacteria | 2441 |
| 513 | Ga0207680_10133130 | 3300025903 | Bacteria | 1640 |
| 514 | Ga0207680_10390225 | 3300025903 | Bacteria | 983 |
| 515 | Ga0207647_10279639 | 3300025904 | Bacteria | 953 |
| 516 | Ga0207685_10119946 | 3300025905 | Bacteria | 1153 |
| 517 | Ga0207699_10104396 | 3300025906 | Bacteria | 1805 |
| 518 | Ga0207699_10116473 | 3300025906 | Bacteria | 1721 |
| 519 | Ga0207645_10000333 | 3300025907 | Bacteria | 39388 |
| 520 | Ga0207645_10083564 | 3300025907 | Bacteria | 2048 |
| 521 | Ga0207645_10444735 | 3300025907 | Unclassified | 874 |
| 522 | Ga0207643_10003574 | 3300025908 | Bacteria | 8372 |
| 523 | Ga0207643_10420612 | 3300025908 | Bacteria | 847 |
| 524 | Ga0207705_10048188 | 3300025909 | Bacteria | 3064 |
| 525 | Ga0207705_10429602 | 3300025909 | Bacteria | 1023 |
| 526 | Ga0207684_10000972 | 3300025910 | Bacteria | 32086 |
| 527 | Ga0207684_10001487 | 3300025910 | Bacteria | 25213 |
| 528 | Ga0207684_10004791 | 3300025910 | Bacteria | 12673 |
| 529 | Ga0207684_10008646 | 3300025910 | Bacteria | 9042 |
| 530 | Ga0207684_10014734 | 3300025910 | Bacteria | 6733 |
| 531 | Ga0207684_10093773 | 3300025910 | Bacteria | 2560 |
| 532 | Ga0207684_10122908 | 3300025910 | Bacteria | 2226 |
| 533 | Ga0207684_10148320 | 3300025910 | Bacteria | 2018 |
| 534 | Ga0207684_10220121 | 3300025910 | Bacteria | 1638 |
| 535 | Ga0207684_10278488 | 3300025910 | Bacteria | 1443 |
| 536 | Ga0207654_10005566 | 3300025911 | Bacteria | 6372 |
| 537 | Ga0207707_10026758 | 3300025912 | Bacteria | 5041 |
| 538 | Ga0207707_10209370 | 3300025912 | Bacteria | 1699 |
| 539 | Ga0207695_10025361 | 3300025913 | Bacteria | 6639 |
| 540 | Ga0207695_10043580 | 3300025913 | Bacteria | 4782 |
| 541 | Ga0207695_10218284 | 3300025913 | Bacteria | 1815 |
| 542 | Ga0207695_10633346 | 3300025913 | Bacteria | 950 |
| 543 | Ga0207671_10046596 | 3300025914 | Bacteria | 3208 |
| 544 | Ga0207671_10202855 | 3300025914 | Bacteria | 1549 |
| 545 | Ga0207671_10419463 | 3300025914 | Bacteria | 1065 |
| 546 | Ga0207693_10003441 | 3300025915 | Bacteria | 13505 |
| 547 | Ga0207693_10003978 | 3300025915 | Bacteria | 12558 |
| 548 | Ga0207693_10010581 | 3300025915 | Bacteria | 7485 |
| 549 | Ga0207693_10014543 | 3300025915 | Bacteria | 6324 |
| 550 | Ga0207663_10118051 | 3300025916 | Bacteria | 1811 |
| 551 | Ga0207663_10148031 | 3300025916 | Bacteria | 1644 |
| 552 | Ga0207663_10547930 | 3300025916 | Bacteria | 904 |
| 553 | Ga0207660_10016888 | 3300025917 | Bacteria | 4841 |
| 554 | Ga0207662_10039183 | 3300025918 | Bacteria | 2779 |
| 555 | Ga0207662_10096070 | 3300025918 | Bacteria | 1830 |
| 556 | Ga0207657_10015295 | 3300025919 | Bacteria | 7437 |
| 557 | Ga0207657_10018119 | 3300025919 | Bacteria | 6737 |
| 558 | Ga0207657_10028035 | 3300025919 | Bacteria | 5146 |
| 559 | Ga0207649_10005189 | 3300025920 | Bacteria | 7035 |
| 560 | Ga0207649_10015006 | 3300025920 | Bacteria | 4350 |
| 561 | Ga0207649_10299954 | 3300025920 | Bacteria | 1174 |
| 562 | Ga0207649_10313520 | 3300025920 | Bacteria | 1150 |
| 563 | Ga0207652_10142242 | 3300025921 | Bacteria | 2146 |
| 564 | Ga0207652_10174458 | 3300025921 | Bacteria | 1930 |
| 565 | Ga0207652_10175441 | 3300025921 | Bacteria | 1925 |
| 566 | Ga0207652_10462430 | 3300025921 | Bacteria | 1143 |
| 567 | Ga0207646_10004214 | 3300025922 | Bacteria | 15743 |
| 568 | Ga0207646_10011235 | 3300025922 | Bacteria | 8695 |
| 569 | Ga0207646_10012388 | 3300025922 | Bacteria | 8199 |
| 570 | Ga0207646_10012608 | 3300025922 | Bacteria | 8115 |
| 571 | Ga0207646_10025565 | 3300025922 | Bacteria | 5400 |
| 572 | Ga0207646_10106522 | 3300025922 | Bacteria | 2514 |
| 573 | Ga0207646_10296490 | 3300025922 | Bacteria | 1461 |
| 574 | Ga0207646_10323950 | 3300025922 | Bacteria | 1392 |
| 575 | Ga0207646_10809448 | 3300025922 | Bacteria | 834 |
| 576 | Ga0207681_10026046 | 3300025923 | Bacteria | 3769 |
| 577 | Ga0207681_10030363 | 3300025923 | Bacteria | 3523 |
| 578 | Ga0207681_10520589 | 3300025923 | Unclassified | 976 |
| 579 | Ga0207694_10008391 | 3300025924 | Bacteria | 7800 |
| 580 | Ga0207694_10038219 | 3300025924 | Bacteria | 3690 |
| 581 | Ga0207694_10281608 | 3300025924 | Bacteria | 1366 |
| 582 | Ga0207650_10005969 | 3300025925 | Bacteria | 8313 |
| 583 | Ga0207650_10007114 | 3300025925 | Bacteria | 7624 |
| 584 | Ga0207650_10008283 | 3300025925 | Bacteria | 7098 |
| 585 | Ga0207650_10017066 | 3300025925 | Bacteria | 5081 |
| 586 | Ga0207650_10090137 | 3300025925 | Bacteria | 2341 |
| 587 | Ga0207650_10111100 | 3300025925 | Bacteria | 2122 |
| 588 | Ga0207650_10129451 | 3300025925 | Bacteria | 1974 |
| 589 | Ga0207650_10221992 | 3300025925 | Bacteria | 1521 |
| 590 | Ga0207650_10458637 | 3300025925 | Bacteria | 1061 |
| 591 | Ga0207650_10895120 | 3300025925 | Bacteria | 753 |
| 592 | Ga0207659_10003096 | 3300025926 | Bacteria | 9932 |
| 593 | Ga0207659_10030578 | 3300025926 | Bacteria | 3681 |
| 594 | Ga0207687_10000171 | 3300025927 | Bacteria | 42958 |
| 595 | Ga0207700_10000234 | 3300025928 | Bacteria | 33281 |
| 596 | Ga0207700_10214988 | 3300025928 | Bacteria | 1627 |
| 597 | Ga0207664_10028724 | 3300025929 | Bacteria | 4229 |
| 598 | Ga0207664_10273424 | 3300025929 | Bacteria | 1480 |
| 599 | Ga0207644_10064191 | 3300025931 | Bacteria | 2668 |
| 600 | Ga0207644_10074790 | 3300025931 | Bacteria | 2487 |
| 601 | Ga0207644_10101583 | 3300025931 | Bacteria | 2161 |
| 602 | Ga0207644_10138658 | 3300025931 | Bacteria | 1870 |
| 603 | Ga0207644_10329359 | 3300025931 | Bacteria | 1236 |
| 604 | Ga0207644_10350683 | 3300025931 | Bacteria | 1198 |
| 605 | Ga0207690_10019497 | 3300025932 | Bacteria | 4179 |
| 606 | Ga0207690_10271003 | 3300025932 | Bacteria | 1319 |
| 607 | Ga0207706_10001560 | 3300025933 | Bacteria | 22717 |
| 608 | Ga0207706_10004253 | 3300025933 | Bacteria | 13474 |
| 609 | Ga0207706_10047120 | 3300025933 | Bacteria | 3815 |
| 610 | Ga0207706_10072570 | 3300025933 | Bacteria | 3027 |
| 611 | Ga0207706_10191904 | 3300025933 | Bacteria | 1793 |
| 612 | Ga0207686_10381003 | 3300025934 | Unclassified | 1070 |
| 613 | Ga0207709_10000103 | 3300025935 | Bacteria | 131589 |
| 614 | Ga0207709_10001788 | 3300025935 | Bacteria | 14412 |
| 615 | Ga0207709_10187158 | 3300025935 | Bacteria | 1467 |
| 616 | Ga0207670_10070093 | 3300025936 | Bacteria | 2420 |
| 617 | Ga0207670_10269320 | 3300025936 | Bacteria | 1323 |
| 618 | Ga0207669_10008879 | 3300025937 | Bacteria | 4746 |
| 619 | Ga0207704_10280220 | 3300025938 | Bacteria | 1267 |
| 620 | Ga0207665_10018074 | 3300025939 | Bacteria | 4633 |
| 621 | Ga0207665_10118506 | 3300025939 | Bacteria | 1868 |
| 622 | Ga0207691_10000029 | 3300025940 | Bacteria | 120814 |
| 623 | Ga0207691_10003525 | 3300025940 | Bacteria | 15222 |
| 624 | Ga0207691_10016744 | 3300025940 | Bacteria | 6959 |
| 625 | Ga0207691_10020307 | 3300025940 | Bacteria | 6281 |
| 626 | Ga0207691_10045976 | 3300025940 | Bacteria | 4013 |
| 627 | Ga0207691_10052926 | 3300025940 | Bacteria | 3707 |
| 628 | Ga0207691_10065492 | 3300025940 | Bacteria | 3289 |
| 629 | Ga0207691_10196630 | 3300025940 | Bacteria | 1756 |
| 630 | Ga0207711_10002156 | 3300025941 | Bacteria | 17721 |
| 631 | Ga0207711_10051870 | 3300025941 | Bacteria | 3515 |
| 632 | Ga0207711_10152082 | 3300025941 | Bacteria | 2089 |
| 633 | Ga0207711_10235428 | 3300025941 | Bacteria | 1678 |
| 634 | Ga0207711_10249437 | 3300025941 | Bacteria | 1630 |
| 635 | Ga0207711_10485988 | 3300025941 | Bacteria | 1150 |
| 636 | Ga0207689_10000387 | 3300025942 | Bacteria | 41370 |
| 637 | Ga0207689_10002193 | 3300025942 | Bacteria | 18314 |
| 638 | Ga0207689_10031450 | 3300025942 | Bacteria | 4418 |
| 639 | Ga0207689_10072429 | 3300025942 | Bacteria | 2831 |
| 640 | Ga0207689_10111987 | 3300025942 | Bacteria | 2243 |
| 641 | Ga0207689_10160331 | 3300025942 | Bacteria | 1854 |
| 642 | Ga0207689_10202613 | 3300025942 | Bacteria | 1638 |
| 643 | Ga0207689_10351373 | 3300025942 | Bacteria | 1226 |
| 644 | Ga0207689_10581972 | 3300025942 | Bacteria | 941 |
| 645 | Ga0207661_10019681 | 3300025944 | Bacteria | 5038 |
| 646 | Ga0207679_10034860 | 3300025945 | Bacteria | 3555 |
| 647 | Ga0207679_10046935 | 3300025945 | Bacteria | 3134 |
| 648 | Ga0207679_10103946 | 3300025945 | Bacteria | 2227 |
| 649 | Ga0207679_10136203 | 3300025945 | Bacteria | 1978 |
| 650 | Ga0207679_10607263 | 3300025945 | Bacteria | 986 |
| 651 | Ga0207667_10004959 | 3300025949 | Bacteria | 16259 |
| 652 | Ga0207667_10006229 | 3300025949 | Bacteria | 14478 |
| 653 | Ga0207667_10534652 | 3300025949 | Bacteria | 1187 |
| 654 | Ga0207667_10570797 | 3300025949 | Bacteria | 1143 |
| 655 | Ga0207667_11041048 | 3300025949 | Bacteria | 804 |
| 656 | Ga0207651_10002436 | 3300025960 | Bacteria | 8898 |
| 657 | Ga0207651_10046180 | 3300025960 | Bacteria | 2927 |
| 658 | Ga0207651_10065137 | 3300025960 | Bacteria | 2554 |
| 659 | Ga0207651_10307410 | 3300025960 | Bacteria | 1321 |
| 660 | Ga0207651_10407499 | 3300025960 | Bacteria | 1158 |
| 661 | Ga0207712_10062931 | 3300025961 | Bacteria | 2639 |
| 662 | Ga0207668_10007158 | 3300025972 | Bacteria | 6625 |
| 663 | Ga0207668_10025148 | 3300025972 | Bacteria | 3850 |
| 664 | Ga0207668_10067618 | 3300025972 | Bacteria | 2537 |
| 665 | Ga0207668_10087739 | 3300025972 | Bacteria | 2276 |
| 666 | Ga0207668_10180203 | 3300025972 | Bacteria | 1665 |
| 667 | Ga0207668_10253086 | 3300025972 | Bacteria | 1431 |
| 668 | Ga0207668_10301092 | 3300025972 | Bacteria | 1323 |
| 669 | Ga0207640_10030427 | 3300025981 | Bacteria | 3324 |
| 670 | Ga0207658_10001631 | 3300025986 | Bacteria | 17206 |
| 671 | Ga0207658_10002140 | 3300025986 | Bacteria | 14673 |
| 672 | Ga0207658_10016053 | 3300025986 | Bacteria | 5144 |
| 673 | Ga0207658_10016727 | 3300025986 | Bacteria | 5048 |
| 674 | Ga0207658_10100268 | 3300025986 | Bacteria | 2267 |
| 675 | Ga0207658_10489785 | 3300025986 | Bacteria | 1094 |
| 676 | Ga0207677_10000370 | 3300026023 | Bacteria | 31254 |
| 677 | Ga0207677_10020540 | 3300026023 | Bacteria | 4012 |
| 678 | Ga0207677_10021894 | 3300026023 | Bacteria | 3917 |
| 679 | Ga0207677_10078784 | 3300026023 | Bacteria | 2354 |
| 680 | Ga0207677_10087387 | 3300026023 | Bacteria | 2257 |
| 681 | Ga0207703_10000374 | 3300026035 | Bacteria | 47821 |
| 682 | Ga0207703_10001245 | 3300026035 | Bacteria | 23856 |
| 683 | Ga0207703_10072586 | 3300026035 | Bacteria | 2845 |
| 684 | Ga0207703_10196401 | 3300026035 | Bacteria | 1790 |
| 685 | Ga0207703_10398488 | 3300026035 | Bacteria | 1276 |
| 686 | Ga0207703_10454968 | 3300026035 | Bacteria | 1196 |
| 687 | Ga0207639_10014598 | 3300026041 | Bacteria | 5531 |
| 688 | Ga0207639_10018496 | 3300026041 | Bacteria | 4953 |
| 689 | Ga0207639_10082687 | 3300026041 | Bacteria | 2546 |
| 690 | Ga0207678_10002599 | 3300026067 | Bacteria | 16446 |
| 691 | Ga0207678_10015548 | 3300026067 | Bacteria | 6692 |
| 692 | Ga0207678_10256023 | 3300026067 | Bacteria | 1500 |
| 693 | Ga0207708_10003210 | 3300026075 | Bacteria | 12048 |
| 694 | Ga0207708_10265279 | 3300026075 | Bacteria | 1387 |
| 695 | Ga0207702_10005567 | 3300026078 | Bacteria | 11001 |
| 696 | Ga0207702_10149349 | 3300026078 | Bacteria | 2124 |
| 697 | Ga0207702_10595189 | 3300026078 | Bacteria | 1085 |
| 698 | Ga0207702_10659148 | 3300026078 | Bacteria | 1030 |
| 699 | Ga0207641_10004076 | 3300026088 | Bacteria | 12744 |
| 700 | Ga0207641_10013227 | 3300026088 | Bacteria | 6766 |
| 701 | Ga0207641_10018826 | 3300026088 | Bacteria | 5663 |
| 702 | Ga0207641_10310403 | 3300026088 | Bacteria | 1492 |
| 703 | Ga0207641_10353383 | 3300026088 | Bacteria | 1401 |
| 704 | Ga0207641_10458493 | 3300026088 | Bacteria | 1233 |
| 705 | Ga0207648_10001008 | 3300026089 | Bacteria | 31704 |
| 706 | Ga0207648_10042274 | 3300026089 | Bacteria | 4001 |
| 707 | Ga0207648_10059445 | 3300026089 | Bacteria | 3334 |
| 708 | Ga0207648_10133488 | 3300026089 | Bacteria | 2186 |
| 709 | Ga0207648_10203684 | 3300026089 | Bacteria | 1756 |
| 710 | Ga0207648_10237708 | 3300026089 | Bacteria | 1621 |
| 711 | Ga0207648_10315907 | 3300026089 | Bacteria | 1403 |
| 712 | Ga0207676_10000054 | 3300026095 | Bacteria | 128222 |
| 713 | Ga0207676_10019308 | 3300026095 | Bacteria | 4970 |
| 714 | Ga0207676_10023898 | 3300026095 | Bacteria | 4516 |
| 715 | Ga0207676_10035603 | 3300026095 | Bacteria | 3780 |
| 716 | Ga0207676_10056995 | 3300026095 | Bacteria | 3075 |
| 717 | Ga0207676_10076241 | 3300026095 | Bacteria | 2708 |
| 718 | Ga0207676_10108320 | 3300026095 | Bacteria | 2319 |
| 719 | Ga0207674_10000253 | 3300026116 | Bacteria | 66599 |
| 720 | Ga0207674_10001083 | 3300026116 | Bacteria | 35406 |
| 721 | Ga0207674_10002156 | 3300026116 | Bacteria | 24894 |
| 722 | Ga0207674_10016943 | 3300026116 | Bacteria | 7958 |
| 723 | Ga0207674_10051844 | 3300026116 | Bacteria | 4186 |
| 724 | Ga0207674_10201300 | 3300026116 | Bacteria | 1941 |
| 725 | Ga0207674_10995340 | 3300026116 | Bacteria | 807 |
| 726 | Ga0207675_100000626 | 3300026118 | Bacteria | 34619 |
| 727 | Ga0207675_100000672 | 3300026118 | Bacteria | 33681 |
| 728 | Ga0207675_100034352 | 3300026118 | Bacteria | 4727 |
| 729 | Ga0207675_100057858 | 3300026118 | Bacteria | 3617 |
| 730 | Ga0207675_100086885 | 3300026118 | Unclassified | 2937 |
| 731 | Ga0207675_100131197 | 3300026118 | Bacteria | 2376 |
| 732 | Ga0207675_100314001 | 3300026118 | Bacteria | 1529 |
| 733 | Ga0207675_100323943 | 3300026118 | Bacteria | 1505 |
| 734 | Ga0207683_10000164 | 3300026121 | Bacteria | 56430 |
| 735 | Ga0207683_10005814 | 3300026121 | Bacteria | 10577 |
| 736 | Ga0207683_10011809 | 3300026121 | Bacteria | 7452 |
| 737 | Ga0207683_10015271 | 3300026121 | Bacteria | 6537 |
| 738 | Ga0207683_10168489 | 3300026121 | Bacteria | 1983 |
| 739 | Ga0207683_10514382 | 3300026121 | Bacteria | 1106 |
| 740 | Ga0207683_10931438 | 3300026121 | Bacteria | 807 |
| 741 | Ga0207698_10002040 | 3300026142 | Bacteria | 11911 |
| 742 | Ga0207698_10004482 | 3300026142 | Bacteria | 8519 |
| 743 | Ga0207698_10052160 | 3300026142 | Bacteria | 3132 |
| 744 | Ga0207698_10059417 | 3300026142 | Bacteria | 2969 |
| 745 | Ga0207698_10078526 | 3300026142 | Bacteria | 2651 |
| 746 | Ga0207698_10088686 | 3300026142 | Bacteria | 2523 |
| 747 | Ga0207698_10713660 | 3300026142 | Bacteria | 999 |
| 748 | Ga0209371_1009416 | 3300027312 | Bacteria | 3108 |
| 749 | Ga0209282_1000117 | 3300027666 | Bacteria | 51134 |
| 750 | Ga0209588_1032409 | 3300027671 | Archaea | 1674 |
| 751 | Ga0207428_10018976 | 3300027907 | Bacteria | 5864 |
| 752 | Ga0268266_10003312 | 3300028379 | Bacteria | 16178 |
| 753 | Ga0268266_10007280 | 3300028379 | Bacteria | 10007 |
| 754 | Ga0268266_10039581 | 3300028379 | Bacteria | 4016 |
| 755 | Ga0268266_10118790 | 3300028379 | Bacteria | 2350 |
| 756 | Ga0268265_10002148 | 3300028380 | Bacteria | 15266 |
| 757 | Ga0268265_10043011 | 3300028380 | Bacteria | 3355 |
| 758 | Ga0268265_10173190 | 3300028380 | Bacteria | 1847 |
| 759 | Ga0268265_10214236 | 3300028380 | Bacteria | 1680 |
| 760 | Ga0268264_10001103 | 3300028381 | Bacteria | 26672 |
| 761 | Ga0268264_10008580 | 3300028381 | Bacteria | 8490 |
| 762 | Ga0268264_10009544 | 3300028381 | Bacteria | 8038 |
| 763 | Ga0268264_10016859 | 3300028381 | Bacteria | 5980 |
| 764 | Ga0268264_10087228 | 3300028381 | Bacteria | 2683 |
| 765 | Ga0268264_10176663 | 3300028381 | Bacteria | 1936 |
| 766 | Ga0268264_10931530 | 3300028381 | Bacteria | 873 |
| 767 | Ga0307517_10199229 | 3300028786 | Bacteria | 1255 |
| 768 | Ga0307515_10074155 | 3300028794 | Bacteria | 4557 |
| 769 | Ga0307515_10133948 | 3300028794 | Bacteria | 2708 |
| 770 | Ga0307515_10156065 | 3300028794 | Bacteria | 2355 |
| 771 | Ga0307515_10229015 | 3300028794 | Bacteria | 1656 |
| 772 | Ga0307515_10376683 | 3300028794 | Bacteria | 1053 |
| 773 | Ga0268256_1009978 | 3300030500 | Bacteria | 3108 |
| 774 | Ga0307512_10019834 | 3300030522 | Bacteria | 6112 |
| 775 | Ga0265325_10040386 | 3300031241 | Bacteria | 2450 |
| 776 | Ga0265339_10041942 | 3300031249 | Bacteria | 2536 |
| 777 | Ga0265331_10019496 | 3300031250 | Bacteria | 3503 |
| 778 | Ga0265327_10052300 | 3300031251 | Bacteria | 2127 |
| 779 | Ga0307513_10000090 | 3300031456 | Bacteria | 129750 |
| 780 | Ga0307513_10502329 | 3300031456 | Bacteria | 930 |
| 781 | Ga0307509_10000157 | 3300031507 | Bacteria | 106022 |
| 782 | Ga0307408_100167064 | 3300031548 | Bacteria | 1753 |
| 783 | Ga0265313_10000408 | 3300031595 | Bacteria | 46126 |
| 784 | Ga0307514_10004434 | 3300031649 | Bacteria | 12921 |
| 785 | Ga0307514_10068072 | 3300031649 | Bacteria | 2685 |
| 786 | Ga0307514_10255879 | 3300031649 | Bacteria | 1031 |
| 787 | Ga0265314_10025397 | 3300031711 | Bacteria | 4469 |
| 788 | Ga0265342_10017753 | 3300031712 | Bacteria | 4621 |
| 789 | Ga0307516_10083461 | 3300031730 | Bacteria | 3036 |
| 790 | Ga0307516_10108644 | 3300031730 | Bacteria | 2580 |
| 791 | Ga0307516_10365799 | 3300031730 | Bacteria | 1106 |
| 792 | Ga0307405_10506897 | 3300031731 | Bacteria | 968 |
| 793 | Ga0307518_10202859 | 3300031838 | Bacteria | 1315 |
| 794 | Ga0307410_10067714 | 3300031852 | Bacteria | 2464 |
| 795 | Ga0307406_10237264 | 3300031901 | Bacteria | 1365 |
| 796 | Ga0307407_10050849 | 3300031903 | Bacteria | 2373 |
| 797 | Ga0307412_10000103 | 3300031911 | Bacteria | 69660 |
| 798 | Ga0307412_10135886 | 3300031911 | Bacteria | 1794 |
| 799 | Ga0307416_100302784 | 3300032002 | Bacteria | 1590 |
| 800 | Ga0307510_10003490 | 3300033180 | Bacteria | 18320 |
| 801 | Ga0307510_10050330 | 3300033180 | Bacteria | 4421 |
| 802 | Ga0307510_10165550 | 3300033180 | Bacteria | 1800 |
| 803 | Ga0373926_0069117 | 3300035083 | Bacteria | 1296 |
| 804 | Ga0373923_0068041 | 3300035111 | Bacteria | 1524 |
| 805 | Ga0373945_0009050 | 3300035116 | Bacteria | 3254 |
| 806 | Ga0373945_0052026 | 3300035116 | Bacteria | 1508 |
| 807 | Ga0373953_0011049 | 3300035117 | Bacteria | 3157 |
| 808 | Ga0373953_0142511 | 3300035117 | Bacteria | 1025 |
| 809 | Ga0373954_0027905 | 3300035118 | Bacteria | 2593 |
| 810 | Ga0373954_0033876 | 3300035118 | Bacteria | 2364 |
| 811 | Ga0373956_0081633 | 3300035119 | Bacteria | 1484 |
| 812 | Ga0373956_0082517 | 3300035119 | Bacteria | 1476 |
| 813 | Ga0373956_0144394 | 3300035119 | Bacteria | 1118 |
| 814 | Ga0373957_0039296 | 3300035120 | Bacteria | 1774 |
| 815 | Ga0373943_0007400 | 3300035170 | Bacteria | 4931 |
| 816 | Ga0373943_0019919 | 3300035170 | Bacteria | 3090 |
| 817 | Ga0373946_0009476 | 3300035171 | Bacteria | 3589 |
| 818 | Ga0373946_0012966 | 3300035171 | Bacteria | 3127 |
| 819 | Ga0373955_0090097 | 3300035172 | Bacteria | 1746 |
| 820 | Ga0373931_0041360 | 3300035691 | Bacteria | 2421 |
| 821 | Ga0373931_0267013 | 3300035691 | Bacteria | 1046 |
| 822 | Ga0373935_0003835 | 3300035692 | Bacteria | 8768 |
| 823 | Ga0373935_0011519 | 3300035692 | Bacteria | 5309 |
| 824 | Ga0373935_0074394 | 3300035692 | Bacteria | 2196 |
| 825 | Ga0373935_0783590 | 3300035692 | Bacteria | 703 |
| 826 | Ga0373927_0008783 | 3300035695 | Bacteria | 6791 |
| 827 | Ga0373927_0238663 | 3300035695 | Bacteria | 1194 |
| 828 | Ga0373933_0073002 | 3300035724 | Bacteria | 2090 |
| 829 | Ga0373933_0102376 | 3300035724 | Bacteria | 1778 |
| 830 | Ga0373933_0132089 | 3300035724 | Bacteria | 1571 |
| 831 | Ga0373947_0195196 | 3300035725 | Bacteria | 1322 |
| 832 | Ga0373937_0005447 | 3300036401 | Bacteria | 10896 |
| 833 | Ga0373937_0031765 | 3300036401 | Bacteria | 4786 |
| 834 | Ga0373937_0034002 | 3300036401 | Bacteria | 4634 |
| 835 | Ga0373937_0057274 | 3300036401 | Bacteria | 3580 |
| 836 | Ga0373925_0005352 | 3300037068 | Bacteria | 9575 |
| 837 | Ga0373925_0005721 | 3300037068 | Bacteria | 9243 |
| 838 | Ga0373925_0045998 | 3300037068 | Bacteria | 3243 |
| 839 | Ga0373925_0111746 | 3300037068 | Bacteria | 2112 |
| 840 | Ga0395899_0169155 | 3300037312 | Bacteria | 1540 |
| 841 | Ga0436364_1272123 | 3300037853 | Bacteria | 1560 |
| 842 | Ga0395901_0666498 | 3300038443 | Unclassified | 1042 |
| 843 | Ga0436365_0234696 | 3300039437 | Bacteria | 3633 |
| 844 | Ga0436361_0505856 | 3300039447 | Bacteria | 3124 |
| 845 | Ga0436361_0608376 | 3300039447 | Bacteria | 19212 |
| 846 | Ga0436361_1150952 | 3300039447 | Bacteria | 846 |
| 847 | Ga0439465_0017823 | 3300041413 | Bacteria | 2219 |
| 848 | Ga0451797_1197028 | 3300041453 | Bacteria | 1054 |
| 849 | Ga0451807_1842326 | 3300041486 | Bacteria | 1984 |
| 850 | Ga0439455_0020293 | 3300042012 | Bacteria | 1574 |
| 851 | Ga0451577_0030876 | 3300042876 | Bacteria | 4838 |
| 852 | Ga0453683_0015585 | 3300044673 | Bacteria | 4919 |
| 853 | Ga0453683_0039914 | 3300044673 | Bacteria | 2950 |
| 854 | Ga0453684_0076543 | 3300044712 | Bacteria | 4200 |
| 855 | Ga0466957_0518864 | 3300044842 | Bacteria | 828 |
| 856 | Ga0466959_0024404 | 3300045049 | Bacteria | 4479 |
| 857 | Ga0466967_0830168 | 3300045976 | Bacteria | 918 |
| 858 | Ga0495627_001781 | 3300046453 | Bacteria | 11533 |
| 859 | Ga0495627_026616 | 3300046453 | Bacteria | 1863 |
| 860 | Ga0495592_0000058 | 3300046454 | Bacteria | 101492 |
| 861 | Ga0495603_0024655 | 3300046455 | Bacteria | 3639 |
| 862 | Ga0495629_0062605 | 3300046459 | Bacteria | 2598 |
| 863 | Ga0495629_0189013 | 3300046459 | Bacteria | 1426 |
| 864 | Ga0495638_0059645 | 3300046460 | Bacteria | 2362 |
| 865 | Ga0495651_0013472 | 3300046462 | Bacteria | 6324 |
| 866 | Ga0495651_0030050 | 3300046462 | Bacteria | 4237 |
| 867 | Ga0495580_0027386 | 3300046472 | Bacteria | 4147 |
| 868 | Ga0495580_0100726 | 3300046472 | Bacteria | 2009 |
| 869 | Ga0495582_0006058 | 3300046473 | Bacteria | 6738 |
| 870 | Ga0495639_0000527 | 3300046475 | Bacteria | 17920 |
| 871 | Ga0495639_0003337 | 3300046475 | Bacteria | 6960 |
| 872 | Ga0495662_0014614 | 3300046476 | Bacteria | 3816 |
| 873 | Ga0495594_0076572 | 3300046499 | Bacteria | 1865 |
| 874 | Ga0495583_0135558 | 3300046506 | Bacteria | 1028 |
| 875 | Ga0495606_0120222 | 3300046507 | Bacteria | 1573 |
| 876 | Ga0495608_0284989 | 3300046511 | Bacteria | 1025 |
| 877 | Ga0495616_0059701 | 3300046513 | Bacteria | 1875 |
| 878 | Ga0495618_0370786 | 3300046514 | Bacteria | 880 |
| 879 | Ga0495620_0040968 | 3300046515 | Bacteria | 2034 |
| 880 | Ga0495628_0043368 | 3300046516 | Bacteria | 3584 |
| 881 | Ga0495630_0208614 | 3300046517 | Bacteria | 1491 |
| 882 | Ga0495630_0210615 | 3300046517 | Bacteria | 1483 |
| 883 | Ga0495631_0091461 | 3300046518 | Bacteria | 1310 |
| 884 | Ga0495637_0028144 | 3300046520 | Bacteria | 2511 |
| 885 | Ga0495642_0041217 | 3300046528 | Bacteria | 1878 |
| 886 | Ga0495654_0006581 | 3300046530 | Bacteria | 6580 |
| 887 | Ga0495665_0001980 | 3300046531 | Bacteria | 11071 |
| 888 | Ga0495640_0045396 | 3300046533 | Bacteria | 3049 |
| 889 | Ga0495586_0073032 | 3300046535 | Bacteria | 1876 |
| 890 | Ga0495587_0122264 | 3300046536 | Bacteria | 1491 |
| 891 | Ga0495609_0132502 | 3300046538 | Bacteria | 1067 |
| 892 | Ga0495597_0025222 | 3300046542 | Bacteria | 2738 |
| 893 | Ga0495645_0028657 | 3300046543 | Bacteria | 4047 |
| 894 | Ga0495667_0214978 | 3300046559 | Bacteria | 1228 |
| 895 | Ga0495656_0026379 | 3300046615 | Bacteria | 2313 |
| 896 | Ga0495668_0172949 | 3300046616 | Bacteria | 1183 |
| 897 | Ga0495634_0099614 | 3300046642 | Bacteria | 1879 |
| 898 | Ga0495625_0000044 | 3300046660 | Bacteria | 203855 |
| 899 | Ga0495625_0001757 | 3300046660 | Bacteria | 25057 |
| 900 | Ga0495625_0044628 | 3300046660 | Bacteria | 3208 |
| 901 | Ga0495625_0104581 | 3300046660 | Bacteria | 1941 |
| 902 | Ga0495625_0300703 | 3300046660 | Bacteria | 1027 |
| 903 | Ga0495635_0047625 | 3300046663 | Bacteria | 2955 |
| 904 | Ga0495635_0255909 | 3300046663 | Bacteria | 1180 |
| 905 | Ga0495661_0121689 | 3300046665 | Bacteria | 1441 |
| 906 | Ga0495588_0001981 | 3300046674 | Bacteria | 8759 |
| 907 | Ga0495588_0013031 | 3300046674 | Bacteria | 3951 |
| 908 | Ga0495588_0200652 | 3300046674 | Bacteria | 1054 |
| 909 | Ga0495623_0172121 | 3300046679 | Bacteria | 1264 |
| 910 | Ga0495646_0060741 | 3300046680 | Bacteria | 2253 |
| 911 | Ga0495646_0194311 | 3300046680 | Bacteria | 1108 |
| 912 | Ga0495647_0001991 | 3300046681 | Bacteria | 6379 |
| 913 | Ga0495647_0184587 | 3300046681 | Bacteria | 909 |
| 914 | Ga0495613_0006118 | 3300046689 | Bacteria | 9004 |
| 915 | Ga0495624_0126357 | 3300046690 | Bacteria | 1569 |
| 916 | Ga0495671_0028593 | 3300046692 | Bacteria | 2870 |
| 917 | Ga0495649_0002553 | 3300046694 | Bacteria | 12758 |
| 918 | Ga0495581_0020189 | 3300047315 | Bacteria | 3868 |
| 919 | Ga0495581_0398255 | 3300047315 | Bacteria | 803 |
| 920 | Ga0495674_0040879 | 3300047319 | Bacteria | 4145 |
| 921 | Ga0495687_001915 | 3300047443 | Bacteria | 17872 |
| 922 | Ga0495687_002495 | 3300047443 | Bacteria | 14668 |
| 923 | Ga0495675_0218244 | 3300047444 | Bacteria | 1155 |
| 924 | Ga0495684_0019515 | 3300047471 | Bacteria | 5222 |
| 925 | Ga0495684_0081495 | 3300047471 | Bacteria | 2456 |
| 926 | Ga0495686_0000855 | 3300047472 | Bacteria | 39059 |
| 927 | Ga0495686_0202994 | 3300047472 | Bacteria | 1137 |
| 928 | Ga0495593_0024422 | 3300047673 | Bacteria | 3350 |
| 929 | Ga0495593_0282854 | 3300047673 | Bacteria | 829 |
| 930 | Ga0495602_0116167 | 3300048088 | Bacteria | 2163 |
| 931 | Ga0495602_0443322 | 3300048088 | Bacteria | 918 |
| 932 | Ga0495614_0019890 | 3300048089 | Bacteria | 2904 |
| 933 | Ga0496100_0089520 | 3300048903 | Bacteria | 2097 |
| 934 | Ga0496100_0313655 | 3300048903 | Bacteria | 1176 |
| 935 | Ga0496101_0010070 | 3300048904 | Bacteria | 6232 |
| 936 | Ga0496101_0169288 | 3300048904 | Bacteria | 1678 |
| 937 | Ga0496102_0004685 | 3300048905 | Bacteria | 11569 |
| 938 | Ga0496102_0045183 | 3300048905 | Bacteria | 3998 |
| 939 | Ga0496102_0245232 | 3300048905 | Bacteria | 1689 |
| 940 | Ga0496104_0001915 | 3300048907 | Bacteria | 18040 |
| 941 | Ga0496104_0068512 | 3300048907 | Bacteria | 3372 |
| 942 | Ga0496104_0104566 | 3300048907 | Bacteria | 2713 |
| 943 | Ga0496104_0313739 | 3300048907 | Bacteria | 1481 |
| 944 | Ga0496104_0341078 | 3300048907 | Bacteria | 1411 |
| 945 | Ga0496104_0757074 | 3300048907 | Bacteria | 878 |
| 946 | Ga0496105_0002495 | 3300048908 | Bacteria | 13340 |
| 947 | Ga0496105_0132608 | 3300048908 | Bacteria | 2053 |
| 948 | Ga0496105_0239951 | 3300048908 | Bacteria | 1471 |
| 949 | Ga0496106_0008837 | 3300048909 | Bacteria | 7445 |
| 950 | Ga0496106_0017642 | 3300048909 | Bacteria | 5280 |
| 951 | Ga0496106_0064875 | 3300048909 | Bacteria | 2779 |
| 952 | Ga0496106_0112230 | 3300048909 | Bacteria | 2124 |
| 953 | Ga0496106_0273791 | 3300048909 | Bacteria | 1352 |
| 954 | Ga0496107_0134136 | 3300048910 | Bacteria | 1829 |
| 955 | Ga0496108_0009107 | 3300048911 | Bacteria | 8037 |
| 956 | Ga0496108_0120449 | 3300048911 | Bacteria | 2250 |
| 957 | Ga0496108_0262172 | 3300048911 | Bacteria | 1504 |
| 958 | Ga0496109_0018574 | 3300048912 | Bacteria | 6109 |
| 959 | Ga0496109_0171450 | 3300048912 | Bacteria | 2036 |
| 960 | Ga0496109_0198905 | 3300048912 | Bacteria | 1884 |
| 961 | Ga0496109_0356059 | 3300048912 | Bacteria | 1383 |
| 962 | Ga0496109_0491563 | 3300048912 | Bacteria | 1158 |
| 963 | Ga0496109_0616600 | 3300048912 | Bacteria | 1021 |
| 964 | Ga0496110_0001550 | 3300048913 | Bacteria | 16736 |
| 965 | Ga0496110_0021587 | 3300048913 | Bacteria | 5455 |
| 966 | Ga0496111_0002155 | 3300048914 | Bacteria | 11779 |
| 967 | Ga0496112_0000484 | 3300048915 | Bacteria | 26701 |
| 968 | Ga0496112_0002564 | 3300048915 | Bacteria | 14680 |
| 969 | Ga0496113_0312122 | 3300048916 | Bacteria | 1260 |
| 970 | Ga0496113_0405398 | 3300048916 | Bacteria | 1095 |
| 971 | Ga0496114_0156535 | 3300048917 | Bacteria | 1979 |
| 972 | Ga0496114_0254961 | 3300048917 | Bacteria | 1544 |
| 973 | Ga0496114_0257652 | 3300048917 | Bacteria | 1535 |
| 974 | Ga0496114_0399646 | 3300048917 | Bacteria | 1217 |
| 975 | Ga0496115_0051529 | 3300048918 | Bacteria | 3300 |
| 976 | Ga0496115_0201079 | 3300048918 | Bacteria | 1646 |
| 977 | Ga0496116_0010409 | 3300048919 | Bacteria | 7797 |
| 978 | Ga0496116_0038983 | 3300048919 | Bacteria | 3290 |
| 979 | Ga0496116_0079763 | 3300048919 | Bacteria | 2035 |
| 980 | Ga0496117_0009415 | 3300048920 | Bacteria | 9090 |
| 981 | Ga0496117_0036187 | 3300048920 | Bacteria | 3697 |
| 982 | Ga0496117_0060047 | 3300048920 | Bacteria | 2623 |
| 983 | Ga0496118_0011374 | 3300048921 | Bacteria | 8697 |
| 984 | Ga0496118_0020167 | 3300048921 | Bacteria | 5922 |
| 985 | Ga0496119_0011498 | 3300048922 | Bacteria | 7319 |
| 986 | Ga0496120_0007023 | 3300048923 | Bacteria | 8461 |
| 987 | Ga0496121_0000628 | 3300048924 | Bacteria | 65856 |
| 988 | Ga0496121_0154001 | 3300048924 | Bacteria | 1688 |
| 989 | Ga0496122_0001687 | 3300048925 | Bacteria | 34240 |
| 990 | Ga0496122_0017137 | 3300048925 | Bacteria | 6794 |
| 991 | Ga0496122_0017870 | 3300048925 | Bacteria | 6591 |
| 992 | Ga0496123_0007576 | 3300048926 | Bacteria | 10172 |
| 993 | Ga0496123_0024177 | 3300048926 | Bacteria | 4625 |
| 994 | Ga0496123_0053452 | 3300048926 | Bacteria | 2669 |
| 995 | Ga0496123_0099931 | 3300048926 | Bacteria | 1692 |
| 996 | Ga0496124_0000038 | 3300048927 | Bacteria | 312485 |
| 997 | Ga0496124_0080017 | 3300048927 | Bacteria | 2690 |
| 998 | Ga0496124_0134848 | 3300048927 | Bacteria | 1956 |
| 999 | Ga0496124_0247896 | 3300048927 | Bacteria | 1319 |
| 1000 | Ga0496125_0000101 | 3300048928 | Bacteria | 202248 |
| 1001 | Ga0496125_0002468 | 3300048928 | Bacteria | 24011 |
| 1002 | Ga0496126_0022852 | 3300048929 | Bacteria | 6072 |
| 1003 | Ga0495682_0034033 | 3300049460 | Bacteria | 1880 |
| 1004 | Ga0501032_0119629 | 3300049569 | Bacteria | 1742 |
| 1005 | Ga0501034_0181401 | 3300049571 | Bacteria | 2070 |
| 1006 | Ga0501043_0151525 | 3300049579 | Bacteria | 1815 |
| 1007 | Ga0501069_0361892 | 3300049585 | Unclassified | 856 |
| 1008 | Ga0501035_0005453 | 3300049822 | Bacteria | 12029 |
| 1009 | Ga0501035_0017221 | 3300049822 | Bacteria | 6661 |
| 1010 | Ga0501044_0000617 | 3300049823 | Bacteria | 42992 |
| 1011 | nmdc:mga03683_2310_c1 | 3300050489 | Bacteria | 5904 |
| 1012 | nmdc:mga03n38_163278_c1 | 3300050490 | Bacteria | 1129 |
| 1013 | nmdc:mga00v17_142216_c1 | 3300050491 | Bacteria | 1539 |
| 1014 | nmdc:mga00v17_191249_c1 | 3300050491 | Bacteria | 1322 |
| 1015 | nmdc:mga0k408_21666_c1 | 3300050493 | Bacteria | 3612 |
| 1016 | nmdc:mga0k408_37220_c1 | 3300050493 | Bacteria | 2793 |
| 1017 | nmdc:mga0k408_55853_c2 | 3300050493 | Bacteria | 1392 |
| 1018 | nmdc:mga0k408_61082_c1 | 3300050493 | Bacteria | 2191 |
| 1019 | nmdc:mga06z11_194647_c1 | 3300050494 | Bacteria | 1175 |
| 1020 | nmdc:mga06z11_47515_c1 | 3300050494 | Bacteria | 2180 |
| 1021 | nmdc:mga07m45_106055_c1 | 3300050496 | Bacteria | 1616 |
| 1022 | nmdc:mga07m45_112789_c1 | 3300050496 | Bacteria | 1567 |
| 1023 | nmdc:mga07m45_19464_c1 | 3300050496 | Bacteria | 3679 |
| 1024 | nmdc:mga07m45_2222_c1 | 3300050496 | Bacteria | 9069 |
| 1025 | nmdc:mga07m45_36348_c1 | 3300050496 | Bacteria | 2743 |
| 1026 | nmdc:mga07m45_51032_c1 | 3300050496 | Bacteria | 2332 |
| 1027 | nmdc:mga07m45_9406_c1 | 3300050496 | Bacteria | 5069 |
| 1028 | nmdc:mga05p37_10543_c1 | 3300050507 | Bacteria | 10959 |
| 1029 | nmdc:mga05p37_227233_c1 | 3300050507 | Bacteria | 2250 |
| 1030 | nmdc:mga05p37_347312_c1 | 3300050507 | Bacteria | 1748 |
| 1031 | nmdc:mga05p37_8884_c1 | 3300050507 | Bacteria | 11871 |
| 1032 | nmdc:mga09592_21022_c1 | 3300050508 | Bacteria | 5374 |
| 1033 | nmdc:mga0qj67_154633_c1 | 3300050509 | Unclassified | 1861 |
| 1034 | nmdc:mga06r32_2159_c1 | 3300050510 | Bacteria | 17603 |
| 1035 | nmdc:mga06r32_8090_c1 | 3300050510 | Bacteria | 9460 |
| 1036 | nmdc:mga08y16_7489_c2 | 3300050511 | Bacteria | 10430 |
| 1037 | nmdc:mga08y16_824970_c1 | 3300050511 | Bacteria | 918 |
| 1038 | nmdc:mga0n895_1032_c1 | 3300050512 | Bacteria | 20251 |
| 1039 | nmdc:mga0n895_157502_c1 | 3300050512 | Bacteria | 2302 |
| 1040 | nmdc:mga0n895_302748_c1 | 3300050512 | Bacteria | 1621 |
| 1041 | nmdc:mga0n895_652503_c1 | 3300050512 | Bacteria | 1051 |
| 1042 | nmdc:mga0rr50_1036592_c1 | 3300050513 | Bacteria | 698 |
| 1043 | nmdc:mga0rr50_118270_c1 | 3300050513 | Bacteria | 2106 |
| 1044 | nmdc:mga0rr50_1210_c1 | 3300050513 | Bacteria | 14029 |
| 1045 | nmdc:mga0rr50_2039_c1 | 3300050513 | Bacteria | 11268 |
| 1046 | nmdc:mga0rr50_331479_c1 | 3300050513 | Bacteria | 1278 |
| 1047 | nmdc:mga0rr50_3745_c1 | 3300050513 | Bacteria | 8813 |
| 1048 | nmdc:mga08x19_112554_c1 | 3300050514 | Bacteria | 1817 |
| 1049 | nmdc:mga08x19_115329_c1 | 3300050514 | Bacteria | 1795 |
| 1050 | nmdc:mga08x19_13398_c1 | 3300050514 | Bacteria | 4957 |
| 1051 | nmdc:mga08x19_385097_c1 | 3300050514 | Bacteria | 982 |
| 1052 | nmdc:mga08x19_753068_c1 | 3300050514 | Unclassified | 692 |
| 1053 | nmdc:mga0a205_361352_c1 | 3300050515 | Bacteria | 1318 |
| 1054 | nmdc:mga0a205_45974_c1 | 3300050515 | Bacteria | 4210 |
| 1055 | nmdc:mga0a205_501516_c1 | 3300050515 | Bacteria | 1071 |
| 1056 | nmdc:mga0a205_834_c1 | 3300050515 | Bacteria | 25152 |
| 1057 | nmdc:mga0a205_85266_c1 | 3300050515 | Bacteria | 3051 |
| 1058 | nmdc:mga0a205_97803_c1 | 3300050515 | Bacteria | 2834 |
| 1059 | nmdc:mga0sz30_82364_c1 | 3300050516 | Bacteria | 784 |
| 1060 | Ga0495601_0169730 | 3300053077 | Bacteria | 1426 |
| 1061 | Ga0500610_0041935 | 3300053079 | Bacteria | 2367 |
| 1062 | Ga0495619_0010470 | 3300053085 | Bacteria | 5832 |
| 1063 | Ga0500578_0025790 | 3300053086 | Bacteria | 3770 |
| 1064 | Ga0500644_0028309 | 3300053088 | Bacteria | 1751 |
| 1065 | Ga0500651_0076426 | 3300053093 | Bacteria | 2079 |
| 1066 | Ga0500641_0011423 | 3300053096 | Bacteria | 3223 |
| 1067 | Ga0500562_064494 | 3300053108 | Bacteria | 986 |
| 1068 | Ga0500569_035158 | 3300053109 | Bacteria | 1435 |
| 1069 | Ga0500593_000470 | 3300053117 | Bacteria | 16048 |
| 1070 | Ga0500593_000946 | 3300053117 | Bacteria | 10692 |
| 1071 | Ga0500594_0003238 | 3300053118 | Bacteria | 3566 |
| 1072 | Ga0500607_000025 | 3300053121 | Bacteria | 95473 |
| 1073 | Ga0500607_036582 | 3300053121 | Bacteria | 2680 |
| 1074 | Ga0500608_000731 | 3300053122 | Bacteria | 11996 |
| 1075 | Ga0500608_161797 | 3300053122 | Bacteria | 969 |
| 1076 | Ga0500614_015886 | 3300053123 | Bacteria | 1683 |
| 1077 | Ga0500628_003649 | 3300053129 | Bacteria | 2543 |
| 1078 | Ga0500642_0009522 | 3300053130 | Bacteria | 3376 |
| 1079 | Ga0500652_095950 | 3300053131 | Bacteria | 1238 |
| 1080 | Ga0500658_0012428 | 3300053134 | Bacteria | 3142 |
| 1081 | Ga0500559_0000326 | 3300053136 | Bacteria | 35945 |
| 1082 | Ga0500559_0040466 | 3300053136 | Bacteria | 2029 |
| 1083 | Ga0500568_0095497 | 3300053139 | Bacteria | 1118 |
| 1084 | Ga0500574_054975 | 3300053141 | Bacteria | 1146 |
| 1085 | Ga0500616_0060192 | 3300053153 | Bacteria | 1970 |
| 1086 | Ga0500619_018760 | 3300053154 | Bacteria | 1949 |
| 1087 | Ga0500622_0004224 | 3300053156 | Bacteria | 9145 |
| 1088 | Ga0500624_004850 | 3300053157 | Bacteria | 1778 |
| 1089 | Ga0500627_0025325 | 3300053158 | Bacteria | 2437 |
| 1090 | Ga0500627_0039467 | 3300053158 | Bacteria | 2021 |
| 1091 | Ga0500636_0085747 | 3300053177 | Bacteria | 1809 |
| 1092 | Ga0500645_005314 | 3300053730 | Bacteria | 4767 |
| 1093 | Ga0500645_006086 | 3300053730 | Bacteria | 4350 |
| 1094 | Ga0500587_000798 | 3300053739 | Bacteria | 4103 |
| 1095 | Ga0501082_0000460 | 3300060353 | Bacteria | 35943 |
| 1096 | 2511242521 | 2511231002 | Bacteria | 5042903 |
| 1097 | 2513228662 | 2513020051 | Bacteria | 6053213 |
| 1098 | 2585555327 | 2585427530 | Bacteria | 7383882 |
| 1099 | 2599623841 | 2599185214 | Bacteria | 8209958 |
| 1100 | 2599671540 | 2599185226 | Bacteria | 8233575 |
| 1101 | 2599681447 | 2599185227 | Bacteria | 8246414 |
| 1102 | 2599693150 | 2599185229 | Bacteria | 8216126 |
| 1103 | 2644163304 | 2643221628 | Bacteria | 5745828 |
| 1104 | 2644327711 | 2643221658 | Bacteria | 6064537 |
| 1105 | 2644400399 | 2643221672 | Bacteria | 6322190 |
| 1106 | 2738879459 | 2738541307 | Bacteria | 8606193 |
| 1107 | 2770199464 | 2767802442 | Bacteria | 5747986 |
| 1108 | 2835313378 | 2835312727 | Bacteria | 7413381 |
| 1109 | 2841916640 | 2841911363 | Bacteria | 6173697 |
| 1110 | 2841922537 | 2841917233 | Bacteria | 6173500 |
| 1111 | 2885204582 | 2885198086 | Bacteria | 7212419 |
| 1112 | 2885218235 | 2885211737 | Bacteria | 7212420 |
| 1113 | 2928071602 | 2928070936 | Bacteria | 8062541 |
| 1114 | 2941482957 | |||
| 1115 | 2945977358 | 2945972063 | Bacteria | 6086495 |
| 1116 | Ga0207687_10392750 | |||
| 1117 | JGI25159J45721_1008928 | |||
| 1118 | JGI25151J46595_10000460 | |||
| 1119 | JGI25153J46596_10000228 | |||
| 1120 | JGI25160J50197_1004251 | |||
| 1121 | JGI25161J50226_1001723 | |||
| 1122 | Ga0055529_1000705 | |||
| 1123 | Ga0055537_1000190 | |||
| 1124 | Ga0055536_1004906 | |||
| 1125 | Ga0055534_1000244 | |||
| 1126 | Ga0055534_1010940 | |||
| 1127 | Ga0055528_1000244 | |||
| 1128 | Ga0055528_1002980 | |||
| 1129 | Ga0055540_1000365 | |||
| 1130 | Ga0055540_1003214 | |||
| 1131 | Ga0055531_10000454 | |||
| 1132 | Ga0055543_1002319 | |||
| 1133 | Ga0065165_1003670 | |||
| 1134 | Ga0065165_1006190 | |||
| 1135 | Ga0065714_10079601 | |||
| 1136 | Ga0065714_10128417 | |||
| 1137 | Ga0065712_10139642 | |||
| 1138 | Ga0065715_10029996 | |||
| 1139 | Ga0070658_10023452 | |||
| 1140 | Ga0070658_10085564 | |||
| 1141 | Ga0070658_10087738 | |||
| 1142 | Ga0070658_10366548 | |||
| 1143 | Ga0070676_10000429 | |||
| 1144 | Ga0070676_10080157 | |||
| 1145 | Ga0070676_10582460 | |||
| 1146 | Ga0070683_100017860 | |||
| 1147 | Ga0070683_100118762 | |||
| 1148 | Ga0070690_100047354 | |||
| 1149 | Ga0070690_100213023 | |||
| 1150 | Ga0070670_100015560 | |||
| 1151 | Ga0070670_100061667 | |||
| 1152 | Ga0070670_100108358 | |||
| 1153 | Ga0070670_100227560 | |||
| 1154 | Ga0070670_100579029 | |||
| 1155 | Ga0070677_10000318 | |||
| 1156 | Ga0070677_10090197 | |||
| 1157 | Ga0070677_10255358 | |||
| 1158 | Ga0068869_100011628 | |||
| 1159 | Ga0068869_100014878 | |||
| 1160 | Ga0068869_100023109 | |||
| 1161 | Ga0068869_100035853 | |||
| 1162 | Ga0068869_100279164 | |||
| 1163 | Ga0068869_100310054 | |||
| 1164 | Ga0068869_100324701 | |||
| 1165 | Ga0070666_10001248 | |||
| 1166 | Ga0070666_10021254 | |||
| 1167 | Ga0070666_10149192 | |||
| 1168 | Ga0070680_100114148 | |||
| 1169 | Ga0070682_100088725 | |||
| 1170 | Ga0068868_100006699 | |||
| 1171 | Ga0068868_100006918 | |||
| 1172 | Ga0068868_100008681 | |||
| 1173 | Ga0070660_100014237 | |||
| 1174 | Ga0070689_100010843 | |||
| 1175 | Ga0070687_100049122 | |||
| 1176 | Ga0070661_100002482 | |||
| 1177 | Ga0070661_100067497 | |||
| 1178 | Ga0070661_100134314 | |||
| 1179 | Ga0070661_100307813 | |||
| 1180 | Ga0070692_10160889 | |||
| 1181 | Ga0070668_100000600 | |||
| 1182 | Ga0070668_100010699 | |||
| 1183 | Ga0070668_100013049 | |||
| 1184 | Ga0070668_100078656 | |||
| 1185 | Ga0070668_100104229 | |||
| 1186 | Ga0070668_100210502 | |||
| 1187 | Ga0070668_100281157 | |||
| 1188 | Ga0070669_100037985 | |||
| 1189 | Ga0070669_100063953 | |||
| 1190 | Ga0070669_100084149 | |||
| 1191 | Ga0070669_100113971 | |||
| 1192 | Ga0070669_100267640 | |||
| 1193 | Ga0070669_100287944 | |||
| 1194 | Ga0070675_100012243 | |||
| 1195 | Ga0070675_100012605 | |||
| 1196 | Ga0070675_100073164 | |||
| 1197 | Ga0070675_100089289 | |||
| 1198 | Ga0070675_100455744 | |||
| 1199 | Ga0070671_100006670 | |||
| 1200 | Ga0070671_100025462 | |||
| 1201 | Ga0070671_100054790 | |||
| 1202 | Ga0070671_100061058 | |||
| 1203 | Ga0070671_100099246 | |||
| 1204 | Ga0070671_100331127 | |||
| 1205 | Ga0070674_100001769 | |||
| 1206 | Ga0070674_100131810 | |||
| 1207 | Ga0070674_100787867 | |||
| 1208 | Ga0070673_100000043 | |||
| 1209 | Ga0070673_100009905 | |||
| 1210 | Ga0070673_100028796 | |||
| 1211 | Ga0070673_100098621 | |||
| 1212 | Ga0070673_100638515 | |||
| 1213 | Ga0070688_100000219 | |||
| 1214 | Ga0070688_100141545 | |||
| 1215 | Ga0070659_100002063 | |||
| 1216 | Ga0070659_100009634 | |||
| 1217 | Ga0070659_100025142 | |||
| 1218 | Ga0070667_100003833 | |||
| 1219 | Ga0070667_100015102 | |||
| 1220 | Ga0070667_100021260 | |||
| 1221 | Ga0070667_100024756 | |||
| 1222 | Ga0070667_100065001 | |||
| 1223 | Ga0070667_100101894 | |||
| 1224 | Ga0070703_10032329 | |||
| 1225 | Ga0070709_10187448 | |||
| 1226 | Ga0070709_10418566 | |||
| 1227 | Ga0070714_100002832 | |||
| 1228 | Ga0070714_100482821 | |||
| 1229 | Ga0070713_100000018 | |||
| 1230 | Ga0070713_100041293 | |||
| 1231 | Ga0070713_100044375 | |||
| 1232 | Ga0070713_100057945 | |||
| 1233 | Ga0070713_100125793 | |||
| 1234 | Ga0070713_100618253 | |||
| 1235 | Ga0070710_10030569 | |||
| 1236 | Ga0070711_100011188 | |||
| 1237 | Ga0070711_100014390 | |||
| 1238 | Ga0070711_100042541 | |||
| 1239 | Ga0070711_100383736 | |||
| 1240 | Ga0070700_100041397 | |||
| 1241 | Ga0070700_100221428 | |||
| 1242 | Ga0070708_100000053 | |||
| 1243 | Ga0070708_100127942 | |||
| 1244 | Ga0070708_100158407 | |||
| 1245 | Ga0070708_100255356 | |||
| 1246 | Ga0070708_100562992 | |||
| 1247 | Ga0070708_100602538 | |||
| 1248 | Ga0070663_100007766 | |||
| 1249 | Ga0070663_100182206 | |||
| 1250 | Ga0070663_100198919 | |||
| 1251 | Ga0070678_100001872 | |||
| 1252 | Ga0070678_100007077 | |||
| 1253 | Ga0070678_100024049 | |||
| 1254 | Ga0070662_100007746 | |||
| 1255 | Ga0070662_100092227 | |||
| 1256 | Ga0070662_100243915 | |||
| 1257 | Ga0070662_100373797 | |||
| 1258 | Ga0070662_100407611 | |||
| 1259 | Ga0068867_100000983 | |||
| 1260 | Ga0068867_100018676 | |||
| 1261 | Ga0068867_100019770 | |||
| 1262 | Ga0068867_100041932 | |||
| 1263 | Ga0068867_100082898 | |||
| 1264 | Ga0068867_100123023 | |||
| 1265 | Ga0068867_100222844 | |||
| 1266 | Ga0068867_100604302 | |||
| 1267 | Ga0070685_10000897 | |||
| 1268 | Ga0070685_10016145 | |||
| 1269 | Ga0070706_100009767 | |||
| 1270 | Ga0070706_100018128 | |||
| 1271 | Ga0070706_100027298 | |||
| 1272 | Ga0070706_100152836 | |||
| 1273 | Ga0070706_100227435 | |||
| 1274 | Ga0070706_100569405 | |||
| 1275 | Ga0070707_100014859 | |||
| 1276 | Ga0070707_100029343 | |||
| 1277 | Ga0070707_100031830 | |||
| 1278 | Ga0070707_100046390 | |||
| 1279 | Ga0070707_100116120 | |||
| 1280 | Ga0070707_100391099 | |||
| 1281 | Ga0070707_100511758 | |||
| 1282 | Ga0070707_100526143 | |||
| 1283 | Ga0070707_100763286 | |||
| 1284 | Ga0070698_100008351 | |||
| 1285 | Ga0070698_100027258 | |||
| 1286 | Ga0070698_100242247 | |||
| 1287 | Ga0070698_100378755 | |||
| 1288 | Ga0070698_100537725 | |||
| 1289 | Ga0070699_100013545 | |||
| 1290 | Ga0070699_100018721 | |||
| 1291 | Ga0070699_100217887 | |||
| 1292 | Ga0070699_100270239 | |||
| 1293 | Ga0070679_100064406 | |||
| 1294 | Ga0070679_100145229 | |||
| 1295 | Ga0070679_100353113 | |||
| 1296 | Ga0070684_100032906 | |||
| 1297 | Ga0070684_100216169 | |||
| 1298 | Ga0070697_100012228 | |||
| 1299 | Ga0070697_100018433 | |||
| 1300 | Ga0070697_100034401 | |||
| 1301 | Ga0070697_100244489 | |||
| 1302 | Ga0070697_100324172 | |||
| 1303 | Ga0068853_100006747 | |||
| 1304 | Ga0068853_100020924 | |||
| 1305 | Ga0068853_100061370 | |||
| 1306 | Ga0068853_100233001 | |||
| 1307 | Ga0068853_100257261 | |||
| 1308 | Ga0068853_100380669 | |||
| 1309 | Ga0070672_100002787 | |||
| 1310 | Ga0070672_100003389 | |||
| 1311 | Ga0070672_100011101 | |||
| 1312 | Ga0070672_100032687 | |||
| 1313 | Ga0070672_100391600 | |||
| 1314 | Ga0070686_100077739 | |||
| 1315 | Ga0070695_100210812 | |||
| 1316 | Ga0070696_100074437 | |||
| 1317 | Ga0070696_100104327 | |||
| 1318 | Ga0070696_100332829 | |||
| 1319 | Ga0070693_100183002 | |||
| 1320 | Ga0070693_100191343 | |||
| 1321 | Ga0070665_100010279 | |||
| 1322 | Ga0070665_100018064 | |||
| 1323 | Ga0070665_100125882 | |||
| 1324 | Ga0070665_100148184 | |||
| 1325 | Ga0070665_100267344 | |||
| 1326 | Ga0070665_100434151 | |||
| 1327 | Ga0070704_100203921 | |||
| 1328 | Ga0070704_100755110 | |||
| 1329 | Ga0068855_100001509 | |||
| 1330 | Ga0068855_100011108 | |||
| 1331 | Ga0068855_100131288 | |||
| 1332 | Ga0068855_100901776 | |||
| 1333 | Ga0070664_100000382 | |||
| 1334 | Ga0070664_100197339 | |||
| 1335 | Ga0070664_100448106 | |||
| 1336 | Ga0068857_100007158 | |||
| 1337 | Ga0068857_100010100 | |||
| 1338 | Ga0068857_100017326 | |||
| 1339 | Ga0068857_100077510 | |||
| 1340 | Ga0068854_100010442 | |||
| 1341 | Ga0068856_100028014 | |||
| 1342 | Ga0068856_100094449 | |||
| 1343 | Ga0068856_100178068 | |||
| 1344 | Ga0068856_100261514 | |||
| 1345 | Ga0070702_100053956 | |||
| 1346 | Ga0070702_100098708 | |||
| 1347 | Ga0068852_100002701 | |||
| 1348 | Ga0068852_100005218 | |||
| 1349 | Ga0068852_100048369 | |||
| 1350 | Ga0068852_100117088 | |||
| 1351 | Ga0068852_100154509 | |||
| 1352 | Ga0068852_100218881 | |||
| 1353 | Ga0068852_100290955 | |||
| 1354 | Ga0068859_100152522 | |||
| 1355 | Ga0068859_100363034 | |||
| 1356 | Ga0068859_100561597 | |||
| 1357 | Ga0068859_100785938 | |||
| 1358 | Ga0068864_100001799 | |||
| 1359 | Ga0068864_100002340 | |||
| 1360 | Ga0068864_100004987 | |||
| 1361 | Ga0068864_100009580 | |||
| 1362 | Ga0068864_100023249 | |||
| 1363 | Ga0068864_100062625 | |||
| 1364 | Ga0068864_100070196 | |||
| 1365 | Ga0068866_10030573 | |||
| 1366 | Ga0068861_100000216 | |||
| 1367 | Ga0068861_100068209 | |||
| 1368 | Ga0068861_100268643 | |||
| 1369 | Ga0068861_100373578 | |||
| 1370 | Ga0068851_10000318 | |||
| 1371 | Ga0068851_10000574 | |||
| 1372 | Ga0068851_10013088 | |||
| 1373 | Ga0068870_10038013 | |||
| 1374 | Ga0068870_10040151 | |||
| 1375 | Ga0068863_100001833 | |||
| 1376 | Ga0068863_100002646 | |||
| 1377 | Ga0068863_100049794 | |||
| 1378 | Ga0068863_100163531 | |||
| 1379 | Ga0068863_100341123 | |||
| 1380 | Ga0068863_100376061 | |||
| 1381 | Ga0068863_100521071 | |||
| 1382 | Ga0068863_101129285 | |||
| 1383 | Ga0068858_100010655 | |||
| 1384 | Ga0068858_100038836 | |||
| 1385 | Ga0068858_100049069 | |||
| 1386 | Ga0068858_100066258 | |||
| 1387 | Ga0068858_100161174 | |||
| 1388 | Ga0068858_100217391 | |||
| 1389 | Ga0068860_100004954 | |||
| 1390 | Ga0068860_100008957 | |||
| 1391 | Ga0068860_100015761 | |||
| 1392 | Ga0068860_100056596 | |||
| 1393 | Ga0068860_100130466 | |||
| 1394 | Ga0068860_100136251 | |||
| 1395 | Ga0068860_100193385 | |||
| 1396 | Ga0068860_100203376 | |||
| 1397 | Ga0068862_100002123 | |||
| 1398 | Ga0068862_100002912 | |||
| 1399 | Ga0068862_100013943 | |||
| 1400 | Ga0068862_100171632 | |||
| 1401 | Ga0068862_100305463 | |||
| 1402 | Ga0070717_10104550 | |||
| 1403 | Ga0070717_10160156 | |||
| 1404 | Ga0075363_100163025 | |||
| 1405 | Ga0075364_10147759 | |||
| 1406 | Ga0075364_10422649 | |||
| 1407 | Ga0075432_10008595 | |||
| 1408 | Ga0075432_10225068 | |||
| 1409 | Ga0070716_100012365 | |||
| 1410 | Ga0070712_100002661 | |||
| 1411 | Ga0070712_100012249 | |||
| 1412 | Ga0070712_100054698 | |||
| 1413 | Ga0070712_100203067 | |||
| 1414 | Ga0070712_100294192 | |||
| 1415 | Ga0075362_10003903 | |||
| 1416 | Ga0075362_10008343 | |||
| 1417 | Ga0075362_10197722 | |||
| 1418 | Ga0075367_10066906 | |||
| 1419 | Ga0075369_10044743 | |||
| 1420 | Ga0075366_10030351 | |||
| 1421 | Ga0075366_10081232 | |||
| 1422 | Ga0075366_10103685 | |||
| 1423 | Ga0075366_10193715 | |||
| 1424 | Ga0097621_100003909 | |||
| 1425 | Ga0097621_100011838 | |||
| 1426 | Ga0097621_100078767 | |||
| 1427 | Ga0097621_100196056 | |||
| 1428 | Ga0097621_100488748 | |||
| 1429 | Ga0097621_100540325 | |||
| 1430 | Ga0075370_10013523 | |||
| 1431 | Ga0075370_10016809 | |||
| 1432 | Ga0075370_10027764 | |||
| 1433 | Ga0075370_10030332 | |||
| 1434 | Ga0075370_10068530 | |||
| 1435 | Ga0075370_10125410 | |||
| 1436 | Ga0075370_10192013 | |||
| 1437 | Ga0075370_10203835 | |||
| 1438 | Ga0068871_100001413 | |||
| 1439 | Ga0068871_100166479 | |||
| 1440 | Ga0068871_100254010 | |||
| 1441 | Ga0068871_100282397 | |||
| 1442 | Ga0068871_100506484 | |||
| 1443 | Ga0075428_100009152 | |||
| 1444 | Ga0075430_100111486 | |||
| 1445 | Ga0075430_100250639 | |||
| 1446 | Ga0075431_100008054 | |||
| 1447 | Ga0075431_100010310 | |||
| 1448 | Ga0075431_100133961 | |||
| 1449 | Ga0075433_10066103 | |||
| 1450 | Ga0075433_10209260 | |||
| 1451 | Ga0075433_10531303 | |||
| 1452 | Ga0075434_100422065 | |||
| 1453 | Ga0075434_100506023 | |||
| 1454 | Ga0075434_101116484 | |||
| 1455 | Ga0075429_100015645 | |||
| 1456 | Ga0075429_100118770 | |||
| 1457 | Ga0068865_100065259 | |||
| 1458 | Ga0075436_100052689 | |||
| 1459 | Ga0075436_100083211 | |||
| 1460 | Ga0075436_100434648 | |||
| 1461 | Ga0097620_100152504 | |||
| 1462 | Ga0097620_100363051 | |||
| 1463 | Ga0097620_100561619 | |||
| 1464 | Ga0097620_100785884 | |||
| 1465 | Ga0079104_1016194 | |||
| 1466 | Ga0099826_10000044 | |||
| 1467 | Ga0075435_100039068 | |||
| 1468 | Ga0075435_100449259 | |||
| 1469 | Ga0075435_100500504 | |||
| 1470 | Ga0075435_100641038 | |||
| 1471 | Ga0099794_10017711 | |||
| 1472 | Ga0099794_10020806 | |||
| 1473 | Ga0099794_10067732 | |||
| 1474 | Ga0099794_10196723 | |||
| 1475 | Ga0105244_10000642 | |||
| 1476 | Ga0105240_10002759 | |||
| 1477 | Ga0105240_10102699 | |||
| 1478 | Ga0105240_10139138 | |||
| 1479 | Ga0111539_10020068 | |||
| 1480 | Ga0111539_10043530 | |||
| 1481 | Ga0111539_10958203 | |||
| 1482 | Ga0105245_10001770 | |||
| 1483 | Ga0105247_10129505 | |||
| 1484 | Ga0105247_10433814 | |||
| 1485 | Ga0114129_10008075 | |||
| 1486 | Ga0114129_10015344 | |||
| 1487 | Ga0114129_10554708 | |||
| 1488 | Ga0105243_10000674 | |||
| 1489 | Ga0105243_10011504 | |||
| 1490 | Ga0105243_10115449 | |||
| 1491 | Ga0105243_10191629 | |||
| 1492 | Ga0105243_10416468 | |||
| 1493 | Ga0105241_10131169 | |||
| 1494 | Ga0105241_10782368 | |||
| 1495 | Ga0105242_10080901 | |||
| 1496 | Ga0105248_10000918 | |||
| 1497 | Ga0105248_10088978 | |||
| 1498 | Ga0105248_10124237 | |||
| 1499 | Ga0105248_10350385 | |||
| 1500 | Ga0105237_10011550 | |||
| 1501 | Ga0105237_10057988 | |||
| 1502 | Ga0105237_10150429 | |||
| 1503 | Ga0105237_10215267 | |||
| 1504 | Ga0105238_10001347 | |||
| 1505 | Ga0105238_10255875 | |||
| 1506 | Ga0105238_10467029 | |||
| 1507 | Ga0105238_10601223 | |||
| 1508 | Ga0105238_10889391 | |||
| 1509 | Ga0105249_10165386 | |||
| 1510 | Ga0105249_10176225 | |||
| 1511 | Ga0105249_10442333 | |||
| 1512 | Ga0105249_10553627 | |||
| 1513 | Ga0105239_10032488 | |||
| 1514 | Ga0105239_10045063 | |||
| 1515 | Ga0105239_10154415 | |||
| 1516 | Ga0105239_10987921 | |||
| 1517 | Ga0105246_10002072 | |||
| 1518 | Ga0105246_10126817 | |||
| 1519 | Ga0105246_10392241 | |||
| 1520 | Ga0157347_1014065 | |||
| 1521 | Ga0157373_10002009 | |||
| 1522 | Ga0157373_10003095 | |||
| 1523 | Ga0157373_10107785 | |||
| 1524 | Ga0157373_10109619 | |||
| 1525 | Ga0157373_10664144 | |||
| 1526 | Ga0157371_10014516 | |||
| 1527 | Ga0157370_10004298 | |||
| 1528 | Ga0157370_10026577 | |||
| 1529 | Ga0157370_10324300 | |||
| 1530 | Ga0157369_10001502 | |||
| 1531 | Ga0157369_10181978 | |||
| 1532 | Ga0157369_10675773 | |||
| 1533 | Ga0157374_10000978 | |||
| 1534 | Ga0157374_10016654 | |||
| 1535 | Ga0157374_10194123 | |||
| 1536 | Ga0157374_11125232 | |||
| 1537 | Ga0157378_10021855 | |||
| 1538 | Ga0157378_10021940 | |||
| 1539 | Ga0157378_10084625 | |||
| 1540 | Ga0157378_10123429 | |||
| 1541 | Ga0157378_10148252 | |||
| 1542 | Ga0157378_10853989 | |||
| 1543 | Ga0163162_10055082 | |||
| 1544 | Ga0163162_10071092 | |||
| 1545 | Ga0163162_10093099 | |||
| 1546 | Ga0163162_10346748 | |||
| 1547 | Ga0163162_10487444 | |||
| 1548 | Ga0157372_10003604 | |||
| 1549 | Ga0157372_10057440 | |||
| 1550 | Ga0157372_10100101 | |||
| 1551 | Ga0157372_10628573 | |||
| 1552 | Ga0157375_10022136 | |||
| 1553 | Ga0157375_10307573 | |||
| 1554 | Ga0163163_10001615 | |||
| 1555 | Ga0163163_10022110 | |||
| 1556 | Ga0163163_10050597 | |||
| 1557 | Ga0163163_10119519 | |||
| 1558 | Ga0163163_10247821 | |||
| 1559 | Ga0157380_10069858 | |||
| 1560 | Ga0157380_10249992 | |||
| 1561 | Ga0157380_10423468 | |||
| 1562 | Ga0182008_10000794 | |||
| 1563 | Ga0182008_10026721 | |||
| 1564 | Ga0157377_10000479 | |||
| 1565 | Ga0157379_10000044 | |||
| 1566 | Ga0157379_10054468 | |||
| 1567 | Ga0157379_10057344 | |||
| 1568 | Ga0157379_10113398 | |||
| 1569 | Ga0157376_10042690 | |||
| 1570 | Ga0157376_10201250 | |||
| 1571 | Ga0157376_10333592 | |||
| 1572 | Ga0157376_10409317 | |||
| 1573 | Ga0157376_10834294 | |||
| 1574 | Ga0182006_1000690 | |||
| 1575 | Ga0182006_1021734 | |||
| 1576 | Ga0182007_10000223 | |||
| 1577 | Ga0182007_10035384 | |||
| 1578 | Ga0183362_10002 | |||
| 1579 | Ga0163161_10015411 | |||
| 1580 | Ga0163161_10053380 | |||
| 1581 | Ga0209672_108769 | |||
| 1582 | Ga0207425_1003414 | |||
| 1583 | Ga0207425_1012591 | |||
| 1584 | Ga0209129_1000281 | |||
| 1585 | Ga0209565_1000047 | |||
| 1586 | Ga0209565_1000278 | |||
| 1587 | Ga0209565_1006520 | |||
| 1588 | Ga0209455_1002782 | |||
| 1589 | Ga0209673_1000079 | |||
| 1590 | Ga0209673_1000693 | |||
| 1591 | Ga0209130_1000890 | |||
| 1592 | Ga0209130_1003561 | |||
| 1593 | Ga0209675_1000046 | |||
| 1594 | Ga0209675_1000423 | |||
| 1595 | Ga0209675_1010260 | |||
| 1596 | Ga0209676_1000383 | |||
| 1597 | Ga0209676_1018495 | |||
| 1598 | Ga0209025_1001476 | |||
| 1599 | Ga0209025_1016419 | |||
| 1600 | Ga0209025_1020008 | |||
| 1601 | Ga0209564_1002819 | |||
| 1602 | Ga0209758_1000665 | |||
| 1603 | Ga0209758_1010522 | |||
| 1604 | Ga0209050_1065904 | |||
| 1605 | Ga0207426_1000076 | |||
| 1606 | Ga0207426_1000591 | |||
| 1607 | Ga0209051_1000213 | |||
| 1608 | Ga0209051_1000259 | |||
| 1609 | Ga0209257_1000116 | |||
| 1610 | Ga0207697_10000793 | |||
| 1611 | Ga0207697_10012348 | |||
| 1612 | Ga0207656_10003496 | |||
| 1613 | Ga0207656_10029837 | |||
| 1614 | Ga0207655_1001085 | |||
| 1615 | Ga0207653_10010810 | |||
| 1616 | Ga0207682_10000397 | |||
| 1617 | Ga0207682_10004865 | |||
| 1618 | Ga0207682_10129294 | |||
| 1619 | Ga0207692_10007269 | |||
| 1620 | Ga0207692_10052005 | |||
| 1621 | Ga0207692_10203999 | |||
| 1622 | Ga0207688_10066617 | |||
| 1623 | Ga0207688_10076615 | |||
| 1624 | Ga0207688_10214732 | |||
| 1625 | Ga0207680_10011740 | |||
| 1626 | Ga0207680_10037749 | |||
| 1627 | Ga0207680_10052629 | |||
| 1628 | Ga0207680_10133130 | |||
| 1629 | Ga0207680_10390225 | |||
| 1630 | Ga0207647_10279639 | |||
| 1631 | Ga0207685_10119946 | |||
| 1632 | Ga0207699_10104396 | |||
| 1633 | Ga0207699_10116473 | |||
| 1634 | Ga0207645_10000333 | |||
| 1635 | Ga0207645_10083564 | |||
| 1636 | Ga0207645_10444735 | |||
| 1637 | Ga0207643_10003574 | |||
| 1638 | Ga0207643_10420612 | |||
| 1639 | Ga0207705_10048188 | |||
| 1640 | Ga0207705_10429602 | |||
| 1641 | Ga0207684_10000972 | |||
| 1642 | Ga0207684_10001487 | |||
| 1643 | Ga0207684_10004791 | |||
| 1644 | Ga0207684_10008646 | |||
| 1645 | Ga0207684_10014734 | |||
| 1646 | Ga0207684_10093773 | |||
| 1647 | Ga0207684_10122908 | |||
| 1648 | Ga0207684_10148320 | |||
| 1649 | Ga0207684_10220121 | |||
| 1650 | Ga0207684_10278488 | |||
| 1651 | Ga0207654_10005566 | |||
| 1652 | Ga0207707_10026758 | |||
| 1653 | Ga0207707_10209370 | |||
| 1654 | Ga0207695_10025361 | |||
| 1655 | Ga0207695_10043580 | |||
| 1656 | Ga0207695_10218284 | |||
| 1657 | Ga0207695_10633346 | |||
| 1658 | Ga0207671_10046596 | |||
| 1659 | Ga0207671_10202855 | |||
| 1660 | Ga0207671_10419463 | |||
| 1661 | Ga0207693_10003441 | |||
| 1662 | Ga0207693_10003978 | |||
| 1663 | Ga0207693_10010581 | |||
| 1664 | Ga0207693_10014543 | |||
| 1665 | Ga0207663_10118051 | |||
| 1666 | Ga0207663_10148031 | |||
| 1667 | Ga0207663_10547930 | |||
| 1668 | Ga0207660_10016888 | |||
| 1669 | Ga0207662_10039183 | |||
| 1670 | Ga0207662_10096070 | |||
| 1671 | Ga0207657_10015295 | |||
| 1672 | Ga0207657_10018119 | |||
| 1673 | Ga0207657_10028035 | |||
| 1674 | Ga0207649_10005189 | |||
| 1675 | Ga0207649_10015006 | |||
| 1676 | Ga0207649_10299954 | |||
| 1677 | Ga0207649_10313520 | |||
| 1678 | Ga0207652_10142242 | |||
| 1679 | Ga0207652_10174458 | |||
| 1680 | Ga0207652_10175441 | |||
| 1681 | Ga0207652_10462430 | |||
| 1682 | Ga0207646_10004214 | |||
| 1683 | Ga0207646_10011235 | |||
| 1684 | Ga0207646_10012388 | |||
| 1685 | Ga0207646_10012608 | |||
| 1686 | Ga0207646_10025565 | |||
| 1687 | Ga0207646_10106522 | |||
| 1688 | Ga0207646_10296490 | |||
| 1689 | Ga0207646_10323950 | |||
| 1690 | Ga0207646_10809448 | |||
| 1691 | Ga0207681_10026046 | |||
| 1692 | Ga0207681_10030363 | |||
| 1693 | Ga0207681_10520589 | |||
| 1694 | Ga0207694_10008391 | |||
| 1695 | Ga0207694_10038219 | |||
| 1696 | Ga0207694_10281608 | |||
| 1697 | Ga0207650_10005969 | |||
| 1698 | Ga0207650_10007114 | |||
| 1699 | Ga0207650_10008283 | |||
| 1700 | Ga0207650_10017066 | |||
| 1701 | Ga0207650_10090137 | |||
| 1702 | Ga0207650_10111100 | |||
| 1703 | Ga0207650_10129451 | |||
| 1704 | Ga0207650_10221992 | |||
| 1705 | Ga0207650_10458637 | |||
| 1706 | Ga0207650_10895120 | |||
| 1707 | Ga0207659_10003096 | |||
| 1708 | Ga0207659_10030578 | |||
| 1709 | Ga0207687_10000171 | |||
| 1710 | Ga0207700_10000234 | |||
| 1711 | Ga0207700_10214988 | |||
| 1712 | Ga0207664_10028724 | |||
| 1713 | Ga0207664_10273424 | |||
| 1714 | Ga0207644_10064191 | |||
| 1715 | Ga0207644_10074790 | |||
| 1716 | Ga0207644_10101583 | |||
| 1717 | Ga0207644_10138658 | |||
| 1718 | Ga0207644_10329359 | |||
| 1719 | Ga0207644_10350683 | |||
| 1720 | Ga0207690_10019497 | |||
| 1721 | Ga0207690_10271003 | |||
| 1722 | Ga0207706_10001560 | |||
| 1723 | Ga0207706_10004253 | |||
| 1724 | Ga0207706_10047120 | |||
| 1725 | Ga0207706_10072570 | |||
| 1726 | Ga0207706_10191904 | |||
| 1727 | Ga0207686_10381003 | |||
| 1728 | Ga0207709_10000103 | |||
| 1729 | Ga0207709_10001788 | |||
| 1730 | Ga0207709_10187158 | |||
| 1731 | Ga0207670_10070093 | |||
| 1732 | Ga0207670_10269320 | |||
| 1733 | Ga0207669_10008879 | |||
| 1734 | Ga0207704_10280220 | |||
| 1735 | Ga0207665_10018074 | |||
| 1736 | Ga0207665_10118506 | |||
| 1737 | Ga0207691_10000029 | |||
| 1738 | Ga0207691_10003525 | |||
| 1739 | Ga0207691_10016744 | |||
| 1740 | Ga0207691_10020307 | |||
| 1741 | Ga0207691_10045976 | |||
| 1742 | Ga0207691_10052926 | |||
| 1743 | Ga0207691_10065492 | |||
| 1744 | Ga0207691_10196630 | |||
| 1745 | Ga0207711_10002156 | |||
| 1746 | Ga0207711_10051870 | |||
| 1747 | Ga0207711_10152082 | |||
| 1748 | Ga0207711_10235428 | |||
| 1749 | Ga0207711_10249437 | |||
| 1750 | Ga0207711_10485988 | |||
| 1751 | Ga0207689_10000387 | |||
| 1752 | Ga0207689_10002193 | |||
| 1753 | Ga0207689_10031450 | |||
| 1754 | Ga0207689_10072429 | |||
| 1755 | Ga0207689_10111987 | |||
| 1756 | Ga0207689_10160331 | |||
| 1757 | Ga0207689_10202613 | |||
| 1758 | Ga0207689_10351373 | |||
| 1759 | Ga0207689_10581972 | |||
| 1760 | Ga0207661_10019681 | |||
| 1761 | Ga0207679_10034860 | |||
| 1762 | Ga0207679_10046935 | |||
| 1763 | Ga0207679_10103946 | |||
| 1764 | Ga0207679_10136203 | |||
| 1765 | Ga0207679_10607263 | |||
| 1766 | Ga0207667_10004959 | |||
| 1767 | Ga0207667_10006229 | |||
| 1768 | Ga0207667_10534652 | |||
| 1769 | Ga0207667_10570797 | |||
| 1770 | Ga0207667_11041048 | |||
| 1771 | Ga0207651_10002436 | |||
| 1772 | Ga0207651_10046180 | |||
| 1773 | Ga0207651_10065137 | |||
| 1774 | Ga0207651_10307410 | |||
| 1775 | Ga0207651_10407499 | |||
| 1776 | Ga0207712_10062931 | |||
| 1777 | Ga0207668_10007158 | |||
| 1778 | Ga0207668_10025148 | |||
| 1779 | Ga0207668_10067618 | |||
| 1780 | Ga0207668_10087739 | |||
| 1781 | Ga0207668_10180203 | |||
| 1782 | Ga0207668_10253086 | |||
| 1783 | Ga0207668_10301092 | |||
| 1784 | Ga0207640_10030427 | |||
| 1785 | Ga0207658_10001631 | |||
| 1786 | Ga0207658_10002140 | |||
| 1787 | Ga0207658_10016053 | |||
| 1788 | Ga0207658_10016727 | |||
| 1789 | Ga0207658_10100268 | |||
| 1790 | Ga0207658_10489785 | |||
| 1791 | Ga0207677_10000370 | |||
| 1792 | Ga0207677_10020540 | |||
| 1793 | Ga0207677_10021894 | |||
| 1794 | Ga0207677_10078784 | |||
| 1795 | Ga0207677_10087387 | |||
| 1796 | Ga0207703_10000374 | |||
| 1797 | Ga0207703_10001245 | |||
| 1798 | Ga0207703_10072586 | |||
| 1799 | Ga0207703_10196401 | |||
| 1800 | Ga0207703_10398488 | |||
| 1801 | Ga0207703_10454968 | |||
| 1802 | Ga0207639_10014598 | |||
| 1803 | Ga0207639_10018496 | |||
| 1804 | Ga0207639_10082687 | |||
| 1805 | Ga0207678_10002599 | |||
| 1806 | Ga0207678_10015548 | |||
| 1807 | Ga0207678_10256023 | |||
| 1808 | Ga0207708_10003210 | |||
| 1809 | Ga0207708_10265279 | |||
| 1810 | Ga0207702_10005567 | |||
| 1811 | Ga0207702_10149349 | |||
| 1812 | Ga0207702_10595189 | |||
| 1813 | Ga0207702_10659148 | |||
| 1814 | Ga0207641_10004076 | |||
| 1815 | Ga0207641_10013227 | |||
| 1816 | Ga0207641_10018826 | |||
| 1817 | Ga0207641_10310403 | |||
| 1818 | Ga0207641_10353383 | |||
| 1819 | Ga0207641_10458493 | |||
| 1820 | Ga0207648_10001008 | |||
| 1821 | Ga0207648_10042274 | |||
| 1822 | Ga0207648_10059445 | |||
| 1823 | Ga0207648_10133488 | |||
| 1824 | Ga0207648_10203684 | |||
| 1825 | Ga0207648_10237708 | |||
| 1826 | Ga0207648_10315907 | |||
| 1827 | Ga0207676_10000054 | |||
| 1828 | Ga0207676_10019308 | |||
| 1829 | Ga0207676_10023898 | |||
| 1830 | Ga0207676_10035603 | |||
| 1831 | Ga0207676_10056995 | |||
| 1832 | Ga0207676_10076241 | |||
| 1833 | Ga0207676_10108320 | |||
| 1834 | Ga0207674_10000253 | |||
| 1835 | Ga0207674_10001083 | |||
| 1836 | Ga0207674_10002156 | |||
| 1837 | Ga0207674_10016943 | |||
| 1838 | Ga0207674_10051844 | |||
| 1839 | Ga0207674_10201300 | |||
| 1840 | Ga0207674_10995340 | |||
| 1841 | Ga0207675_100000626 | |||
| 1842 | Ga0207675_100000672 | |||
| 1843 | Ga0207675_100034352 | |||
| 1844 | Ga0207675_100057858 | |||
| 1845 | Ga0207675_100086885 | |||
| 1846 | Ga0207675_100131197 | |||
| 1847 | Ga0207675_100314001 | |||
| 1848 | Ga0207675_100323943 | |||
| 1849 | Ga0207683_10000164 | |||
| 1850 | Ga0207683_10005814 | |||
| 1851 | Ga0207683_10011809 | |||
| 1852 | Ga0207683_10015271 | |||
| 1853 | Ga0207683_10168489 | |||
| 1854 | Ga0207683_10514382 | |||
| 1855 | Ga0207683_10931438 | |||
| 1856 | Ga0207698_10002040 | |||
| 1857 | Ga0207698_10004482 | |||
| 1858 | Ga0207698_10052160 | |||
| 1859 | Ga0207698_10059417 | |||
| 1860 | Ga0207698_10078526 | |||
| 1861 | Ga0207698_10088686 | |||
| 1862 | Ga0207698_10713660 | |||
| 1863 | Ga0209371_1009416 | |||
| 1864 | Ga0209282_1000117 | |||
| 1865 | Ga0209588_1032409 | |||
| 1866 | Ga0207428_10018976 | |||
| 1867 | Ga0268266_10003312 | |||
| 1868 | Ga0268266_10007280 | |||
| 1869 | Ga0268266_10039581 | |||
| 1870 | Ga0268266_10118790 | |||
| 1871 | Ga0268265_10002148 | |||
| 1872 | Ga0268265_10043011 | |||
| 1873 | Ga0268265_10173190 | |||
| 1874 | Ga0268265_10214236 | |||
| 1875 | Ga0268264_10001103 | |||
| 1876 | Ga0268264_10008580 | |||
| 1877 | Ga0268264_10009544 | |||
| 1878 | Ga0268264_10016859 | |||
| 1879 | Ga0268264_10087228 | |||
| 1880 | Ga0268264_10176663 | |||
| 1881 | Ga0268264_10931530 | |||
| 1882 | Ga0307517_10199229 | |||
| 1883 | Ga0307515_10074155 | |||
| 1884 | Ga0307515_10133948 | |||
| 1885 | Ga0307515_10156065 | |||
| 1886 | Ga0307515_10229015 | |||
| 1887 | Ga0307515_10376683 | |||
| 1888 | Ga0268256_1009978 | |||
| 1889 | Ga0307512_10019834 | |||
| 1890 | Ga0265325_10040386 | |||
| 1891 | Ga0265339_10041942 | |||
| 1892 | Ga0265331_10019496 | |||
| 1893 | Ga0265327_10052300 | |||
| 1894 | Ga0307513_10000090 | |||
| 1895 | Ga0307513_10502329 | |||
| 1896 | Ga0307509_10000157 | |||
| 1897 | Ga0307408_100167064 | |||
| 1898 | Ga0265313_10000408 | |||
| 1899 | Ga0307514_10004434 | |||
| 1900 | Ga0307514_10068072 | |||
| 1901 | Ga0307514_10255879 | |||
| 1902 | Ga0265314_10025397 | |||
| 1903 | Ga0265342_10017753 | |||
| 1904 | Ga0307516_10083461 | |||
| 1905 | Ga0307516_10108644 | |||
| 1906 | Ga0307516_10365799 | |||
| 1907 | Ga0307405_10506897 | |||
| 1908 | Ga0307518_10202859 | |||
| 1909 | Ga0307410_10067714 | |||
| 1910 | Ga0307406_10237264 | |||
| 1911 | Ga0307407_10050849 | |||
| 1912 | Ga0307412_10000103 | |||
| 1913 | Ga0307412_10135886 | |||
| 1914 | Ga0307416_100302784 | |||
| 1915 | Ga0307510_10003490 | |||
| 1916 | Ga0307510_10050330 | |||
| 1917 | Ga0307510_10165550 | |||
| 1918 | Ga0373926_0069117 | |||
| 1919 | Ga0373923_0068041 | |||
| 1920 | Ga0373945_0009050 | |||
| 1921 | Ga0373945_0052026 | |||
| 1922 | Ga0373953_0011049 | |||
| 1923 | Ga0373953_0142511 | |||
| 1924 | Ga0373954_0027905 | |||
| 1925 | Ga0373954_0033876 | |||
| 1926 | Ga0373956_0081633 | |||
| 1927 | Ga0373956_0082517 | |||
| 1928 | Ga0373956_0144394 | |||
| 1929 | Ga0373957_0039296 | |||
| 1930 | Ga0373943_0007400 | |||
| 1931 | Ga0373943_0019919 | |||
| 1932 | Ga0373946_0009476 | |||
| 1933 | Ga0373946_0012966 | |||
| 1934 | Ga0373955_0090097 | |||
| 1935 | Ga0373931_0041360 | |||
| 1936 | Ga0373931_0267013 | |||
| 1937 | Ga0373935_0003835 | |||
| 1938 | Ga0373935_0011519 | |||
| 1939 | Ga0373935_0074394 | |||
| 1940 | Ga0373935_0783590 | |||
| 1941 | Ga0373927_0008783 | |||
| 1942 | Ga0373927_0238663 | |||
| 1943 | Ga0373933_0073002 | |||
| 1944 | Ga0373933_0102376 | |||
| 1945 | Ga0373933_0132089 | |||
| 1946 | Ga0373947_0195196 | |||
| 1947 | Ga0373937_0005447 | |||
| 1948 | Ga0373937_0031765 | |||
| 1949 | Ga0373937_0034002 | |||
| 1950 | Ga0373937_0057274 | |||
| 1951 | Ga0373925_0005352 | |||
| 1952 | Ga0373925_0005721 | |||
| 1953 | Ga0373925_0045998 | |||
| 1954 | Ga0373925_0111746 | |||
| 1955 | Ga0395899_0169155 | |||
| 1956 | Ga0436364_1272123 | |||
| 1957 | Ga0395901_0666498 | |||
| 1958 | Ga0436365_0234696 | |||
| 1959 | Ga0436361_0505856 | |||
| 1960 | Ga0436361_0608376 | |||
| 1961 | Ga0436361_1150952 | |||
| 1962 | Ga0439465_0017823 | |||
| 1963 | Ga0451797_1197028 | |||
| 1964 | Ga0451807_1842326 | |||
| 1965 | Ga0439455_0020293 | |||
| 1966 | Ga0451577_0030876 | |||
| 1967 | Ga0453683_0015585 | |||
| 1968 | Ga0453683_0039914 | |||
| 1969 | Ga0453684_0076543 | |||
| 1970 | Ga0466957_0518864 | |||
| 1971 | Ga0466959_0024404 | |||
| 1972 | Ga0466967_0830168 | |||
| 1973 | Ga0495627_001781 | |||
| 1974 | Ga0495627_026616 | |||
| 1975 | Ga0495592_0000058 | |||
| 1976 | Ga0495603_0024655 | |||
| 1977 | Ga0495629_0062605 | |||
| 1978 | Ga0495629_0189013 | |||
| 1979 | Ga0495638_0059645 | |||
| 1980 | Ga0495651_0013472 | |||
| 1981 | Ga0495651_0030050 | |||
| 1982 | Ga0495580_0027386 | |||
| 1983 | Ga0495580_0100726 | |||
| 1984 | Ga0495582_0006058 | |||
| 1985 | Ga0495639_0000527 | |||
| 1986 | Ga0495639_0003337 | |||
| 1987 | Ga0495662_0014614 | |||
| 1988 | Ga0495594_0076572 | |||
| 1989 | Ga0495583_0135558 | |||
| 1990 | Ga0495606_0120222 | |||
| 1991 | Ga0495608_0284989 | |||
| 1992 | Ga0495616_0059701 | |||
| 1993 | Ga0495618_0370786 | |||
| 1994 | Ga0495620_0040968 | |||
| 1995 | Ga0495628_0043368 | |||
| 1996 | Ga0495630_0208614 | |||
| 1997 | Ga0495630_0210615 | |||
| 1998 | Ga0495631_0091461 | |||
| 1999 | Ga0495637_0028144 | |||
| 2000 | Ga0495642_0041217 | |||
| 2001 | Ga0495654_0006581 | |||
| 2002 | Ga0495665_0001980 | |||
| 2003 | Ga0495640_0045396 | |||
| 2004 | Ga0495586_0073032 | |||
| 2005 | Ga0495587_0122264 | |||
| 2006 | Ga0495609_0132502 | |||
| 2007 | Ga0495597_0025222 | |||
| 2008 | Ga0495645_0028657 | |||
| 2009 | Ga0495667_0214978 | |||
| 2010 | Ga0495656_0026379 | |||
| 2011 | Ga0495668_0172949 | |||
| 2012 | Ga0495634_0099614 | |||
| 2013 | Ga0495625_0000044 | |||
| 2014 | Ga0495625_0001757 | |||
| 2015 | Ga0495625_0044628 | |||
| 2016 | Ga0495625_0104581 | |||
| 2017 | Ga0495625_0300703 | |||
| 2018 | Ga0495635_0047625 | |||
| 2019 | Ga0495635_0255909 | |||
| 2020 | Ga0495661_0121689 | |||
| 2021 | Ga0495588_0001981 | |||
| 2022 | Ga0495588_0013031 | |||
| 2023 | Ga0495588_0200652 | |||
| 2024 | Ga0495623_0172121 | |||
| 2025 | Ga0495646_0060741 | |||
| 2026 | Ga0495646_0194311 | |||
| 2027 | Ga0495647_0001991 | |||
| 2028 | Ga0495647_0184587 | |||
| 2029 | Ga0495613_0006118 | |||
| 2030 | Ga0495624_0126357 | |||
| 2031 | Ga0495671_0028593 | |||
| 2032 | Ga0495649_0002553 | |||
| 2033 | Ga0495581_0020189 | |||
| 2034 | Ga0495581_0398255 | |||
| 2035 | Ga0495674_0040879 | |||
| 2036 | Ga0495687_001915 | |||
| 2037 | Ga0495687_002495 | |||
| 2038 | Ga0495675_0218244 | |||
| 2039 | Ga0495684_0019515 | |||
| 2040 | Ga0495684_0081495 | |||
| 2041 | Ga0495686_0000855 | |||
| 2042 | Ga0495686_0202994 | |||
| 2043 | Ga0495593_0024422 | |||
| 2044 | Ga0495593_0282854 | |||
| 2045 | Ga0495602_0116167 | |||
| 2046 | Ga0495602_0443322 | |||
| 2047 | Ga0495614_0019890 | |||
| 2048 | Ga0496100_0089520 | |||
| 2049 | Ga0496100_0313655 | |||
| 2050 | Ga0496101_0010070 | |||
| 2051 | Ga0496101_0169288 | |||
| 2052 | Ga0496102_0004685 | |||
| 2053 | Ga0496102_0045183 | |||
| 2054 | Ga0496102_0245232 | |||
| 2055 | Ga0496104_0001915 | |||
| 2056 | Ga0496104_0068512 | |||
| 2057 | Ga0496104_0104566 | |||
| 2058 | Ga0496104_0313739 | |||
| 2059 | Ga0496104_0341078 | |||
| 2060 | Ga0496104_0757074 | |||
| 2061 | Ga0496105_0002495 | |||
| 2062 | Ga0496105_0132608 | |||
| 2063 | Ga0496105_0239951 | |||
| 2064 | Ga0496106_0008837 | |||
| 2065 | Ga0496106_0017642 | |||
| 2066 | Ga0496106_0064875 | |||
| 2067 | Ga0496106_0112230 | |||
| 2068 | Ga0496106_0273791 | |||
| 2069 | Ga0496107_0134136 | |||
| 2070 | Ga0496108_0009107 | |||
| 2071 | Ga0496108_0120449 | |||
| 2072 | Ga0496108_0262172 | |||
| 2073 | Ga0496109_0018574 | |||
| 2074 | Ga0496109_0171450 | |||
| 2075 | Ga0496109_0198905 | |||
| 2076 | Ga0496109_0356059 | |||
| 2077 | Ga0496109_0491563 | |||
| 2078 | Ga0496109_0616600 | |||
| 2079 | Ga0496110_0001550 | |||
| 2080 | Ga0496110_0021587 | |||
| 2081 | Ga0496111_0002155 | |||
| 2082 | Ga0496112_0000484 | |||
| 2083 | Ga0496112_0002564 | |||
| 2084 | Ga0496113_0312122 | |||
| 2085 | Ga0496113_0405398 | |||
| 2086 | Ga0496114_0156535 | |||
| 2087 | Ga0496114_0254961 | |||
| 2088 | Ga0496114_0257652 | |||
| 2089 | Ga0496114_0399646 | |||
| 2090 | Ga0496115_0051529 | |||
| 2091 | Ga0496115_0201079 | |||
| 2092 | Ga0496116_0010409 | |||
| 2093 | Ga0496116_0038983 | |||
| 2094 | Ga0496116_0079763 | |||
| 2095 | Ga0496117_0009415 | |||
| 2096 | Ga0496117_0036187 | |||
| 2097 | Ga0496117_0060047 | |||
| 2098 | Ga0496118_0011374 | |||
| 2099 | Ga0496118_0020167 | |||
| 2100 | Ga0496119_0011498 | |||
| 2101 | Ga0496120_0007023 | |||
| 2102 | Ga0496121_0000628 | |||
| 2103 | Ga0496121_0154001 | |||
| 2104 | Ga0496122_0001687 | |||
| 2105 | Ga0496122_0017137 | |||
| 2106 | Ga0496122_0017870 | |||
| 2107 | Ga0496123_0007576 | |||
| 2108 | Ga0496123_0024177 | |||
| 2109 | Ga0496123_0053452 | |||
| 2110 | Ga0496123_0099931 | |||
| 2111 | Ga0496124_0000038 | |||
| 2112 | Ga0496124_0080017 | |||
| 2113 | Ga0496124_0134848 | |||
| 2114 | Ga0496124_0247896 | |||
| 2115 | Ga0496125_0000101 | |||
| 2116 | Ga0496125_0002468 | |||
| 2117 | Ga0496126_0022852 | |||
| 2118 | Ga0495682_0034033 | |||
| 2119 | Ga0501032_0119629 | |||
| 2120 | Ga0501034_0181401 | |||
| 2121 | Ga0501043_0151525 | |||
| 2122 | Ga0501069_0361892 | |||
| 2123 | Ga0501035_0005453 | |||
| 2124 | Ga0501035_0017221 | |||
| 2125 | Ga0501044_0000617 | |||
| 2126 | nmdc:mga03683_2310_c1 | |||
| 2127 | nmdc:mga03n38_163278_c1 | |||
| 2128 | nmdc:mga00v17_142216_c1 | |||
| 2129 | nmdc:mga00v17_191249_c1 | |||
| 2130 | nmdc:mga0k408_21666_c1 | |||
| 2131 | nmdc:mga0k408_37220_c1 | |||
| 2132 | nmdc:mga0k408_55853_c2 | |||
| 2133 | nmdc:mga0k408_61082_c1 | |||
| 2134 | nmdc:mga06z11_194647_c1 | |||
| 2135 | nmdc:mga06z11_47515_c1 | |||
| 2136 | nmdc:mga07m45_106055_c1 | |||
| 2137 | nmdc:mga07m45_112789_c1 | |||
| 2138 | nmdc:mga07m45_19464_c1 | |||
| 2139 | nmdc:mga07m45_2222_c1 | |||
| 2140 | nmdc:mga07m45_36348_c1 | |||
| 2141 | nmdc:mga07m45_51032_c1 | |||
| 2142 | nmdc:mga07m45_9406_c1 | |||
| 2143 | nmdc:mga05p37_10543_c1 | |||
| 2144 | nmdc:mga05p37_227233_c1 | |||
| 2145 | nmdc:mga05p37_347312_c1 | |||
| 2146 | nmdc:mga05p37_8884_c1 | |||
| 2147 | nmdc:mga09592_21022_c1 | |||
| 2148 | nmdc:mga0qj67_154633_c1 | |||
| 2149 | nmdc:mga06r32_2159_c1 | |||
| 2150 | nmdc:mga06r32_8090_c1 | |||
| 2151 | nmdc:mga08y16_7489_c2 | |||
| 2152 | nmdc:mga08y16_824970_c1 | |||
| 2153 | nmdc:mga0n895_1032_c1 | |||
| 2154 | nmdc:mga0n895_157502_c1 | |||
| 2155 | nmdc:mga0n895_302748_c1 | |||
| 2156 | nmdc:mga0n895_652503_c1 | |||
| 2157 | nmdc:mga0rr50_1036592_c1 | |||
| 2158 | nmdc:mga0rr50_118270_c1 | |||
| 2159 | nmdc:mga0rr50_1210_c1 | |||
| 2160 | nmdc:mga0rr50_2039_c1 | |||
| 2161 | nmdc:mga0rr50_331479_c1 | |||
| 2162 | nmdc:mga0rr50_3745_c1 | |||
| 2163 | nmdc:mga08x19_112554_c1 | |||
| 2164 | nmdc:mga08x19_115329_c1 | |||
| 2165 | nmdc:mga08x19_13398_c1 | |||
| 2166 | nmdc:mga08x19_385097_c1 | |||
| 2167 | nmdc:mga08x19_753068_c1 | |||
| 2168 | nmdc:mga0a205_361352_c1 | |||
| 2169 | nmdc:mga0a205_45974_c1 | |||
| 2170 | nmdc:mga0a205_501516_c1 | |||
| 2171 | nmdc:mga0a205_834_c1 | |||
| 2172 | nmdc:mga0a205_85266_c1 | |||
| 2173 | nmdc:mga0a205_97803_c1 | |||
| 2174 | nmdc:mga0sz30_82364_c1 | |||
| 2175 | Ga0495601_0169730 | |||
| 2176 | Ga0500610_0041935 | |||
| 2177 | Ga0495619_0010470 | |||
| 2178 | Ga0500578_0025790 | |||
| 2179 | Ga0500644_0028309 | |||
| 2180 | Ga0500651_0076426 | |||
| 2181 | Ga0500641_0011423 | |||
| 2182 | Ga0500562_064494 | |||
| 2183 | Ga0500569_035158 | |||
| 2184 | Ga0500593_000470 | |||
| 2185 | Ga0500593_000946 | |||
| 2186 | Ga0500594_0003238 | |||
| 2187 | Ga0500607_000025 | |||
| 2188 | Ga0500607_036582 | |||
| 2189 | Ga0500608_000731 | |||
| 2190 | Ga0500608_161797 | |||
| 2191 | Ga0500614_015886 | |||
| 2192 | Ga0500628_003649 | |||
| 2193 | Ga0500642_0009522 | |||
| 2194 | Ga0500652_095950 | |||
| 2195 | Ga0500658_0012428 | |||
| 2196 | Ga0500559_0000326 | |||
| 2197 | Ga0500559_0040466 | |||
| 2198 | Ga0500568_0095497 | |||
| 2199 | Ga0500574_054975 | |||
| 2200 | Ga0500616_0060192 | |||
| 2201 | Ga0500619_018760 | |||
| 2202 | Ga0500622_0004224 | |||
| 2203 | Ga0500624_004850 | |||
| 2204 | Ga0500627_0025325 | |||
| 2205 | Ga0500627_0039467 | |||
| 2206 | Ga0500636_0085747 | |||
| 2207 | Ga0500645_005314 | |||
| 2208 | Ga0500645_006086 | |||
| 2209 | Ga0500587_000798 | |||
| 2210 | Ga0501082_0000460 | |||
| 2211 | 2511242521 | |||
| 2212 | 2513228662 | |||
| 2213 | 2585555327 | |||
| 2214 | 2599623841 | |||
| 2215 | 2599671540 | |||
| 2216 | 2599681447 | |||
| 2217 | 2599693150 | |||
| 2218 | 2644163304 | |||
| 2219 | 2644327711 | |||
| 2220 | 2644400399 | |||
| 2221 | 2738879459 | |||
| 2222 | 2770199464 | |||
| 2223 | 2835313378 | |||
| 2224 | 2841916640 | |||
| 2225 | 2841922537 | |||
| 2226 | 2885204582 | |||
| 2227 | 2885218235 | |||
| 2228 | 2928071602 | |||
| 2229 | 2941482957 | |||
| 2230 | 2945977358 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
33
217
0.91
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ymu-assembly1.cif.gz_C | crystal structure of an amino acid abc transporter complex with arginines and atps | 0.8099 | 1 | 214 |
| 4ymu-assembly1.cif.gz_C | crystal structure of an amino acid abc transporter complex with arginines and atps | 0.8032 | 1 | 214 |
| 4jbw-assembly1.cif.gz_F | crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc | 0.7192 | 20 | 160 |
| 4jbw-assembly2.cif.gz_H | crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc | 0.7091 | 11 | 160 |
| 7mc0-assembly1.cif.gz_B | inward facing conformation of the metni methionine abc transporter | 0.7019 | 6 | 215 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4ymsD00 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8057 | 1 | 215 | 1.10.3720.10 |
| af_P0AFT2_3_219_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8017 | 6 | 214 | 1.10.3720.10 |
| af_P0AEQ6_1_218_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8009 | 1 | 217 | 1.10.3720.10 |
| 4ymsD00 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.799 | 1 | 215 | 1.10.3720.10 |
| af_P52094_1_222_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.7957 | 8 | 217 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2W6XUN9-F1-model_v4 | ABC transporter permease | 0.8717 | 1 | 168 |
GO:0006865
GO:0022857 GO:0043190 |
| AF-A0A4Q0IZF8-F1-model_v4 | deleted | 0.87 | 22 | 167 |
|
| AF-A0A5N8A1F9-F1-model_v4 | Amino acid ABC transporter permease | 0.8682 | 1 | 168 |
GO:0006865
GO:0022857 GO:0043190 |
| AF-A0A1Q4AME9-F1-model_v4 | ABC transmembrane type-1 domain-containing protein | 0.8642 | 1 | 215 |
GO:0006865
GO:0022857 GO:0043190 |
| AF-A0A7Z7YS21-F1-model_v4 | Amino acid ABC transporter permease | 0.8637 | 17 | 158 |
GO:0006865
GO:0015675 GO:0022857 GO:0043190 |