F490294
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1115 | 459 | 2230 | 247 |
Family's Representative Sequence
| Representative Sequence | 3300031251|Ga0265327_10013343|Ga0265327_100133433 |
| Length | 262 |
| Sequence | LATELATGSASGGAAAQPPGTLLELDNVVAGYGKMMVLKGTSFKVARGKITTIIGPNGAGKSTVFKAVFGLLKPQSGKILYNGADITGWSQRRLLEAGICYVPQGRNIFPELSVRHNLELGGVAAGRGIDLQARIEGVMQRFSMLKSKADAQASTLSGGQQKLLEIARGLLLDPQLILIDEPSIGLSPLLVQETFRILTGLRDKGVTILMVEQNARSALQMSDYGIVLETGETRIEDSAANILADPRIGQLFLGGGLAPKPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 2 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 3 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 4 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 5 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 6 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 7 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 8 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 9 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 10 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 11 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 12 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 13 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 14 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 15 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 16 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 17 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 18 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 20 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 27 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 31 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 62 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 69 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 77 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 79 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 80 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 81 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 83 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 84 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 85 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 86 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 87 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 88 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 89 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 90 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 91 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 92 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 93 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 94 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 95 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 96 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 97 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 99 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 100 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 101 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 102 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 103 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 104 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 105 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 106 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 107 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 108 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 109 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 110 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 112 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 113 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 114 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 115 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 116 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 117 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 118 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 119 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 120 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 122 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 123 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 226 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 228 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 232 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 233 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 234 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 235 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 236 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 237 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 238 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 239 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 240 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 241 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 242 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 243 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 244 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 245 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 246 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 247 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 248 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 249 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 250 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 251 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 252 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 253 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 254 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 255 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 256 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 257 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 258 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 259 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 260 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 261 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 262 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 263 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 264 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 265 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 266 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 267 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 268 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 269 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 270 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 271 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 272 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 273 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 274 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 275 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 276 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 277 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 278 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 279 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 280 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 281 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 282 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 283 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 284 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 285 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 286 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 287 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 288 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 289 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 290 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 291 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 292 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 359 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 360 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 361 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 362 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 363 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 364 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 365 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 366 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 367 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 368 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 369 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 370 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 371 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 372 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 373 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 374 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 395 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 399 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 400 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 401 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 402 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 405 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 406 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 407 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 408 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 409 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 410 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 411 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 412 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 413 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 414 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 417 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 418 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 419 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 420 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 421 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 422 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 423 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 424 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 429 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 430 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 431 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 432 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 433 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 434 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 435 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 436 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 437 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 438 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 439 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 440 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 441 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 442 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 443 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 444 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 445 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 446 | 2883354860 | Hypericibacter adhaerens R5959 | Isolate | Rhizosphere |
| 447 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 448 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 449 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 450 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 451 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 452 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 453 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 454 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 455 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 456 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 457 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 458 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 459 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.48 |
| Metatranscriptomes | 0 |
| Isolates | 1.52 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.16 |
| Nodule | 1.26 |
| Rhizoplane | 8.34 |
| Rhizosphere | 81.35 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0265327_10013343 | 3300031251 | Bacteria | 5463 |
| 2 | JGI24032J14994_100195 | 3300001430 | Bacteria | 3101 |
| 3 | JGI24736J21556_1018891 | 3300001904 | Bacteria | 1090 |
| 4 | JGI24746J21847_1000023 | 3300001977 | Bacteria | 14867 |
| 5 | JGI24747J21853_1007192 | 3300001978 | Bacteria | 1066 |
| 6 | JGI24740J21852_10006000 | 3300001979 | Bacteria | 5080 |
| 7 | JGI24739J22299_10000241 | 3300001989 | Bacteria | 18446 |
| 8 | JGI24737J22298_10000224 | 3300001990 | Bacteria | 18603 |
| 9 | JGI24750J21931_1002931 | 3300002070 | Bacteria | 2042 |
| 10 | JGI24745J21846_1003827 | 3300002073 | Bacteria | 1589 |
| 11 | JGI24748J21848_1000156 | 3300002074 | Bacteria | 10018 |
| 12 | JGI24749J21850_1000332 | 3300002076 | Bacteria | 7165 |
| 13 | JGI24035J26624_1000018 | 3300002126 | Bacteria | 11637 |
| 14 | JGI24033J26618_1001362 | 3300002155 | Bacteria | 2422 |
| 15 | JGI24742J22300_10000292 | 3300002244 | Bacteria | 7472 |
| 16 | JGI24742J22300_10008452 | 3300002244 | Bacteria | 1698 |
| 17 | JGI24751J29686_10015572 | 3300002459 | Bacteria | 1568 |
| 18 | JGI25405J52794_10028243 | 3300003911 | Bacteria | 1157 |
| 19 | Ga0065704_10213197 | 3300005289 | Bacteria | 1101 |
| 20 | Ga0065712_10078486 | 3300005290 | Bacteria | 3341 |
| 21 | Ga0065715_10094438 | 3300005293 | Bacteria | 4334 |
| 22 | Ga0070676_10000629 | 3300005328 | Bacteria | 17200 |
| 23 | Ga0070683_100000240 | 3300005329 | Bacteria | 37588 |
| 24 | Ga0070683_100469829 | 3300005329 | Bacteria | 1201 |
| 25 | Ga0070690_100277390 | 3300005330 | Bacteria | 1194 |
| 26 | Ga0070670_100002399 | 3300005331 | Bacteria | 15441 |
| 27 | Ga0070670_100005146 | 3300005331 | Bacteria | 11002 |
| 28 | Ga0070670_100079536 | 3300005331 | Bacteria | 2817 |
| 29 | Ga0070677_10000507 | 3300005333 | Bacteria | 13417 |
| 30 | Ga0068869_100000189 | 3300005334 | Bacteria | 31886 |
| 31 | Ga0068869_100022353 | 3300005334 | Bacteria | 4357 |
| 32 | Ga0070666_10037337 | 3300005335 | Bacteria | 3230 |
| 33 | Ga0070680_100000706 | 3300005336 | Bacteria | 23169 |
| 34 | Ga0070680_100212164 | 3300005336 | Bacteria | 1633 |
| 35 | Ga0070682_100000202 | 3300005337 | Bacteria | 44018 |
| 36 | Ga0070682_100296371 | 3300005337 | Bacteria | 1185 |
| 37 | Ga0070682_100349728 | 3300005337 | Bacteria | 1101 |
| 38 | Ga0068868_100000614 | 3300005338 | Bacteria | 23959 |
| 39 | Ga0068868_100037776 | 3300005338 | Bacteria | 3745 |
| 40 | Ga0070660_100000223 | 3300005339 | Bacteria | 37464 |
| 41 | Ga0070689_100000187 | 3300005340 | Bacteria | 37473 |
| 42 | Ga0070689_100204024 | 3300005340 | Bacteria | 1615 |
| 43 | Ga0070691_10000236 | 3300005341 | Bacteria | 18840 |
| 44 | Ga0070687_100018832 | 3300005343 | Bacteria | 3202 |
| 45 | Ga0070687_100141252 | 3300005343 | Bacteria | 1403 |
| 46 | Ga0070661_100000298 | 3300005344 | Bacteria | 40083 |
| 47 | Ga0070661_100061349 | 3300005344 | Bacteria | 2759 |
| 48 | Ga0070692_10000016 | 3300005345 | Bacteria | 34456 |
| 49 | Ga0070692_10051757 | 3300005345 | Bacteria | 2137 |
| 50 | Ga0070668_100011766 | 3300005347 | Bacteria | 6515 |
| 51 | Ga0070669_100000959 | 3300005353 | Bacteria | 21059 |
| 52 | Ga0070669_100008568 | 3300005353 | Bacteria | 7299 |
| 53 | Ga0070675_100000215 | 3300005354 | Bacteria | 37364 |
| 54 | Ga0070675_100063249 | 3300005354 | Bacteria | 3059 |
| 55 | Ga0070671_100000402 | 3300005355 | Bacteria | 29873 |
| 56 | Ga0070671_100038892 | 3300005355 | Bacteria | 3948 |
| 57 | Ga0070674_100088272 | 3300005356 | Bacteria | 2231 |
| 58 | Ga0070673_100000035 | 3300005364 | Bacteria | 57163 |
| 59 | Ga0070673_100042057 | 3300005364 | Bacteria | 3520 |
| 60 | Ga0070673_100496766 | 3300005364 | Bacteria | 1103 |
| 61 | Ga0070688_100000130 | 3300005365 | Bacteria | 40342 |
| 62 | Ga0070688_100157331 | 3300005365 | Bacteria | 1558 |
| 63 | Ga0070688_100373156 | 3300005365 | Bacteria | 1050 |
| 64 | Ga0070659_100000583 | 3300005366 | Bacteria | 26638 |
| 65 | Ga0070659_100246834 | 3300005366 | Bacteria | 1479 |
| 66 | Ga0070667_100000712 | 3300005367 | Bacteria | 32083 |
| 67 | Ga0070667_100103626 | 3300005367 | Bacteria | 2460 |
| 68 | Ga0070667_100119102 | 3300005367 | Bacteria | 2295 |
| 69 | Ga0070667_100229298 | 3300005367 | Bacteria | 1656 |
| 70 | Ga0070703_10003763 | 3300005406 | Bacteria | 4292 |
| 71 | Ga0070709_10393736 | 3300005434 | Bacteria | 1033 |
| 72 | Ga0070714_100108188 | 3300005435 | Bacteria | 2458 |
| 73 | Ga0070714_100125294 | 3300005435 | Bacteria | 2290 |
| 74 | Ga0070713_100016322 | 3300005436 | Bacteria | 5583 |
| 75 | Ga0070713_100055369 | 3300005436 | Bacteria | 3295 |
| 76 | Ga0070713_100122517 | 3300005436 | Bacteria | 2282 |
| 77 | Ga0070713_100870623 | 3300005436 | Bacteria | 866 |
| 78 | Ga0070710_10032561 | 3300005437 | Bacteria | 2825 |
| 79 | Ga0070710_10064728 | 3300005437 | Bacteria | 2092 |
| 80 | Ga0070701_10000081 | 3300005438 | Bacteria | 26416 |
| 81 | Ga0070711_100002454 | 3300005439 | Bacteria | 10583 |
| 82 | Ga0070711_100032952 | 3300005439 | Bacteria | 3448 |
| 83 | Ga0070711_100092853 | 3300005439 | Bacteria | 2179 |
| 84 | Ga0070711_100113342 | 3300005439 | Bacteria | 1994 |
| 85 | Ga0070711_100166814 | 3300005439 | Bacteria | 1675 |
| 86 | Ga0070711_100233336 | 3300005439 | Bacteria | 1435 |
| 87 | Ga0070705_100000911 | 3300005440 | Bacteria | 16539 |
| 88 | Ga0070705_100036554 | 3300005440 | Bacteria | 2762 |
| 89 | Ga0070705_100075743 | 3300005440 | Bacteria | 2049 |
| 90 | Ga0070700_100000393 | 3300005441 | Bacteria | 22580 |
| 91 | Ga0070700_100018829 | 3300005441 | Bacteria | 3975 |
| 92 | Ga0070700_100318285 | 3300005441 | Bacteria | 1142 |
| 93 | Ga0070694_100000129 | 3300005444 | Bacteria | 37699 |
| 94 | Ga0070694_100023553 | 3300005444 | Bacteria | 3962 |
| 95 | Ga0070694_100041690 | 3300005444 | Bacteria | 3064 |
| 96 | Ga0070694_100176338 | 3300005444 | Bacteria | 1578 |
| 97 | Ga0070708_100020441 | 3300005445 | Bacteria | 5582 |
| 98 | Ga0070663_100000746 | 3300005455 | Bacteria | 17593 |
| 99 | Ga0070663_100156899 | 3300005455 | Bacteria | 1749 |
| 100 | Ga0070663_100630527 | 3300005455 | Bacteria | 904 |
| 101 | Ga0070678_100000399 | 3300005456 | Bacteria | 20439 |
| 102 | Ga0070678_100065422 | 3300005456 | Bacteria | 2699 |
| 103 | Ga0070678_100070356 | 3300005456 | Bacteria | 2615 |
| 104 | Ga0070662_100001543 | 3300005457 | Bacteria | 14211 |
| 105 | Ga0070681_10001286 | 3300005458 | Bacteria | 21879 |
| 106 | Ga0070681_10183193 | 3300005458 | Bacteria | 2015 |
| 107 | Ga0070681_10715590 | 3300005458 | Bacteria | 917 |
| 108 | Ga0068867_100000369 | 3300005459 | Bacteria | 29980 |
| 109 | Ga0068867_100040352 | 3300005459 | Bacteria | 3406 |
| 110 | Ga0070685_10000490 | 3300005466 | Bacteria | 22910 |
| 111 | Ga0070685_10014589 | 3300005466 | Bacteria | 4163 |
| 112 | Ga0070685_10053956 | 3300005466 | Bacteria | 2330 |
| 113 | Ga0070706_100044132 | 3300005467 | Bacteria | 4119 |
| 114 | Ga0070706_100299650 | 3300005467 | Bacteria | 1500 |
| 115 | Ga0070698_100030729 | 3300005471 | Bacteria | 5569 |
| 116 | Ga0070698_100515424 | 3300005471 | Bacteria | 1134 |
| 117 | Ga0070679_100000553 | 3300005530 | Bacteria | 31683 |
| 118 | Ga0070679_100147317 | 3300005530 | Bacteria | 2332 |
| 119 | Ga0070679_100451852 | 3300005530 | Bacteria | 1230 |
| 120 | Ga0070684_100000246 | 3300005535 | Bacteria | 37600 |
| 121 | Ga0070684_100188202 | 3300005535 | Bacteria | 1878 |
| 122 | Ga0070684_100845241 | 3300005535 | Bacteria | 857 |
| 123 | Ga0070697_100237757 | 3300005536 | Bacteria | 1555 |
| 124 | Ga0068853_100000243 | 3300005539 | Bacteria | 38327 |
| 125 | Ga0068853_100216016 | 3300005539 | Bacteria | 1749 |
| 126 | Ga0070672_100000157 | 3300005543 | Bacteria | 37598 |
| 127 | Ga0070686_100000260 | 3300005544 | Bacteria | 36083 |
| 128 | Ga0070686_100328931 | 3300005544 | Bacteria | 1142 |
| 129 | Ga0070695_100001653 | 3300005545 | Bacteria | 12525 |
| 130 | Ga0070695_100019838 | 3300005545 | Bacteria | 4099 |
| 131 | Ga0070695_100124322 | 3300005545 | Bacteria | 1770 |
| 132 | Ga0070695_100429492 | 3300005545 | Bacteria | 1008 |
| 133 | Ga0070696_100000970 | 3300005546 | Bacteria | 18596 |
| 134 | Ga0070696_100592696 | 3300005546 | Bacteria | 893 |
| 135 | Ga0070693_100000925 | 3300005547 | Bacteria | 13032 |
| 136 | Ga0070693_100009542 | 3300005547 | Bacteria | 4827 |
| 137 | Ga0070693_100199410 | 3300005547 | Bacteria | 1299 |
| 138 | Ga0070665_100010001 | 3300005548 | Bacteria | 9596 |
| 139 | Ga0070665_100050448 | 3300005548 | Bacteria | 4175 |
| 140 | Ga0070665_100063747 | 3300005548 | Bacteria | 3695 |
| 141 | Ga0070665_100111383 | 3300005548 | Bacteria | 2739 |
| 142 | Ga0070665_100200847 | 3300005548 | Bacteria | 1994 |
| 143 | Ga0070704_100000171 | 3300005549 | Bacteria | 25774 |
| 144 | Ga0068855_100010157 | 3300005563 | Bacteria | 11347 |
| 145 | Ga0068855_100060530 | 3300005563 | Bacteria | 4428 |
| 146 | Ga0070664_100000269 | 3300005564 | Bacteria | 37475 |
| 147 | Ga0070664_100145118 | 3300005564 | Bacteria | 2092 |
| 148 | Ga0070664_100231415 | 3300005564 | Bacteria | 1657 |
| 149 | Ga0068857_100000174 | 3300005577 | Bacteria | 40766 |
| 150 | Ga0068854_100000211 | 3300005578 | Bacteria | 39059 |
| 151 | Ga0068856_100000600 | 3300005614 | Bacteria | 39415 |
| 152 | Ga0068856_100224783 | 3300005614 | Bacteria | 1892 |
| 153 | Ga0070702_100001226 | 3300005615 | Bacteria | 10380 |
| 154 | Ga0070702_100008942 | 3300005615 | Bacteria | 4876 |
| 155 | Ga0068852_100000629 | 3300005616 | Bacteria | 23063 |
| 156 | Ga0068852_100284754 | 3300005616 | Bacteria | 1594 |
| 157 | Ga0068859_100000894 | 3300005617 | Bacteria | 30361 |
| 158 | Ga0068859_100135914 | 3300005617 | Bacteria | 2532 |
| 159 | Ga0068859_100879193 | 3300005617 | Bacteria | 981 |
| 160 | Ga0068864_100000329 | 3300005618 | Bacteria | 41801 |
| 161 | Ga0068864_100079371 | 3300005618 | Bacteria | 2873 |
| 162 | Ga0068864_100650307 | 3300005618 | Bacteria | 1027 |
| 163 | Ga0068866_10000177 | 3300005718 | Bacteria | 29851 |
| 164 | Ga0068866_10163097 | 3300005718 | Bacteria | 1301 |
| 165 | Ga0068861_100000329 | 3300005719 | Bacteria | 26778 |
| 166 | Ga0068851_10045110 | 3300005834 | Bacteria | 2227 |
| 167 | Ga0068870_10000056 | 3300005840 | Bacteria | 36039 |
| 168 | Ga0068863_100000278 | 3300005841 | Bacteria | 53024 |
| 169 | Ga0068863_100338958 | 3300005841 | Bacteria | 1462 |
| 170 | Ga0068858_100001048 | 3300005842 | Bacteria | 28582 |
| 171 | Ga0068858_100383155 | 3300005842 | Bacteria | 1349 |
| 172 | Ga0068860_100000985 | 3300005843 | Bacteria | 31478 |
| 173 | Ga0068860_100055313 | 3300005843 | Bacteria | 3772 |
| 174 | Ga0068860_100144436 | 3300005843 | Bacteria | 2289 |
| 175 | Ga0068860_100164210 | 3300005843 | Bacteria | 2143 |
| 176 | Ga0068862_100000593 | 3300005844 | Bacteria | 37703 |
| 177 | Ga0068862_100198757 | 3300005844 | Bacteria | 1807 |
| 178 | Ga0081455_10000523 | 3300005937 | Bacteria | 49838 |
| 179 | Ga0081455_10097800 | 3300005937 | Bacteria | 2364 |
| 180 | Ga0081455_10397491 | 3300005937 | Bacteria | 958 |
| 181 | Ga0081538_10016043 | 3300005981 | Bacteria | 5764 |
| 182 | Ga0081538_10089721 | 3300005981 | Bacteria | 1594 |
| 183 | Ga0081540_1000002 | 3300005983 | Bacteria | 251149 |
| 184 | Ga0081540_1109824 | 3300005983 | Bacteria | 1168 |
| 185 | Ga0081539_10003057 | 3300005985 | Bacteria | 21597 |
| 186 | Ga0081539_10076118 | 3300005985 | Bacteria | 1779 |
| 187 | Ga0070717_10171763 | 3300006028 | Bacteria | 1886 |
| 188 | Ga0070717_10429212 | 3300006028 | Bacteria | 1189 |
| 189 | Ga0075365_10052915 | 3300006038 | Bacteria | 2687 |
| 190 | Ga0075365_10071781 | 3300006038 | Bacteria | 2331 |
| 191 | Ga0075365_10077086 | 3300006038 | Bacteria | 2252 |
| 192 | Ga0075365_10094047 | 3300006038 | Bacteria | 2045 |
| 193 | Ga0075365_10098773 | 3300006038 | Bacteria | 1997 |
| 194 | Ga0075365_10359215 | 3300006038 | Bacteria | 1027 |
| 195 | Ga0075365_10442082 | 3300006038 | Bacteria | 918 |
| 196 | Ga0075368_10001270 | 3300006042 | Bacteria | 7999 |
| 197 | Ga0075368_10005670 | 3300006042 | Bacteria | 4311 |
| 198 | Ga0075368_10028942 | 3300006042 | Bacteria | 2142 |
| 199 | Ga0075368_10032622 | 3300006042 | Bacteria | 2024 |
| 200 | Ga0075363_100000768 | 3300006048 | Bacteria | 11015 |
| 201 | Ga0075363_100034241 | 3300006048 | Bacteria | 2650 |
| 202 | Ga0075363_100039560 | 3300006048 | Bacteria | 2482 |
| 203 | Ga0075363_100073631 | 3300006048 | Bacteria | 1859 |
| 204 | Ga0075364_10046300 | 3300006051 | Bacteria | 2832 |
| 205 | Ga0075364_10054479 | 3300006051 | Bacteria | 2616 |
| 206 | Ga0075364_10098468 | 3300006051 | Bacteria | 1945 |
| 207 | Ga0075364_10149504 | 3300006051 | Bacteria | 1573 |
| 208 | Ga0075364_10167198 | 3300006051 | Bacteria | 1486 |
| 209 | Ga0075364_10242390 | 3300006051 | Bacteria | 1224 |
| 210 | Ga0075432_10000435 | 3300006058 | Bacteria | 12267 |
| 211 | Ga0070716_100091335 | 3300006173 | Bacteria | 1844 |
| 212 | Ga0070712_100067684 | 3300006175 | Bacteria | 2541 |
| 213 | Ga0070712_100264732 | 3300006175 | Bacteria | 1379 |
| 214 | Ga0075362_10016516 | 3300006177 | Bacteria | 3024 |
| 215 | Ga0075362_10085696 | 3300006177 | Bacteria | 1457 |
| 216 | Ga0075362_10094219 | 3300006177 | Bacteria | 1393 |
| 217 | Ga0075367_10000684 | 3300006178 | Bacteria | 13028 |
| 218 | Ga0075367_10042972 | 3300006178 | Bacteria | 2646 |
| 219 | Ga0075367_10052216 | 3300006178 | Bacteria | 2419 |
| 220 | Ga0075367_10066230 | 3300006178 | Bacteria | 2164 |
| 221 | Ga0075367_10146137 | 3300006178 | Bacteria | 1466 |
| 222 | Ga0075367_10180909 | 3300006178 | Bacteria | 1314 |
| 223 | Ga0075369_10000702 | 3300006186 | Bacteria | 10767 |
| 224 | Ga0075369_10013091 | 3300006186 | Bacteria | 3285 |
| 225 | Ga0075427_10014511 | 3300006194 | Bacteria | 1209 |
| 226 | Ga0075366_10012158 | 3300006195 | Bacteria | 4877 |
| 227 | Ga0075366_10018063 | 3300006195 | Bacteria | 4071 |
| 228 | Ga0075366_10121584 | 3300006195 | Bacteria | 1573 |
| 229 | Ga0075366_10180368 | 3300006195 | Bacteria | 1283 |
| 230 | Ga0097621_100000504 | 3300006237 | Bacteria | 27335 |
| 231 | Ga0075370_10009280 | 3300006353 | Bacteria | 5104 |
| 232 | Ga0075370_10048030 | 3300006353 | Bacteria | 2417 |
| 233 | Ga0068871_100000815 | 3300006358 | Bacteria | 20895 |
| 234 | Ga0068871_100451111 | 3300006358 | Bacteria | 1153 |
| 235 | Ga0075428_100001439 | 3300006844 | Bacteria | 25419 |
| 236 | Ga0075428_100127851 | 3300006844 | Bacteria | 2765 |
| 237 | Ga0075428_100407185 | 3300006844 | Bacteria | 1457 |
| 238 | Ga0075430_100001275 | 3300006846 | Bacteria | 20297 |
| 239 | Ga0075430_100122634 | 3300006846 | Bacteria | 2167 |
| 240 | Ga0075430_100167364 | 3300006846 | Bacteria | 1829 |
| 241 | Ga0075430_100597029 | 3300006846 | Bacteria | 911 |
| 242 | Ga0075430_100717555 | 3300006846 | Bacteria | 824 |
| 243 | Ga0075431_100005046 | 3300006847 | Bacteria | 12986 |
| 244 | Ga0075431_100554994 | 3300006847 | Bacteria | 1136 |
| 245 | Ga0075433_10002183 | 3300006852 | Bacteria | 14837 |
| 246 | Ga0075433_10010619 | 3300006852 | Bacteria | 7404 |
| 247 | Ga0075433_10032030 | 3300006852 | Bacteria | 4500 |
| 248 | Ga0075433_10148107 | 3300006852 | Bacteria | 2087 |
| 249 | Ga0075433_10218628 | 3300006852 | Bacteria | 1693 |
| 250 | Ga0075433_10725576 | 3300006852 | Bacteria | 870 |
| 251 | Ga0075434_100000244 | 3300006871 | Bacteria | 38039 |
| 252 | Ga0075434_100002619 | 3300006871 | Bacteria | 15865 |
| 253 | Ga0075434_100011824 | 3300006871 | Bacteria | 8247 |
| 254 | Ga0075434_100012549 | 3300006871 | Bacteria | 8035 |
| 255 | Ga0075434_100047465 | 3300006871 | Bacteria | 4262 |
| 256 | Ga0075434_100602210 | 3300006871 | Bacteria | 1118 |
| 257 | Ga0075434_100695987 | 3300006871 | Bacteria | 1034 |
| 258 | Ga0075429_100000388 | 3300006880 | Bacteria | 32233 |
| 259 | Ga0075429_100066160 | 3300006880 | Bacteria | 3146 |
| 260 | Ga0075429_100503223 | 3300006880 | Bacteria | 1062 |
| 261 | Ga0068865_100000332 | 3300006881 | Bacteria | 26180 |
| 262 | Ga0068865_100136282 | 3300006881 | Bacteria | 1845 |
| 263 | Ga0068865_100243208 | 3300006881 | Bacteria | 1417 |
| 264 | Ga0097620_100000894 | 3300006931 | Bacteria | 30361 |
| 265 | Ga0097620_100135916 | 3300006931 | Bacteria | 2532 |
| 266 | Ga0097620_100879196 | 3300006931 | Bacteria | 981 |
| 267 | Ga0075435_100002584 | 3300007076 | Bacteria | 12081 |
| 268 | Ga0075435_100042005 | 3300007076 | Bacteria | 3656 |
| 269 | Ga0075435_100057389 | 3300007076 | Bacteria | 3149 |
| 270 | Ga0075435_100207282 | 3300007076 | Bacteria | 1662 |
| 271 | Ga0099795_10019588 | 3300007788 | Bacteria | 2193 |
| 272 | Ga0105251_10052402 | 3300009011 | Bacteria | 1943 |
| 273 | Ga0105240_10336182 | 3300009093 | Bacteria | 1717 |
| 274 | Ga0111539_10001076 | 3300009094 | Bacteria | 36048 |
| 275 | Ga0111539_10002315 | 3300009094 | Bacteria | 25343 |
| 276 | Ga0111539_10019996 | 3300009094 | Bacteria | 8247 |
| 277 | Ga0111539_10020456 | 3300009094 | Bacteria | 8150 |
| 278 | Ga0111539_10037026 | 3300009094 | Bacteria | 5895 |
| 279 | Ga0111539_10048465 | 3300009094 | Bacteria | 5072 |
| 280 | Ga0111539_10470369 | 3300009094 | Bacteria | 1464 |
| 281 | Ga0105245_10000451 | 3300009098 | Bacteria | 37705 |
| 282 | Ga0105245_10042912 | 3300009098 | Bacteria | 4034 |
| 283 | Ga0105245_10270589 | 3300009098 | Bacteria | 1657 |
| 284 | Ga0105247_10097608 | 3300009101 | Bacteria | 1874 |
| 285 | Ga0114129_10007449 | 3300009147 | Bacteria | 15590 |
| 286 | Ga0114129_10012907 | 3300009147 | Bacteria | 11887 |
| 287 | Ga0114129_10046418 | 3300009147 | Bacteria | 6105 |
| 288 | Ga0114129_10226684 | 3300009147 | Bacteria | 2518 |
| 289 | Ga0114129_10535446 | 3300009147 | Bacteria | 1525 |
| 290 | Ga0105243_10001205 | 3300009148 | Bacteria | 23282 |
| 291 | Ga0105243_10106599 | 3300009148 | Bacteria | 2336 |
| 292 | Ga0105243_10366915 | 3300009148 | Bacteria | 1327 |
| 293 | Ga0105241_10000515 | 3300009174 | Bacteria | 29094 |
| 294 | Ga0105242_10000947 | 3300009176 | Bacteria | 22652 |
| 295 | Ga0105242_10054094 | 3300009176 | Bacteria | 3280 |
| 296 | Ga0105248_10000837 | 3300009177 | Bacteria | 34570 |
| 297 | Ga0105248_10058387 | 3300009177 | Bacteria | 4333 |
| 298 | Ga0105248_10065044 | 3300009177 | Bacteria | 4093 |
| 299 | Ga0105248_10120659 | 3300009177 | Bacteria | 2958 |
| 300 | Ga0105248_10340503 | 3300009177 | Bacteria | 1689 |
| 301 | Ga0105237_10204484 | 3300009545 | Bacteria | 1975 |
| 302 | Ga0105237_10206434 | 3300009545 | Bacteria | 1965 |
| 303 | Ga0105249_10000976 | 3300009553 | Bacteria | 25338 |
| 304 | Ga0105249_10127126 | 3300009553 | Bacteria | 2429 |
| 305 | Ga0105249_10563340 | 3300009553 | Bacteria | 1191 |
| 306 | Ga0105239_10038973 | 3300010375 | Bacteria | 5205 |
| 307 | Ga0105239_10154564 | 3300010375 | Bacteria | 2562 |
| 308 | Ga0105239_10413907 | 3300010375 | Bacteria | 1526 |
| 309 | Ga0105246_10000100 | 3300011119 | Bacteria | 37689 |
| 310 | Ga0105246_10175672 | 3300011119 | Bacteria | 1644 |
| 311 | Ga0157373_10124368 | 3300013100 | Bacteria | 1814 |
| 312 | Ga0157371_10001676 | 3300013102 | Bacteria | 22625 |
| 313 | Ga0157370_10359882 | 3300013104 | Bacteria | 1341 |
| 314 | Ga0157369_10512016 | 3300013105 | Bacteria | 1242 |
| 315 | Ga0157374_10000956 | 3300013296 | Bacteria | 25071 |
| 316 | Ga0157374_10079625 | 3300013296 | Bacteria | 3105 |
| 317 | Ga0157378_10001544 | 3300013297 | Bacteria | 20818 |
| 318 | Ga0157378_10025137 | 3300013297 | Bacteria | 5247 |
| 319 | Ga0157378_10067701 | 3300013297 | Bacteria | 3201 |
| 320 | Ga0157378_10323572 | 3300013297 | Bacteria | 1499 |
| 321 | Ga0163162_10001003 | 3300013306 | Bacteria | 26222 |
| 322 | Ga0163162_10927467 | 3300013306 | Bacteria | 983 |
| 323 | Ga0157372_10003782 | 3300013307 | Bacteria | 16248 |
| 324 | Ga0157375_10000464 | 3300013308 | Bacteria | 36915 |
| 325 | Ga0157375_10163586 | 3300013308 | Bacteria | 2369 |
| 326 | Ga0157375_10179981 | 3300013308 | Bacteria | 2265 |
| 327 | Ga0163163_10003318 | 3300014325 | Bacteria | 13651 |
| 328 | Ga0163163_10064168 | 3300014325 | Bacteria | 3644 |
| 329 | Ga0157380_10000145 | 3300014326 | Bacteria | 40211 |
| 330 | Ga0157377_10000179 | 3300014745 | Bacteria | 36682 |
| 331 | Ga0157377_10010122 | 3300014745 | Bacteria | 4653 |
| 332 | Ga0157377_10155254 | 3300014745 | Bacteria | 1418 |
| 333 | Ga0157379_10000067 | 3300014968 | Bacteria | 66051 |
| 334 | Ga0157379_10105816 | 3300014968 | Bacteria | 2525 |
| 335 | Ga0157379_10455769 | 3300014968 | Bacteria | 1181 |
| 336 | Ga0157379_10648027 | 3300014968 | Bacteria | 989 |
| 337 | Ga0157379_10869403 | 3300014968 | Bacteria | 854 |
| 338 | Ga0157376_10000864 | 3300014969 | Bacteria | 19873 |
| 339 | Ga0157376_10169140 | 3300014969 | Bacteria | 1988 |
| 340 | Ga0163161_10001462 | 3300017792 | Bacteria | 17455 |
| 341 | Ga0209233_1006378 | 3300025261 | Bacteria | 3808 |
| 342 | Ga0207666_1000002 | 3300025271 | Bacteria | 62717 |
| 343 | Ga0207673_1000087 | 3300025290 | Bacteria | 8178 |
| 344 | Ga0209675_1002319 | 3300025291 | Bacteria | 9842 |
| 345 | Ga0207697_10000113 | 3300025315 | Bacteria | 37772 |
| 346 | Ga0207697_10045688 | 3300025315 | Bacteria | 1803 |
| 347 | Ga0207653_10001646 | 3300025885 | Bacteria | 7166 |
| 348 | Ga0207682_10000094 | 3300025893 | Bacteria | 41188 |
| 349 | Ga0207692_10009305 | 3300025898 | Bacteria | 4097 |
| 350 | Ga0207692_10076551 | 3300025898 | Bacteria | 1778 |
| 351 | Ga0207642_10000106 | 3300025899 | Bacteria | 22456 |
| 352 | Ga0207642_10012442 | 3300025899 | Bacteria | 3072 |
| 353 | Ga0207710_10016772 | 3300025900 | Bacteria | 3101 |
| 354 | Ga0207688_10000074 | 3300025901 | Bacteria | 37681 |
| 355 | Ga0207688_10011402 | 3300025901 | Bacteria | 4839 |
| 356 | Ga0207688_10217047 | 3300025901 | Bacteria | 1151 |
| 357 | Ga0207680_10017648 | 3300025903 | Bacteria | 3773 |
| 358 | Ga0207680_10053411 | 3300025903 | Bacteria | 2425 |
| 359 | Ga0207647_10000218 | 3300025904 | Bacteria | 46963 |
| 360 | Ga0207647_10019749 | 3300025904 | Bacteria | 4527 |
| 361 | Ga0207685_10017110 | 3300025905 | Bacteria | 2336 |
| 362 | Ga0207699_10055900 | 3300025906 | Bacteria | 2350 |
| 363 | Ga0207699_10146498 | 3300025906 | Bacteria | 1557 |
| 364 | Ga0207645_10000247 | 3300025907 | Bacteria | 44983 |
| 365 | Ga0207643_10000004 | 3300025908 | Bacteria | 187006 |
| 366 | Ga0207643_10001836 | 3300025908 | Bacteria | 11762 |
| 367 | Ga0207705_10092377 | 3300025909 | Bacteria | 2217 |
| 368 | Ga0207684_10113130 | 3300025910 | Bacteria | 2324 |
| 369 | Ga0207654_10000408 | 3300025911 | Bacteria | 24946 |
| 370 | Ga0207707_10000618 | 3300025912 | Bacteria | 35350 |
| 371 | Ga0207707_10254865 | 3300025912 | Bacteria | 1524 |
| 372 | Ga0207671_10006046 | 3300025914 | Bacteria | 10917 |
| 373 | Ga0207693_10070840 | 3300025915 | Bacteria | 2728 |
| 374 | Ga0207693_10274042 | 3300025915 | Bacteria | 1322 |
| 375 | Ga0207663_10031260 | 3300025916 | Bacteria | 3149 |
| 376 | Ga0207663_10079825 | 3300025916 | Bacteria | 2138 |
| 377 | Ga0207663_10139090 | 3300025916 | Bacteria | 1689 |
| 378 | Ga0207663_10165531 | 3300025916 | Bacteria | 1566 |
| 379 | Ga0207660_10000741 | 3300025917 | Bacteria | 21651 |
| 380 | Ga0207660_10108230 | 3300025917 | Bacteria | 2087 |
| 381 | Ga0207662_10000119 | 3300025918 | Bacteria | 37770 |
| 382 | Ga0207662_10015565 | 3300025918 | Bacteria | 4282 |
| 383 | Ga0207657_10000316 | 3300025919 | Bacteria | 51145 |
| 384 | Ga0207657_10022891 | 3300025919 | Bacteria | 5831 |
| 385 | Ga0207657_10076248 | 3300025919 | Bacteria | 2829 |
| 386 | Ga0207649_10000090 | 3300025920 | Bacteria | 75387 |
| 387 | Ga0207649_10015183 | 3300025920 | Bacteria | 4326 |
| 388 | Ga0207649_10301637 | 3300025920 | Bacteria | 1171 |
| 389 | Ga0207652_10000847 | 3300025921 | Bacteria | 29115 |
| 390 | Ga0207652_10057847 | 3300025921 | Bacteria | 3340 |
| 391 | Ga0207681_10000370 | 3300025923 | Bacteria | 31836 |
| 392 | Ga0207681_10016162 | 3300025923 | Bacteria | 4663 |
| 393 | Ga0207681_10147556 | 3300025923 | Bacteria | 1759 |
| 394 | Ga0207694_10271719 | 3300025924 | Bacteria | 1391 |
| 395 | Ga0207650_10003373 | 3300025925 | Bacteria | 10996 |
| 396 | Ga0207650_10014660 | 3300025925 | Bacteria | 5445 |
| 397 | Ga0207659_10000038 | 3300025926 | Bacteria | 93848 |
| 398 | Ga0207659_10010384 | 3300025926 | Bacteria | 5853 |
| 399 | Ga0207687_10000342 | 3300025927 | Bacteria | 31186 |
| 400 | Ga0207700_10029938 | 3300025928 | Bacteria | 3849 |
| 401 | Ga0207700_10047750 | 3300025928 | Bacteria | 3175 |
| 402 | Ga0207664_10219306 | 3300025929 | Bacteria | 1649 |
| 403 | Ga0207644_10000825 | 3300025931 | Bacteria | 19709 |
| 404 | Ga0207690_10000239 | 3300025932 | Bacteria | 39850 |
| 405 | Ga0207706_10000424 | 3300025933 | Bacteria | 45410 |
| 406 | Ga0207706_10004762 | 3300025933 | Bacteria | 12706 |
| 407 | Ga0207706_10009773 | 3300025933 | Bacteria | 8804 |
| 408 | Ga0207686_10005718 | 3300025934 | Bacteria | 6666 |
| 409 | Ga0207686_10030791 | 3300025934 | Bacteria | 3181 |
| 410 | Ga0207709_10000379 | 3300025935 | Bacteria | 44189 |
| 411 | Ga0207709_10201726 | 3300025935 | Bacteria | 1421 |
| 412 | Ga0207709_10453605 | 3300025935 | Bacteria | 992 |
| 413 | Ga0207670_10000176 | 3300025936 | Bacteria | 42483 |
| 414 | Ga0207670_10030260 | 3300025936 | Bacteria | 3458 |
| 415 | Ga0207670_10378786 | 3300025936 | Bacteria | 1126 |
| 416 | Ga0207669_10000165 | 3300025937 | Bacteria | 31741 |
| 417 | Ga0207704_10001293 | 3300025938 | Bacteria | 11185 |
| 418 | Ga0207704_10094564 | 3300025938 | Bacteria | 1974 |
| 419 | Ga0207665_10045247 | 3300025939 | Bacteria | 2947 |
| 420 | Ga0207665_10060873 | 3300025939 | Bacteria | 2557 |
| 421 | Ga0207665_10329420 | 3300025939 | Bacteria | 1148 |
| 422 | Ga0207691_10000358 | 3300025940 | Bacteria | 46095 |
| 423 | Ga0207691_10005474 | 3300025940 | Bacteria | 12259 |
| 424 | Ga0207691_10439759 | 3300025940 | Bacteria | 1110 |
| 425 | Ga0207711_10000780 | 3300025941 | Bacteria | 31295 |
| 426 | Ga0207711_10067010 | 3300025941 | Bacteria | 3107 |
| 427 | Ga0207711_10114937 | 3300025941 | Bacteria | 2397 |
| 428 | Ga0207711_10150908 | 3300025941 | Bacteria | 2097 |
| 429 | Ga0207689_10000479 | 3300025942 | Bacteria | 37696 |
| 430 | Ga0207689_10017846 | 3300025942 | Bacteria | 5996 |
| 431 | Ga0207689_10147898 | 3300025942 | Bacteria | 1936 |
| 432 | Ga0207661_10001263 | 3300025944 | Bacteria | 16914 |
| 433 | Ga0207661_10561710 | 3300025944 | Bacteria | 1046 |
| 434 | Ga0207679_10000139 | 3300025945 | Bacteria | 59804 |
| 435 | Ga0207679_10857365 | 3300025945 | Bacteria | 830 |
| 436 | Ga0207667_10003492 | 3300025949 | Bacteria | 19417 |
| 437 | Ga0207667_10377482 | 3300025949 | Bacteria | 1444 |
| 438 | Ga0207667_10715950 | 3300025949 | Bacteria | 1002 |
| 439 | Ga0207651_10000072 | 3300025960 | Bacteria | 46009 |
| 440 | Ga0207651_10278123 | 3300025960 | Bacteria | 1382 |
| 441 | Ga0207712_10000588 | 3300025961 | Bacteria | 29188 |
| 442 | Ga0207668_10000168 | 3300025972 | Bacteria | 45205 |
| 443 | Ga0207640_10000242 | 3300025981 | Bacteria | 37007 |
| 444 | Ga0207640_10223780 | 3300025981 | Bacteria | 1442 |
| 445 | Ga0207658_10000667 | 3300025986 | Bacteria | 29975 |
| 446 | Ga0207658_10021614 | 3300025986 | Bacteria | 4470 |
| 447 | Ga0207677_10003053 | 3300026023 | Bacteria | 8850 |
| 448 | Ga0207677_10267779 | 3300026023 | Bacteria | 1396 |
| 449 | Ga0207703_10000463 | 3300026035 | Bacteria | 42725 |
| 450 | Ga0207703_10044027 | 3300026035 | Bacteria | 3585 |
| 451 | Ga0207703_10074279 | 3300026035 | Bacteria | 2815 |
| 452 | Ga0207639_10000745 | 3300026041 | Bacteria | 22238 |
| 453 | Ga0207639_10038789 | 3300026041 | Bacteria | 3545 |
| 454 | Ga0207678_10000447 | 3300026067 | Bacteria | 37597 |
| 455 | Ga0207678_10001556 | 3300026067 | Bacteria | 21059 |
| 456 | Ga0207678_10008450 | 3300026067 | Bacteria | 9081 |
| 457 | Ga0207678_10047543 | 3300026067 | Bacteria | 3710 |
| 458 | Ga0207678_10288250 | 3300026067 | Bacteria | 1410 |
| 459 | Ga0207708_10000293 | 3300026075 | Bacteria | 39298 |
| 460 | Ga0207708_10001604 | 3300026075 | Bacteria | 16845 |
| 461 | Ga0207708_10138013 | 3300026075 | Bacteria | 1911 |
| 462 | Ga0207702_10001723 | 3300026078 | Bacteria | 21539 |
| 463 | Ga0207641_10000724 | 3300026088 | Bacteria | 35413 |
| 464 | Ga0207641_10061568 | 3300026088 | Bacteria | 3201 |
| 465 | Ga0207648_10000223 | 3300026089 | Bacteria | 61064 |
| 466 | Ga0207648_10013990 | 3300026089 | Bacteria | 7437 |
| 467 | Ga0207676_10000392 | 3300026095 | Bacteria | 37207 |
| 468 | Ga0207674_10000955 | 3300026116 | Bacteria | 37769 |
| 469 | Ga0207674_10063771 | 3300026116 | Bacteria | 3718 |
| 470 | Ga0207675_100000364 | 3300026118 | Bacteria | 43420 |
| 471 | Ga0207675_100014968 | 3300026118 | Bacteria | 7240 |
| 472 | Ga0207683_10000397 | 3300026121 | Bacteria | 39911 |
| 473 | Ga0207683_10012017 | 3300026121 | Bacteria | 7393 |
| 474 | Ga0207683_10034678 | 3300026121 | Bacteria | 4386 |
| 475 | Ga0207698_10000818 | 3300026142 | Bacteria | 18058 |
| 476 | Ga0207698_10179336 | 3300026142 | Bacteria | 1874 |
| 477 | Ga0209970_1011595 | 3300027614 | Bacteria | 1452 |
| 478 | Ga0210002_1004936 | 3300027617 | Bacteria | 1992 |
| 479 | Ga0209971_1014157 | 3300027682 | Bacteria | 1890 |
| 480 | Ga0209966_1019062 | 3300027695 | Bacteria | 1319 |
| 481 | Ga0209813_10002503 | 3300027866 | Bacteria | 4208 |
| 482 | Ga0209813_10017645 | 3300027866 | Bacteria | 1962 |
| 483 | Ga0209974_10001333 | 3300027876 | Bacteria | 8868 |
| 484 | Ga0207428_10000272 | 3300027907 | Bacteria | 69872 |
| 485 | Ga0207428_10000439 | 3300027907 | Bacteria | 50911 |
| 486 | Ga0268266_10003158 | 3300028379 | Bacteria | 16724 |
| 487 | Ga0268266_10016688 | 3300028379 | Bacteria | 6275 |
| 488 | Ga0268266_10032116 | 3300028379 | Bacteria | 4460 |
| 489 | Ga0268266_10152117 | 3300028379 | Bacteria | 2087 |
| 490 | Ga0268266_10378559 | 3300028379 | Bacteria | 1335 |
| 491 | Ga0268266_10453425 | 3300028379 | Bacteria | 1219 |
| 492 | Ga0268265_10001307 | 3300028380 | Bacteria | 21379 |
| 493 | Ga0268264_10000890 | 3300028381 | Bacteria | 31465 |
| 494 | Ga0268264_10024166 | 3300028381 | Bacteria | 4960 |
| 495 | Ga0268264_10056532 | 3300028381 | Bacteria | 3280 |
| 496 | Ga0268264_10104297 | 3300028381 | Bacteria | 2471 |
| 497 | Ga0268264_10524472 | 3300028381 | Bacteria | 1158 |
| 498 | Ga0265334_10004346 | 3300028573 | Bacteria | 6302 |
| 499 | Ga0307511_10000499 | 3300030521 | Bacteria | 42317 |
| 500 | Ga0265330_10033553 | 3300031235 | Bacteria | 2295 |
| 501 | Ga0265325_10002712 | 3300031241 | Bacteria | 11829 |
| 502 | Ga0265325_10020112 | 3300031241 | Bacteria | 3684 |
| 503 | Ga0265329_10021946 | 3300031242 | Bacteria | 2139 |
| 504 | Ga0265339_10111088 | 3300031249 | Bacteria | 1418 |
| 505 | Ga0265331_10108727 | 3300031250 | Bacteria | 1273 |
| 506 | Ga0307513_10020688 | 3300031456 | Bacteria | 7794 |
| 507 | Ga0265313_10000168 | 3300031595 | Bacteria | 68804 |
| 508 | Ga0265313_10030718 | 3300031595 | Bacteria | 2761 |
| 509 | Ga0265313_10058530 | 3300031595 | Bacteria | 1816 |
| 510 | Ga0265314_10083064 | 3300031711 | Bacteria | 2106 |
| 511 | Ga0265314_10162412 | 3300031711 | Bacteria | 1358 |
| 512 | Ga0265342_10017126 | 3300031712 | Bacteria | 4719 |
| 513 | Ga0307516_10430952 | 3300031730 | Bacteria | 976 |
| 514 | Ga0307413_10124649 | 3300031824 | Bacteria | 1752 |
| 515 | Ga0307416_100500506 | 3300032002 | Bacteria | 1279 |
| 516 | Ga0307416_101323962 | 3300032002 | Bacteria | 826 |
| 517 | Ga0307411_10217539 | 3300032005 | Bacteria | 1480 |
| 518 | Ga0307507_10041281 | 3300033179 | Bacteria | 4620 |
| 519 | Ga0373948_0022249 | 3300034817 | Bacteria | 1221 |
| 520 | Ga0373958_0001661 | 3300034819 | Bacteria | 3022 |
| 521 | Ga0373938_0000561 | 3300034957 | Bacteria | 6003 |
| 522 | Ga0373926_0008949 | 3300035083 | Bacteria | 3338 |
| 523 | Ga0373926_0046705 | 3300035083 | Bacteria | 1554 |
| 524 | Ga0373928_0098687 | 3300035084 | Bacteria | 759 |
| 525 | Ga0373929_0001977 | 3300035085 | Bacteria | 3827 |
| 526 | Ga0373934_0026615 | 3300035086 | Bacteria | 2244 |
| 527 | Ga0373934_0033941 | 3300035086 | Bacteria | 2004 |
| 528 | Ga0373934_0035938 | 3300035086 | Bacteria | 1951 |
| 529 | Ga0373940_0005191 | 3300035088 | Bacteria | 2806 |
| 530 | Ga0373944_0006392 | 3300035089 | Bacteria | 3129 |
| 531 | Ga0373944_0008700 | 3300035089 | Bacteria | 2743 |
| 532 | Ga0373949_0037801 | 3300035090 | Bacteria | 1176 |
| 533 | Ga0373951_0002379 | 3300035091 | Bacteria | 4753 |
| 534 | Ga0373952_0001315 | 3300035092 | Bacteria | 4541 |
| 535 | Ga0373952_0024251 | 3300035092 | Bacteria | 1302 |
| 536 | Ga0373923_0006355 | 3300035111 | Bacteria | 4079 |
| 537 | Ga0373923_0125844 | 3300035111 | Bacteria | 1148 |
| 538 | Ga0373932_0000239 | 3300035112 | Bacteria | 16722 |
| 539 | Ga0373936_0000123 | 3300035113 | Bacteria | 27381 |
| 540 | Ga0373936_0005828 | 3300035113 | Bacteria | 4639 |
| 541 | Ga0373936_0014239 | 3300035113 | Bacteria | 3039 |
| 542 | Ga0373936_0073703 | 3300035113 | Bacteria | 1411 |
| 543 | Ga0373939_0000771 | 3300035114 | Bacteria | 7903 |
| 544 | Ga0373939_0114530 | 3300035114 | Bacteria | 944 |
| 545 | Ga0373941_0000800 | 3300035115 | Bacteria | 6465 |
| 546 | Ga0373941_0007551 | 3300035115 | Bacteria | 2663 |
| 547 | Ga0373941_0019433 | 3300035115 | Bacteria | 1891 |
| 548 | Ga0373945_0002307 | 3300035116 | Bacteria | 5971 |
| 549 | Ga0373945_0208996 | 3300035116 | Bacteria | 813 |
| 550 | Ga0373953_0004397 | 3300035117 | Bacteria | 4491 |
| 551 | Ga0373953_0023351 | 3300035117 | Bacteria | 2340 |
| 552 | Ga0373954_0070419 | 3300035118 | Bacteria | 1662 |
| 553 | Ga0373954_0175326 | 3300035118 | Bacteria | 1051 |
| 554 | Ga0373956_0022890 | 3300035119 | Bacteria | 2677 |
| 555 | Ga0373957_0246729 | 3300035120 | Bacteria | 751 |
| 556 | Ga0373960_0011690 | 3300035121 | Bacteria | 2166 |
| 557 | Ga0373943_0003717 | 3300035170 | Bacteria | 6939 |
| 558 | Ga0373943_0014205 | 3300035170 | Bacteria | 3601 |
| 559 | Ga0373943_0017533 | 3300035170 | Bacteria | 3276 |
| 560 | Ga0373943_0023758 | 3300035170 | Bacteria | 2852 |
| 561 | Ga0373943_0226755 | 3300035170 | Bacteria | 1042 |
| 562 | Ga0373946_0003238 | 3300035171 | Bacteria | 5783 |
| 563 | Ga0373946_0015216 | 3300035171 | Bacteria | 2913 |
| 564 | Ga0373946_0026933 | 3300035171 | Bacteria | 2271 |
| 565 | Ga0373946_0043627 | 3300035171 | Bacteria | 1848 |
| 566 | Ga0373955_0000123 | 3300035172 | Bacteria | 30881 |
| 567 | Ga0373955_0000925 | 3300035172 | Bacteria | 12602 |
| 568 | Ga0373955_0002779 | 3300035172 | Bacteria | 7680 |
| 569 | Ga0373955_0147813 | 3300035172 | Bacteria | 1381 |
| 570 | Ga0373942_0049735 | 3300035207 | Bacteria | 1171 |
| 571 | Ga0373961_0003440 | 3300035241 | Bacteria | 3915 |
| 572 | Ga0373961_0071676 | 3300035241 | Bacteria | 1073 |
| 573 | Ga0373962_0000617 | 3300035242 | Bacteria | 8039 |
| 574 | Ga0373962_0097756 | 3300035242 | Bacteria | 912 |
| 575 | Ga0373924_0004104 | 3300035410 | Bacteria | 5068 |
| 576 | Ga0373924_0011740 | 3300035410 | Bacteria | 3258 |
| 577 | Ga0373924_0057937 | 3300035410 | Bacteria | 1616 |
| 578 | Ga0373931_0000089 | 3300035691 | Bacteria | 42136 |
| 579 | Ga0373931_0002029 | 3300035691 | Bacteria | 8916 |
| 580 | Ga0373931_0027667 | 3300035691 | Bacteria | 2897 |
| 581 | Ga0373931_0346192 | 3300035691 | Bacteria | 929 |
| 582 | Ga0373935_0001607 | 3300035692 | Bacteria | 12589 |
| 583 | Ga0373935_0007593 | 3300035692 | Bacteria | 6494 |
| 584 | Ga0373935_0023225 | 3300035692 | Bacteria | 3809 |
| 585 | Ga0373935_0106116 | 3300035692 | Bacteria | 1859 |
| 586 | Ga0373935_0111907 | 3300035692 | Bacteria | 1813 |
| 587 | Ga0373927_0007356 | 3300035695 | Bacteria | 7453 |
| 588 | Ga0373927_0100814 | 3300035695 | Bacteria | 1877 |
| 589 | Ga0373933_0000893 | 3300035724 | Bacteria | 18249 |
| 590 | Ga0373933_0001458 | 3300035724 | Bacteria | 13849 |
| 591 | Ga0373933_0001984 | 3300035724 | Bacteria | 11808 |
| 592 | Ga0373947_0000841 | 3300035725 | Bacteria | 18543 |
| 593 | Ga0373947_0005203 | 3300035725 | Bacteria | 7610 |
| 594 | Ga0373947_0066666 | 3300035725 | Bacteria | 2197 |
| 595 | Ga0373947_0080827 | 3300035725 | Bacteria | 2011 |
| 596 | Ga0373947_0118114 | 3300035725 | Bacteria | 1683 |
| 597 | Ga0373937_0000030 | 3300036401 | Bacteria | 122176 |
| 598 | Ga0373937_0002299 | 3300036401 | Bacteria | 15964 |
| 599 | Ga0373937_0008640 | 3300036401 | Bacteria | 8849 |
| 600 | Ga0373937_0142505 | 3300036401 | Bacteria | 2243 |
| 601 | Ga0373925_0000002 | 3300037068 | Bacteria | 368879 |
| 602 | Ga0373925_0031004 | 3300037068 | Bacteria | 3926 |
| 603 | Ga0373925_0053534 | 3300037068 | Bacteria | 3017 |
| 604 | Ga0373925_0157547 | 3300037068 | Bacteria | 1787 |
| 605 | Ga0373925_0202713 | 3300037068 | Bacteria | 1578 |
| 606 | Ga0436364_0113317 | 3300037853 | Bacteria | 2864 |
| 607 | Ga0436365_1558634 | 3300039437 | Bacteria | 2775 |
| 608 | Ga0436360_0497803 | 3300039438 | Bacteria | 941 |
| 609 | Ga0436360_0608365 | 3300039438 | Bacteria | 1528 |
| 610 | Ga0436363_1364752 | 3300039450 | Bacteria | 1440 |
| 611 | Ga0451847_0154865 | 3300041503 | Bacteria | 904 |
| 612 | Ga0439459_0030117 | 3300042438 | Bacteria | 1099 |
| 613 | Ga0466963_0079212 | 3300044694 | Bacteria | 2223 |
| 614 | Ga0466959_0123275 | 3300045049 | Bacteria | 1841 |
| 615 | Ga0495592_0000046 | 3300046454 | Bacteria | 117345 |
| 616 | Ga0495603_0054373 | 3300046455 | Bacteria | 2373 |
| 617 | Ga0495603_0079917 | 3300046455 | Bacteria | 1916 |
| 618 | Ga0495603_0122870 | 3300046455 | Bacteria | 1512 |
| 619 | Ga0495629_0000715 | 3300046459 | Bacteria | 26888 |
| 620 | Ga0495629_0062407 | 3300046459 | Bacteria | 2603 |
| 621 | Ga0495629_0068158 | 3300046459 | Bacteria | 2483 |
| 622 | Ga0495629_0072521 | 3300046459 | Bacteria | 2403 |
| 623 | Ga0495629_0240760 | 3300046459 | Bacteria | 1246 |
| 624 | Ga0495629_0367771 | 3300046459 | Bacteria | 979 |
| 625 | Ga0495641_0004301 | 3300046461 | Bacteria | 10140 |
| 626 | Ga0495641_0014848 | 3300046461 | Bacteria | 4195 |
| 627 | Ga0495641_0076696 | 3300046461 | Bacteria | 1498 |
| 628 | Ga0495651_0000367 | 3300046462 | Bacteria | 34798 |
| 629 | Ga0495651_0014223 | 3300046462 | Bacteria | 6152 |
| 630 | Ga0495651_0095339 | 3300046462 | Bacteria | 2225 |
| 631 | Ga0495653_0000006 | 3300046463 | Bacteria | 363285 |
| 632 | Ga0495653_0022686 | 3300046463 | Bacteria | 5077 |
| 633 | Ga0495653_0110195 | 3300046463 | Bacteria | 1979 |
| 634 | Ga0495653_0119854 | 3300046463 | Bacteria | 1877 |
| 635 | Ga0495580_0048842 | 3300046472 | Bacteria | 2994 |
| 636 | Ga0495580_0131579 | 3300046472 | Bacteria | 1735 |
| 637 | Ga0495582_0006057 | 3300046473 | Bacteria | 6739 |
| 638 | Ga0495582_0117872 | 3300046473 | Bacteria | 1494 |
| 639 | Ga0495582_0149160 | 3300046473 | Bacteria | 1327 |
| 640 | Ga0495639_0011590 | 3300046475 | Bacteria | 3803 |
| 641 | Ga0495639_0030118 | 3300046475 | Bacteria | 2411 |
| 642 | Ga0495662_0007136 | 3300046476 | Bacteria | 5537 |
| 643 | Ga0495662_0053910 | 3300046476 | Bacteria | 1942 |
| 644 | Ga0495662_0062328 | 3300046476 | Bacteria | 1801 |
| 645 | Ga0495664_0000002 | 3300046477 | Bacteria | 625183 |
| 646 | Ga0495664_0026061 | 3300046477 | Bacteria | 3404 |
| 647 | Ga0495664_0127424 | 3300046477 | Bacteria | 1540 |
| 648 | Ga0495584_0019631 | 3300046491 | Bacteria | 3433 |
| 649 | Ga0495584_0030486 | 3300046491 | Bacteria | 2732 |
| 650 | Ga0495584_0057383 | 3300046491 | Bacteria | 1959 |
| 651 | Ga0495584_0191623 | 3300046491 | Bacteria | 1039 |
| 652 | Ga0495584_0200886 | 3300046491 | Bacteria | 1013 |
| 653 | Ga0495585_0003015 | 3300046492 | Bacteria | 11605 |
| 654 | Ga0495594_0099646 | 3300046499 | Bacteria | 1634 |
| 655 | Ga0495594_0104756 | 3300046499 | Bacteria | 1592 |
| 656 | Ga0495594_0112366 | 3300046499 | Bacteria | 1536 |
| 657 | Ga0495596_0023185 | 3300046500 | Bacteria | 2520 |
| 658 | Ga0495607_0077437 | 3300046501 | Bacteria | 1837 |
| 659 | Ga0495607_0208577 | 3300046501 | Bacteria | 963 |
| 660 | Ga0495608_0000006 | 3300046511 | Bacteria | 324334 |
| 661 | Ga0495608_0024231 | 3300046511 | Bacteria | 4151 |
| 662 | Ga0495608_0042490 | 3300046511 | Bacteria | 3040 |
| 663 | Ga0495616_0015699 | 3300046513 | Bacteria | 4206 |
| 664 | Ga0495618_0000034 | 3300046514 | Bacteria | 104335 |
| 665 | Ga0495618_0103299 | 3300046514 | Bacteria | 1824 |
| 666 | Ga0495618_0317418 | 3300046514 | Bacteria | 965 |
| 667 | Ga0495620_0043362 | 3300046515 | Bacteria | 1960 |
| 668 | Ga0495628_0000002 | 3300046516 | Bacteria | 589399 |
| 669 | Ga0495628_0033147 | 3300046516 | Bacteria | 4164 |
| 670 | Ga0495628_0191330 | 3300046516 | Bacteria | 1545 |
| 671 | Ga0495630_0000681 | 3300046517 | Bacteria | 24313 |
| 672 | Ga0495637_0013925 | 3300046520 | Bacteria | 3807 |
| 673 | Ga0495637_0043648 | 3300046520 | Bacteria | 1912 |
| 674 | Ga0495644_0001007 | 3300046523 | Bacteria | 11735 |
| 675 | Ga0495663_0052085 | 3300046525 | Bacteria | 1270 |
| 676 | Ga0495666_0004207 | 3300046526 | Bacteria | 7261 |
| 677 | Ga0495642_0024002 | 3300046528 | Bacteria | 2411 |
| 678 | Ga0495652_0000004 | 3300046529 | Bacteria | 588877 |
| 679 | Ga0495652_0025782 | 3300046529 | Bacteria | 5197 |
| 680 | Ga0495652_0038140 | 3300046529 | Bacteria | 4164 |
| 681 | Ga0495665_0063974 | 3300046531 | Bacteria | 1941 |
| 682 | Ga0495640_0000007 | 3300046533 | Bacteria | 265481 |
| 683 | Ga0495640_0009410 | 3300046533 | Bacteria | 7609 |
| 684 | Ga0495640_0034366 | 3300046533 | Bacteria | 3596 |
| 685 | Ga0495640_0046452 | 3300046533 | Bacteria | 3008 |
| 686 | Ga0495640_0085264 | 3300046533 | Bacteria | 2093 |
| 687 | Ga0495587_0000031 | 3300046536 | Bacteria | 126721 |
| 688 | Ga0495587_0000674 | 3300046536 | Bacteria | 22861 |
| 689 | Ga0495598_0004776 | 3300046537 | Bacteria | 2958 |
| 690 | Ga0495598_0022964 | 3300046537 | Bacteria | 1674 |
| 691 | Ga0495609_0067883 | 3300046538 | Bacteria | 1570 |
| 692 | Ga0495645_0000116 | 3300046543 | Bacteria | 54286 |
| 693 | Ga0495645_0007302 | 3300046543 | Bacteria | 7686 |
| 694 | Ga0495645_0281583 | 3300046543 | Bacteria | 1093 |
| 695 | Ga0495633_0004191 | 3300046558 | Bacteria | 9253 |
| 696 | Ga0495667_0000002 | 3300046559 | Bacteria | 437535 |
| 697 | Ga0495667_0003450 | 3300046559 | Bacteria | 10596 |
| 698 | Ga0495667_0014292 | 3300046559 | Bacteria | 5362 |
| 699 | Ga0495656_0005104 | 3300046615 | Bacteria | 4525 |
| 700 | Ga0495656_0007368 | 3300046615 | Bacteria | 3885 |
| 701 | Ga0495656_0059562 | 3300046615 | Bacteria | 1662 |
| 702 | Ga0495634_0000533 | 3300046642 | Bacteria | 37336 |
| 703 | Ga0495634_0114793 | 3300046642 | Bacteria | 1729 |
| 704 | Ga0495634_0283607 | 3300046642 | Bacteria | 1005 |
| 705 | Ga0495634_0389470 | 3300046642 | Bacteria | 829 |
| 706 | Ga0495611_0078087 | 3300046648 | Bacteria | 1519 |
| 707 | Ga0495635_0000021 | 3300046663 | Bacteria | 164643 |
| 708 | Ga0495635_0005685 | 3300046663 | Bacteria | 8687 |
| 709 | Ga0495635_0010208 | 3300046663 | Bacteria | 6566 |
| 710 | Ga0495635_0018634 | 3300046663 | Bacteria | 4842 |
| 711 | Ga0495659_0000937 | 3300046664 | Bacteria | 10349 |
| 712 | Ga0495661_0069562 | 3300046665 | Bacteria | 2062 |
| 713 | Ga0495588_0002591 | 3300046674 | Bacteria | 7739 |
| 714 | Ga0495588_0017703 | 3300046674 | Bacteria | 3465 |
| 715 | Ga0495588_0139743 | 3300046674 | Bacteria | 1279 |
| 716 | Ga0495657_0000867 | 3300046675 | Bacteria | 26671 |
| 717 | Ga0495657_0019909 | 3300046675 | Bacteria | 4834 |
| 718 | Ga0495657_0037924 | 3300046675 | Bacteria | 3319 |
| 719 | Ga0495657_0041122 | 3300046675 | Bacteria | 3166 |
| 720 | Ga0495599_0000001 | 3300046678 | Bacteria | 537563 |
| 721 | Ga0495599_0001955 | 3300046678 | Bacteria | 11938 |
| 722 | Ga0495599_0069959 | 3300046678 | Bacteria | 2190 |
| 723 | Ga0495623_0001034 | 3300046679 | Bacteria | 18813 |
| 724 | Ga0495623_0008654 | 3300046679 | Bacteria | 6609 |
| 725 | Ga0495623_0075124 | 3300046679 | Bacteria | 2099 |
| 726 | Ga0495646_0000007 | 3300046680 | Bacteria | 236764 |
| 727 | Ga0495646_0002645 | 3300046680 | Bacteria | 11065 |
| 728 | Ga0495646_0024325 | 3300046680 | Bacteria | 3814 |
| 729 | Ga0495647_0004164 | 3300046681 | Bacteria | 4685 |
| 730 | Ga0495647_0029042 | 3300046681 | Bacteria | 2042 |
| 731 | Ga0495658_0002203 | 3300046683 | Bacteria | 9849 |
| 732 | Ga0495658_0035540 | 3300046683 | Bacteria | 2742 |
| 733 | Ga0495613_0035350 | 3300046689 | Bacteria | 3708 |
| 734 | Ga0495613_0060603 | 3300046689 | Bacteria | 2771 |
| 735 | Ga0495613_0080097 | 3300046689 | Bacteria | 2374 |
| 736 | Ga0495613_0192155 | 3300046689 | Bacteria | 1442 |
| 737 | Ga0495624_0019158 | 3300046690 | Bacteria | 4571 |
| 738 | Ga0495624_0300235 | 3300046690 | Bacteria | 968 |
| 739 | Ga0495670_0001110 | 3300046691 | Bacteria | 13063 |
| 740 | Ga0495670_0236503 | 3300046691 | Bacteria | 972 |
| 741 | Ga0495671_0099080 | 3300046692 | Bacteria | 1425 |
| 742 | Ga0495589_0021275 | 3300046794 | Bacteria | 3314 |
| 743 | Ga0495600_0000033 | 3300046809 | Bacteria | 83590 |
| 744 | Ga0495600_0005493 | 3300046809 | Bacteria | 7648 |
| 745 | Ga0495600_0020370 | 3300046809 | Bacteria | 4243 |
| 746 | Ga0495600_0162664 | 3300046809 | Bacteria | 1442 |
| 747 | Ga0495660_0080925 | 3300046810 | Bacteria | 1704 |
| 748 | Ga0495581_0038026 | 3300047315 | Bacteria | 2784 |
| 749 | Ga0495581_0065977 | 3300047315 | Bacteria | 2093 |
| 750 | Ga0495581_0094558 | 3300047315 | Bacteria | 1735 |
| 751 | Ga0495581_0191222 | 3300047315 | Bacteria | 1197 |
| 752 | Ga0495604_0000005 | 3300047317 | Bacteria | 424516 |
| 753 | Ga0495604_0000625 | 3300047317 | Bacteria | 30418 |
| 754 | Ga0495674_0000003 | 3300047319 | Bacteria | 562126 |
| 755 | Ga0495674_0011567 | 3300047319 | Bacteria | 8324 |
| 756 | Ga0495674_0021735 | 3300047319 | Bacteria | 5929 |
| 757 | Ga0495674_0222162 | 3300047319 | Bacteria | 1561 |
| 758 | Ga0495676_0035370 | 3300047321 | Bacteria | 4179 |
| 759 | Ga0495676_0235884 | 3300047321 | Bacteria | 1254 |
| 760 | Ga0495676_0244690 | 3300047321 | Bacteria | 1226 |
| 761 | Ga0495680_0000580 | 3300047322 | Bacteria | 41033 |
| 762 | Ga0495680_0006925 | 3300047322 | Bacteria | 10463 |
| 763 | Ga0495680_0009825 | 3300047322 | Bacteria | 8578 |
| 764 | Ga0495680_0033333 | 3300047322 | Bacteria | 4171 |
| 765 | Ga0495675_0000064 | 3300047444 | Bacteria | 74132 |
| 766 | Ga0495675_0000480 | 3300047444 | Bacteria | 26138 |
| 767 | Ga0495675_0006426 | 3300047444 | Bacteria | 7195 |
| 768 | Ga0495684_0001454 | 3300047471 | Bacteria | 18946 |
| 769 | Ga0495684_0013547 | 3300047471 | Bacteria | 6276 |
| 770 | Ga0495684_0208099 | 3300047471 | Bacteria | 1440 |
| 771 | Ga0495684_0253503 | 3300047471 | Bacteria | 1279 |
| 772 | Ga0495593_0004225 | 3300047673 | Bacteria | 8542 |
| 773 | Ga0495602_0000211 | 3300048088 | Bacteria | 54539 |
| 774 | Ga0495602_0016484 | 3300048088 | Bacteria | 7432 |
| 775 | Ga0495602_0024071 | 3300048088 | Bacteria | 5913 |
| 776 | Ga0495602_0060816 | 3300048088 | Bacteria | 3289 |
| 777 | Ga0495614_0053737 | 3300048089 | Bacteria | 1727 |
| 778 | Ga0496100_0000200 | 3300048903 | Bacteria | 32909 |
| 779 | Ga0496100_0002672 | 3300048903 | Bacteria | 9086 |
| 780 | Ga0496100_0005525 | 3300048903 | Bacteria | 6821 |
| 781 | Ga0496100_0012075 | 3300048903 | Bacteria | 4940 |
| 782 | Ga0496100_0117138 | 3300048903 | Bacteria | 1859 |
| 783 | Ga0496101_0000339 | 3300048904 | Bacteria | 31619 |
| 784 | Ga0496101_0003678 | 3300048904 | Bacteria | 9571 |
| 785 | Ga0496101_0020762 | 3300048904 | Bacteria | 4504 |
| 786 | Ga0496101_0036198 | 3300048904 | Bacteria | 3495 |
| 787 | Ga0496101_0114360 | 3300048904 | Bacteria | 2034 |
| 788 | Ga0496101_0197912 | 3300048904 | Bacteria | 1552 |
| 789 | Ga0496102_0000729 | 3300048905 | Bacteria | 32340 |
| 790 | Ga0496102_0012537 | 3300048905 | Bacteria | 7339 |
| 791 | Ga0496102_0015961 | 3300048905 | Bacteria | 6552 |
| 792 | Ga0496102_0019149 | 3300048905 | Bacteria | 6025 |
| 793 | Ga0496102_0032908 | 3300048905 | Bacteria | 4659 |
| 794 | Ga0496102_0092789 | 3300048905 | Bacteria | 2796 |
| 795 | Ga0496103_0001522 | 3300048906 | Bacteria | 15479 |
| 796 | Ga0496103_0002903 | 3300048906 | Bacteria | 10634 |
| 797 | Ga0496103_0003319 | 3300048906 | Bacteria | 9843 |
| 798 | Ga0496103_0034425 | 3300048906 | Bacteria | 3097 |
| 799 | Ga0496103_0049128 | 3300048906 | Bacteria | 2608 |
| 800 | Ga0496103_0102960 | 3300048906 | Bacteria | 1808 |
| 801 | Ga0496104_0005594 | 3300048907 | Bacteria | 11003 |
| 802 | Ga0496104_0016617 | 3300048907 | Bacteria | 6687 |
| 803 | Ga0496104_0018807 | 3300048907 | Bacteria | 6311 |
| 804 | Ga0496104_0038922 | 3300048907 | Bacteria | 4450 |
| 805 | Ga0496104_0069431 | 3300048907 | Bacteria | 3349 |
| 806 | Ga0496104_0160029 | 3300048907 | Bacteria | 2160 |
| 807 | Ga0496104_0171949 | 3300048907 | Bacteria | 2077 |
| 808 | Ga0496104_0304107 | 3300048907 | Bacteria | 1507 |
| 809 | Ga0496104_0331301 | 3300048907 | Bacteria | 1435 |
| 810 | Ga0496104_0416643 | 3300048907 | Bacteria | 1255 |
| 811 | Ga0496105_0010114 | 3300048908 | Bacteria | 7409 |
| 812 | Ga0496105_0015770 | 3300048908 | Bacteria | 6028 |
| 813 | Ga0496105_0019387 | 3300048908 | Bacteria | 5486 |
| 814 | Ga0496105_0083360 | 3300048908 | Bacteria | 2640 |
| 815 | Ga0496105_0096405 | 3300048908 | Bacteria | 2443 |
| 816 | Ga0496105_0100387 | 3300048908 | Bacteria | 2390 |
| 817 | Ga0496105_0169085 | 3300048908 | Bacteria | 1792 |
| 818 | Ga0496105_0182216 | 3300048908 | Bacteria | 1719 |
| 819 | Ga0496105_0316855 | 3300048908 | Bacteria | 1251 |
| 820 | Ga0496106_0000202 | 3300048909 | Bacteria | 41819 |
| 821 | Ga0496106_0010414 | 3300048909 | Bacteria | 6865 |
| 822 | Ga0496106_0013976 | 3300048909 | Bacteria | 5936 |
| 823 | Ga0496106_0018811 | 3300048909 | Bacteria | 5117 |
| 824 | Ga0496106_0063863 | 3300048909 | Bacteria | 2799 |
| 825 | Ga0496107_0000066 | 3300048910 | Bacteria | 52207 |
| 826 | Ga0496107_0003364 | 3300048910 | Bacteria | 10687 |
| 827 | Ga0496107_0012266 | 3300048910 | Bacteria | 5981 |
| 828 | Ga0496107_0014933 | 3300048910 | Bacteria | 5438 |
| 829 | Ga0496108_0002149 | 3300048911 | Bacteria | 15798 |
| 830 | Ga0496108_0009138 | 3300048911 | Bacteria | 8022 |
| 831 | Ga0496108_0011507 | 3300048911 | Bacteria | 7190 |
| 832 | Ga0496108_0013864 | 3300048911 | Bacteria | 6574 |
| 833 | Ga0496108_0027082 | 3300048911 | Bacteria | 4729 |
| 834 | Ga0496108_0083523 | 3300048911 | Bacteria | 2709 |
| 835 | Ga0496109_0000595 | 3300048912 | Bacteria | 30262 |
| 836 | Ga0496109_0003533 | 3300048912 | Bacteria | 13046 |
| 837 | Ga0496109_0033348 | 3300048912 | Bacteria | 4632 |
| 838 | Ga0496109_0222663 | 3300048912 | Bacteria | 1774 |
| 839 | Ga0496110_0012365 | 3300048913 | Bacteria | 7018 |
| 840 | Ga0496110_0012395 | 3300048913 | Bacteria | 7009 |
| 841 | Ga0496110_0021429 | 3300048913 | Bacteria | 5472 |
| 842 | Ga0496110_0057184 | 3300048913 | Bacteria | 3433 |
| 843 | Ga0496110_0088667 | 3300048913 | Bacteria | 2763 |
| 844 | Ga0496110_0091095 | 3300048913 | Bacteria | 2727 |
| 845 | Ga0496110_0306004 | 3300048913 | Bacteria | 1448 |
| 846 | Ga0496110_0341522 | 3300048913 | Bacteria | 1364 |
| 847 | Ga0496110_0429025 | 3300048913 | Bacteria | 1205 |
| 848 | Ga0496111_0006175 | 3300048914 | Bacteria | 7757 |
| 849 | Ga0496111_0030256 | 3300048914 | Bacteria | 3850 |
| 850 | Ga0496111_0030980 | 3300048914 | Bacteria | 3806 |
| 851 | Ga0496111_0162718 | 3300048914 | Bacteria | 1657 |
| 852 | Ga0496111_0189349 | 3300048914 | Bacteria | 1530 |
| 853 | Ga0496112_0005130 | 3300048915 | Bacteria | 11260 |
| 854 | Ga0496112_0180537 | 3300048915 | Bacteria | 2074 |
| 855 | Ga0496113_0000936 | 3300048916 | Bacteria | 15498 |
| 856 | Ga0496113_0039780 | 3300048916 | Bacteria | 3462 |
| 857 | Ga0496113_0081800 | 3300048916 | Bacteria | 2476 |
| 858 | Ga0496113_0160059 | 3300048916 | Bacteria | 1779 |
| 859 | Ga0496114_0018186 | 3300048917 | Bacteria | 5678 |
| 860 | Ga0496114_0033831 | 3300048917 | Bacteria | 4214 |
| 861 | Ga0496114_0112528 | 3300048917 | Bacteria | 2333 |
| 862 | Ga0496114_0179432 | 3300048917 | Bacteria | 1849 |
| 863 | Ga0496114_0697219 | 3300048917 | Bacteria | 891 |
| 864 | Ga0496115_0001197 | 3300048918 | Bacteria | 18589 |
| 865 | Ga0496115_0004591 | 3300048918 | Bacteria | 10003 |
| 866 | Ga0496115_0007531 | 3300048918 | Bacteria | 8017 |
| 867 | Ga0496115_0019783 | 3300048918 | Bacteria | 5185 |
| 868 | Ga0496115_0075652 | 3300048918 | Bacteria | 2735 |
| 869 | Ga0496115_0113411 | 3300048918 | Bacteria | 2227 |
| 870 | Ga0496115_0389107 | 3300048918 | Bacteria | 1133 |
| 871 | Ga0501031_0036504 | 3300049568 | Bacteria | 3206 |
| 872 | Ga0501031_0284753 | 3300049568 | Bacteria | 1072 |
| 873 | Ga0501032_0022586 | 3300049569 | Bacteria | 4359 |
| 874 | Ga0501032_0126431 | 3300049569 | Bacteria | 1688 |
| 875 | Ga0501032_0169000 | 3300049569 | Bacteria | 1434 |
| 876 | Ga0501033_0039686 | 3300049570 | Bacteria | 3516 |
| 877 | Ga0501034_0052213 | 3300049571 | Bacteria | 4119 |
| 878 | Ga0501034_0080407 | 3300049571 | Bacteria | 3262 |
| 879 | Ga0501034_0153891 | 3300049571 | Bacteria | 2274 |
| 880 | Ga0501034_0193055 | 3300049571 | Bacteria | 1998 |
| 881 | Ga0501034_0323310 | 3300049571 | Bacteria | 1475 |
| 882 | Ga0501034_0359545 | 3300049571 | Bacteria | 1383 |
| 883 | Ga0501034_0472642 | 3300049571 | Bacteria | 1169 |
| 884 | Ga0501036_0000499 | 3300049572 | Bacteria | 28121 |
| 885 | Ga0501036_0004466 | 3300049572 | Bacteria | 11304 |
| 886 | Ga0501036_0154219 | 3300049572 | Bacteria | 1937 |
| 887 | Ga0501036_0222853 | 3300049572 | Bacteria | 1583 |
| 888 | Ga0501037_0004304 | 3300049573 | Bacteria | 10327 |
| 889 | Ga0501037_0049134 | 3300049573 | Bacteria | 3089 |
| 890 | Ga0501037_0081766 | 3300049573 | Bacteria | 2342 |
| 891 | Ga0501037_0160172 | 3300049573 | Bacteria | 1604 |
| 892 | Ga0501038_0021308 | 3300049574 | Bacteria | 5819 |
| 893 | Ga0501038_0093480 | 3300049574 | Bacteria | 2515 |
| 894 | Ga0501038_0096930 | 3300049574 | Bacteria | 2461 |
| 895 | Ga0501038_0097916 | 3300049574 | Bacteria | 2446 |
| 896 | Ga0501038_0098954 | 3300049574 | Bacteria | 2431 |
| 897 | Ga0501039_0013202 | 3300049575 | Bacteria | 6313 |
| 898 | Ga0501039_0015680 | 3300049575 | Bacteria | 5797 |
| 899 | Ga0501039_0026725 | 3300049575 | Bacteria | 4435 |
| 900 | Ga0501039_0046309 | 3300049575 | Bacteria | 3360 |
| 901 | Ga0501039_0050154 | 3300049575 | Bacteria | 3228 |
| 902 | Ga0501039_0125226 | 3300049575 | Bacteria | 2015 |
| 903 | Ga0501039_0515094 | 3300049575 | Bacteria | 939 |
| 904 | Ga0501040_0470946 | 3300049576 | Bacteria | 905 |
| 905 | Ga0501041_0022261 | 3300049577 | Bacteria | 3794 |
| 906 | Ga0501042_0139776 | 3300049578 | Bacteria | 1746 |
| 907 | Ga0501042_0286249 | 3300049578 | Bacteria | 1190 |
| 908 | Ga0501042_0469786 | 3300049578 | Bacteria | 912 |
| 909 | Ga0501043_0001994 | 3300049579 | Bacteria | 17420 |
| 910 | Ga0501043_0005803 | 3300049579 | Bacteria | 9934 |
| 911 | Ga0501043_0068503 | 3300049579 | Bacteria | 2786 |
| 912 | Ga0501043_0120165 | 3300049579 | Bacteria | 2060 |
| 913 | Ga0501046_0038534 | 3300049580 | Bacteria | 3834 |
| 914 | Ga0501046_0056851 | 3300049580 | Bacteria | 3069 |
| 915 | Ga0501046_0123960 | 3300049580 | Bacteria | 1964 |
| 916 | Ga0501046_0277360 | 3300049580 | Bacteria | 1229 |
| 917 | Ga0501047_0006121 | 3300049581 | Bacteria | 11306 |
| 918 | Ga0501047_0183326 | 3300049581 | Bacteria | 1959 |
| 919 | Ga0501047_0286113 | 3300049581 | Bacteria | 1492 |
| 920 | Ga0501047_0377844 | 3300049581 | Bacteria | 1251 |
| 921 | Ga0501048_0000256 | 3300049582 | Bacteria | 35566 |
| 922 | Ga0501048_0028019 | 3300049582 | Bacteria | 4091 |
| 923 | Ga0501048_0132804 | 3300049582 | Bacteria | 1759 |
| 924 | Ga0501067_0016157 | 3300049583 | Bacteria | 4127 |
| 925 | Ga0501067_0085867 | 3300049583 | Bacteria | 1746 |
| 926 | Ga0501068_0017335 | 3300049584 | Bacteria | 4164 |
| 927 | Ga0501068_0019130 | 3300049584 | Bacteria | 3971 |
| 928 | Ga0501068_0122127 | 3300049584 | Bacteria | 1624 |
| 929 | Ga0501068_0221349 | 3300049584 | Bacteria | 1203 |
| 930 | Ga0501069_0027792 | 3300049585 | Bacteria | 3101 |
| 931 | Ga0501069_0040881 | 3300049585 | Bacteria | 2562 |
| 932 | Ga0501069_0042967 | 3300049585 | Bacteria | 2501 |
| 933 | Ga0501069_0130731 | 3300049585 | Bacteria | 1437 |
| 934 | Ga0501070_0000817 | 3300049586 | Bacteria | 28270 |
| 935 | Ga0501070_0007450 | 3300049586 | Bacteria | 9296 |
| 936 | Ga0501070_0091120 | 3300049586 | Bacteria | 2523 |
| 937 | Ga0501070_0244232 | 3300049586 | Bacteria | 1469 |
| 938 | Ga0501070_0315740 | 3300049586 | Bacteria | 1271 |
| 939 | Ga0501070_0333677 | 3300049586 | Bacteria | 1232 |
| 940 | Ga0501071_0082042 | 3300049587 | Bacteria | 2360 |
| 941 | Ga0501071_0444215 | 3300049587 | Bacteria | 992 |
| 942 | Ga0501072_0024435 | 3300049588 | Bacteria | 4700 |
| 943 | Ga0501072_0091845 | 3300049588 | Bacteria | 2410 |
| 944 | Ga0501072_0318748 | 3300049588 | Bacteria | 1235 |
| 945 | Ga0501072_0412925 | 3300049588 | Bacteria | 1070 |
| 946 | Ga0501073_0041000 | 3300049589 | Bacteria | 3273 |
| 947 | Ga0501073_0124019 | 3300049589 | Bacteria | 1790 |
| 948 | Ga0501073_0389265 | 3300049589 | Bacteria | 963 |
| 949 | Ga0501073_0481000 | 3300049589 | Bacteria | 859 |
| 950 | Ga0501074_0025755 | 3300049590 | Bacteria | 4268 |
| 951 | Ga0501074_0031242 | 3300049590 | Bacteria | 3858 |
| 952 | Ga0501074_0058942 | 3300049590 | Bacteria | 2766 |
| 953 | Ga0501074_0074734 | 3300049590 | Bacteria | 2433 |
| 954 | Ga0501075_0042097 | 3300049591 | Bacteria | 3424 |
| 955 | Ga0501076_0010949 | 3300049592 | Bacteria | 6746 |
| 956 | Ga0501076_0629612 | 3300049592 | Bacteria | 885 |
| 957 | Ga0501079_0167297 | 3300049741 | Bacteria | 1715 |
| 958 | Ga0501079_0178805 | 3300049741 | Bacteria | 1655 |
| 959 | Ga0501079_0185463 | 3300049741 | Bacteria | 1624 |
| 960 | Ga0501080_0004650 | 3300049742 | Bacteria | 12241 |
| 961 | Ga0501080_0007139 | 3300049742 | Bacteria | 10081 |
| 962 | Ga0501080_0233560 | 3300049742 | Bacteria | 1680 |
| 963 | Ga0501080_0448111 | 3300049742 | Bacteria | 1157 |
| 964 | Ga0501080_0814034 | 3300049742 | Bacteria | 818 |
| 965 | Ga0501081_0213203 | 3300049743 | Bacteria | 1403 |
| 966 | Ga0501083_0000704 | 3300049744 | Bacteria | 21763 |
| 967 | Ga0501083_0002432 | 3300049744 | Bacteria | 12739 |
| 968 | Ga0501083_0015359 | 3300049744 | Bacteria | 5364 |
| 969 | Ga0501083_0087374 | 3300049744 | Bacteria | 2061 |
| 970 | Ga0501083_0114278 | 3300049744 | Bacteria | 1773 |
| 971 | Ga0501083_0118652 | 3300049744 | Bacteria | 1736 |
| 972 | Ga0501083_0239855 | 3300049744 | Bacteria | 1180 |
| 973 | Ga0501035_0001481 | 3300049822 | Bacteria | 24033 |
| 974 | Ga0501035_0007974 | 3300049822 | Bacteria | 9875 |
| 975 | Ga0501035_0053372 | 3300049822 | Bacteria | 3615 |
| 976 | Ga0501035_0083810 | 3300049822 | Bacteria | 2812 |
| 977 | Ga0501035_0551561 | 3300049822 | Bacteria | 944 |
| 978 | Ga0501044_0142306 | 3300049823 | Bacteria | 2386 |
| 979 | Ga0501044_0144706 | 3300049823 | Bacteria | 2363 |
| 980 | Ga0501044_0148529 | 3300049823 | Bacteria | 2327 |
| 981 | Ga0501044_0269292 | 3300049823 | Bacteria | 1639 |
| 982 | Ga0501044_0466110 | 3300049823 | Bacteria | 1168 |
| 983 | Ga0501045_0027004 | 3300049824 | Bacteria | 4133 |
| 984 | Ga0501045_0147001 | 3300049824 | Bacteria | 1753 |
| 985 | nmdc:mga03683_5699_c1 | 3300050489 | Bacteria | 4222 |
| 986 | nmdc:mga03683_574_c2 | 3300050489 | Bacteria | 9415 |
| 987 | nmdc:mga03n38_104152_c1 | 3300050490 | Bacteria | 1372 |
| 988 | nmdc:mga03n38_135935_c1 | 3300050490 | Bacteria | 1223 |
| 989 | nmdc:mga03n38_210524_c1 | 3300050490 | Bacteria | 1010 |
| 990 | nmdc:mga03n38_384164_c1 | 3300050490 | Bacteria | 770 |
| 991 | nmdc:mga03n38_50884_c1 | 3300050490 | Bacteria | 1848 |
| 992 | nmdc:mga00v17_122742_c1 | 3300050491 | Bacteria | 1655 |
| 993 | nmdc:mga00v17_198738_c1 | 3300050491 | Bacteria | 1296 |
| 994 | nmdc:mga00v17_234370_c1 | 3300050491 | Bacteria | 1190 |
| 995 | nmdc:mga00v17_61153_c1 | 3300050491 | Bacteria | 2315 |
| 996 | nmdc:mga00v17_90598_c1 | 3300050491 | Bacteria | 1920 |
| 997 | nmdc:mga0yw44_190997_c1 | 3300050492 | Bacteria | 1351 |
| 998 | nmdc:mga0yw44_19101_c1 | 3300050492 | Bacteria | 3772 |
| 999 | nmdc:mga0yw44_19147_c1 | 3300050492 | Bacteria | 3767 |
| 1000 | nmdc:mga0yw44_201255_c1 | 3300050492 | Bacteria | 1315 |
| 1001 | nmdc:mga0yw44_350192_c1 | 3300050492 | Bacteria | 994 |
| 1002 | nmdc:mga0yw44_423_c1 | 3300050492 | Bacteria | 14812 |
| 1003 | nmdc:mga0k408_183858_c1 | 3300050493 | Bacteria | 1246 |
| 1004 | nmdc:mga0k408_275455_c1 | 3300050493 | Bacteria | 1004 |
| 1005 | nmdc:mga0k408_42706_c1 | 3300050493 | Bacteria | 2611 |
| 1006 | nmdc:mga0k408_5032_c1 | 3300050493 | Bacteria | 6999 |
| 1007 | nmdc:mga0k408_7820_c1 | 3300050493 | Bacteria | 5716 |
| 1008 | nmdc:mga06z11_17615_c1 | 3300050494 | Bacteria | 3246 |
| 1009 | nmdc:mga06z11_176278_c1 | 3300050494 | Bacteria | 1230 |
| 1010 | nmdc:mga06z11_232923_c1 | 3300050494 | Bacteria | 1079 |
| 1011 | nmdc:mga06z11_9053_c1 | 3300050494 | Bacteria | 4182 |
| 1012 | nmdc:mga06z11_9265_c1 | 3300050494 | Bacteria | 4142 |
| 1013 | nmdc:mga06z11_95938_c1 | 3300050494 | Bacteria | 1619 |
| 1014 | nmdc:mga04h51_15337_c1 | 3300050495 | Bacteria | 2206 |
| 1015 | nmdc:mga04h51_6699_c1 | 3300050495 | Bacteria | 3003 |
| 1016 | nmdc:mga07m45_3503_c1 | 3300050496 | Bacteria | 7566 |
| 1017 | nmdc:mga07m45_4332_c1 | 3300050496 | Bacteria | 5348 |
| 1018 | nmdc:mga05p37_1740_c1 | 3300050507 | Bacteria | 25419 |
| 1019 | nmdc:mga05p37_89003_c1 | 3300050507 | Bacteria | 3805 |
| 1020 | nmdc:mga09592_1499_c1 | 3300050508 | Bacteria | 18808 |
| 1021 | nmdc:mga09592_54222_c1 | 3300050508 | Bacteria | 3387 |
| 1022 | nmdc:mga0qj67_224967_c1 | 3300050509 | Bacteria | 1523 |
| 1023 | nmdc:mga0qj67_26598_c1 | 3300050509 | Bacteria | 4478 |
| 1024 | nmdc:mga0qj67_2708_c1 | 3300050509 | Bacteria | 12703 |
| 1025 | nmdc:mga0qj67_277074_c1 | 3300050509 | Bacteria | 1360 |
| 1026 | nmdc:mga0qj67_330988_c1 | 3300050509 | Bacteria | 1232 |
| 1027 | nmdc:mga0qj67_385842_c1 | 3300050509 | Bacteria | 1131 |
| 1028 | nmdc:mga06r32_106497_c1 | 3300050510 | Bacteria | 2755 |
| 1029 | nmdc:mga06r32_546_c1 | 3300050510 | Bacteria | 32690 |
| 1030 | nmdc:mga06r32_89394_c1 | 3300050510 | Bacteria | 3007 |
| 1031 | nmdc:mga08y16_1229_c1 | 3300050511 | Bacteria | 25351 |
| 1032 | nmdc:mga08y16_206644_c1 | 3300050511 | Bacteria | 2034 |
| 1033 | nmdc:mga08y16_3164_c1 | 3300050511 | Bacteria | 17060 |
| 1034 | nmdc:mga08y16_367004_c1 | 3300050511 | Bacteria | 1477 |
| 1035 | nmdc:mga08y16_53319_c1 | 3300050511 | Bacteria | 4229 |
| 1036 | nmdc:mga08y16_67041_c1 | 3300050511 | Bacteria | 3745 |
| 1037 | nmdc:mga0n895_266_c1 | 3300050512 | Bacteria | 34104 |
| 1038 | nmdc:mga0n895_356437_c1 | 3300050512 | Bacteria | 1481 |
| 1039 | nmdc:mga0n895_381_c1 | 3300050512 | Bacteria | 30014 |
| 1040 | nmdc:mga0n895_512715_c1 | 3300050512 | Bacteria | 1207 |
| 1041 | nmdc:mga0n895_526896_c1 | 3300050512 | Bacteria | 1189 |
| 1042 | nmdc:mga0n895_99533_c1 | 3300050512 | Bacteria | 2916 |
| 1043 | nmdc:mga0rr50_1066_c1 | 3300050513 | Bacteria | 14910 |
| 1044 | nmdc:mga0rr50_158213_c1 | 3300050513 | Bacteria | 1837 |
| 1045 | nmdc:mga0rr50_164307_c1 | 3300050513 | Bacteria | 1804 |
| 1046 | nmdc:mga0rr50_51500_c1 | 3300050513 | Bacteria | 3055 |
| 1047 | nmdc:mga0rr50_53668_c1 | 3300050513 | Bacteria | 2999 |
| 1048 | nmdc:mga08x19_119965_c1 | 3300050514 | Bacteria | 1762 |
| 1049 | nmdc:mga08x19_91289_c1 | 3300050514 | Bacteria | 2010 |
| 1050 | nmdc:mga0a205_1323_c1 | 3300050515 | Bacteria | 20896 |
| 1051 | nmdc:mga0a205_2432_c1 | 3300050515 | Bacteria | 16422 |
| 1052 | nmdc:mga0a205_250459_c1 | 3300050515 | Bacteria | 1651 |
| 1053 | nmdc:mga0a205_371726_c1 | 3300050515 | Bacteria | 1295 |
| 1054 | nmdc:mga0a205_373814_c1 | 3300050515 | Bacteria | 1291 |
| 1055 | nmdc:mga0a205_70963_c2 | 3300050515 | Bacteria | 2195 |
| 1056 | nmdc:mga0sz30_1107_c1 | 3300050516 | Bacteria | 9680 |
| 1057 | nmdc:mga0sz30_189939_c1 | 3300050516 | Bacteria | 912 |
| 1058 | nmdc:mga0sz30_22397_c1 | 3300050516 | Bacteria | 2564 |
| 1059 | Ga0495601_0000008 | 3300053077 | Bacteria | 362152 |
| 1060 | Ga0495601_0003866 | 3300053077 | Bacteria | 8624 |
| 1061 | Ga0495601_0004477 | 3300053077 | Bacteria | 8075 |
| 1062 | Ga0495601_0008678 | 3300053077 | Bacteria | 5996 |
| 1063 | Ga0495601_0045707 | 3300053077 | Bacteria | 2754 |
| 1064 | Ga0495601_0087849 | 3300053077 | Bacteria | 1999 |
| 1065 | Ga0495612_0000026 | 3300053078 | Bacteria | 111627 |
| 1066 | Ga0495612_0004903 | 3300053078 | Bacteria | 5535 |
| 1067 | Ga0495612_0011774 | 3300053078 | Bacteria | 3525 |
| 1068 | Ga0495612_0013030 | 3300053078 | Bacteria | 3348 |
| 1069 | Ga0495595_0000096 | 3300053084 | Bacteria | 41512 |
| 1070 | Ga0495595_0001646 | 3300053084 | Bacteria | 8745 |
| 1071 | Ga0495595_0001927 | 3300053084 | Bacteria | 8048 |
| 1072 | Ga0495619_0000002 | 3300053085 | Bacteria | 530226 |
| 1073 | Ga0495619_0000266 | 3300053085 | Bacteria | 38066 |
| 1074 | Ga0495619_0005383 | 3300053085 | Bacteria | 8107 |
| 1075 | Ga0495619_0008789 | 3300053085 | Bacteria | 6388 |
| 1076 | Ga0495619_0011357 | 3300053085 | Bacteria | 5608 |
| 1077 | Ga0495619_0018946 | 3300053085 | Bacteria | 4371 |
| 1078 | Ga0500646_0000464 | 3300053090 | Bacteria | 11970 |
| 1079 | Ga0500651_0109485 | 3300053093 | Bacteria | 1687 |
| 1080 | Ga0500641_0003675 | 3300053096 | Bacteria | 5415 |
| 1081 | Ga0500641_0008671 | 3300053096 | Bacteria | 3635 |
| 1082 | Ga0500650_0088324 | 3300053098 | Bacteria | 1451 |
| 1083 | Ga0500593_003902 | 3300053117 | Bacteria | 5720 |
| 1084 | Ga0500642_0002845 | 3300053130 | Bacteria | 5137 |
| 1085 | Ga0500655_007900 | 3300053133 | Bacteria | 1916 |
| 1086 | Ga0500568_0155559 | 3300053139 | Bacteria | 845 |
| 1087 | Ga0500604_0000243 | 3300053151 | Bacteria | 15638 |
| 1088 | Ga0500616_0178452 | 3300053153 | Bacteria | 958 |
| 1089 | Ga0500636_0166840 | 3300053177 | Bacteria | 1195 |
| 1090 | Ga0500637_0040667 | 3300053178 | Bacteria | 2627 |
| 1091 | Ga0501084_0128596 | 3300054114 | Bacteria | 2132 |
| 1092 | Ga0501082_0037054 | 3300060353 | Bacteria | 4202 |
| 1093 | Ga0501082_0202537 | 3300060353 | Bacteria | 1727 |
| 1094 | Ga0501082_0295870 | 3300060353 | Bacteria | 1409 |
| 1095 | Ga0501082_0538602 | 3300060353 | Bacteria | 1021 |
| 1096 | Ga0501082_0584455 | 3300060353 | Bacteria | 977 |
| 1097 | Ga0501082_0598126 | 3300060353 | Bacteria | 965 |
| 1098 | Ga0530510_0294757 | 3300061734 | Bacteria | 1213 |
| 1099 | 2508546153 | 2508501009 | Bacteria | 7784016 |
| 1100 | 2643755737 | 2643221547 | Bacteria | 4740017 |
| 1101 | 2739305777 | 2738543024 | Bacteria | 5603683 |
| 1102 | 2883356039 | 2883354860 | Bacteria | 5865246 |
| 1103 | 2894238127 | 2894232714 | Bacteria | 8834183 |
| 1104 | 2935615000 | 2935608549 | Bacteria | 8203142 |
| 1105 | 2935825962 | 2935819856 | Bacteria | 8261050 |
| 1106 | 2935851581 | 2935847175 | Bacteria | 8228321 |
| 1107 | 2935910396 | 2935908558 | Bacteria | 8568796 |
| 1108 | 2935918318 | 2935916978 | Bacteria | 9113783 |
| 1109 | 2935927693 | 2935926038 | Bacteria | 8601059 |
| 1110 | 2935936435 | 2935934488 | Bacteria | 8602579 |
| 1111 | 2935944012 | 2935942939 | Bacteria | 8599779 |
| 1112 | 2935952449 | 2935951376 | Bacteria | 8602333 |
| 1113 | 2935969289 | 2935967501 | Bacteria | 8603075 |
| 1114 | 8016636130 | 8016630954 | Bacteria | 9217207 |
| 1115 | 8019696745 | 8019687851 | Bacteria | 8712826 |
| 1116 | Ga0265327_10013343 | |||
| 1117 | JGI24032J14994_100195 | |||
| 1118 | JGI24736J21556_1018891 | |||
| 1119 | JGI24746J21847_1000023 | |||
| 1120 | JGI24747J21853_1007192 | |||
| 1121 | JGI24740J21852_10006000 | |||
| 1122 | JGI24739J22299_10000241 | |||
| 1123 | JGI24737J22298_10000224 | |||
| 1124 | JGI24750J21931_1002931 | |||
| 1125 | JGI24745J21846_1003827 | |||
| 1126 | JGI24748J21848_1000156 | |||
| 1127 | JGI24749J21850_1000332 | |||
| 1128 | JGI24035J26624_1000018 | |||
| 1129 | JGI24033J26618_1001362 | |||
| 1130 | JGI24742J22300_10000292 | |||
| 1131 | JGI24742J22300_10008452 | |||
| 1132 | JGI24751J29686_10015572 | |||
| 1133 | JGI25405J52794_10028243 | |||
| 1134 | Ga0065704_10213197 | |||
| 1135 | Ga0065712_10078486 | |||
| 1136 | Ga0065715_10094438 | |||
| 1137 | Ga0070676_10000629 | |||
| 1138 | Ga0070683_100000240 | |||
| 1139 | Ga0070683_100469829 | |||
| 1140 | Ga0070690_100277390 | |||
| 1141 | Ga0070670_100002399 | |||
| 1142 | Ga0070670_100005146 | |||
| 1143 | Ga0070670_100079536 | |||
| 1144 | Ga0070677_10000507 | |||
| 1145 | Ga0068869_100000189 | |||
| 1146 | Ga0068869_100022353 | |||
| 1147 | Ga0070666_10037337 | |||
| 1148 | Ga0070680_100000706 | |||
| 1149 | Ga0070680_100212164 | |||
| 1150 | Ga0070682_100000202 | |||
| 1151 | Ga0070682_100296371 | |||
| 1152 | Ga0070682_100349728 | |||
| 1153 | Ga0068868_100000614 | |||
| 1154 | Ga0068868_100037776 | |||
| 1155 | Ga0070660_100000223 | |||
| 1156 | Ga0070689_100000187 | |||
| 1157 | Ga0070689_100204024 | |||
| 1158 | Ga0070691_10000236 | |||
| 1159 | Ga0070687_100018832 | |||
| 1160 | Ga0070687_100141252 | |||
| 1161 | Ga0070661_100000298 | |||
| 1162 | Ga0070661_100061349 | |||
| 1163 | Ga0070692_10000016 | |||
| 1164 | Ga0070692_10051757 | |||
| 1165 | Ga0070668_100011766 | |||
| 1166 | Ga0070669_100000959 | |||
| 1167 | Ga0070669_100008568 | |||
| 1168 | Ga0070675_100000215 | |||
| 1169 | Ga0070675_100063249 | |||
| 1170 | Ga0070671_100000402 | |||
| 1171 | Ga0070671_100038892 | |||
| 1172 | Ga0070674_100088272 | |||
| 1173 | Ga0070673_100000035 | |||
| 1174 | Ga0070673_100042057 | |||
| 1175 | Ga0070673_100496766 | |||
| 1176 | Ga0070688_100000130 | |||
| 1177 | Ga0070688_100157331 | |||
| 1178 | Ga0070688_100373156 | |||
| 1179 | Ga0070659_100000583 | |||
| 1180 | Ga0070659_100246834 | |||
| 1181 | Ga0070667_100000712 | |||
| 1182 | Ga0070667_100103626 | |||
| 1183 | Ga0070667_100119102 | |||
| 1184 | Ga0070667_100229298 | |||
| 1185 | Ga0070703_10003763 | |||
| 1186 | Ga0070709_10393736 | |||
| 1187 | Ga0070714_100108188 | |||
| 1188 | Ga0070714_100125294 | |||
| 1189 | Ga0070713_100016322 | |||
| 1190 | Ga0070713_100055369 | |||
| 1191 | Ga0070713_100122517 | |||
| 1192 | Ga0070713_100870623 | |||
| 1193 | Ga0070710_10032561 | |||
| 1194 | Ga0070710_10064728 | |||
| 1195 | Ga0070701_10000081 | |||
| 1196 | Ga0070711_100002454 | |||
| 1197 | Ga0070711_100032952 | |||
| 1198 | Ga0070711_100092853 | |||
| 1199 | Ga0070711_100113342 | |||
| 1200 | Ga0070711_100166814 | |||
| 1201 | Ga0070711_100233336 | |||
| 1202 | Ga0070705_100000911 | |||
| 1203 | Ga0070705_100036554 | |||
| 1204 | Ga0070705_100075743 | |||
| 1205 | Ga0070700_100000393 | |||
| 1206 | Ga0070700_100018829 | |||
| 1207 | Ga0070700_100318285 | |||
| 1208 | Ga0070694_100000129 | |||
| 1209 | Ga0070694_100023553 | |||
| 1210 | Ga0070694_100041690 | |||
| 1211 | Ga0070694_100176338 | |||
| 1212 | Ga0070708_100020441 | |||
| 1213 | Ga0070663_100000746 | |||
| 1214 | Ga0070663_100156899 | |||
| 1215 | Ga0070663_100630527 | |||
| 1216 | Ga0070678_100000399 | |||
| 1217 | Ga0070678_100065422 | |||
| 1218 | Ga0070678_100070356 | |||
| 1219 | Ga0070662_100001543 | |||
| 1220 | Ga0070681_10001286 | |||
| 1221 | Ga0070681_10183193 | |||
| 1222 | Ga0070681_10715590 | |||
| 1223 | Ga0068867_100000369 | |||
| 1224 | Ga0068867_100040352 | |||
| 1225 | Ga0070685_10000490 | |||
| 1226 | Ga0070685_10014589 | |||
| 1227 | Ga0070685_10053956 | |||
| 1228 | Ga0070706_100044132 | |||
| 1229 | Ga0070706_100299650 | |||
| 1230 | Ga0070698_100030729 | |||
| 1231 | Ga0070698_100515424 | |||
| 1232 | Ga0070679_100000553 | |||
| 1233 | Ga0070679_100147317 | |||
| 1234 | Ga0070679_100451852 | |||
| 1235 | Ga0070684_100000246 | |||
| 1236 | Ga0070684_100188202 | |||
| 1237 | Ga0070684_100845241 | |||
| 1238 | Ga0070697_100237757 | |||
| 1239 | Ga0068853_100000243 | |||
| 1240 | Ga0068853_100216016 | |||
| 1241 | Ga0070672_100000157 | |||
| 1242 | Ga0070686_100000260 | |||
| 1243 | Ga0070686_100328931 | |||
| 1244 | Ga0070695_100001653 | |||
| 1245 | Ga0070695_100019838 | |||
| 1246 | Ga0070695_100124322 | |||
| 1247 | Ga0070695_100429492 | |||
| 1248 | Ga0070696_100000970 | |||
| 1249 | Ga0070696_100592696 | |||
| 1250 | Ga0070693_100000925 | |||
| 1251 | Ga0070693_100009542 | |||
| 1252 | Ga0070693_100199410 | |||
| 1253 | Ga0070665_100010001 | |||
| 1254 | Ga0070665_100050448 | |||
| 1255 | Ga0070665_100063747 | |||
| 1256 | Ga0070665_100111383 | |||
| 1257 | Ga0070665_100200847 | |||
| 1258 | Ga0070704_100000171 | |||
| 1259 | Ga0068855_100010157 | |||
| 1260 | Ga0068855_100060530 | |||
| 1261 | Ga0070664_100000269 | |||
| 1262 | Ga0070664_100145118 | |||
| 1263 | Ga0070664_100231415 | |||
| 1264 | Ga0068857_100000174 | |||
| 1265 | Ga0068854_100000211 | |||
| 1266 | Ga0068856_100000600 | |||
| 1267 | Ga0068856_100224783 | |||
| 1268 | Ga0070702_100001226 | |||
| 1269 | Ga0070702_100008942 | |||
| 1270 | Ga0068852_100000629 | |||
| 1271 | Ga0068852_100284754 | |||
| 1272 | Ga0068859_100000894 | |||
| 1273 | Ga0068859_100135914 | |||
| 1274 | Ga0068859_100879193 | |||
| 1275 | Ga0068864_100000329 | |||
| 1276 | Ga0068864_100079371 | |||
| 1277 | Ga0068864_100650307 | |||
| 1278 | Ga0068866_10000177 | |||
| 1279 | Ga0068866_10163097 | |||
| 1280 | Ga0068861_100000329 | |||
| 1281 | Ga0068851_10045110 | |||
| 1282 | Ga0068870_10000056 | |||
| 1283 | Ga0068863_100000278 | |||
| 1284 | Ga0068863_100338958 | |||
| 1285 | Ga0068858_100001048 | |||
| 1286 | Ga0068858_100383155 | |||
| 1287 | Ga0068860_100000985 | |||
| 1288 | Ga0068860_100055313 | |||
| 1289 | Ga0068860_100144436 | |||
| 1290 | Ga0068860_100164210 | |||
| 1291 | Ga0068862_100000593 | |||
| 1292 | Ga0068862_100198757 | |||
| 1293 | Ga0081455_10000523 | |||
| 1294 | Ga0081455_10097800 | |||
| 1295 | Ga0081455_10397491 | |||
| 1296 | Ga0081538_10016043 | |||
| 1297 | Ga0081538_10089721 | |||
| 1298 | Ga0081540_1000002 | |||
| 1299 | Ga0081540_1109824 | |||
| 1300 | Ga0081539_10003057 | |||
| 1301 | Ga0081539_10076118 | |||
| 1302 | Ga0070717_10171763 | |||
| 1303 | Ga0070717_10429212 | |||
| 1304 | Ga0075365_10052915 | |||
| 1305 | Ga0075365_10071781 | |||
| 1306 | Ga0075365_10077086 | |||
| 1307 | Ga0075365_10094047 | |||
| 1308 | Ga0075365_10098773 | |||
| 1309 | Ga0075365_10359215 | |||
| 1310 | Ga0075365_10442082 | |||
| 1311 | Ga0075368_10001270 | |||
| 1312 | Ga0075368_10005670 | |||
| 1313 | Ga0075368_10028942 | |||
| 1314 | Ga0075368_10032622 | |||
| 1315 | Ga0075363_100000768 | |||
| 1316 | Ga0075363_100034241 | |||
| 1317 | Ga0075363_100039560 | |||
| 1318 | Ga0075363_100073631 | |||
| 1319 | Ga0075364_10046300 | |||
| 1320 | Ga0075364_10054479 | |||
| 1321 | Ga0075364_10098468 | |||
| 1322 | Ga0075364_10149504 | |||
| 1323 | Ga0075364_10167198 | |||
| 1324 | Ga0075364_10242390 | |||
| 1325 | Ga0075432_10000435 | |||
| 1326 | Ga0070716_100091335 | |||
| 1327 | Ga0070712_100067684 | |||
| 1328 | Ga0070712_100264732 | |||
| 1329 | Ga0075362_10016516 | |||
| 1330 | Ga0075362_10085696 | |||
| 1331 | Ga0075362_10094219 | |||
| 1332 | Ga0075367_10000684 | |||
| 1333 | Ga0075367_10042972 | |||
| 1334 | Ga0075367_10052216 | |||
| 1335 | Ga0075367_10066230 | |||
| 1336 | Ga0075367_10146137 | |||
| 1337 | Ga0075367_10180909 | |||
| 1338 | Ga0075369_10000702 | |||
| 1339 | Ga0075369_10013091 | |||
| 1340 | Ga0075427_10014511 | |||
| 1341 | Ga0075366_10012158 | |||
| 1342 | Ga0075366_10018063 | |||
| 1343 | Ga0075366_10121584 | |||
| 1344 | Ga0075366_10180368 | |||
| 1345 | Ga0097621_100000504 | |||
| 1346 | Ga0075370_10009280 | |||
| 1347 | Ga0075370_10048030 | |||
| 1348 | Ga0068871_100000815 | |||
| 1349 | Ga0068871_100451111 | |||
| 1350 | Ga0075428_100001439 | |||
| 1351 | Ga0075428_100127851 | |||
| 1352 | Ga0075428_100407185 | |||
| 1353 | Ga0075430_100001275 | |||
| 1354 | Ga0075430_100122634 | |||
| 1355 | Ga0075430_100167364 | |||
| 1356 | Ga0075430_100597029 | |||
| 1357 | Ga0075430_100717555 | |||
| 1358 | Ga0075431_100005046 | |||
| 1359 | Ga0075431_100554994 | |||
| 1360 | Ga0075433_10002183 | |||
| 1361 | Ga0075433_10010619 | |||
| 1362 | Ga0075433_10032030 | |||
| 1363 | Ga0075433_10148107 | |||
| 1364 | Ga0075433_10218628 | |||
| 1365 | Ga0075433_10725576 | |||
| 1366 | Ga0075434_100000244 | |||
| 1367 | Ga0075434_100002619 | |||
| 1368 | Ga0075434_100011824 | |||
| 1369 | Ga0075434_100012549 | |||
| 1370 | Ga0075434_100047465 | |||
| 1371 | Ga0075434_100602210 | |||
| 1372 | Ga0075434_100695987 | |||
| 1373 | Ga0075429_100000388 | |||
| 1374 | Ga0075429_100066160 | |||
| 1375 | Ga0075429_100503223 | |||
| 1376 | Ga0068865_100000332 | |||
| 1377 | Ga0068865_100136282 | |||
| 1378 | Ga0068865_100243208 | |||
| 1379 | Ga0097620_100000894 | |||
| 1380 | Ga0097620_100135916 | |||
| 1381 | Ga0097620_100879196 | |||
| 1382 | Ga0075435_100002584 | |||
| 1383 | Ga0075435_100042005 | |||
| 1384 | Ga0075435_100057389 | |||
| 1385 | Ga0075435_100207282 | |||
| 1386 | Ga0099795_10019588 | |||
| 1387 | Ga0105251_10052402 | |||
| 1388 | Ga0105240_10336182 | |||
| 1389 | Ga0111539_10001076 | |||
| 1390 | Ga0111539_10002315 | |||
| 1391 | Ga0111539_10019996 | |||
| 1392 | Ga0111539_10020456 | |||
| 1393 | Ga0111539_10037026 | |||
| 1394 | Ga0111539_10048465 | |||
| 1395 | Ga0111539_10470369 | |||
| 1396 | Ga0105245_10000451 | |||
| 1397 | Ga0105245_10042912 | |||
| 1398 | Ga0105245_10270589 | |||
| 1399 | Ga0105247_10097608 | |||
| 1400 | Ga0114129_10007449 | |||
| 1401 | Ga0114129_10012907 | |||
| 1402 | Ga0114129_10046418 | |||
| 1403 | Ga0114129_10226684 | |||
| 1404 | Ga0114129_10535446 | |||
| 1405 | Ga0105243_10001205 | |||
| 1406 | Ga0105243_10106599 | |||
| 1407 | Ga0105243_10366915 | |||
| 1408 | Ga0105241_10000515 | |||
| 1409 | Ga0105242_10000947 | |||
| 1410 | Ga0105242_10054094 | |||
| 1411 | Ga0105248_10000837 | |||
| 1412 | Ga0105248_10058387 | |||
| 1413 | Ga0105248_10065044 | |||
| 1414 | Ga0105248_10120659 | |||
| 1415 | Ga0105248_10340503 | |||
| 1416 | Ga0105237_10204484 | |||
| 1417 | Ga0105237_10206434 | |||
| 1418 | Ga0105249_10000976 | |||
| 1419 | Ga0105249_10127126 | |||
| 1420 | Ga0105249_10563340 | |||
| 1421 | Ga0105239_10038973 | |||
| 1422 | Ga0105239_10154564 | |||
| 1423 | Ga0105239_10413907 | |||
| 1424 | Ga0105246_10000100 | |||
| 1425 | Ga0105246_10175672 | |||
| 1426 | Ga0157373_10124368 | |||
| 1427 | Ga0157371_10001676 | |||
| 1428 | Ga0157370_10359882 | |||
| 1429 | Ga0157369_10512016 | |||
| 1430 | Ga0157374_10000956 | |||
| 1431 | Ga0157374_10079625 | |||
| 1432 | Ga0157378_10001544 | |||
| 1433 | Ga0157378_10025137 | |||
| 1434 | Ga0157378_10067701 | |||
| 1435 | Ga0157378_10323572 | |||
| 1436 | Ga0163162_10001003 | |||
| 1437 | Ga0163162_10927467 | |||
| 1438 | Ga0157372_10003782 | |||
| 1439 | Ga0157375_10000464 | |||
| 1440 | Ga0157375_10163586 | |||
| 1441 | Ga0157375_10179981 | |||
| 1442 | Ga0163163_10003318 | |||
| 1443 | Ga0163163_10064168 | |||
| 1444 | Ga0157380_10000145 | |||
| 1445 | Ga0157377_10000179 | |||
| 1446 | Ga0157377_10010122 | |||
| 1447 | Ga0157377_10155254 | |||
| 1448 | Ga0157379_10000067 | |||
| 1449 | Ga0157379_10105816 | |||
| 1450 | Ga0157379_10455769 | |||
| 1451 | Ga0157379_10648027 | |||
| 1452 | Ga0157379_10869403 | |||
| 1453 | Ga0157376_10000864 | |||
| 1454 | Ga0157376_10169140 | |||
| 1455 | Ga0163161_10001462 | |||
| 1456 | Ga0209233_1006378 | |||
| 1457 | Ga0207666_1000002 | |||
| 1458 | Ga0207673_1000087 | |||
| 1459 | Ga0209675_1002319 | |||
| 1460 | Ga0207697_10000113 | |||
| 1461 | Ga0207697_10045688 | |||
| 1462 | Ga0207653_10001646 | |||
| 1463 | Ga0207682_10000094 | |||
| 1464 | Ga0207692_10009305 | |||
| 1465 | Ga0207692_10076551 | |||
| 1466 | Ga0207642_10000106 | |||
| 1467 | Ga0207642_10012442 | |||
| 1468 | Ga0207710_10016772 | |||
| 1469 | Ga0207688_10000074 | |||
| 1470 | Ga0207688_10011402 | |||
| 1471 | Ga0207688_10217047 | |||
| 1472 | Ga0207680_10017648 | |||
| 1473 | Ga0207680_10053411 | |||
| 1474 | Ga0207647_10000218 | |||
| 1475 | Ga0207647_10019749 | |||
| 1476 | Ga0207685_10017110 | |||
| 1477 | Ga0207699_10055900 | |||
| 1478 | Ga0207699_10146498 | |||
| 1479 | Ga0207645_10000247 | |||
| 1480 | Ga0207643_10000004 | |||
| 1481 | Ga0207643_10001836 | |||
| 1482 | Ga0207705_10092377 | |||
| 1483 | Ga0207684_10113130 | |||
| 1484 | Ga0207654_10000408 | |||
| 1485 | Ga0207707_10000618 | |||
| 1486 | Ga0207707_10254865 | |||
| 1487 | Ga0207671_10006046 | |||
| 1488 | Ga0207693_10070840 | |||
| 1489 | Ga0207693_10274042 | |||
| 1490 | Ga0207663_10031260 | |||
| 1491 | Ga0207663_10079825 | |||
| 1492 | Ga0207663_10139090 | |||
| 1493 | Ga0207663_10165531 | |||
| 1494 | Ga0207660_10000741 | |||
| 1495 | Ga0207660_10108230 | |||
| 1496 | Ga0207662_10000119 | |||
| 1497 | Ga0207662_10015565 | |||
| 1498 | Ga0207657_10000316 | |||
| 1499 | Ga0207657_10022891 | |||
| 1500 | Ga0207657_10076248 | |||
| 1501 | Ga0207649_10000090 | |||
| 1502 | Ga0207649_10015183 | |||
| 1503 | Ga0207649_10301637 | |||
| 1504 | Ga0207652_10000847 | |||
| 1505 | Ga0207652_10057847 | |||
| 1506 | Ga0207681_10000370 | |||
| 1507 | Ga0207681_10016162 | |||
| 1508 | Ga0207681_10147556 | |||
| 1509 | Ga0207694_10271719 | |||
| 1510 | Ga0207650_10003373 | |||
| 1511 | Ga0207650_10014660 | |||
| 1512 | Ga0207659_10000038 | |||
| 1513 | Ga0207659_10010384 | |||
| 1514 | Ga0207687_10000342 | |||
| 1515 | Ga0207700_10029938 | |||
| 1516 | Ga0207700_10047750 | |||
| 1517 | Ga0207664_10219306 | |||
| 1518 | Ga0207644_10000825 | |||
| 1519 | Ga0207690_10000239 | |||
| 1520 | Ga0207706_10000424 | |||
| 1521 | Ga0207706_10004762 | |||
| 1522 | Ga0207706_10009773 | |||
| 1523 | Ga0207686_10005718 | |||
| 1524 | Ga0207686_10030791 | |||
| 1525 | Ga0207709_10000379 | |||
| 1526 | Ga0207709_10201726 | |||
| 1527 | Ga0207709_10453605 | |||
| 1528 | Ga0207670_10000176 | |||
| 1529 | Ga0207670_10030260 | |||
| 1530 | Ga0207670_10378786 | |||
| 1531 | Ga0207669_10000165 | |||
| 1532 | Ga0207704_10001293 | |||
| 1533 | Ga0207704_10094564 | |||
| 1534 | Ga0207665_10045247 | |||
| 1535 | Ga0207665_10060873 | |||
| 1536 | Ga0207665_10329420 | |||
| 1537 | Ga0207691_10000358 | |||
| 1538 | Ga0207691_10005474 | |||
| 1539 | Ga0207691_10439759 | |||
| 1540 | Ga0207711_10000780 | |||
| 1541 | Ga0207711_10067010 | |||
| 1542 | Ga0207711_10114937 | |||
| 1543 | Ga0207711_10150908 | |||
| 1544 | Ga0207689_10000479 | |||
| 1545 | Ga0207689_10017846 | |||
| 1546 | Ga0207689_10147898 | |||
| 1547 | Ga0207661_10001263 | |||
| 1548 | Ga0207661_10561710 | |||
| 1549 | Ga0207679_10000139 | |||
| 1550 | Ga0207679_10857365 | |||
| 1551 | Ga0207667_10003492 | |||
| 1552 | Ga0207667_10377482 | |||
| 1553 | Ga0207667_10715950 | |||
| 1554 | Ga0207651_10000072 | |||
| 1555 | Ga0207651_10278123 | |||
| 1556 | Ga0207712_10000588 | |||
| 1557 | Ga0207668_10000168 | |||
| 1558 | Ga0207640_10000242 | |||
| 1559 | Ga0207640_10223780 | |||
| 1560 | Ga0207658_10000667 | |||
| 1561 | Ga0207658_10021614 | |||
| 1562 | Ga0207677_10003053 | |||
| 1563 | Ga0207677_10267779 | |||
| 1564 | Ga0207703_10000463 | |||
| 1565 | Ga0207703_10044027 | |||
| 1566 | Ga0207703_10074279 | |||
| 1567 | Ga0207639_10000745 | |||
| 1568 | Ga0207639_10038789 | |||
| 1569 | Ga0207678_10000447 | |||
| 1570 | Ga0207678_10001556 | |||
| 1571 | Ga0207678_10008450 | |||
| 1572 | Ga0207678_10047543 | |||
| 1573 | Ga0207678_10288250 | |||
| 1574 | Ga0207708_10000293 | |||
| 1575 | Ga0207708_10001604 | |||
| 1576 | Ga0207708_10138013 | |||
| 1577 | Ga0207702_10001723 | |||
| 1578 | Ga0207641_10000724 | |||
| 1579 | Ga0207641_10061568 | |||
| 1580 | Ga0207648_10000223 | |||
| 1581 | Ga0207648_10013990 | |||
| 1582 | Ga0207676_10000392 | |||
| 1583 | Ga0207674_10000955 | |||
| 1584 | Ga0207674_10063771 | |||
| 1585 | Ga0207675_100000364 | |||
| 1586 | Ga0207675_100014968 | |||
| 1587 | Ga0207683_10000397 | |||
| 1588 | Ga0207683_10012017 | |||
| 1589 | Ga0207683_10034678 | |||
| 1590 | Ga0207698_10000818 | |||
| 1591 | Ga0207698_10179336 | |||
| 1592 | Ga0209970_1011595 | |||
| 1593 | Ga0210002_1004936 | |||
| 1594 | Ga0209971_1014157 | |||
| 1595 | Ga0209966_1019062 | |||
| 1596 | Ga0209813_10002503 | |||
| 1597 | Ga0209813_10017645 | |||
| 1598 | Ga0209974_10001333 | |||
| 1599 | Ga0207428_10000272 | |||
| 1600 | Ga0207428_10000439 | |||
| 1601 | Ga0268266_10003158 | |||
| 1602 | Ga0268266_10016688 | |||
| 1603 | Ga0268266_10032116 | |||
| 1604 | Ga0268266_10152117 | |||
| 1605 | Ga0268266_10378559 | |||
| 1606 | Ga0268266_10453425 | |||
| 1607 | Ga0268265_10001307 | |||
| 1608 | Ga0268264_10000890 | |||
| 1609 | Ga0268264_10024166 | |||
| 1610 | Ga0268264_10056532 | |||
| 1611 | Ga0268264_10104297 | |||
| 1612 | Ga0268264_10524472 | |||
| 1613 | Ga0265334_10004346 | |||
| 1614 | Ga0307511_10000499 | |||
| 1615 | Ga0265330_10033553 | |||
| 1616 | Ga0265325_10002712 | |||
| 1617 | Ga0265325_10020112 | |||
| 1618 | Ga0265329_10021946 | |||
| 1619 | Ga0265339_10111088 | |||
| 1620 | Ga0265331_10108727 | |||
| 1621 | Ga0307513_10020688 | |||
| 1622 | Ga0265313_10000168 | |||
| 1623 | Ga0265313_10030718 | |||
| 1624 | Ga0265313_10058530 | |||
| 1625 | Ga0265314_10083064 | |||
| 1626 | Ga0265314_10162412 | |||
| 1627 | Ga0265342_10017126 | |||
| 1628 | Ga0307516_10430952 | |||
| 1629 | Ga0307413_10124649 | |||
| 1630 | Ga0307416_100500506 | |||
| 1631 | Ga0307416_101323962 | |||
| 1632 | Ga0307411_10217539 | |||
| 1633 | Ga0307507_10041281 | |||
| 1634 | Ga0373948_0022249 | |||
| 1635 | Ga0373958_0001661 | |||
| 1636 | Ga0373938_0000561 | |||
| 1637 | Ga0373926_0008949 | |||
| 1638 | Ga0373926_0046705 | |||
| 1639 | Ga0373928_0098687 | |||
| 1640 | Ga0373929_0001977 | |||
| 1641 | Ga0373934_0026615 | |||
| 1642 | Ga0373934_0033941 | |||
| 1643 | Ga0373934_0035938 | |||
| 1644 | Ga0373940_0005191 | |||
| 1645 | Ga0373944_0006392 | |||
| 1646 | Ga0373944_0008700 | |||
| 1647 | Ga0373949_0037801 | |||
| 1648 | Ga0373951_0002379 | |||
| 1649 | Ga0373952_0001315 | |||
| 1650 | Ga0373952_0024251 | |||
| 1651 | Ga0373923_0006355 | |||
| 1652 | Ga0373923_0125844 | |||
| 1653 | Ga0373932_0000239 | |||
| 1654 | Ga0373936_0000123 | |||
| 1655 | Ga0373936_0005828 | |||
| 1656 | Ga0373936_0014239 | |||
| 1657 | Ga0373936_0073703 | |||
| 1658 | Ga0373939_0000771 | |||
| 1659 | Ga0373939_0114530 | |||
| 1660 | Ga0373941_0000800 | |||
| 1661 | Ga0373941_0007551 | |||
| 1662 | Ga0373941_0019433 | |||
| 1663 | Ga0373945_0002307 | |||
| 1664 | Ga0373945_0208996 | |||
| 1665 | Ga0373953_0004397 | |||
| 1666 | Ga0373953_0023351 | |||
| 1667 | Ga0373954_0070419 | |||
| 1668 | Ga0373954_0175326 | |||
| 1669 | Ga0373956_0022890 | |||
| 1670 | Ga0373957_0246729 | |||
| 1671 | Ga0373960_0011690 | |||
| 1672 | Ga0373943_0003717 | |||
| 1673 | Ga0373943_0014205 | |||
| 1674 | Ga0373943_0017533 | |||
| 1675 | Ga0373943_0023758 | |||
| 1676 | Ga0373943_0226755 | |||
| 1677 | Ga0373946_0003238 | |||
| 1678 | Ga0373946_0015216 | |||
| 1679 | Ga0373946_0026933 | |||
| 1680 | Ga0373946_0043627 | |||
| 1681 | Ga0373955_0000123 | |||
| 1682 | Ga0373955_0000925 | |||
| 1683 | Ga0373955_0002779 | |||
| 1684 | Ga0373955_0147813 | |||
| 1685 | Ga0373942_0049735 | |||
| 1686 | Ga0373961_0003440 | |||
| 1687 | Ga0373961_0071676 | |||
| 1688 | Ga0373962_0000617 | |||
| 1689 | Ga0373962_0097756 | |||
| 1690 | Ga0373924_0004104 | |||
| 1691 | Ga0373924_0011740 | |||
| 1692 | Ga0373924_0057937 | |||
| 1693 | Ga0373931_0000089 | |||
| 1694 | Ga0373931_0002029 | |||
| 1695 | Ga0373931_0027667 | |||
| 1696 | Ga0373931_0346192 | |||
| 1697 | Ga0373935_0001607 | |||
| 1698 | Ga0373935_0007593 | |||
| 1699 | Ga0373935_0023225 | |||
| 1700 | Ga0373935_0106116 | |||
| 1701 | Ga0373935_0111907 | |||
| 1702 | Ga0373927_0007356 | |||
| 1703 | Ga0373927_0100814 | |||
| 1704 | Ga0373933_0000893 | |||
| 1705 | Ga0373933_0001458 | |||
| 1706 | Ga0373933_0001984 | |||
| 1707 | Ga0373947_0000841 | |||
| 1708 | Ga0373947_0005203 | |||
| 1709 | Ga0373947_0066666 | |||
| 1710 | Ga0373947_0080827 | |||
| 1711 | Ga0373947_0118114 | |||
| 1712 | Ga0373937_0000030 | |||
| 1713 | Ga0373937_0002299 | |||
| 1714 | Ga0373937_0008640 | |||
| 1715 | Ga0373937_0142505 | |||
| 1716 | Ga0373925_0000002 | |||
| 1717 | Ga0373925_0031004 | |||
| 1718 | Ga0373925_0053534 | |||
| 1719 | Ga0373925_0157547 | |||
| 1720 | Ga0373925_0202713 | |||
| 1721 | Ga0436364_0113317 | |||
| 1722 | Ga0436365_1558634 | |||
| 1723 | Ga0436360_0497803 | |||
| 1724 | Ga0436360_0608365 | |||
| 1725 | Ga0436363_1364752 | |||
| 1726 | Ga0451847_0154865 | |||
| 1727 | Ga0439459_0030117 | |||
| 1728 | Ga0466963_0079212 | |||
| 1729 | Ga0466959_0123275 | |||
| 1730 | Ga0495592_0000046 | |||
| 1731 | Ga0495603_0054373 | |||
| 1732 | Ga0495603_0079917 | |||
| 1733 | Ga0495603_0122870 | |||
| 1734 | Ga0495629_0000715 | |||
| 1735 | Ga0495629_0062407 | |||
| 1736 | Ga0495629_0068158 | |||
| 1737 | Ga0495629_0072521 | |||
| 1738 | Ga0495629_0240760 | |||
| 1739 | Ga0495629_0367771 | |||
| 1740 | Ga0495641_0004301 | |||
| 1741 | Ga0495641_0014848 | |||
| 1742 | Ga0495641_0076696 | |||
| 1743 | Ga0495651_0000367 | |||
| 1744 | Ga0495651_0014223 | |||
| 1745 | Ga0495651_0095339 | |||
| 1746 | Ga0495653_0000006 | |||
| 1747 | Ga0495653_0022686 | |||
| 1748 | Ga0495653_0110195 | |||
| 1749 | Ga0495653_0119854 | |||
| 1750 | Ga0495580_0048842 | |||
| 1751 | Ga0495580_0131579 | |||
| 1752 | Ga0495582_0006057 | |||
| 1753 | Ga0495582_0117872 | |||
| 1754 | Ga0495582_0149160 | |||
| 1755 | Ga0495639_0011590 | |||
| 1756 | Ga0495639_0030118 | |||
| 1757 | Ga0495662_0007136 | |||
| 1758 | Ga0495662_0053910 | |||
| 1759 | Ga0495662_0062328 | |||
| 1760 | Ga0495664_0000002 | |||
| 1761 | Ga0495664_0026061 | |||
| 1762 | Ga0495664_0127424 | |||
| 1763 | Ga0495584_0019631 | |||
| 1764 | Ga0495584_0030486 | |||
| 1765 | Ga0495584_0057383 | |||
| 1766 | Ga0495584_0191623 | |||
| 1767 | Ga0495584_0200886 | |||
| 1768 | Ga0495585_0003015 | |||
| 1769 | Ga0495594_0099646 | |||
| 1770 | Ga0495594_0104756 | |||
| 1771 | Ga0495594_0112366 | |||
| 1772 | Ga0495596_0023185 | |||
| 1773 | Ga0495607_0077437 | |||
| 1774 | Ga0495607_0208577 | |||
| 1775 | Ga0495608_0000006 | |||
| 1776 | Ga0495608_0024231 | |||
| 1777 | Ga0495608_0042490 | |||
| 1778 | Ga0495616_0015699 | |||
| 1779 | Ga0495618_0000034 | |||
| 1780 | Ga0495618_0103299 | |||
| 1781 | Ga0495618_0317418 | |||
| 1782 | Ga0495620_0043362 | |||
| 1783 | Ga0495628_0000002 | |||
| 1784 | Ga0495628_0033147 | |||
| 1785 | Ga0495628_0191330 | |||
| 1786 | Ga0495630_0000681 | |||
| 1787 | Ga0495637_0013925 | |||
| 1788 | Ga0495637_0043648 | |||
| 1789 | Ga0495644_0001007 | |||
| 1790 | Ga0495663_0052085 | |||
| 1791 | Ga0495666_0004207 | |||
| 1792 | Ga0495642_0024002 | |||
| 1793 | Ga0495652_0000004 | |||
| 1794 | Ga0495652_0025782 | |||
| 1795 | Ga0495652_0038140 | |||
| 1796 | Ga0495665_0063974 | |||
| 1797 | Ga0495640_0000007 | |||
| 1798 | Ga0495640_0009410 | |||
| 1799 | Ga0495640_0034366 | |||
| 1800 | Ga0495640_0046452 | |||
| 1801 | Ga0495640_0085264 | |||
| 1802 | Ga0495587_0000031 | |||
| 1803 | Ga0495587_0000674 | |||
| 1804 | Ga0495598_0004776 | |||
| 1805 | Ga0495598_0022964 | |||
| 1806 | Ga0495609_0067883 | |||
| 1807 | Ga0495645_0000116 | |||
| 1808 | Ga0495645_0007302 | |||
| 1809 | Ga0495645_0281583 | |||
| 1810 | Ga0495633_0004191 | |||
| 1811 | Ga0495667_0000002 | |||
| 1812 | Ga0495667_0003450 | |||
| 1813 | Ga0495667_0014292 | |||
| 1814 | Ga0495656_0005104 | |||
| 1815 | Ga0495656_0007368 | |||
| 1816 | Ga0495656_0059562 | |||
| 1817 | Ga0495634_0000533 | |||
| 1818 | Ga0495634_0114793 | |||
| 1819 | Ga0495634_0283607 | |||
| 1820 | Ga0495634_0389470 | |||
| 1821 | Ga0495611_0078087 | |||
| 1822 | Ga0495635_0000021 | |||
| 1823 | Ga0495635_0005685 | |||
| 1824 | Ga0495635_0010208 | |||
| 1825 | Ga0495635_0018634 | |||
| 1826 | Ga0495659_0000937 | |||
| 1827 | Ga0495661_0069562 | |||
| 1828 | Ga0495588_0002591 | |||
| 1829 | Ga0495588_0017703 | |||
| 1830 | Ga0495588_0139743 | |||
| 1831 | Ga0495657_0000867 | |||
| 1832 | Ga0495657_0019909 | |||
| 1833 | Ga0495657_0037924 | |||
| 1834 | Ga0495657_0041122 | |||
| 1835 | Ga0495599_0000001 | |||
| 1836 | Ga0495599_0001955 | |||
| 1837 | Ga0495599_0069959 | |||
| 1838 | Ga0495623_0001034 | |||
| 1839 | Ga0495623_0008654 | |||
| 1840 | Ga0495623_0075124 | |||
| 1841 | Ga0495646_0000007 | |||
| 1842 | Ga0495646_0002645 | |||
| 1843 | Ga0495646_0024325 | |||
| 1844 | Ga0495647_0004164 | |||
| 1845 | Ga0495647_0029042 | |||
| 1846 | Ga0495658_0002203 | |||
| 1847 | Ga0495658_0035540 | |||
| 1848 | Ga0495613_0035350 | |||
| 1849 | Ga0495613_0060603 | |||
| 1850 | Ga0495613_0080097 | |||
| 1851 | Ga0495613_0192155 | |||
| 1852 | Ga0495624_0019158 | |||
| 1853 | Ga0495624_0300235 | |||
| 1854 | Ga0495670_0001110 | |||
| 1855 | Ga0495670_0236503 | |||
| 1856 | Ga0495671_0099080 | |||
| 1857 | Ga0495589_0021275 | |||
| 1858 | Ga0495600_0000033 | |||
| 1859 | Ga0495600_0005493 | |||
| 1860 | Ga0495600_0020370 | |||
| 1861 | Ga0495600_0162664 | |||
| 1862 | Ga0495660_0080925 | |||
| 1863 | Ga0495581_0038026 | |||
| 1864 | Ga0495581_0065977 | |||
| 1865 | Ga0495581_0094558 | |||
| 1866 | Ga0495581_0191222 | |||
| 1867 | Ga0495604_0000005 | |||
| 1868 | Ga0495604_0000625 | |||
| 1869 | Ga0495674_0000003 | |||
| 1870 | Ga0495674_0011567 | |||
| 1871 | Ga0495674_0021735 | |||
| 1872 | Ga0495674_0222162 | |||
| 1873 | Ga0495676_0035370 | |||
| 1874 | Ga0495676_0235884 | |||
| 1875 | Ga0495676_0244690 | |||
| 1876 | Ga0495680_0000580 | |||
| 1877 | Ga0495680_0006925 | |||
| 1878 | Ga0495680_0009825 | |||
| 1879 | Ga0495680_0033333 | |||
| 1880 | Ga0495675_0000064 | |||
| 1881 | Ga0495675_0000480 | |||
| 1882 | Ga0495675_0006426 | |||
| 1883 | Ga0495684_0001454 | |||
| 1884 | Ga0495684_0013547 | |||
| 1885 | Ga0495684_0208099 | |||
| 1886 | Ga0495684_0253503 | |||
| 1887 | Ga0495593_0004225 | |||
| 1888 | Ga0495602_0000211 | |||
| 1889 | Ga0495602_0016484 | |||
| 1890 | Ga0495602_0024071 | |||
| 1891 | Ga0495602_0060816 | |||
| 1892 | Ga0495614_0053737 | |||
| 1893 | Ga0496100_0000200 | |||
| 1894 | Ga0496100_0002672 | |||
| 1895 | Ga0496100_0005525 | |||
| 1896 | Ga0496100_0012075 | |||
| 1897 | Ga0496100_0117138 | |||
| 1898 | Ga0496101_0000339 | |||
| 1899 | Ga0496101_0003678 | |||
| 1900 | Ga0496101_0020762 | |||
| 1901 | Ga0496101_0036198 | |||
| 1902 | Ga0496101_0114360 | |||
| 1903 | Ga0496101_0197912 | |||
| 1904 | Ga0496102_0000729 | |||
| 1905 | Ga0496102_0012537 | |||
| 1906 | Ga0496102_0015961 | |||
| 1907 | Ga0496102_0019149 | |||
| 1908 | Ga0496102_0032908 | |||
| 1909 | Ga0496102_0092789 | |||
| 1910 | Ga0496103_0001522 | |||
| 1911 | Ga0496103_0002903 | |||
| 1912 | Ga0496103_0003319 | |||
| 1913 | Ga0496103_0034425 | |||
| 1914 | Ga0496103_0049128 | |||
| 1915 | Ga0496103_0102960 | |||
| 1916 | Ga0496104_0005594 | |||
| 1917 | Ga0496104_0016617 | |||
| 1918 | Ga0496104_0018807 | |||
| 1919 | Ga0496104_0038922 | |||
| 1920 | Ga0496104_0069431 | |||
| 1921 | Ga0496104_0160029 | |||
| 1922 | Ga0496104_0171949 | |||
| 1923 | Ga0496104_0304107 | |||
| 1924 | Ga0496104_0331301 | |||
| 1925 | Ga0496104_0416643 | |||
| 1926 | Ga0496105_0010114 | |||
| 1927 | Ga0496105_0015770 | |||
| 1928 | Ga0496105_0019387 | |||
| 1929 | Ga0496105_0083360 | |||
| 1930 | Ga0496105_0096405 | |||
| 1931 | Ga0496105_0100387 | |||
| 1932 | Ga0496105_0169085 | |||
| 1933 | Ga0496105_0182216 | |||
| 1934 | Ga0496105_0316855 | |||
| 1935 | Ga0496106_0000202 | |||
| 1936 | Ga0496106_0010414 | |||
| 1937 | Ga0496106_0013976 | |||
| 1938 | Ga0496106_0018811 | |||
| 1939 | Ga0496106_0063863 | |||
| 1940 | Ga0496107_0000066 | |||
| 1941 | Ga0496107_0003364 | |||
| 1942 | Ga0496107_0012266 | |||
| 1943 | Ga0496107_0014933 | |||
| 1944 | Ga0496108_0002149 | |||
| 1945 | Ga0496108_0009138 | |||
| 1946 | Ga0496108_0011507 | |||
| 1947 | Ga0496108_0013864 | |||
| 1948 | Ga0496108_0027082 | |||
| 1949 | Ga0496108_0083523 | |||
| 1950 | Ga0496109_0000595 | |||
| 1951 | Ga0496109_0003533 | |||
| 1952 | Ga0496109_0033348 | |||
| 1953 | Ga0496109_0222663 | |||
| 1954 | Ga0496110_0012365 | |||
| 1955 | Ga0496110_0012395 | |||
| 1956 | Ga0496110_0021429 | |||
| 1957 | Ga0496110_0057184 | |||
| 1958 | Ga0496110_0088667 | |||
| 1959 | Ga0496110_0091095 | |||
| 1960 | Ga0496110_0306004 | |||
| 1961 | Ga0496110_0341522 | |||
| 1962 | Ga0496110_0429025 | |||
| 1963 | Ga0496111_0006175 | |||
| 1964 | Ga0496111_0030256 | |||
| 1965 | Ga0496111_0030980 | |||
| 1966 | Ga0496111_0162718 | |||
| 1967 | Ga0496111_0189349 | |||
| 1968 | Ga0496112_0005130 | |||
| 1969 | Ga0496112_0180537 | |||
| 1970 | Ga0496113_0000936 | |||
| 1971 | Ga0496113_0039780 | |||
| 1972 | Ga0496113_0081800 | |||
| 1973 | Ga0496113_0160059 | |||
| 1974 | Ga0496114_0018186 | |||
| 1975 | Ga0496114_0033831 | |||
| 1976 | Ga0496114_0112528 | |||
| 1977 | Ga0496114_0179432 | |||
| 1978 | Ga0496114_0697219 | |||
| 1979 | Ga0496115_0001197 | |||
| 1980 | Ga0496115_0004591 | |||
| 1981 | Ga0496115_0007531 | |||
| 1982 | Ga0496115_0019783 | |||
| 1983 | Ga0496115_0075652 | |||
| 1984 | Ga0496115_0113411 | |||
| 1985 | Ga0496115_0389107 | |||
| 1986 | Ga0501031_0036504 | |||
| 1987 | Ga0501031_0284753 | |||
| 1988 | Ga0501032_0022586 | |||
| 1989 | Ga0501032_0126431 | |||
| 1990 | Ga0501032_0169000 | |||
| 1991 | Ga0501033_0039686 | |||
| 1992 | Ga0501034_0052213 | |||
| 1993 | Ga0501034_0080407 | |||
| 1994 | Ga0501034_0153891 | |||
| 1995 | Ga0501034_0193055 | |||
| 1996 | Ga0501034_0323310 | |||
| 1997 | Ga0501034_0359545 | |||
| 1998 | Ga0501034_0472642 | |||
| 1999 | Ga0501036_0000499 | |||
| 2000 | Ga0501036_0004466 | |||
| 2001 | Ga0501036_0154219 | |||
| 2002 | Ga0501036_0222853 | |||
| 2003 | Ga0501037_0004304 | |||
| 2004 | Ga0501037_0049134 | |||
| 2005 | Ga0501037_0081766 | |||
| 2006 | Ga0501037_0160172 | |||
| 2007 | Ga0501038_0021308 | |||
| 2008 | Ga0501038_0093480 | |||
| 2009 | Ga0501038_0096930 | |||
| 2010 | Ga0501038_0097916 | |||
| 2011 | Ga0501038_0098954 | |||
| 2012 | Ga0501039_0013202 | |||
| 2013 | Ga0501039_0015680 | |||
| 2014 | Ga0501039_0026725 | |||
| 2015 | Ga0501039_0046309 | |||
| 2016 | Ga0501039_0050154 | |||
| 2017 | Ga0501039_0125226 | |||
| 2018 | Ga0501039_0515094 | |||
| 2019 | Ga0501040_0470946 | |||
| 2020 | Ga0501041_0022261 | |||
| 2021 | Ga0501042_0139776 | |||
| 2022 | Ga0501042_0286249 | |||
| 2023 | Ga0501042_0469786 | |||
| 2024 | Ga0501043_0001994 | |||
| 2025 | Ga0501043_0005803 | |||
| 2026 | Ga0501043_0068503 | |||
| 2027 | Ga0501043_0120165 | |||
| 2028 | Ga0501046_0038534 | |||
| 2029 | Ga0501046_0056851 | |||
| 2030 | Ga0501046_0123960 | |||
| 2031 | Ga0501046_0277360 | |||
| 2032 | Ga0501047_0006121 | |||
| 2033 | Ga0501047_0183326 | |||
| 2034 | Ga0501047_0286113 | |||
| 2035 | Ga0501047_0377844 | |||
| 2036 | Ga0501048_0000256 | |||
| 2037 | Ga0501048_0028019 | |||
| 2038 | Ga0501048_0132804 | |||
| 2039 | Ga0501067_0016157 | |||
| 2040 | Ga0501067_0085867 | |||
| 2041 | Ga0501068_0017335 | |||
| 2042 | Ga0501068_0019130 | |||
| 2043 | Ga0501068_0122127 | |||
| 2044 | Ga0501068_0221349 | |||
| 2045 | Ga0501069_0027792 | |||
| 2046 | Ga0501069_0040881 | |||
| 2047 | Ga0501069_0042967 | |||
| 2048 | Ga0501069_0130731 | |||
| 2049 | Ga0501070_0000817 | |||
| 2050 | Ga0501070_0007450 | |||
| 2051 | Ga0501070_0091120 | |||
| 2052 | Ga0501070_0244232 | |||
| 2053 | Ga0501070_0315740 | |||
| 2054 | Ga0501070_0333677 | |||
| 2055 | Ga0501071_0082042 | |||
| 2056 | Ga0501071_0444215 | |||
| 2057 | Ga0501072_0024435 | |||
| 2058 | Ga0501072_0091845 | |||
| 2059 | Ga0501072_0318748 | |||
| 2060 | Ga0501072_0412925 | |||
| 2061 | Ga0501073_0041000 | |||
| 2062 | Ga0501073_0124019 | |||
| 2063 | Ga0501073_0389265 | |||
| 2064 | Ga0501073_0481000 | |||
| 2065 | Ga0501074_0025755 | |||
| 2066 | Ga0501074_0031242 | |||
| 2067 | Ga0501074_0058942 | |||
| 2068 | Ga0501074_0074734 | |||
| 2069 | Ga0501075_0042097 | |||
| 2070 | Ga0501076_0010949 | |||
| 2071 | Ga0501076_0629612 | |||
| 2072 | Ga0501079_0167297 | |||
| 2073 | Ga0501079_0178805 | |||
| 2074 | Ga0501079_0185463 | |||
| 2075 | Ga0501080_0004650 | |||
| 2076 | Ga0501080_0007139 | |||
| 2077 | Ga0501080_0233560 | |||
| 2078 | Ga0501080_0448111 | |||
| 2079 | Ga0501080_0814034 | |||
| 2080 | Ga0501081_0213203 | |||
| 2081 | Ga0501083_0000704 | |||
| 2082 | Ga0501083_0002432 | |||
| 2083 | Ga0501083_0015359 | |||
| 2084 | Ga0501083_0087374 | |||
| 2085 | Ga0501083_0114278 | |||
| 2086 | Ga0501083_0118652 | |||
| 2087 | Ga0501083_0239855 | |||
| 2088 | Ga0501035_0001481 | |||
| 2089 | Ga0501035_0007974 | |||
| 2090 | Ga0501035_0053372 | |||
| 2091 | Ga0501035_0083810 | |||
| 2092 | Ga0501035_0551561 | |||
| 2093 | Ga0501044_0142306 | |||
| 2094 | Ga0501044_0144706 | |||
| 2095 | Ga0501044_0148529 | |||
| 2096 | Ga0501044_0269292 | |||
| 2097 | Ga0501044_0466110 | |||
| 2098 | Ga0501045_0027004 | |||
| 2099 | Ga0501045_0147001 | |||
| 2100 | nmdc:mga03683_5699_c1 | |||
| 2101 | nmdc:mga03683_574_c2 | |||
| 2102 | nmdc:mga03n38_104152_c1 | |||
| 2103 | nmdc:mga03n38_135935_c1 | |||
| 2104 | nmdc:mga03n38_210524_c1 | |||
| 2105 | nmdc:mga03n38_384164_c1 | |||
| 2106 | nmdc:mga03n38_50884_c1 | |||
| 2107 | nmdc:mga00v17_122742_c1 | |||
| 2108 | nmdc:mga00v17_198738_c1 | |||
| 2109 | nmdc:mga00v17_234370_c1 | |||
| 2110 | nmdc:mga00v17_61153_c1 | |||
| 2111 | nmdc:mga00v17_90598_c1 | |||
| 2112 | nmdc:mga0yw44_190997_c1 | |||
| 2113 | nmdc:mga0yw44_19101_c1 | |||
| 2114 | nmdc:mga0yw44_19147_c1 | |||
| 2115 | nmdc:mga0yw44_201255_c1 | |||
| 2116 | nmdc:mga0yw44_350192_c1 | |||
| 2117 | nmdc:mga0yw44_423_c1 | |||
| 2118 | nmdc:mga0k408_183858_c1 | |||
| 2119 | nmdc:mga0k408_275455_c1 | |||
| 2120 | nmdc:mga0k408_42706_c1 | |||
| 2121 | nmdc:mga0k408_5032_c1 | |||
| 2122 | nmdc:mga0k408_7820_c1 | |||
| 2123 | nmdc:mga06z11_17615_c1 | |||
| 2124 | nmdc:mga06z11_176278_c1 | |||
| 2125 | nmdc:mga06z11_232923_c1 | |||
| 2126 | nmdc:mga06z11_9053_c1 | |||
| 2127 | nmdc:mga06z11_9265_c1 | |||
| 2128 | nmdc:mga06z11_95938_c1 | |||
| 2129 | nmdc:mga04h51_15337_c1 | |||
| 2130 | nmdc:mga04h51_6699_c1 | |||
| 2131 | nmdc:mga07m45_3503_c1 | |||
| 2132 | nmdc:mga07m45_4332_c1 | |||
| 2133 | nmdc:mga05p37_1740_c1 | |||
| 2134 | nmdc:mga05p37_89003_c1 | |||
| 2135 | nmdc:mga09592_1499_c1 | |||
| 2136 | nmdc:mga09592_54222_c1 | |||
| 2137 | nmdc:mga0qj67_224967_c1 | |||
| 2138 | nmdc:mga0qj67_26598_c1 | |||
| 2139 | nmdc:mga0qj67_2708_c1 | |||
| 2140 | nmdc:mga0qj67_277074_c1 | |||
| 2141 | nmdc:mga0qj67_330988_c1 | |||
| 2142 | nmdc:mga0qj67_385842_c1 | |||
| 2143 | nmdc:mga06r32_106497_c1 | |||
| 2144 | nmdc:mga06r32_546_c1 | |||
| 2145 | nmdc:mga06r32_89394_c1 | |||
| 2146 | nmdc:mga08y16_1229_c1 | |||
| 2147 | nmdc:mga08y16_206644_c1 | |||
| 2148 | nmdc:mga08y16_3164_c1 | |||
| 2149 | nmdc:mga08y16_367004_c1 | |||
| 2150 | nmdc:mga08y16_53319_c1 | |||
| 2151 | nmdc:mga08y16_67041_c1 | |||
| 2152 | nmdc:mga0n895_266_c1 | |||
| 2153 | nmdc:mga0n895_356437_c1 | |||
| 2154 | nmdc:mga0n895_381_c1 | |||
| 2155 | nmdc:mga0n895_512715_c1 | |||
| 2156 | nmdc:mga0n895_526896_c1 | |||
| 2157 | nmdc:mga0n895_99533_c1 | |||
| 2158 | nmdc:mga0rr50_1066_c1 | |||
| 2159 | nmdc:mga0rr50_158213_c1 | |||
| 2160 | nmdc:mga0rr50_164307_c1 | |||
| 2161 | nmdc:mga0rr50_51500_c1 | |||
| 2162 | nmdc:mga0rr50_53668_c1 | |||
| 2163 | nmdc:mga08x19_119965_c1 | |||
| 2164 | nmdc:mga08x19_91289_c1 | |||
| 2165 | nmdc:mga0a205_1323_c1 | |||
| 2166 | nmdc:mga0a205_2432_c1 | |||
| 2167 | nmdc:mga0a205_250459_c1 | |||
| 2168 | nmdc:mga0a205_371726_c1 | |||
| 2169 | nmdc:mga0a205_373814_c1 | |||
| 2170 | nmdc:mga0a205_70963_c2 | |||
| 2171 | nmdc:mga0sz30_1107_c1 | |||
| 2172 | nmdc:mga0sz30_189939_c1 | |||
| 2173 | nmdc:mga0sz30_22397_c1 | |||
| 2174 | Ga0495601_0000008 | |||
| 2175 | Ga0495601_0003866 | |||
| 2176 | Ga0495601_0004477 | |||
| 2177 | Ga0495601_0008678 | |||
| 2178 | Ga0495601_0045707 | |||
| 2179 | Ga0495601_0087849 | |||
| 2180 | Ga0495612_0000026 | |||
| 2181 | Ga0495612_0004903 | |||
| 2182 | Ga0495612_0011774 | |||
| 2183 | Ga0495612_0013030 | |||
| 2184 | Ga0495595_0000096 | |||
| 2185 | Ga0495595_0001646 | |||
| 2186 | Ga0495595_0001927 | |||
| 2187 | Ga0495619_0000002 | |||
| 2188 | Ga0495619_0000266 | |||
| 2189 | Ga0495619_0005383 | |||
| 2190 | Ga0495619_0008789 | |||
| 2191 | Ga0495619_0011357 | |||
| 2192 | Ga0495619_0018946 | |||
| 2193 | Ga0500646_0000464 | |||
| 2194 | Ga0500651_0109485 | |||
| 2195 | Ga0500641_0003675 | |||
| 2196 | Ga0500641_0008671 | |||
| 2197 | Ga0500650_0088324 | |||
| 2198 | Ga0500593_003902 | |||
| 2199 | Ga0500642_0002845 | |||
| 2200 | Ga0500655_007900 | |||
| 2201 | Ga0500568_0155559 | |||
| 2202 | Ga0500604_0000243 | |||
| 2203 | Ga0500616_0178452 | |||
| 2204 | Ga0500636_0166840 | |||
| 2205 | Ga0500637_0040667 | |||
| 2206 | Ga0501084_0128596 | |||
| 2207 | Ga0501082_0037054 | |||
| 2208 | Ga0501082_0202537 | |||
| 2209 | Ga0501082_0295870 | |||
| 2210 | Ga0501082_0538602 | |||
| 2211 | Ga0501082_0584455 | |||
| 2212 | Ga0501082_0598126 | |||
| 2213 | Ga0530510_0294757 | |||
| 2214 | 2508546153 | |||
| 2215 | 2643755737 | |||
| 2216 | 2739305777 | |||
| 2217 | 2883356039 | |||
| 2218 | 2894238127 | |||
| 2219 | 2935615000 | |||
| 2220 | 2935825962 | |||
| 2221 | 2935851581 | |||
| 2222 | 2935910396 | |||
| 2223 | 2935918318 | |||
| 2224 | 2935927693 | |||
| 2225 | 2935936435 | |||
| 2226 | 2935944012 | |||
| 2227 | 2935952449 | |||
| 2228 | 2935969289 | |||
| 2229 | 8016636130 | |||
| 2230 | 8019696745 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ji0-assembly1.cif.gz_A | crystal structure analysis of the abc transporter from thermotoga maritima | 0.923 | 1 | 238 |
| 6z4w-assembly1.cif.gz_A | ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) | 0.9225 | 5 | 223 |
| 6b89-assembly1.cif.gz_A | e. coli lptb in complex with adp and novobiocin | 0.9173 | 7 | 236 |
| 6z67-assembly3.cif.gz_E | ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution | 0.9161 | 5 | 223 |
| 6z67-assembly2.cif.gz_B | ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution | 0.9132 | 5 | 223 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58664_1_235_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9591 | 7 | 238 | 3.40.50.300 |
| af_P22731_1_237_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9571 | 4 | 239 | 3.40.50.300 |
| af_P22731_1_237_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9454 | 4 | 239 | 3.40.50.300 |
| af_Q58664_1_235_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9433 | 7 | 238 | 3.40.50.300 |
| af_P77795_1_218_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9228 | 5 | 222 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0S6UIX9-F1-model_v4 | High-affinity branched-chain amino acid transport ATP-binding protein BivF | 0.9942 | 3 | 218 |
GO:0005524
GO:0015658 GO:0015807 GO:0016887 |
| AF-A0A0S6UIX9-F1-model_v4 | High-affinity branched-chain amino acid transport ATP-binding protein BivF | 0.9851 | 3 | 218 |
GO:0005524
GO:0015658 GO:0015807 GO:0016887 |
| AF-A0A4P8WN98-F1-model_v4 | ABC transporter ATP-binding protein | 0.9828 | 5 | 237 |
GO:0005524
GO:0015658 GO:0015807 GO:0016887 |
| AF-A0A535QTI8-F1-model_v4 | ABC transporter ATP-binding protein | 0.9751 | 6 | 230 |
GO:0005524
GO:0015658 GO:0015807 GO:0016887 |
| AF-A0A2E1A6Q7-F1-model_v4 | ABC transporter ATP-binding protein | 0.9743 | 7 | 237 |
GO:0005524
GO:0015658 GO:0015807 GO:0016887 |