F490295
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1115 | 475 | 2230 | 322 |
Family's Representative Sequence
| Representative Sequence | 3300037853|Ga0436364_0684151|Ga0436364_0684151_1040_2089 |
| Length | 349 |
| Sequence | LQLITGSAAIVFLFRADQSSILQSIEQSMKILVTGAAGMIGRKFCDALVKRGKIGSRPVVRLTMADTIKPTAPTGAPFEACTDSADISDPGVAESLVADRPEIIYHLAAVVSGEAEADFDKGYRVNLTGTQRLFEAVRRAGHQPRVVFASSIAVFGTPFPEKIPEDYALTPLTSYGTQKAIGEFLLADFSRRGFFNGIGIRFPTICVRPGKPNKAASGFFSNIIREPLKGKPAVLPVGEEVRHWFASPRAAVEFLFHAGALDLGQIGSGRTLNMPGLSATVREMIVSLRNVAGAECAKLIRREPDPAIQKIVDGWPGRLDASRAEALGFRAETSFEEIVRQHIEDESAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 2 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 4 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 6 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 7 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 8 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 9 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 10 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 11 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 12 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 13 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 14 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 15 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 16 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 17 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 18 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 19 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 24 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 25 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 26 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 34 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 38 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 51 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 68 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 72 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 75 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 83 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 85 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 86 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 87 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 89 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 90 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 91 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 92 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 93 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 94 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 95 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 96 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 97 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 98 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 99 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 100 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 101 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 103 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 104 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 105 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 106 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 107 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 108 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 109 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 110 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 111 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 112 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 113 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 114 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 116 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 117 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 118 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 119 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 120 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 121 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 122 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 123 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 125 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 126 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 157 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 158 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 159 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 164 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 166 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 168 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 240 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 244 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 245 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 246 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 247 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 248 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 249 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 250 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 251 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 252 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 253 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 254 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 255 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 256 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 257 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 258 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 259 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 260 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 261 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 262 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 263 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 264 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 265 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 266 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 267 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 268 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 269 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 270 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 271 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 272 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 273 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 274 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 275 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 276 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 277 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 278 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 279 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 280 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 281 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 282 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 283 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 284 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 285 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 286 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 287 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 288 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 289 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 290 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 291 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 292 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 293 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 294 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 295 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 296 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 297 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 298 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 299 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 300 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 301 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 302 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 303 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 304 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 305 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 306 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 307 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 308 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 309 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 310 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 311 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 374 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 375 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 376 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 377 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 378 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 379 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 380 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 381 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 382 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 383 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 384 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 385 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 386 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 387 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 388 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 389 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 390 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 391 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 392 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 393 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 394 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 395 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 396 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 397 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 400 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 402 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 403 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 406 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 407 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 408 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 409 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 410 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 411 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 412 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 413 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 414 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 416 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 417 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 421 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 422 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 423 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 424 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 425 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 426 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 427 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 428 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 429 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 430 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 431 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 432 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 433 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 434 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 435 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 436 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 437 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 438 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 441 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 444 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 445 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 446 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 447 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 448 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 449 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 450 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 451 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 452 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 453 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 454 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 455 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 456 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 457 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 458 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 459 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 460 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 461 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 462 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 463 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 464 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 465 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 466 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 467 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 468 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 469 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 470 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 471 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 472 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 473 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 474 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 475 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.3 |
| Metatranscriptomes | 0 |
| Isolates | 1.7 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.57 |
| Nodule | 0.81 |
| Rhizoplane | 6.64 |
| Rhizosphere | 85.11 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0436364_0684151 | 3300037853 | Unclassified | 2101 |
| 2 | ARcpr5oldR_c000046 | 3300000041 | Bacteria | 22854 |
| 3 | ARSoilYngRDRAFT_c00078 | 3300000042 | Bacteria | 16119 |
| 4 | ARcpr5yngRDRAFT_c000072 | 3300000043 | Bacteria | 16816 |
| 5 | ARSoilOldRDRAFT_c000019 | 3300000044 | Bacteria | 37577 |
| 6 | ARCol0oldRDRAFT_c00019 | 3300000045 | Bacteria | 12070 |
| 7 | ARCol0yngRDRAFT_1000004 | 3300000652 | Bacteria | 52222 |
| 8 | JGI24739J22299_10001890 | 3300001989 | Bacteria | 8001 |
| 9 | JGI24737J22298_10000207 | 3300001990 | Bacteria | 19137 |
| 10 | JGI24737J22298_10001119 | 3300001990 | Bacteria | 9430 |
| 11 | JGI24750J21931_1001369 | 3300002070 | Bacteria | 3064 |
| 12 | JGI24745J21846_1001822 | 3300002073 | Bacteria | 2110 |
| 13 | JGI24748J21848_1000218 | 3300002074 | Bacteria | 7022 |
| 14 | JGI24738J21930_10000029 | 3300002075 | Bacteria | 26851 |
| 15 | JGI24749J21850_1001190 | 3300002076 | Bacteria | 3694 |
| 16 | JGI24744J21845_10001741 | 3300002077 | Bacteria | 4367 |
| 17 | JGI24742J22300_10002072 | 3300002244 | Bacteria | 3190 |
| 18 | JGI25406J46586_10000093 | 3300003203 | Bacteria | 41100 |
| 19 | JGI25153J46596_10002951 | 3300003215 | Bacteria | 9630 |
| 20 | JGI25153J46596_10003480 | 3300003215 | Bacteria | 8805 |
| 21 | JGI25153J46596_10013314 | 3300003215 | Bacteria | 3483 |
| 22 | Ga0055526_1000427 | 3300003771 | Bacteria | 33902 |
| 23 | Ga0055524_1001121 | 3300003775 | Bacteria | 16157 |
| 24 | Ga0055530_10003423 | 3300003791 | Bacteria | 9029 |
| 25 | Ga0055531_10028919 | 3300003794 | Bacteria | 1899 |
| 26 | JGI25405J52794_10006708 | 3300003911 | Bacteria | 2107 |
| 27 | Ga0065165_1010588 | 3300005262 | Bacteria | 3960 |
| 28 | Ga0065712_10001614 | 3300005290 | Bacteria | 6094 |
| 29 | Ga0065712_10081440 | 3300005290 | Bacteria | 3006 |
| 30 | Ga0065715_10001152 | 3300005293 | Bacteria | 6938 |
| 31 | Ga0065715_10104947 | 3300005293 | Bacteria | 2925 |
| 32 | Ga0065707_10101857 | 3300005295 | Bacteria | 2842 |
| 33 | Ga0070676_10001460 | 3300005328 | Bacteria | 11953 |
| 34 | Ga0070676_10026353 | 3300005328 | Bacteria | 3291 |
| 35 | Ga0070683_100087289 | 3300005329 | Bacteria | 2925 |
| 36 | Ga0070683_100100186 | 3300005329 | Bacteria | 2727 |
| 37 | Ga0070690_100004467 | 3300005330 | Bacteria | 7770 |
| 38 | Ga0070690_100021035 | 3300005330 | Bacteria | 3980 |
| 39 | Ga0070670_100054629 | 3300005331 | Bacteria | 3429 |
| 40 | Ga0070670_100063259 | 3300005331 | Bacteria | 3176 |
| 41 | Ga0070670_100132432 | 3300005331 | Bacteria | 2153 |
| 42 | Ga0070677_10000429 | 3300005333 | Bacteria | 14486 |
| 43 | Ga0068869_100000687 | 3300005334 | Bacteria | 19110 |
| 44 | Ga0068869_100085936 | 3300005334 | Bacteria | 2357 |
| 45 | Ga0068869_100268560 | 3300005334 | Bacteria | 1368 |
| 46 | Ga0068869_100381291 | 3300005334 | Bacteria | 1155 |
| 47 | Ga0070666_10060082 | 3300005335 | Bacteria | 2572 |
| 48 | Ga0070680_100027252 | 3300005336 | Bacteria | 4575 |
| 49 | Ga0070680_100077923 | 3300005336 | Bacteria | 2730 |
| 50 | Ga0070680_100246084 | 3300005336 | Bacteria | 1512 |
| 51 | Ga0070682_100000995 | 3300005337 | Bacteria | 16400 |
| 52 | Ga0070682_100003787 | 3300005337 | Bacteria | 8408 |
| 53 | Ga0070682_100065437 | 3300005337 | Bacteria | 2310 |
| 54 | Ga0070682_100136920 | 3300005337 | Bacteria | 1664 |
| 55 | Ga0068868_100058156 | 3300005338 | Bacteria | 3055 |
| 56 | Ga0068868_100254238 | 3300005338 | Bacteria | 1479 |
| 57 | Ga0070660_100006096 | 3300005339 | Bacteria | 8336 |
| 58 | Ga0070660_100083714 | 3300005339 | Bacteria | 2506 |
| 59 | Ga0070660_100091470 | 3300005339 | Bacteria | 2400 |
| 60 | Ga0070689_100016831 | 3300005340 | Bacteria | 5359 |
| 61 | Ga0070689_100065316 | 3300005340 | Bacteria | 2833 |
| 62 | Ga0070691_10001450 | 3300005341 | Bacteria | 10155 |
| 63 | Ga0070687_100010183 | 3300005343 | Bacteria | 4054 |
| 64 | Ga0070687_100025480 | 3300005343 | Bacteria | 2838 |
| 65 | Ga0070661_100075460 | 3300005344 | Bacteria | 2484 |
| 66 | Ga0070692_10001330 | 3300005345 | Bacteria | 8896 |
| 67 | Ga0070692_10032664 | 3300005345 | Bacteria | 2618 |
| 68 | Ga0070668_100052491 | 3300005347 | Bacteria | 3142 |
| 69 | Ga0070668_100214941 | 3300005347 | Bacteria | 1583 |
| 70 | Ga0070669_100032918 | 3300005353 | Bacteria | 3746 |
| 71 | Ga0070669_100062781 | 3300005353 | Bacteria | 2733 |
| 72 | Ga0070675_100000240 | 3300005354 | Bacteria | 35499 |
| 73 | Ga0070675_100070918 | 3300005354 | Bacteria | 2889 |
| 74 | Ga0070671_100027986 | 3300005355 | Bacteria | 4641 |
| 75 | Ga0070671_100196451 | 3300005355 | Bacteria | 1710 |
| 76 | Ga0070671_100278529 | 3300005355 | Bacteria | 1422 |
| 77 | Ga0070674_100002264 | 3300005356 | Bacteria | 10625 |
| 78 | Ga0070673_100019462 | 3300005364 | Bacteria | 4872 |
| 79 | Ga0070673_100134704 | 3300005364 | Bacteria | 2078 |
| 80 | Ga0070688_100016686 | 3300005365 | Bacteria | 4202 |
| 81 | Ga0070688_100041792 | 3300005365 | Bacteria | 2816 |
| 82 | Ga0070659_100009275 | 3300005366 | Bacteria | 7224 |
| 83 | Ga0070659_100033735 | 3300005366 | Bacteria | 3978 |
| 84 | Ga0070659_100064249 | 3300005366 | Bacteria | 2905 |
| 85 | Ga0070667_100015593 | 3300005367 | Bacteria | 6283 |
| 86 | Ga0070667_100066927 | 3300005367 | Bacteria | 3053 |
| 87 | Ga0070667_100088578 | 3300005367 | Bacteria | 2658 |
| 88 | Ga0070709_10237690 | 3300005434 | Bacteria | 1307 |
| 89 | Ga0070714_100093931 | 3300005435 | Bacteria | 2632 |
| 90 | Ga0070713_100008105 | 3300005436 | Bacteria | 7430 |
| 91 | Ga0070713_100017182 | 3300005436 | Bacteria | 5464 |
| 92 | Ga0070713_100034300 | 3300005436 | Bacteria | 4076 |
| 93 | Ga0070713_100041015 | 3300005436 | Bacteria | 3768 |
| 94 | Ga0070713_100142923 | 3300005436 | Bacteria | 2121 |
| 95 | Ga0070710_10006165 | 3300005437 | Bacteria | 5737 |
| 96 | Ga0070710_10016385 | 3300005437 | Bacteria | 3770 |
| 97 | Ga0070701_10000039 | 3300005438 | Bacteria | 32727 |
| 98 | Ga0070711_100016158 | 3300005439 | Bacteria | 4736 |
| 99 | Ga0070711_100022759 | 3300005439 | Bacteria | 4066 |
| 100 | Ga0070705_100000768 | 3300005440 | Bacteria | 18121 |
| 101 | Ga0070705_100102717 | 3300005440 | Bacteria | 1808 |
| 102 | Ga0070700_100000735 | 3300005441 | Bacteria | 16194 |
| 103 | Ga0070694_100005074 | 3300005444 | Bacteria | 7938 |
| 104 | Ga0070694_100023281 | 3300005444 | Bacteria | 3981 |
| 105 | Ga0070708_100011083 | 3300005445 | Bacteria | 7325 |
| 106 | Ga0070708_100327900 | 3300005445 | Bacteria | 1442 |
| 107 | Ga0070663_100057916 | 3300005455 | Bacteria | 2781 |
| 108 | Ga0070663_100065616 | 3300005455 | Bacteria | 2628 |
| 109 | Ga0070678_100000998 | 3300005456 | Bacteria | 14672 |
| 110 | Ga0070678_100013593 | 3300005456 | Bacteria | 5111 |
| 111 | Ga0070678_100031955 | 3300005456 | Bacteria | 3637 |
| 112 | Ga0070662_100060345 | 3300005457 | Bacteria | 2765 |
| 113 | Ga0070662_100061564 | 3300005457 | Bacteria | 2740 |
| 114 | Ga0070681_10002988 | 3300005458 | Bacteria | 15683 |
| 115 | Ga0070681_10009201 | 3300005458 | Bacteria | 9709 |
| 116 | Ga0070681_10019515 | 3300005458 | Bacteria | 6787 |
| 117 | Ga0070681_10019918 | 3300005458 | Bacteria | 6722 |
| 118 | Ga0070681_10064905 | 3300005458 | Bacteria | 3621 |
| 119 | Ga0070681_10143822 | 3300005458 | Bacteria | 2314 |
| 120 | Ga0070681_10280825 | 3300005458 | Bacteria | 1576 |
| 121 | Ga0068867_100008309 | 3300005459 | Bacteria | 7328 |
| 122 | Ga0070685_10016125 | 3300005466 | Bacteria | 3975 |
| 123 | Ga0070685_10040878 | 3300005466 | Bacteria | 2640 |
| 124 | Ga0070707_100004536 | 3300005468 | Bacteria | 12999 |
| 125 | Ga0070698_100079951 | 3300005471 | Bacteria | 3265 |
| 126 | Ga0070679_100001814 | 3300005530 | Bacteria | 19260 |
| 127 | Ga0070679_100010765 | 3300005530 | Bacteria | 8684 |
| 128 | Ga0070679_100011317 | 3300005530 | Bacteria | 8506 |
| 129 | Ga0070679_100016730 | 3300005530 | Bacteria | 7086 |
| 130 | Ga0070679_100049458 | 3300005530 | Unclassified | 4187 |
| 131 | Ga0070679_100086604 | 3300005530 | Bacteria | 3119 |
| 132 | Ga0070679_100441582 | 3300005530 | Bacteria | 1246 |
| 133 | Ga0070684_100006735 | 3300005535 | Bacteria | 8912 |
| 134 | Ga0070684_100178396 | 3300005535 | Bacteria | 1931 |
| 135 | Ga0070697_100030782 | 3300005536 | Bacteria | 4313 |
| 136 | Ga0070697_100038587 | 3300005536 | Bacteria | 3860 |
| 137 | Ga0070697_100047284 | 3300005536 | Bacteria | 3489 |
| 138 | Ga0070697_100204273 | 3300005536 | Bacteria | 1680 |
| 139 | Ga0068853_100000437 | 3300005539 | Bacteria | 28499 |
| 140 | Ga0068853_100031350 | 3300005539 | Bacteria | 4496 |
| 141 | Ga0070672_100001847 | 3300005543 | Bacteria | 13222 |
| 142 | Ga0070686_100003301 | 3300005544 | Bacteria | 8832 |
| 143 | Ga0070686_100019694 | 3300005544 | Bacteria | 3980 |
| 144 | Ga0070695_100003423 | 3300005545 | Bacteria | 9272 |
| 145 | Ga0070695_100021124 | 3300005545 | Bacteria | 3980 |
| 146 | Ga0070696_100019038 | 3300005546 | Bacteria | 4647 |
| 147 | Ga0070696_100072002 | 3300005546 | Bacteria | 2433 |
| 148 | Ga0070696_100341126 | 3300005546 | Bacteria | 1158 |
| 149 | Ga0070693_100003347 | 3300005547 | Bacteria | 7453 |
| 150 | Ga0070693_100078512 | 3300005547 | Bacteria | 1962 |
| 151 | Ga0070693_100096188 | 3300005547 | Bacteria | 1795 |
| 152 | Ga0070665_100400073 | 3300005548 | Bacteria | 1381 |
| 153 | Ga0070704_100013544 | 3300005549 | Bacteria | 5063 |
| 154 | Ga0070704_100073537 | 3300005549 | Bacteria | 2490 |
| 155 | Ga0070704_100201039 | 3300005549 | Bacteria | 1608 |
| 156 | Ga0068855_100002138 | 3300005563 | Bacteria | 24449 |
| 157 | Ga0068855_100023725 | 3300005563 | Bacteria | 7348 |
| 158 | Ga0068855_100046002 | 3300005563 | Bacteria | 5159 |
| 159 | Ga0070664_100001002 | 3300005564 | Bacteria | 22163 |
| 160 | Ga0068857_100008801 | 3300005577 | Bacteria | 8743 |
| 161 | Ga0068857_100255119 | 3300005577 | Bacteria | 1608 |
| 162 | Ga0068854_100001976 | 3300005578 | Bacteria | 12534 |
| 163 | Ga0068854_100089710 | 3300005578 | Bacteria | 2285 |
| 164 | Ga0068856_100005280 | 3300005614 | Bacteria | 12741 |
| 165 | Ga0068856_100143713 | 3300005614 | Bacteria | 2394 |
| 166 | Ga0070702_100002858 | 3300005615 | Bacteria | 7581 |
| 167 | Ga0068859_100018024 | 3300005617 | Bacteria | 7096 |
| 168 | Ga0068859_100119803 | 3300005617 | Bacteria | 2698 |
| 169 | Ga0068864_100006180 | 3300005618 | Bacteria | 9820 |
| 170 | Ga0068866_10011870 | 3300005718 | Bacteria | 3784 |
| 171 | Ga0068861_100000248 | 3300005719 | Bacteria | 29792 |
| 172 | Ga0068870_10000157 | 3300005840 | Bacteria | 23872 |
| 173 | Ga0068863_100000674 | 3300005841 | Bacteria | 34508 |
| 174 | Ga0068863_100323821 | 3300005841 | Bacteria | 1497 |
| 175 | Ga0068863_100390688 | 3300005841 | Bacteria | 1359 |
| 176 | Ga0068858_100054434 | 3300005842 | Bacteria | 3700 |
| 177 | Ga0068858_100072251 | 3300005842 | Bacteria | 3201 |
| 178 | Ga0068860_100011546 | 3300005843 | Bacteria | 8707 |
| 179 | Ga0068860_100050047 | 3300005843 | Bacteria | 3979 |
| 180 | Ga0068860_100072707 | 3300005843 | Bacteria | 3269 |
| 181 | Ga0068862_100040120 | 3300005844 | Bacteria | 3979 |
| 182 | Ga0081455_10000059 | 3300005937 | Bacteria | 119148 |
| 183 | Ga0081455_10002427 | 3300005937 | Bacteria | 22238 |
| 184 | Ga0081455_10242350 | 3300005937 | Bacteria | 1324 |
| 185 | Ga0081538_10049508 | 3300005981 | Bacteria | 2548 |
| 186 | Ga0081540_1008452 | 3300005983 | Bacteria | 7190 |
| 187 | Ga0081539_10000140 | 3300005985 | Bacteria | 166746 |
| 188 | Ga0081539_10046544 | 3300005985 | Bacteria | 2485 |
| 189 | Ga0070717_10000161 | 3300006028 | Bacteria | 50633 |
| 190 | Ga0070717_10012075 | 3300006028 | Bacteria | 6581 |
| 191 | Ga0070717_10045154 | 3300006028 | Bacteria | 3601 |
| 192 | Ga0075365_10003405 | 3300006038 | Bacteria | 8181 |
| 193 | Ga0075368_10001688 | 3300006042 | Bacteria | 7091 |
| 194 | Ga0075363_100013917 | 3300006048 | Bacteria | 3917 |
| 195 | Ga0075364_10009796 | 3300006051 | Bacteria | 5763 |
| 196 | Ga0075432_10010678 | 3300006058 | Bacteria | 3121 |
| 197 | Ga0070715_10002352 | 3300006163 | Bacteria | 5786 |
| 198 | Ga0070716_100026605 | 3300006173 | Bacteria | 3099 |
| 199 | Ga0070716_100259043 | 3300006173 | Bacteria | 1189 |
| 200 | Ga0070712_100006221 | 3300006175 | Bacteria | 7388 |
| 201 | Ga0070712_100123444 | 3300006175 | Bacteria | 1952 |
| 202 | Ga0075367_10074959 | 3300006178 | Bacteria | 2040 |
| 203 | Ga0075369_10041306 | 3300006186 | Bacteria | 1974 |
| 204 | Ga0075427_10000100 | 3300006194 | Bacteria | 7234 |
| 205 | Ga0075366_10087695 | 3300006195 | Bacteria | 1863 |
| 206 | Ga0097621_100001613 | 3300006237 | Bacteria | 15457 |
| 207 | Ga0068871_100001066 | 3300006358 | Bacteria | 18401 |
| 208 | Ga0075430_100000070 | 3300006846 | Bacteria | 55805 |
| 209 | Ga0075431_100001221 | 3300006847 | Bacteria | 23276 |
| 210 | Ga0075433_10006220 | 3300006852 | Bacteria | 9418 |
| 211 | Ga0075433_10110695 | 3300006852 | Bacteria | 2437 |
| 212 | Ga0075433_10124808 | 3300006852 | Bacteria | 2287 |
| 213 | Ga0075434_100000212 | 3300006871 | Bacteria | 39628 |
| 214 | Ga0075434_100027125 | 3300006871 | Bacteria | 5621 |
| 215 | Ga0075434_100157948 | 3300006871 | Bacteria | 2287 |
| 216 | Ga0075434_100216040 | 3300006871 | Bacteria | 1937 |
| 217 | Ga0075429_100003999 | 3300006880 | Bacteria | 12622 |
| 218 | Ga0068865_100000131 | 3300006881 | Bacteria | 38862 |
| 219 | Ga0075436_100001731 | 3300006914 | Bacteria | 14950 |
| 220 | Ga0075436_100034998 | 3300006914 | Bacteria | 3464 |
| 221 | Ga0075436_100070908 | 3300006914 | Bacteria | 2409 |
| 222 | Ga0097620_100018022 | 3300006931 | Bacteria | 7096 |
| 223 | Ga0097620_100119802 | 3300006931 | Bacteria | 2698 |
| 224 | Ga0075435_100015735 | 3300007076 | Bacteria | 5690 |
| 225 | Ga0075435_100049577 | 3300007076 | Bacteria | 3377 |
| 226 | Ga0075435_100109551 | 3300007076 | Bacteria | 2296 |
| 227 | Ga0075435_100268392 | 3300007076 | Bacteria | 1455 |
| 228 | Ga0099794_10006018 | 3300007265 | Bacteria | 4896 |
| 229 | Ga0105244_10017643 | 3300009036 | Bacteria | 4029 |
| 230 | Ga0105240_10000411 | 3300009093 | Bacteria | 79786 |
| 231 | Ga0105240_10003526 | 3300009093 | Bacteria | 24279 |
| 232 | Ga0105240_10011914 | 3300009093 | Bacteria | 12061 |
| 233 | Ga0105240_10191619 | 3300009093 | Bacteria | 2404 |
| 234 | Ga0111539_10000138 | 3300009094 | Bacteria | 82968 |
| 235 | Ga0111539_10000684 | 3300009094 | Bacteria | 43895 |
| 236 | Ga0111539_10005247 | 3300009094 | Bacteria | 16787 |
| 237 | Ga0111539_10028103 | 3300009094 | Bacteria | 6867 |
| 238 | Ga0111539_10232912 | 3300009094 | Bacteria | 2144 |
| 239 | Ga0105245_10003161 | 3300009098 | Bacteria | 14721 |
| 240 | Ga0105245_10005778 | 3300009098 | Bacteria | 10853 |
| 241 | Ga0105245_10167920 | 3300009098 | Bacteria | 2087 |
| 242 | Ga0105245_10297231 | 3300009098 | Bacteria | 1583 |
| 243 | Ga0105247_10005112 | 3300009101 | Bacteria | 8310 |
| 244 | Ga0105247_10034021 | 3300009101 | Bacteria | 3103 |
| 245 | Ga0105247_10056044 | 3300009101 | Bacteria | 2433 |
| 246 | Ga0105247_10111516 | 3300009101 | Bacteria | 1761 |
| 247 | Ga0105247_10159395 | 3300009101 | Bacteria | 1493 |
| 248 | Ga0114129_10002312 | 3300009147 | Bacteria | 26434 |
| 249 | Ga0114129_10058044 | 3300009147 | Bacteria | 5414 |
| 250 | Ga0114129_10482426 | 3300009147 | Bacteria | 1622 |
| 251 | Ga0105243_10071183 | 3300009148 | Bacteria | 2811 |
| 252 | Ga0105243_10073860 | 3300009148 | Bacteria | 2764 |
| 253 | Ga0105241_10069318 | 3300009174 | Bacteria | 2734 |
| 254 | Ga0105241_10075502 | 3300009174 | Bacteria | 2627 |
| 255 | Ga0105241_10405603 | 3300009174 | Bacteria | 1196 |
| 256 | Ga0105242_10021762 | 3300009176 | Bacteria | 5038 |
| 257 | Ga0105242_10215419 | 3300009176 | Bacteria | 1713 |
| 258 | Ga0105248_10051300 | 3300009177 | Bacteria | 4629 |
| 259 | Ga0105248_10103407 | 3300009177 | Bacteria | 3211 |
| 260 | Ga0105248_10117464 | 3300009177 | Bacteria | 3000 |
| 261 | Ga0105237_10016490 | 3300009545 | Bacteria | 7674 |
| 262 | Ga0105237_10079338 | 3300009545 | Bacteria | 3273 |
| 263 | Ga0105237_10087884 | 3300009545 | Bacteria | 3097 |
| 264 | Ga0105238_10002477 | 3300009551 | Bacteria | 18476 |
| 265 | Ga0105238_10058977 | 3300009551 | Bacteria | 3846 |
| 266 | Ga0105238_10257445 | 3300009551 | Bacteria | 1724 |
| 267 | Ga0105249_10000711 | 3300009553 | Bacteria | 30203 |
| 268 | Ga0105249_10005299 | 3300009553 | Bacteria | 11137 |
| 269 | Ga0105249_10021879 | 3300009553 | Bacteria | 5726 |
| 270 | Ga0105249_10073357 | 3300009553 | Bacteria | 3166 |
| 271 | Ga0105239_10021637 | 3300010375 | Bacteria | 7090 |
| 272 | Ga0105239_10173107 | 3300010375 | Bacteria | 2414 |
| 273 | Ga0105239_10417110 | 3300010375 | Bacteria | 1520 |
| 274 | Ga0105246_10002665 | 3300011119 | Bacteria | 10812 |
| 275 | Ga0105246_10117875 | 3300011119 | Bacteria | 1962 |
| 276 | Ga0105246_10209764 | 3300011119 | Bacteria | 1520 |
| 277 | Ga0105246_10273185 | 3300011119 | Bacteria | 1352 |
| 278 | Ga0157373_10011307 | 3300013100 | Bacteria | 6563 |
| 279 | Ga0157373_10020584 | 3300013100 | Bacteria | 4792 |
| 280 | Ga0157371_10057880 | 3300013102 | Bacteria | 2749 |
| 281 | Ga0157370_10003496 | 3300013104 | Bacteria | 18415 |
| 282 | Ga0157370_10065204 | 3300013104 | Bacteria | 3446 |
| 283 | Ga0157370_10589985 | 3300013104 | Bacteria | 1018 |
| 284 | Ga0157369_10004403 | 3300013105 | Bacteria | 16624 |
| 285 | Ga0157369_10018324 | 3300013105 | Bacteria | 7851 |
| 286 | Ga0157374_10000671 | 3300013296 | Bacteria | 30150 |
| 287 | Ga0157374_10032272 | 3300013296 | Bacteria | 4766 |
| 288 | Ga0157374_10084810 | 3300013296 | Unclassified | 3011 |
| 289 | Ga0157374_10205183 | 3300013296 | Bacteria | 1931 |
| 290 | Ga0157378_10126975 | 3300013297 | Bacteria | 2357 |
| 291 | Ga0157378_10175656 | 3300013297 | Bacteria | 2012 |
| 292 | Ga0157378_10348032 | 3300013297 | Bacteria | 1447 |
| 293 | Ga0163162_10003419 | 3300013306 | Bacteria | 15152 |
| 294 | Ga0163162_10137663 | 3300013306 | Bacteria | 2553 |
| 295 | Ga0163162_10197380 | 3300013306 | Bacteria | 2141 |
| 296 | Ga0157372_10105543 | 3300013307 | Bacteria | 3222 |
| 297 | Ga0157375_10009189 | 3300013308 | Bacteria | 8664 |
| 298 | Ga0157375_10017721 | 3300013308 | Bacteria | 6437 |
| 299 | Ga0157375_10138520 | 3300013308 | Bacteria | 2559 |
| 300 | Ga0163163_10004312 | 3300014325 | Bacteria | 12118 |
| 301 | Ga0163163_10029813 | 3300014325 | Bacteria | 5250 |
| 302 | Ga0157380_10000678 | 3300014326 | Bacteria | 21096 |
| 303 | Ga0157380_10532272 | 3300014326 | Bacteria | 1149 |
| 304 | Ga0157377_10000570 | 3300014745 | Bacteria | 15436 |
| 305 | Ga0157377_10056043 | 3300014745 | Bacteria | 2237 |
| 306 | Ga0157377_10191287 | 3300014745 | Bacteria | 1293 |
| 307 | Ga0157379_10000345 | 3300014968 | Bacteria | 37352 |
| 308 | Ga0157379_10042501 | 3300014968 | Bacteria | 4058 |
| 309 | Ga0157379_10061412 | 3300014968 | Bacteria | 3360 |
| 310 | Ga0157379_10311399 | 3300014968 | Bacteria | 1436 |
| 311 | Ga0157379_10414874 | 3300014968 | Bacteria | 1239 |
| 312 | Ga0157376_10003644 | 3300014969 | Bacteria | 10633 |
| 313 | Ga0163161_10004669 | 3300017792 | Bacteria | 9525 |
| 314 | Ga0213872_10015714 | 3300021361 | Unclassified | 3518 |
| 315 | Ga0213872_10100322 | 3300021361 | Bacteria | 1291 |
| 316 | Ga0213874_10004551 | 3300021377 | Unclassified | 3180 |
| 317 | Ga0213876_10001266 | 3300021384 | Bacteria | 15963 |
| 318 | Ga0209677_106740 | 3300025253 | Bacteria | 2636 |
| 319 | Ga0209148_1011843 | 3300025254 | Bacteria | 1610 |
| 320 | Ga0207666_1000069 | 3300025271 | Bacteria | 17953 |
| 321 | Ga0207666_1001537 | 3300025271 | Bacteria | 2724 |
| 322 | Ga0207673_1000145 | 3300025290 | Bacteria | 6892 |
| 323 | Ga0209675_1000307 | 3300025291 | Bacteria | 44268 |
| 324 | Ga0209025_1024894 | 3300025294 | Bacteria | 3072 |
| 325 | Ga0209564_1000015 | 3300025295 | Bacteria | 615324 |
| 326 | Ga0209564_1000031 | 3300025295 | Bacteria | 494703 |
| 327 | Ga0209564_1025935 | 3300025295 | Bacteria | 1953 |
| 328 | Ga0209758_1000140 | 3300025297 | Bacteria | 174267 |
| 329 | Ga0209758_1000232 | 3300025297 | Bacteria | 117382 |
| 330 | Ga0209758_1000925 | 3300025297 | Bacteria | 39673 |
| 331 | Ga0209758_1002072 | 3300025297 | Bacteria | 21375 |
| 332 | Ga0209758_1007360 | 3300025297 | Bacteria | 7527 |
| 333 | Ga0209256_1000205 | 3300025299 | Bacteria | 111530 |
| 334 | Ga0209256_1004348 | 3300025299 | Bacteria | 8979 |
| 335 | Ga0209256_1007690 | 3300025299 | Bacteria | 5231 |
| 336 | Ga0207426_1000434 | 3300025302 | Bacteria | 68127 |
| 337 | Ga0207426_1058688 | 3300025302 | Bacteria | 1115 |
| 338 | Ga0209257_1001932 | 3300025304 | Bacteria | 22369 |
| 339 | Ga0207697_10019122 | 3300025315 | Bacteria | 2806 |
| 340 | Ga0207653_10016912 | 3300025885 | Bacteria | 2294 |
| 341 | Ga0207682_10000048 | 3300025893 | Bacteria | 50998 |
| 342 | Ga0207692_10008259 | 3300025898 | Bacteria | 4305 |
| 343 | Ga0207642_10000783 | 3300025899 | Bacteria | 9847 |
| 344 | Ga0207710_10037372 | 3300025900 | Bacteria | 2144 |
| 345 | Ga0207688_10001496 | 3300025901 | Bacteria | 12264 |
| 346 | Ga0207688_10040016 | 3300025901 | Bacteria | 2604 |
| 347 | Ga0207680_10021980 | 3300025903 | Bacteria | 3462 |
| 348 | Ga0207647_10007263 | 3300025904 | Bacteria | 8019 |
| 349 | Ga0207647_10008534 | 3300025904 | Bacteria | 7336 |
| 350 | Ga0207647_10012181 | 3300025904 | Bacteria | 5999 |
| 351 | Ga0207699_10000944 | 3300025906 | Bacteria | 13851 |
| 352 | Ga0207699_10067828 | 3300025906 | Bacteria | 2170 |
| 353 | Ga0207699_10169314 | 3300025906 | Bacteria | 1460 |
| 354 | Ga0207645_10003506 | 3300025907 | Bacteria | 11875 |
| 355 | Ga0207645_10063042 | 3300025907 | Bacteria | 2368 |
| 356 | Ga0207645_10156185 | 3300025907 | Bacteria | 1490 |
| 357 | Ga0207643_10001399 | 3300025908 | Bacteria | 13828 |
| 358 | Ga0207684_10064509 | 3300025910 | Bacteria | 3109 |
| 359 | Ga0207654_10003198 | 3300025911 | Bacteria | 8280 |
| 360 | Ga0207654_10215549 | 3300025911 | Bacteria | 1271 |
| 361 | Ga0207707_10000119 | 3300025912 | Bacteria | 80273 |
| 362 | Ga0207707_10001610 | 3300025912 | Bacteria | 20791 |
| 363 | Ga0207707_10018809 | 3300025912 | Bacteria | 6026 |
| 364 | Ga0207707_10020384 | 3300025912 | Bacteria | 5789 |
| 365 | Ga0207707_10023721 | 3300025912 | Bacteria | 5365 |
| 366 | Ga0207707_10023741 | 3300025912 | Bacteria | 5363 |
| 367 | Ga0207707_10036943 | 3300025912 | Bacteria | 4269 |
| 368 | Ga0207707_10037232 | 3300025912 | Bacteria | 4250 |
| 369 | Ga0207707_10226637 | 3300025912 | Bacteria | 1626 |
| 370 | Ga0207695_10004562 | 3300025913 | Bacteria | 18831 |
| 371 | Ga0207695_10064793 | 3300025913 | Bacteria | 3760 |
| 372 | Ga0207695_10144499 | 3300025913 | Bacteria | 2324 |
| 373 | Ga0207695_10152593 | 3300025913 | Bacteria | 2248 |
| 374 | Ga0207695_10280138 | 3300025913 | Bacteria | 1561 |
| 375 | Ga0207671_10115222 | 3300025914 | Bacteria | 2049 |
| 376 | Ga0207671_10206742 | 3300025914 | Bacteria | 1534 |
| 377 | Ga0207693_10002467 | 3300025915 | Bacteria | 16076 |
| 378 | Ga0207663_10011512 | 3300025916 | Bacteria | 4751 |
| 379 | Ga0207663_10063336 | 3300025916 | Bacteria | 2354 |
| 380 | Ga0207663_10119530 | 3300025916 | Bacteria | 1802 |
| 381 | Ga0207660_10000104 | 3300025917 | Bacteria | 47254 |
| 382 | Ga0207660_10004090 | 3300025917 | Bacteria | 9500 |
| 383 | Ga0207660_10103776 | 3300025917 | Bacteria | 2127 |
| 384 | Ga0207660_10107364 | 3300025917 | Bacteria | 2095 |
| 385 | Ga0207660_10201056 | 3300025917 | Bacteria | 1556 |
| 386 | Ga0207660_10229653 | 3300025917 | Bacteria | 1459 |
| 387 | Ga0207660_10389475 | 3300025917 | Bacteria | 1121 |
| 388 | Ga0207662_10003087 | 3300025918 | Bacteria | 8502 |
| 389 | Ga0207662_10004464 | 3300025918 | Bacteria | 7364 |
| 390 | Ga0207657_10003518 | 3300025919 | Bacteria | 16733 |
| 391 | Ga0207657_10088833 | 3300025919 | Bacteria | 2582 |
| 392 | Ga0207657_10094095 | 3300025919 | Bacteria | 2495 |
| 393 | Ga0207649_10000141 | 3300025920 | Bacteria | 60047 |
| 394 | Ga0207649_10123937 | 3300025920 | Bacteria | 1746 |
| 395 | Ga0207652_10000515 | 3300025921 | Bacteria | 39187 |
| 396 | Ga0207652_10001526 | 3300025921 | Bacteria | 20428 |
| 397 | Ga0207652_10142877 | 3300025921 | Bacteria | 2141 |
| 398 | Ga0207652_10210755 | 3300025921 | Bacteria | 1749 |
| 399 | Ga0207646_10011053 | 3300025922 | Bacteria | 8767 |
| 400 | Ga0207681_10000359 | 3300025923 | Bacteria | 32485 |
| 401 | Ga0207681_10166082 | 3300025923 | Bacteria | 1669 |
| 402 | Ga0207694_10122911 | 3300025924 | Bacteria | 2074 |
| 403 | Ga0207694_10201258 | 3300025924 | Bacteria | 1620 |
| 404 | Ga0207650_10032317 | 3300025925 | Bacteria | 3785 |
| 405 | Ga0207659_10000052 | 3300025926 | Bacteria | 79692 |
| 406 | Ga0207659_10243311 | 3300025926 | Bacteria | 1456 |
| 407 | Ga0207687_10000097 | 3300025927 | Bacteria | 64441 |
| 408 | Ga0207687_10010954 | 3300025927 | Bacteria | 5925 |
| 409 | Ga0207687_10188765 | 3300025927 | Bacteria | 1602 |
| 410 | Ga0207700_10000673 | 3300025928 | Bacteria | 19951 |
| 411 | Ga0207700_10008693 | 3300025928 | Bacteria | 6308 |
| 412 | Ga0207700_10057884 | 3300025928 | Bacteria | 2925 |
| 413 | Ga0207700_10250010 | 3300025928 | Bacteria | 1514 |
| 414 | Ga0207664_10010534 | 3300025929 | Bacteria | 6530 |
| 415 | Ga0207664_10107677 | 3300025929 | Bacteria | 2313 |
| 416 | Ga0207644_10002956 | 3300025931 | Bacteria | 10949 |
| 417 | Ga0207690_10000278 | 3300025932 | Bacteria | 36244 |
| 418 | Ga0207690_10018178 | 3300025932 | Bacteria | 4309 |
| 419 | Ga0207706_10078650 | 3300025933 | Bacteria | 2900 |
| 420 | Ga0207706_10083323 | 3300025933 | Bacteria | 2811 |
| 421 | Ga0207706_10088290 | 3300025933 | Bacteria | 2726 |
| 422 | Ga0207686_10000850 | 3300025934 | Bacteria | 18532 |
| 423 | Ga0207686_10045453 | 3300025934 | Bacteria | 2702 |
| 424 | Ga0207709_10000349 | 3300025935 | Bacteria | 47453 |
| 425 | Ga0207709_10041427 | 3300025935 | Bacteria | 2763 |
| 426 | Ga0207670_10000781 | 3300025936 | Bacteria | 16732 |
| 427 | Ga0207670_10061577 | 3300025936 | Bacteria | 2561 |
| 428 | Ga0207669_10000168 | 3300025937 | Bacteria | 30867 |
| 429 | Ga0207704_10000704 | 3300025938 | Bacteria | 14739 |
| 430 | Ga0207665_10000248 | 3300025939 | Bacteria | 37228 |
| 431 | Ga0207665_10074153 | 3300025939 | Bacteria | 2329 |
| 432 | Ga0207691_10003348 | 3300025940 | Bacteria | 15596 |
| 433 | Ga0207691_10142573 | 3300025940 | Bacteria | 2110 |
| 434 | Ga0207711_10003359 | 3300025941 | Bacteria | 13863 |
| 435 | Ga0207689_10005416 | 3300025942 | Bacteria | 11423 |
| 436 | Ga0207689_10045015 | 3300025942 | Bacteria | 3650 |
| 437 | Ga0207661_10000143 | 3300025944 | Bacteria | 45329 |
| 438 | Ga0207661_10186597 | 3300025944 | Bacteria | 1815 |
| 439 | Ga0207679_10000035 | 3300025945 | Bacteria | 144173 |
| 440 | Ga0207679_10011268 | 3300025945 | Bacteria | 5781 |
| 441 | Ga0207667_10001570 | 3300025949 | Bacteria | 28787 |
| 442 | Ga0207667_10046224 | 3300025949 | Bacteria | 4609 |
| 443 | Ga0207667_10049164 | 3300025949 | Bacteria | 4456 |
| 444 | Ga0207651_10000080 | 3300025960 | Bacteria | 42826 |
| 445 | Ga0207712_10001127 | 3300025961 | Bacteria | 18629 |
| 446 | Ga0207712_10092379 | 3300025961 | Bacteria | 2231 |
| 447 | Ga0207712_10330591 | 3300025961 | Bacteria | 1261 |
| 448 | Ga0207668_10005342 | 3300025972 | Bacteria | 7557 |
| 449 | Ga0207668_10071444 | 3300025972 | Bacteria | 2479 |
| 450 | Ga0207668_10085490 | 3300025972 | Bacteria | 2302 |
| 451 | Ga0207640_10001402 | 3300025981 | Bacteria | 13012 |
| 452 | Ga0207640_10098875 | 3300025981 | Bacteria | 2041 |
| 453 | Ga0207640_10257024 | 3300025981 | Bacteria | 1359 |
| 454 | Ga0207658_10032065 | 3300025986 | Bacteria | 3736 |
| 455 | Ga0207658_10217197 | 3300025986 | Bacteria | 1606 |
| 456 | Ga0207677_10000614 | 3300026023 | Bacteria | 21876 |
| 457 | Ga0207677_10335320 | 3300026023 | Bacteria | 1262 |
| 458 | Ga0207703_10030485 | 3300026035 | Bacteria | 4263 |
| 459 | Ga0207703_10125493 | 3300026035 | Bacteria | 2209 |
| 460 | Ga0207703_10151412 | 3300026035 | Bacteria | 2023 |
| 461 | Ga0207639_10021338 | 3300026041 | Bacteria | 4651 |
| 462 | Ga0207678_10038552 | 3300026067 | Bacteria | 4152 |
| 463 | Ga0207678_10079023 | 3300026067 | Bacteria | 2817 |
| 464 | Ga0207678_10082729 | 3300026067 | Bacteria | 2746 |
| 465 | Ga0207678_10082730 | 3300026067 | Bacteria | 2746 |
| 466 | Ga0207708_10001353 | 3300026075 | Bacteria | 18401 |
| 467 | Ga0207708_10007477 | 3300026075 | Bacteria | 8073 |
| 468 | Ga0207702_10001956 | 3300026078 | Bacteria | 20052 |
| 469 | Ga0207702_10060712 | 3300026078 | Bacteria | 3223 |
| 470 | Ga0207702_10116988 | 3300026078 | Bacteria | 2380 |
| 471 | Ga0207702_10218473 | 3300026078 | Bacteria | 1775 |
| 472 | Ga0207641_10084479 | 3300026088 | Bacteria | 2763 |
| 473 | Ga0207641_10102400 | 3300026088 | Bacteria | 2525 |
| 474 | Ga0207648_10013365 | 3300026089 | Bacteria | 7641 |
| 475 | Ga0207648_10143291 | 3300026089 | Bacteria | 2107 |
| 476 | Ga0207676_10001840 | 3300026095 | Bacteria | 15541 |
| 477 | Ga0207674_10008438 | 3300026116 | Bacteria | 11902 |
| 478 | Ga0207674_10043305 | 3300026116 | Bacteria | 4642 |
| 479 | Ga0207674_10149204 | 3300026116 | Bacteria | 2295 |
| 480 | Ga0207674_10193479 | 3300026116 | Bacteria | 1984 |
| 481 | Ga0207674_10247416 | 3300026116 | Bacteria | 1730 |
| 482 | Ga0207674_10328044 | 3300026116 | Bacteria | 1480 |
| 483 | Ga0207675_100002948 | 3300026118 | Bacteria | 16733 |
| 484 | Ga0207675_100012197 | 3300026118 | Bacteria | 8027 |
| 485 | Ga0207675_100028974 | 3300026118 | Bacteria | 5159 |
| 486 | Ga0207683_10002096 | 3300026121 | Bacteria | 17563 |
| 487 | Ga0207683_10003030 | 3300026121 | Bacteria | 14680 |
| 488 | Ga0207683_10100175 | 3300026121 | Bacteria | 2586 |
| 489 | Ga0207698_10008006 | 3300026142 | Bacteria | 6661 |
| 490 | Ga0209971_1004128 | 3300027682 | Bacteria | 3441 |
| 491 | Ga0209966_1001601 | 3300027695 | Bacteria | 3876 |
| 492 | Ga0209998_10005225 | 3300027717 | Bacteria | 2722 |
| 493 | Ga0209998_10006493 | 3300027717 | Bacteria | 2430 |
| 494 | Ga0209998_10031253 | 3300027717 | Bacteria | 1180 |
| 495 | Ga0209974_10008734 | 3300027876 | Bacteria | 3452 |
| 496 | Ga0209974_10068970 | 3300027876 | Bacteria | 1204 |
| 497 | Ga0207428_10000075 | 3300027907 | Bacteria | 137887 |
| 498 | Ga0207428_10000428 | 3300027907 | Bacteria | 51964 |
| 499 | Ga0207428_10001396 | 3300027907 | Bacteria | 25497 |
| 500 | Ga0207428_10156604 | 3300027907 | Bacteria | 1732 |
| 501 | Ga0268266_10027620 | 3300028379 | Bacteria | 4824 |
| 502 | Ga0268266_10111657 | 3300028379 | Bacteria | 2422 |
| 503 | Ga0268265_10003048 | 3300028380 | Bacteria | 12223 |
| 504 | Ga0268265_10011699 | 3300028380 | Bacteria | 5934 |
| 505 | Ga0268264_10001145 | 3300028381 | Bacteria | 25934 |
| 506 | Ga0268264_10079277 | 3300028381 | Bacteria | 2801 |
| 507 | Ga0268264_10195287 | 3300028381 | Bacteria | 1847 |
| 508 | Ga0265337_1000182 | 3300028556 | Bacteria | 33103 |
| 509 | Ga0307515_10000600 | 3300028794 | Bacteria | 83981 |
| 510 | Ga0265332_10125828 | 3300031238 | Bacteria | 1076 |
| 511 | Ga0265340_10001673 | 3300031247 | Bacteria | 12747 |
| 512 | Ga0265339_10001531 | 3300031249 | Bacteria | 17069 |
| 513 | Ga0265339_10141850 | 3300031249 | Bacteria | 1221 |
| 514 | Ga0265316_10317838 | 3300031344 | Bacteria | 1131 |
| 515 | Ga0307513_10008298 | 3300031456 | Bacteria | 13309 |
| 516 | Ga0265313_10000181 | 3300031595 | Bacteria | 67263 |
| 517 | Ga0307406_10027838 | 3300031901 | Bacteria | 3410 |
| 518 | Ga0316583_10040564 | 3300032133 | Bacteria | 1648 |
| 519 | Ga0307510_10094692 | 3300033180 | Bacteria | 2810 |
| 520 | Ga0373930_0000464 | 3300034816 | Bacteria | 5460 |
| 521 | Ga0373930_0003826 | 3300034816 | Bacteria | 2413 |
| 522 | Ga0373930_0015819 | 3300034816 | Bacteria | 1420 |
| 523 | Ga0373948_0000488 | 3300034817 | Bacteria | 4950 |
| 524 | Ga0373948_0001405 | 3300034817 | Bacteria | 3324 |
| 525 | Ga0373950_0000351 | 3300034818 | Bacteria | 5715 |
| 526 | Ga0373950_0002315 | 3300034818 | Bacteria | 2611 |
| 527 | Ga0373950_0011583 | 3300034818 | Bacteria | 1442 |
| 528 | Ga0373958_0000402 | 3300034819 | Bacteria | 5242 |
| 529 | Ga0373958_0001293 | 3300034819 | Bacteria | 3348 |
| 530 | Ga0373958_0002203 | 3300034819 | Bacteria | 2707 |
| 531 | Ga0373959_0000494 | 3300034820 | Bacteria | 7127 |
| 532 | Ga0373959_0001509 | 3300034820 | Bacteria | 3724 |
| 533 | Ga0373938_0000413 | 3300034957 | Bacteria | 6890 |
| 534 | Ga0373926_0002008 | 3300035083 | Bacteria | 6390 |
| 535 | Ga0373926_0010300 | 3300035083 | Bacteria | 3131 |
| 536 | Ga0373928_0000172 | 3300035084 | Bacteria | 12512 |
| 537 | Ga0373928_0002041 | 3300035084 | Bacteria | 3934 |
| 538 | Ga0373929_0000302 | 3300035085 | Bacteria | 9176 |
| 539 | Ga0373929_0003253 | 3300035085 | Bacteria | 2939 |
| 540 | Ga0373934_0015240 | 3300035086 | Bacteria | 2915 |
| 541 | Ga0373934_0046778 | 3300035086 | Bacteria | 1712 |
| 542 | Ga0373940_0003536 | 3300035088 | Bacteria | 3199 |
| 543 | Ga0373940_0008001 | 3300035088 | Bacteria | 2409 |
| 544 | Ga0373944_0000062 | 3300035089 | Bacteria | 17879 |
| 545 | Ga0373944_0005563 | 3300035089 | Bacteria | 3321 |
| 546 | Ga0373949_0002398 | 3300035090 | Bacteria | 4832 |
| 547 | Ga0373949_0003324 | 3300035090 | Bacteria | 3861 |
| 548 | Ga0373949_0003453 | 3300035090 | Bacteria | 3758 |
| 549 | Ga0373951_0001192 | 3300035091 | Bacteria | 6872 |
| 550 | Ga0373951_0006845 | 3300035091 | Bacteria | 2604 |
| 551 | Ga0373952_0000447 | 3300035092 | Bacteria | 7176 |
| 552 | Ga0373952_0000884 | 3300035092 | Bacteria | 5461 |
| 553 | Ga0373952_0001020 | 3300035092 | Bacteria | 5115 |
| 554 | Ga0373923_0000387 | 3300035111 | Bacteria | 10139 |
| 555 | Ga0373932_0000029 | 3300035112 | Bacteria | 39605 |
| 556 | Ga0373932_0003160 | 3300035112 | Bacteria | 4007 |
| 557 | Ga0373932_0003822 | 3300035112 | Bacteria | 3599 |
| 558 | Ga0373936_0000484 | 3300035113 | Bacteria | 13457 |
| 559 | Ga0373936_0019710 | 3300035113 | Bacteria | 2615 |
| 560 | Ga0373936_0108417 | 3300035113 | Bacteria | 1177 |
| 561 | Ga0373939_0000356 | 3300035114 | Bacteria | 11594 |
| 562 | Ga0373939_0001362 | 3300035114 | Bacteria | 5918 |
| 563 | Ga0373941_0000106 | 3300035115 | Bacteria | 14078 |
| 564 | Ga0373941_0000424 | 3300035115 | Bacteria | 8379 |
| 565 | Ga0373941_0026859 | 3300035115 | Bacteria | 1675 |
| 566 | Ga0373945_0004180 | 3300035116 | Bacteria | 4582 |
| 567 | Ga0373945_0023152 | 3300035116 | Bacteria | 2144 |
| 568 | Ga0373953_0001395 | 3300035117 | Bacteria | 6962 |
| 569 | Ga0373953_0063163 | 3300035117 | Bacteria | 1517 |
| 570 | Ga0373954_0037654 | 3300035118 | Bacteria | 2248 |
| 571 | Ga0373956_0027092 | 3300035119 | Bacteria | 2486 |
| 572 | Ga0373957_0000713 | 3300035120 | Bacteria | 8612 |
| 573 | Ga0373957_0011670 | 3300035120 | Bacteria | 2940 |
| 574 | Ga0373960_0000009 | 3300035121 | Bacteria | 26216 |
| 575 | Ga0373960_0009990 | 3300035121 | Bacteria | 2310 |
| 576 | Ga0373943_0012718 | 3300035170 | Bacteria | 3794 |
| 577 | Ga0373943_0020592 | 3300035170 | Bacteria | 3042 |
| 578 | Ga0373943_0028976 | 3300035170 | Bacteria | 2613 |
| 579 | Ga0373943_0047591 | 3300035170 | Bacteria | 2097 |
| 580 | Ga0373946_0002687 | 3300035171 | Bacteria | 6285 |
| 581 | Ga0373946_0012381 | 3300035171 | Bacteria | 3192 |
| 582 | Ga0373946_0018899 | 3300035171 | Bacteria | 2649 |
| 583 | Ga0373946_0047960 | 3300035171 | Bacteria | 1776 |
| 584 | Ga0373955_0000366 | 3300035172 | Bacteria | 19051 |
| 585 | Ga0373955_0002392 | 3300035172 | Bacteria | 8177 |
| 586 | Ga0373955_0043353 | 3300035172 | Bacteria | 2420 |
| 587 | Ga0373942_0000542 | 3300035207 | Bacteria | 10621 |
| 588 | Ga0373961_0001281 | 3300035241 | Bacteria | 7655 |
| 589 | Ga0373961_0002601 | 3300035241 | Bacteria | 4646 |
| 590 | Ga0373962_0000376 | 3300035242 | Bacteria | 9743 |
| 591 | Ga0373962_0008200 | 3300035242 | Bacteria | 2568 |
| 592 | Ga0373924_0019001 | 3300035410 | Bacteria | 2657 |
| 593 | Ga0373924_0037312 | 3300035410 | Bacteria | 1978 |
| 594 | Ga0373931_0000409 | 3300035691 | Bacteria | 17588 |
| 595 | Ga0373931_0004931 | 3300035691 | Bacteria | 6136 |
| 596 | Ga0373931_0013494 | 3300035691 | Bacteria | 3979 |
| 597 | Ga0373935_0000382 | 3300035692 | Bacteria | 22745 |
| 598 | Ga0373935_0010618 | 3300035692 | Bacteria | 5527 |
| 599 | Ga0373935_0024746 | 3300035692 | Bacteria | 3697 |
| 600 | Ga0373927_0000956 | 3300035695 | Bacteria | 22017 |
| 601 | Ga0373927_0002885 | 3300035695 | Bacteria | 12521 |
| 602 | Ga0373927_0045009 | 3300035695 | Bacteria | 2855 |
| 603 | Ga0373933_0000110 | 3300035724 | Bacteria | 52519 |
| 604 | Ga0373933_0002646 | 3300035724 | Bacteria | 10029 |
| 605 | Ga0373933_0061272 | 3300035724 | Bacteria | 2270 |
| 606 | Ga0373933_0066231 | 3300035724 | Bacteria | 2189 |
| 607 | Ga0373947_0000731 | 3300035725 | Bacteria | 19641 |
| 608 | Ga0373947_0001850 | 3300035725 | Bacteria | 12909 |
| 609 | Ga0373947_0003531 | 3300035725 | Bacteria | 9232 |
| 610 | Ga0373937_0002001 | 3300036401 | Bacteria | 17037 |
| 611 | Ga0373937_0007098 | 3300036401 | Bacteria | 9677 |
| 612 | Ga0373937_0009476 | 3300036401 | Bacteria | 8464 |
| 613 | Ga0373937_0109590 | 3300036401 | Bacteria | 2567 |
| 614 | Ga0373925_0002634 | 3300037068 | Bacteria | 14243 |
| 615 | Ga0373925_0003685 | 3300037068 | Bacteria | 11776 |
| 616 | Ga0373925_0010358 | 3300037068 | Bacteria | 6765 |
| 617 | Ga0373925_0103628 | 3300037068 | Bacteria | 2190 |
| 618 | Ga0373925_0349406 | 3300037068 | Bacteria | 1200 |
| 619 | Ga0395900_0137353 | 3300037418 | Bacteria | 2505 |
| 620 | Ga0395905_0002565 | 3300037471 | Bacteria | 20011 |
| 621 | Ga0395901_0136667 | 3300038443 | Bacteria | 2576 |
| 622 | Ga0395901_0166786 | 3300038443 | Bacteria | 2312 |
| 623 | Ga0436365_0513279 | 3300039437 | Bacteria | 19541 |
| 624 | Ga0436365_1104947 | 3300039437 | Bacteria | 3437 |
| 625 | Ga0436360_1211363 | 3300039438 | Bacteria | 4122 |
| 626 | Ga0436361_0027198 | 3300039447 | Bacteria | 15108 |
| 627 | Ga0436361_0147176 | 3300039447 | Bacteria | 4122 |
| 628 | Ga0436361_1157127 | 3300039447 | Bacteria | 2805 |
| 629 | Ga0436363_0096027 | 3300039450 | Bacteria | 1621 |
| 630 | Ga0436363_0540018 | 3300039450 | Bacteria | 12334 |
| 631 | Ga0439453_0003687 | 3300041408 | Bacteria | 2224 |
| 632 | Ga0439448_0041230 | 3300042005 | Bacteria | 1493 |
| 633 | Ga0439435_0006396 | 3300042436 | Bacteria | 2646 |
| 634 | Ga0466969_0080482 | 3300044656 | Bacteria | 1556 |
| 635 | Ga0466966_0006283 | 3300044684 | Bacteria | 7861 |
| 636 | Ga0466961_0000154 | 3300044693 | Bacteria | 46518 |
| 637 | Ga0466963_0004891 | 3300044694 | Bacteria | 7811 |
| 638 | Ga0466963_0259264 | 3300044694 | Bacteria | 1220 |
| 639 | Ga0453684_0253798 | 3300044712 | Bacteria | 2018 |
| 640 | Ga0466959_0012963 | 3300045049 | Bacteria | 6035 |
| 641 | Ga0451576_0016775 | 3300045051 | Bacteria | 8074 |
| 642 | Ga0495592_0029190 | 3300046454 | Bacteria | 4175 |
| 643 | Ga0495592_0036453 | 3300046454 | Bacteria | 3704 |
| 644 | Ga0495592_0051160 | 3300046454 | Bacteria | 3069 |
| 645 | Ga0495592_0157393 | 3300046454 | Bacteria | 1566 |
| 646 | Ga0495592_0208641 | 3300046454 | Bacteria | 1313 |
| 647 | Ga0495603_0002008 | 3300046455 | Bacteria | 11977 |
| 648 | Ga0495603_0009274 | 3300046455 | Bacteria | 5952 |
| 649 | Ga0495603_0056028 | 3300046455 | Bacteria | 2335 |
| 650 | Ga0495629_0000500 | 3300046459 | Bacteria | 32861 |
| 651 | Ga0495629_0002524 | 3300046459 | Bacteria | 14035 |
| 652 | Ga0495629_0014754 | 3300046459 | Bacteria | 5620 |
| 653 | Ga0495629_0021353 | 3300046459 | Bacteria | 4620 |
| 654 | Ga0495629_0072107 | 3300046459 | Bacteria | 2410 |
| 655 | Ga0495638_0029760 | 3300046460 | Bacteria | 3521 |
| 656 | Ga0495641_0001436 | 3300046461 | Bacteria | 20225 |
| 657 | Ga0495641_0025868 | 3300046461 | Bacteria | 2874 |
| 658 | Ga0495651_0001150 | 3300046462 | Bacteria | 20444 |
| 659 | Ga0495651_0003637 | 3300046462 | Bacteria | 11807 |
| 660 | Ga0495651_0013744 | 3300046462 | Bacteria | 6259 |
| 661 | Ga0495651_0024828 | 3300046462 | Bacteria | 4663 |
| 662 | Ga0495653_0001957 | 3300046463 | Bacteria | 16221 |
| 663 | Ga0495653_0009176 | 3300046463 | Bacteria | 8089 |
| 664 | Ga0495653_0192942 | 3300046463 | Bacteria | 1388 |
| 665 | Ga0495650_0030504 | 3300046471 | Bacteria | 2442 |
| 666 | Ga0495650_0042756 | 3300046471 | Bacteria | 1927 |
| 667 | Ga0495580_0001416 | 3300046472 | Bacteria | 21075 |
| 668 | Ga0495580_0004694 | 3300046472 | Bacteria | 11461 |
| 669 | Ga0495580_0026223 | 3300046472 | Bacteria | 4251 |
| 670 | Ga0495582_0000251 | 3300046473 | Bacteria | 29816 |
| 671 | Ga0495582_0044786 | 3300046473 | Bacteria | 2436 |
| 672 | Ga0495582_0077010 | 3300046473 | Bacteria | 1849 |
| 673 | Ga0495639_0000077 | 3300046475 | Bacteria | 46394 |
| 674 | Ga0495639_0009153 | 3300046475 | Bacteria | 4244 |
| 675 | Ga0495639_0025780 | 3300046475 | Bacteria | 2594 |
| 676 | Ga0495662_0002039 | 3300046476 | Bacteria | 10119 |
| 677 | Ga0495662_0005023 | 3300046476 | Bacteria | 6628 |
| 678 | Ga0495664_0000178 | 3300046477 | Bacteria | 31382 |
| 679 | Ga0495594_0000648 | 3300046499 | Bacteria | 17955 |
| 680 | Ga0495594_0018573 | 3300046499 | Bacteria | 3685 |
| 681 | Ga0495594_0043982 | 3300046499 | Bacteria | 2449 |
| 682 | Ga0495594_0067104 | 3300046499 | Bacteria | 1990 |
| 683 | Ga0495607_0010007 | 3300046501 | Bacteria | 6390 |
| 684 | Ga0495583_0053134 | 3300046506 | Bacteria | 1840 |
| 685 | Ga0495606_0008377 | 3300046507 | Bacteria | 8999 |
| 686 | Ga0495608_0001671 | 3300046511 | Bacteria | 15955 |
| 687 | Ga0495608_0012960 | 3300046511 | Bacteria | 5784 |
| 688 | Ga0495608_0087254 | 3300046511 | Bacteria | 2021 |
| 689 | Ga0495618_0043141 | 3300046514 | Bacteria | 2845 |
| 690 | Ga0495618_0045614 | 3300046514 | Bacteria | 2765 |
| 691 | Ga0495618_0079346 | 3300046514 | Bacteria | 2094 |
| 692 | Ga0495618_0122232 | 3300046514 | Bacteria | 1668 |
| 693 | Ga0495618_0156045 | 3300046514 | Bacteria | 1456 |
| 694 | Ga0495628_0001448 | 3300046516 | Bacteria | 21780 |
| 695 | Ga0495628_0007599 | 3300046516 | Bacteria | 9369 |
| 696 | Ga0495628_0058528 | 3300046516 | Bacteria | 3027 |
| 697 | Ga0495628_0067617 | 3300046516 | Bacteria | 2789 |
| 698 | Ga0495628_0385534 | 3300046516 | Bacteria | 1026 |
| 699 | Ga0495630_0001279 | 3300046517 | Bacteria | 17334 |
| 700 | Ga0495630_0015634 | 3300046517 | Bacteria | 5545 |
| 701 | Ga0495630_0118561 | 3300046517 | Bacteria | 2007 |
| 702 | Ga0495644_0013279 | 3300046523 | Bacteria | 3162 |
| 703 | Ga0495666_0000187 | 3300046526 | Bacteria | 26576 |
| 704 | Ga0495666_0006830 | 3300046526 | Bacteria | 5730 |
| 705 | Ga0495666_0025210 | 3300046526 | Bacteria | 2937 |
| 706 | Ga0495652_0016995 | 3300046529 | Bacteria | 6500 |
| 707 | Ga0495652_0020641 | 3300046529 | Bacteria | 5855 |
| 708 | Ga0495652_0022353 | 3300046529 | Bacteria | 5611 |
| 709 | Ga0495652_0057912 | 3300046529 | Bacteria | 3284 |
| 710 | Ga0495652_0058863 | 3300046529 | Bacteria | 3252 |
| 711 | Ga0495652_0154913 | 3300046529 | Bacteria | 1785 |
| 712 | Ga0495652_0371961 | 3300046529 | Bacteria | 1018 |
| 713 | Ga0495665_0008864 | 3300046531 | Bacteria | 5456 |
| 714 | Ga0495665_0010034 | 3300046531 | Bacteria | 5132 |
| 715 | Ga0495665_0010232 | 3300046531 | Bacteria | 5079 |
| 716 | Ga0495640_0036563 | 3300046533 | Bacteria | 3469 |
| 717 | Ga0495640_0086181 | 3300046533 | Bacteria | 2080 |
| 718 | Ga0495640_0156752 | 3300046533 | Bacteria | 1461 |
| 719 | Ga0495586_0004369 | 3300046535 | Bacteria | 7558 |
| 720 | Ga0495586_0114764 | 3300046535 | Bacteria | 1501 |
| 721 | Ga0495587_0002681 | 3300046536 | Bacteria | 11893 |
| 722 | Ga0495587_0015083 | 3300046536 | Bacteria | 4829 |
| 723 | Ga0495587_0026467 | 3300046536 | Bacteria | 3538 |
| 724 | Ga0495587_0081897 | 3300046536 | Bacteria | 1870 |
| 725 | Ga0495598_0002702 | 3300046537 | Bacteria | 3678 |
| 726 | Ga0495645_0005154 | 3300046543 | Bacteria | 8949 |
| 727 | Ga0495645_0113517 | 3300046543 | Bacteria | 1915 |
| 728 | Ga0495622_0006500 | 3300046557 | Bacteria | 5422 |
| 729 | Ga0495622_0013770 | 3300046557 | Bacteria | 3750 |
| 730 | Ga0495633_0012498 | 3300046558 | Bacteria | 4512 |
| 731 | Ga0495667_0000821 | 3300046559 | Bacteria | 20039 |
| 732 | Ga0495667_0032794 | 3300046559 | Bacteria | 3477 |
| 733 | Ga0495667_0047814 | 3300046559 | Bacteria | 2825 |
| 734 | Ga0495656_0000534 | 3300046615 | Bacteria | 12388 |
| 735 | Ga0495668_0020492 | 3300046616 | Bacteria | 3804 |
| 736 | Ga0495634_0001976 | 3300046642 | Bacteria | 17475 |
| 737 | Ga0495634_0015427 | 3300046642 | Bacteria | 5490 |
| 738 | Ga0495634_0023646 | 3300046642 | Bacteria | 4317 |
| 739 | Ga0495634_0063318 | 3300046642 | Bacteria | 2455 |
| 740 | Ga0495634_0174029 | 3300046642 | Bacteria | 1352 |
| 741 | Ga0495611_0016881 | 3300046648 | Bacteria | 3121 |
| 742 | Ga0495635_0002471 | 3300046663 | Bacteria | 12619 |
| 743 | Ga0495635_0010978 | 3300046663 | Bacteria | 6347 |
| 744 | Ga0495635_0041465 | 3300046663 | Bacteria | 3179 |
| 745 | Ga0495635_0057830 | 3300046663 | Bacteria | 2668 |
| 746 | Ga0495659_0013500 | 3300046664 | Bacteria | 2661 |
| 747 | Ga0495661_0066763 | 3300046665 | Bacteria | 2116 |
| 748 | Ga0495588_0001695 | 3300046674 | Bacteria | 9374 |
| 749 | Ga0495588_0040655 | 3300046674 | Bacteria | 2373 |
| 750 | Ga0495588_0126037 | 3300046674 | Bacteria | 1350 |
| 751 | Ga0495657_0003184 | 3300046675 | Bacteria | 13516 |
| 752 | Ga0495657_0034766 | 3300046675 | Bacteria | 3498 |
| 753 | Ga0495599_0000806 | 3300046678 | Bacteria | 17617 |
| 754 | Ga0495599_0009828 | 3300046678 | Bacteria | 5855 |
| 755 | Ga0495599_0038287 | 3300046678 | Bacteria | 3013 |
| 756 | Ga0495623_0008437 | 3300046679 | Bacteria | 6694 |
| 757 | Ga0495647_0000638 | 3300046681 | Bacteria | 10362 |
| 758 | Ga0495647_0006505 | 3300046681 | Bacteria | 3874 |
| 759 | Ga0495647_0007166 | 3300046681 | Bacteria | 3726 |
| 760 | Ga0495658_0001615 | 3300046683 | Bacteria | 11744 |
| 761 | Ga0495658_0002133 | 3300046683 | Bacteria | 10012 |
| 762 | Ga0495658_0044890 | 3300046683 | Bacteria | 2477 |
| 763 | Ga0495658_0107390 | 3300046683 | Bacteria | 1674 |
| 764 | Ga0495669_0027321 | 3300046684 | Bacteria | 2497 |
| 765 | Ga0495613_0013924 | 3300046689 | Bacteria | 5968 |
| 766 | Ga0495613_0051009 | 3300046689 | Bacteria | 3050 |
| 767 | Ga0495613_0064833 | 3300046689 | Bacteria | 2670 |
| 768 | Ga0495613_0396753 | 3300046689 | Bacteria | 941 |
| 769 | Ga0495624_0001411 | 3300046690 | Bacteria | 18734 |
| 770 | Ga0495624_0002021 | 3300046690 | Bacteria | 15445 |
| 771 | Ga0495624_0031367 | 3300046690 | Bacteria | 3456 |
| 772 | Ga0495624_0117183 | 3300046690 | Bacteria | 1636 |
| 773 | Ga0495670_0004377 | 3300046691 | Bacteria | 6924 |
| 774 | Ga0495649_0035904 | 3300046694 | Bacteria | 2725 |
| 775 | Ga0495600_0000208 | 3300046809 | Bacteria | 33755 |
| 776 | Ga0495600_0009879 | 3300046809 | Bacteria | 5907 |
| 777 | Ga0495600_0066443 | 3300046809 | Bacteria | 2357 |
| 778 | Ga0495600_0089176 | 3300046809 | Bacteria | 2012 |
| 779 | Ga0495581_0000503 | 3300047315 | Bacteria | 19983 |
| 780 | Ga0495581_0005790 | 3300047315 | Bacteria | 7163 |
| 781 | Ga0495604_0001423 | 3300047317 | Bacteria | 19641 |
| 782 | Ga0495674_0009848 | 3300047319 | Bacteria | 9072 |
| 783 | Ga0495674_0016553 | 3300047319 | Bacteria | 6882 |
| 784 | Ga0495674_0053424 | 3300047319 | Bacteria | 3551 |
| 785 | Ga0495676_0011575 | 3300047321 | Bacteria | 7958 |
| 786 | Ga0495676_0024072 | 3300047321 | Bacteria | 5276 |
| 787 | Ga0495676_0036100 | 3300047321 | Bacteria | 4130 |
| 788 | Ga0495676_0080628 | 3300047321 | Bacteria | 2470 |
| 789 | Ga0495680_0001491 | 3300047322 | Bacteria | 25179 |
| 790 | Ga0495680_0002844 | 3300047322 | Bacteria | 17397 |
| 791 | Ga0495680_0029147 | 3300047322 | Bacteria | 4522 |
| 792 | Ga0495675_0020212 | 3300047444 | Bacteria | 4233 |
| 793 | Ga0495675_0176444 | 3300047444 | Bacteria | 1310 |
| 794 | Ga0495684_0009241 | 3300047471 | Bacteria | 7612 |
| 795 | Ga0495684_0064370 | 3300047471 | Bacteria | 2786 |
| 796 | Ga0495684_0149264 | 3300047471 | Bacteria | 1748 |
| 797 | Ga0495593_0000372 | 3300047673 | Bacteria | 24728 |
| 798 | Ga0495593_0010385 | 3300047673 | Bacteria | 5383 |
| 799 | Ga0495593_0054779 | 3300047673 | Bacteria | 2101 |
| 800 | Ga0495593_0055548 | 3300047673 | Bacteria | 2083 |
| 801 | Ga0495593_0064268 | 3300047673 | Bacteria | 1916 |
| 802 | Ga0495602_0010688 | 3300048088 | Bacteria | 9521 |
| 803 | Ga0495602_0083964 | 3300048088 | Bacteria | 2665 |
| 804 | Ga0495614_0007981 | 3300048089 | Bacteria | 4705 |
| 805 | Ga0495614_0037583 | 3300048089 | Bacteria | 2077 |
| 806 | Ga0496100_0000203 | 3300048903 | Bacteria | 32744 |
| 807 | Ga0496100_0005697 | 3300048903 | Bacteria | 6737 |
| 808 | Ga0496101_0002812 | 3300048904 | Bacteria | 10691 |
| 809 | Ga0496101_0228873 | 3300048904 | Bacteria | 1444 |
| 810 | Ga0496101_0228883 | 3300048904 | Bacteria | 1444 |
| 811 | Ga0496102_0107498 | 3300048905 | Bacteria | 2597 |
| 812 | Ga0496102_0131082 | 3300048905 | Bacteria | 2346 |
| 813 | Ga0496102_0684154 | 3300048905 | Bacteria | 949 |
| 814 | Ga0496103_0001529 | 3300048906 | Bacteria | 15450 |
| 815 | Ga0496103_0011847 | 3300048906 | Bacteria | 5174 |
| 816 | Ga0496103_0044221 | 3300048906 | Bacteria | 2743 |
| 817 | Ga0496103_0073333 | 3300048906 | Bacteria | 2144 |
| 818 | Ga0496103_0147742 | 3300048906 | Bacteria | 1505 |
| 819 | Ga0496104_0001608 | 3300048907 | Bacteria | 19461 |
| 820 | Ga0496104_0016648 | 3300048907 | Bacteria | 6682 |
| 821 | Ga0496104_0451451 | 3300048907 | Bacteria | 1197 |
| 822 | Ga0496105_0006281 | 3300048908 | Bacteria | 9125 |
| 823 | Ga0496105_0103975 | 3300048908 | Bacteria | 2345 |
| 824 | Ga0496105_0128391 | 3300048908 | Bacteria | 2090 |
| 825 | Ga0496105_0184888 | 3300048908 | Bacteria | 1705 |
| 826 | Ga0496105_0321252 | 3300048908 | Bacteria | 1241 |
| 827 | Ga0496106_0006066 | 3300048909 | Bacteria | 8944 |
| 828 | Ga0496106_0042498 | 3300048909 | Bacteria | 3409 |
| 829 | Ga0496106_0053524 | 3300048909 | Bacteria | 3048 |
| 830 | Ga0496106_0080438 | 3300048909 | Bacteria | 2502 |
| 831 | Ga0496107_0003174 | 3300048910 | Bacteria | 10928 |
| 832 | Ga0496107_0031467 | 3300048910 | Bacteria | 3787 |
| 833 | Ga0496107_0053179 | 3300048910 | Bacteria | 2921 |
| 834 | Ga0496107_0193468 | 3300048910 | Bacteria | 1511 |
| 835 | Ga0496107_0221521 | 3300048910 | Bacteria | 1407 |
| 836 | Ga0496107_0337107 | 3300048910 | Bacteria | 1122 |
| 837 | Ga0496108_0006052 | 3300048911 | Bacteria | 9791 |
| 838 | Ga0496108_0038993 | 3300048911 | Bacteria | 3960 |
| 839 | Ga0496108_0043035 | 3300048911 | Bacteria | 3771 |
| 840 | Ga0496108_0103805 | 3300048911 | Bacteria | 2425 |
| 841 | Ga0496108_0113621 | 3300048911 | Bacteria | 2317 |
| 842 | Ga0496108_0212236 | 3300048911 | Bacteria | 1681 |
| 843 | Ga0496109_0006654 | 3300048912 | Bacteria | 9730 |
| 844 | Ga0496109_0008201 | 3300048912 | Bacteria | 8863 |
| 845 | Ga0496109_0013562 | 3300048912 | Bacteria | 7076 |
| 846 | Ga0496109_0030701 | 3300048912 | Bacteria | 4817 |
| 847 | Ga0496109_0076567 | 3300048912 | Bacteria | 3077 |
| 848 | Ga0496109_0179219 | 3300048912 | Bacteria | 1990 |
| 849 | Ga0496110_0025973 | 3300048913 | Bacteria | 5007 |
| 850 | Ga0496110_0026118 | 3300048913 | Bacteria | 4994 |
| 851 | Ga0496110_0046934 | 3300048913 | Bacteria | 3780 |
| 852 | Ga0496110_0114351 | 3300048913 | Bacteria | 2428 |
| 853 | Ga0496110_0269457 | 3300048913 | Bacteria | 1550 |
| 854 | Ga0496111_0005390 | 3300048914 | Bacteria | 8187 |
| 855 | Ga0496111_0033297 | 3300048914 | Bacteria | 3675 |
| 856 | Ga0496111_0040973 | 3300048914 | Bacteria | 3322 |
| 857 | Ga0496111_0041513 | 3300048914 | Bacteria | 3301 |
| 858 | Ga0496111_0080316 | 3300048914 | Bacteria | 2379 |
| 859 | Ga0496112_0000004 | 3300048915 | Bacteria | 553294 |
| 860 | Ga0496112_0023658 | 3300048915 | Bacteria | 5874 |
| 861 | Ga0496112_0028755 | 3300048915 | Bacteria | 5369 |
| 862 | Ga0496112_0043941 | 3300048915 | Bacteria | 4375 |
| 863 | Ga0496112_0098122 | 3300048915 | Bacteria | 2899 |
| 864 | Ga0496112_0127710 | 3300048915 | Bacteria | 2513 |
| 865 | Ga0496112_0148010 | 3300048915 | Bacteria | 2316 |
| 866 | Ga0496112_0172581 | 3300048915 | Bacteria | 2127 |
| 867 | Ga0496112_0220185 | 3300048915 | Bacteria | 1854 |
| 868 | Ga0496113_0002762 | 3300048916 | Bacteria | 10321 |
| 869 | Ga0496113_0006342 | 3300048916 | Bacteria | 7482 |
| 870 | Ga0496113_0100320 | 3300048916 | Bacteria | 2243 |
| 871 | Ga0496113_0188936 | 3300048916 | Bacteria | 1635 |
| 872 | Ga0496113_0284106 | 3300048916 | Bacteria | 1323 |
| 873 | Ga0496114_0005021 | 3300048917 | Bacteria | 10319 |
| 874 | Ga0496114_0112639 | 3300048917 | Bacteria | 2332 |
| 875 | Ga0496115_0027336 | 3300048918 | Bacteria | 4460 |
| 876 | Ga0496115_0035893 | 3300048918 | Bacteria | 3924 |
| 877 | Ga0496115_0082053 | 3300048918 | Bacteria | 2626 |
| 878 | Ga0496115_0117908 | 3300048918 | Bacteria | 2183 |
| 879 | Ga0496115_0393293 | 3300048918 | Bacteria | 1125 |
| 880 | Ga0496117_0032569 | 3300048920 | Bacteria | 3958 |
| 881 | Ga0496118_0097639 | 3300048921 | Bacteria | 1998 |
| 882 | Ga0496119_0003438 | 3300048922 | Bacteria | 16444 |
| 883 | Ga0496119_0026329 | 3300048922 | Bacteria | 4035 |
| 884 | Ga0496121_0000458 | 3300048924 | Bacteria | 80207 |
| 885 | Ga0496122_0148270 | 3300048925 | Bacteria | 1454 |
| 886 | Ga0496124_0143143 | 3300048927 | Bacteria | 1884 |
| 887 | Ga0496125_0073574 | 3300048928 | Bacteria | 2656 |
| 888 | Ga0496125_0155943 | 3300048928 | Bacteria | 1560 |
| 889 | Ga0496125_0171824 | 3300048928 | Bacteria | 1456 |
| 890 | Ga0496126_0015313 | 3300048929 | Bacteria | 7717 |
| 891 | Ga0496126_0021658 | 3300048929 | Bacteria | 6274 |
| 892 | Ga0496126_0127629 | 3300048929 | Bacteria | 2200 |
| 893 | Ga0496126_0204102 | 3300048929 | Bacteria | 1667 |
| 894 | Ga0496126_0332205 | 3300048929 | Bacteria | 1247 |
| 895 | Ga0501031_0009952 | 3300049568 | Bacteria | 6191 |
| 896 | Ga0501031_0040419 | 3300049568 | Bacteria | 3045 |
| 897 | Ga0501031_0068246 | 3300049568 | Bacteria | 2316 |
| 898 | Ga0501031_0128196 | 3300049568 | Bacteria | 1657 |
| 899 | Ga0501032_0004443 | 3300049569 | Bacteria | 10572 |
| 900 | Ga0501032_0010442 | 3300049569 | Bacteria | 6697 |
| 901 | Ga0501032_0020767 | 3300049569 | Bacteria | 4571 |
| 902 | Ga0501032_0079846 | 3300049569 | Bacteria | 2177 |
| 903 | Ga0501033_0001387 | 3300049570 | Bacteria | 21551 |
| 904 | Ga0501033_0003747 | 3300049570 | Bacteria | 12358 |
| 905 | Ga0501033_0009064 | 3300049570 | Bacteria | 7677 |
| 906 | Ga0501033_0012028 | 3300049570 | Bacteria | 6608 |
| 907 | Ga0501033_0019522 | 3300049570 | Bacteria | 5125 |
| 908 | Ga0501033_0057808 | 3300049570 | Bacteria | 2865 |
| 909 | Ga0501034_0013177 | 3300049571 | Bacteria | 8516 |
| 910 | Ga0501034_0022766 | 3300049571 | Bacteria | 6382 |
| 911 | Ga0501034_0065325 | 3300049571 | Bacteria | 3650 |
| 912 | Ga0501034_0092593 | 3300049571 | Bacteria | 3019 |
| 913 | Ga0501036_0001303 | 3300049572 | Bacteria | 19110 |
| 914 | Ga0501036_0013017 | 3300049572 | Bacteria | 6906 |
| 915 | Ga0501036_0030450 | 3300049572 | Bacteria | 4558 |
| 916 | Ga0501036_0043307 | 3300049572 | Bacteria | 3811 |
| 917 | Ga0501036_0090229 | 3300049572 | Bacteria | 2589 |
| 918 | Ga0501036_0130597 | 3300049572 | Bacteria | 2121 |
| 919 | Ga0501037_0000328 | 3300049573 | Bacteria | 40237 |
| 920 | Ga0501037_0003605 | 3300049573 | Bacteria | 11225 |
| 921 | Ga0501037_0016589 | 3300049573 | Bacteria | 5420 |
| 922 | Ga0501037_0024107 | 3300049573 | Bacteria | 4499 |
| 923 | Ga0501037_0024368 | 3300049573 | Bacteria | 4475 |
| 924 | Ga0501038_0009112 | 3300049574 | Bacteria | 9107 |
| 925 | Ga0501038_0026430 | 3300049574 | Bacteria | 5170 |
| 926 | Ga0501038_0033611 | 3300049574 | Bacteria | 4517 |
| 927 | Ga0501038_0041501 | 3300049574 | Bacteria | 4012 |
| 928 | Ga0501038_0051184 | 3300049574 | Bacteria | 3566 |
| 929 | Ga0501038_0116784 | 3300049574 | Bacteria | 2204 |
| 930 | Ga0501038_0125102 | 3300049574 | Bacteria | 2117 |
| 931 | Ga0501038_0274756 | 3300049574 | Bacteria | 1328 |
| 932 | Ga0501039_0164667 | 3300049575 | Bacteria | 1743 |
| 933 | Ga0501041_0067417 | 3300049577 | Bacteria | 2194 |
| 934 | Ga0501042_0026243 | 3300049578 | Bacteria | 4095 |
| 935 | Ga0501042_0201419 | 3300049578 | Bacteria | 1435 |
| 936 | Ga0501042_0316559 | 3300049578 | Bacteria | 1127 |
| 937 | Ga0501043_0000377 | 3300049579 | Bacteria | 40484 |
| 938 | Ga0501043_0014338 | 3300049579 | Bacteria | 6203 |
| 939 | Ga0501043_0019625 | 3300049579 | Bacteria | 5306 |
| 940 | Ga0501043_0031985 | 3300049579 | Bacteria | 4135 |
| 941 | Ga0501043_0296519 | 3300049579 | Bacteria | 1237 |
| 942 | Ga0501046_0003241 | 3300049580 | Bacteria | 14957 |
| 943 | Ga0501046_0016244 | 3300049580 | Bacteria | 6241 |
| 944 | Ga0501046_0026473 | 3300049580 | Bacteria | 4738 |
| 945 | Ga0501046_0058330 | 3300049580 | Bacteria | 3026 |
| 946 | Ga0501047_0030661 | 3300049581 | Bacteria | 5183 |
| 947 | Ga0501047_0040563 | 3300049581 | Bacteria | 4502 |
| 948 | Ga0501047_0044503 | 3300049581 | Bacteria | 4289 |
| 949 | Ga0501047_0064418 | 3300049581 | Bacteria | 3535 |
| 950 | Ga0501047_0068132 | 3300049581 | Bacteria | 3428 |
| 951 | Ga0501047_0145285 | 3300049581 | Bacteria | 2249 |
| 952 | Ga0501047_0185442 | 3300049581 | Bacteria | 1946 |
| 953 | Ga0501048_0004184 | 3300049582 | Bacteria | 11002 |
| 954 | Ga0501048_0017935 | 3300049582 | Bacteria | 5208 |
| 955 | Ga0501048_0268106 | 3300049582 | Bacteria | 1213 |
| 956 | Ga0501067_0010554 | 3300049583 | Bacteria | 5114 |
| 957 | Ga0501067_0017640 | 3300049583 | Bacteria | 3951 |
| 958 | Ga0501067_0031337 | 3300049583 | Bacteria | 2950 |
| 959 | Ga0501068_0002507 | 3300049584 | Bacteria | 9752 |
| 960 | Ga0501068_0042908 | 3300049584 | Bacteria | 2720 |
| 961 | Ga0501068_0164250 | 3300049584 | Bacteria | 1400 |
| 962 | Ga0501068_0211376 | 3300049584 | Bacteria | 1232 |
| 963 | Ga0501069_0000100 | 3300049585 | Bacteria | 40506 |
| 964 | Ga0501069_0003145 | 3300049585 | Bacteria | 8461 |
| 965 | Ga0501069_0016117 | 3300049585 | Bacteria | 4009 |
| 966 | Ga0501069_0018526 | 3300049585 | Bacteria | 3758 |
| 967 | Ga0501070_0000229 | 3300049586 | Bacteria | 52795 |
| 968 | Ga0501070_0000714 | 3300049586 | Bacteria | 30358 |
| 969 | Ga0501070_0001806 | 3300049586 | Bacteria | 18882 |
| 970 | Ga0501070_0003195 | 3300049586 | Bacteria | 14252 |
| 971 | Ga0501070_0006026 | 3300049586 | Bacteria | 10326 |
| 972 | Ga0501070_0170533 | 3300049586 | Bacteria | 1792 |
| 973 | Ga0501070_0172101 | 3300049586 | Bacteria | 1783 |
| 974 | Ga0501071_0013118 | 3300049587 | Bacteria | 5640 |
| 975 | Ga0501071_0017405 | 3300049587 | Bacteria | 4955 |
| 976 | Ga0501071_0032588 | 3300049587 | Bacteria | 3701 |
| 977 | Ga0501072_0075492 | 3300049588 | Bacteria | 2666 |
| 978 | Ga0501073_0006658 | 3300049589 | Bacteria | 8605 |
| 979 | Ga0501073_0009289 | 3300049589 | Bacteria | 7253 |
| 980 | Ga0501073_0015968 | 3300049589 | Bacteria | 5442 |
| 981 | Ga0501073_0017729 | 3300049589 | Bacteria | 5154 |
| 982 | Ga0501073_0027212 | 3300049589 | Bacteria | 4092 |
| 983 | Ga0501073_0027631 | 3300049589 | Bacteria | 4057 |
| 984 | Ga0501073_0068983 | 3300049589 | Bacteria | 2464 |
| 985 | Ga0501074_0000113 | 3300049590 | Bacteria | 40297 |
| 986 | Ga0501074_0004959 | 3300049590 | Bacteria | 9538 |
| 987 | Ga0501074_0020303 | 3300049590 | Bacteria | 4828 |
| 988 | Ga0501074_0023766 | 3300049590 | Bacteria | 4455 |
| 989 | Ga0501074_0208311 | 3300049590 | Bacteria | 1393 |
| 990 | Ga0501076_0053637 | 3300049592 | Bacteria | 3195 |
| 991 | Ga0501076_0264551 | 3300049592 | Bacteria | 1408 |
| 992 | Ga0501079_0018785 | 3300049741 | Bacteria | 5281 |
| 993 | Ga0501079_0074734 | 3300049741 | Bacteria | 2620 |
| 994 | Ga0501079_0137031 | 3300049741 | Bacteria | 1906 |
| 995 | Ga0501079_0211695 | 3300049741 | Bacteria | 1514 |
| 996 | Ga0501080_0007250 | 3300049742 | Bacteria | 10004 |
| 997 | Ga0501080_0014802 | 3300049742 | Bacteria | 7183 |
| 998 | Ga0501080_0021648 | 3300049742 | Bacteria | 5953 |
| 999 | Ga0501080_0033198 | 3300049742 | Bacteria | 4817 |
| 1000 | Ga0501080_0047654 | 3300049742 | Bacteria | 3990 |
| 1001 | Ga0501080_0065528 | 3300049742 | Bacteria | 3378 |
| 1002 | Ga0501080_0190205 | 3300049742 | Bacteria | 1886 |
| 1003 | Ga0501080_0292969 | 3300049742 | Bacteria | 1477 |
| 1004 | Ga0501080_0361578 | 3300049742 | Bacteria | 1309 |
| 1005 | Ga0501081_0162792 | 3300049743 | Bacteria | 1608 |
| 1006 | Ga0501081_0244361 | 3300049743 | Bacteria | 1309 |
| 1007 | Ga0501081_0380641 | 3300049743 | Bacteria | 1043 |
| 1008 | Ga0501083_0000529 | 3300049744 | Bacteria | 24371 |
| 1009 | Ga0501083_0036835 | 3300049744 | Bacteria | 3334 |
| 1010 | Ga0501083_0066225 | 3300049744 | Bacteria | 2406 |
| 1011 | Ga0501083_0091983 | 3300049744 | Bacteria | 2002 |
| 1012 | Ga0501035_0000373 | 3300049822 | Bacteria | 51518 |
| 1013 | Ga0501035_0000580 | 3300049822 | Bacteria | 40294 |
| 1014 | Ga0501035_0003027 | 3300049822 | Bacteria | 16113 |
| 1015 | Ga0501035_0010765 | 3300049822 | Bacteria | 8469 |
| 1016 | Ga0501035_0034886 | 3300049822 | Bacteria | 4569 |
| 1017 | Ga0501035_0307857 | 3300049822 | Bacteria | 1333 |
| 1018 | Ga0501044_0000494 | 3300049823 | Bacteria | 47857 |
| 1019 | Ga0501044_0012523 | 3300049823 | Bacteria | 9186 |
| 1020 | Ga0501044_0013031 | 3300049823 | Bacteria | 8998 |
| 1021 | Ga0501044_0024835 | 3300049823 | Bacteria | 6357 |
| 1022 | Ga0501044_0031713 | 3300049823 | Bacteria | 5559 |
| 1023 | Ga0501044_0032277 | 3300049823 | Bacteria | 5506 |
| 1024 | Ga0501044_0034815 | 3300049823 | Bacteria | 5279 |
| 1025 | Ga0501044_0125363 | 3300049823 | Bacteria | 2566 |
| 1026 | nmdc:mga00v17_8336_c1 | 3300050491 | Bacteria | 5576 |
| 1027 | nmdc:mga0yw44_28739_c1 | 3300050492 | Bacteria | 3203 |
| 1028 | nmdc:mga0yw44_40792_c1 | 3300050492 | Bacteria | 2760 |
| 1029 | nmdc:mga0k408_71829_c1 | 3300050493 | Bacteria | 2020 |
| 1030 | nmdc:mga05p37_30291_c1 | 3300050507 | Bacteria | 6602 |
| 1031 | nmdc:mga05p37_32_c1 | 3300050507 | Bacteria | 112982 |
| 1032 | nmdc:mga09592_6535_c1 | 3300050508 | Bacteria | 9497 |
| 1033 | nmdc:mga0qj67_355_c1 | 3300050509 | Bacteria | 31660 |
| 1034 | nmdc:mga06r32_5297_c1 | 3300050510 | Bacteria | 11609 |
| 1035 | nmdc:mga08y16_175108_c1 | 3300050511 | Bacteria | 2228 |
| 1036 | nmdc:mga08y16_2238_c1 | 3300050511 | Bacteria | 19836 |
| 1037 | nmdc:mga08y16_6098_c1 | 3300050511 | Bacteria | 12643 |
| 1038 | nmdc:mga0n895_101316_c1 | 3300050512 | Bacteria | 2890 |
| 1039 | nmdc:mga0n895_40463_c1 | 3300050512 | Bacteria | 4527 |
| 1040 | nmdc:mga0n895_442378_c1 | 3300050512 | Bacteria | 1313 |
| 1041 | nmdc:mga0n895_452920_c1 | 3300050512 | Bacteria | 1295 |
| 1042 | nmdc:mga0n895_547_c1 | 3300050512 | Bacteria | 25755 |
| 1043 | nmdc:mga0n895_67573_c1 | 3300050512 | Bacteria | 3540 |
| 1044 | nmdc:mga0n895_8451_c1 | 3300050512 | Bacteria | 8914 |
| 1045 | nmdc:mga0rr50_2161_c1 | 3300050513 | Bacteria | 10994 |
| 1046 | nmdc:mga0rr50_237205_c1 | 3300050513 | Bacteria | 1511 |
| 1047 | nmdc:mga0rr50_24109_c1 | 3300050513 | Bacteria | 4209 |
| 1048 | nmdc:mga0rr50_51016_c1 | 3300050513 | Bacteria | 3068 |
| 1049 | nmdc:mga08x19_143264_c1 | 3300050514 | Bacteria | 1615 |
| 1050 | nmdc:mga08x19_6_c1 | 3300050514 | Bacteria | 405679 |
| 1051 | nmdc:mga08x19_91285_c1 | 3300050514 | Bacteria | 2010 |
| 1052 | nmdc:mga0a205_19845_c1 | 3300050515 | Bacteria | 6342 |
| 1053 | nmdc:mga0a205_278960_c1 | 3300050515 | Bacteria | 1547 |
| 1054 | nmdc:mga0a205_629_c1 | 3300050515 | Bacteria | 28029 |
| 1055 | Ga0495601_0004297 | 3300053077 | Bacteria | 8228 |
| 1056 | Ga0495601_0004847 | 3300053077 | Bacteria | 7804 |
| 1057 | Ga0495601_0005893 | 3300053077 | Bacteria | 7146 |
| 1058 | Ga0495601_0007409 | 3300053077 | Bacteria | 6430 |
| 1059 | Ga0495601_0008232 | 3300053077 | Bacteria | 6151 |
| 1060 | Ga0495612_0005828 | 3300053078 | Bacteria | 5088 |
| 1061 | Ga0500635_0000553 | 3300053080 | Bacteria | 9959 |
| 1062 | Ga0495595_0002810 | 3300053084 | Bacteria | 6850 |
| 1063 | Ga0495595_0003138 | 3300053084 | Bacteria | 6551 |
| 1064 | Ga0495595_0003361 | 3300053084 | Bacteria | 6352 |
| 1065 | Ga0495595_0004354 | 3300053084 | Bacteria | 5697 |
| 1066 | Ga0495595_0046712 | 3300053084 | Bacteria | 1996 |
| 1067 | Ga0495619_0000016 | 3300053085 | Bacteria | 231442 |
| 1068 | Ga0495619_0002830 | 3300053085 | Bacteria | 11300 |
| 1069 | Ga0495619_0006052 | 3300053085 | Bacteria | 7664 |
| 1070 | Ga0495619_0010377 | 3300053085 | Bacteria | 5863 |
| 1071 | Ga0495619_0030196 | 3300053085 | Bacteria | 3507 |
| 1072 | Ga0495619_0045414 | 3300053085 | Bacteria | 2886 |
| 1073 | Ga0495619_0138516 | 3300053085 | Bacteria | 1674 |
| 1074 | Ga0495619_0149951 | 3300053085 | Bacteria | 1608 |
| 1075 | Ga0500566_0131967 | 3300053094 | Bacteria | 1335 |
| 1076 | Ga0500640_024696 | 3300053095 | Bacteria | 2612 |
| 1077 | Ga0500595_023055 | 3300053119 | Bacteria | 2192 |
| 1078 | Ga0500607_067427 | 3300053121 | Bacteria | 1854 |
| 1079 | Ga0500652_096804 | 3300053131 | Bacteria | 1233 |
| 1080 | Ga0500568_0000682 | 3300053139 | Bacteria | 24448 |
| 1081 | Ga0500568_0008676 | 3300053139 | Bacteria | 4878 |
| 1082 | Ga0500568_0073721 | 3300053139 | Bacteria | 1303 |
| 1083 | Ga0500603_001483 | 3300053150 | Bacteria | 5353 |
| 1084 | Ga0500604_0019357 | 3300053151 | Bacteria | 1906 |
| 1085 | Ga0500637_0099587 | 3300053178 | Bacteria | 1685 |
| 1086 | Ga0500609_000759 | 3300053731 | Bacteria | 4841 |
| 1087 | Ga0500609_013616 | 3300053731 | Bacteria | 1101 |
| 1088 | Ga0501084_0013177 | 3300054114 | Bacteria | 6840 |
| 1089 | Ga0501082_0005362 | 3300060353 | Bacteria | 11126 |
| 1090 | Ga0501082_0009755 | 3300060353 | Bacteria | 8272 |
| 1091 | Ga0501082_0023892 | 3300060353 | Bacteria | 5270 |
| 1092 | Ga0501082_0094555 | 3300060353 | Bacteria | 2583 |
| 1093 | Ga0501082_0229824 | 3300060353 | Bacteria | 1614 |
| 1094 | Ga0501082_0302275 | 3300060353 | Bacteria | 1393 |
| 1095 | Ga0466962_0015456 | 3300061719 | Bacteria | 3679 |
| 1096 | Ga0530510_0297590 | 3300061734 | Bacteria | 1207 |
| 1097 | 2508729138 | 2508501050 | Bacteria | 9633614 |
| 1098 | 2509078049 | 2508501114 | Bacteria | 7082538 |
| 1099 | 2511394988 | 2511231028 | Bacteria | 8046582 |
| 1100 | 2528848582 | 2528768022 | Bacteria | 10457665 |
| 1101 | 2644494869 | 2643221688 | Bacteria | 5260751 |
| 1102 | 2644498255 | 2643221689 | Bacteria | 6042950 |
| 1103 | 2824775347 | 2824773399 | Bacteria | 8360218 |
| 1104 | 2835312799 | 2835312727 | Bacteria | 7413381 |
| 1105 | 2879104573 | 2879099564 | Bacteria | 10442239 |
| 1106 | 2885369174 | 2885366525 | Bacteria | 8326213 |
| 1107 | 2904570923 | 2904564687 | Bacteria | 7609577 |
| 1108 | 2904578123 | 2904571731 | Bacteria | 7608790 |
| 1109 | 2928543017 | 2928536128 | Bacteria | 7657547 |
| 1110 | 2932817385 | 2932809354 | Bacteria | 9135765 |
| 1111 | 2932826154 | 2932818245 | Bacteria | 9955613 |
| 1112 | 2935765185 | 2935760218 | Bacteria | 9817913 |
| 1113 | 2935960691 | 2935959822 | Bacteria | 7869783 |
| 1114 | 8020943355 | 8020938398 | Bacteria | 7472757 |
| 1115 | 8020954546 | 8020953355 | Bacteria | 7439080 |
| 1116 | Ga0436364_0684151 | |||
| 1117 | ARcpr5oldR_c000046 | |||
| 1118 | ARSoilYngRDRAFT_c00078 | |||
| 1119 | ARcpr5yngRDRAFT_c000072 | |||
| 1120 | ARSoilOldRDRAFT_c000019 | |||
| 1121 | ARCol0oldRDRAFT_c00019 | |||
| 1122 | ARCol0yngRDRAFT_1000004 | |||
| 1123 | JGI24739J22299_10001890 | |||
| 1124 | JGI24737J22298_10000207 | |||
| 1125 | JGI24737J22298_10001119 | |||
| 1126 | JGI24750J21931_1001369 | |||
| 1127 | JGI24745J21846_1001822 | |||
| 1128 | JGI24748J21848_1000218 | |||
| 1129 | JGI24738J21930_10000029 | |||
| 1130 | JGI24749J21850_1001190 | |||
| 1131 | JGI24744J21845_10001741 | |||
| 1132 | JGI24742J22300_10002072 | |||
| 1133 | JGI25406J46586_10000093 | |||
| 1134 | JGI25153J46596_10002951 | |||
| 1135 | JGI25153J46596_10003480 | |||
| 1136 | JGI25153J46596_10013314 | |||
| 1137 | Ga0055526_1000427 | |||
| 1138 | Ga0055524_1001121 | |||
| 1139 | Ga0055530_10003423 | |||
| 1140 | Ga0055531_10028919 | |||
| 1141 | JGI25405J52794_10006708 | |||
| 1142 | Ga0065165_1010588 | |||
| 1143 | Ga0065712_10001614 | |||
| 1144 | Ga0065712_10081440 | |||
| 1145 | Ga0065715_10001152 | |||
| 1146 | Ga0065715_10104947 | |||
| 1147 | Ga0065707_10101857 | |||
| 1148 | Ga0070676_10001460 | |||
| 1149 | Ga0070676_10026353 | |||
| 1150 | Ga0070683_100087289 | |||
| 1151 | Ga0070683_100100186 | |||
| 1152 | Ga0070690_100004467 | |||
| 1153 | Ga0070690_100021035 | |||
| 1154 | Ga0070670_100054629 | |||
| 1155 | Ga0070670_100063259 | |||
| 1156 | Ga0070670_100132432 | |||
| 1157 | Ga0070677_10000429 | |||
| 1158 | Ga0068869_100000687 | |||
| 1159 | Ga0068869_100085936 | |||
| 1160 | Ga0068869_100268560 | |||
| 1161 | Ga0068869_100381291 | |||
| 1162 | Ga0070666_10060082 | |||
| 1163 | Ga0070680_100027252 | |||
| 1164 | Ga0070680_100077923 | |||
| 1165 | Ga0070680_100246084 | |||
| 1166 | Ga0070682_100000995 | |||
| 1167 | Ga0070682_100003787 | |||
| 1168 | Ga0070682_100065437 | |||
| 1169 | Ga0070682_100136920 | |||
| 1170 | Ga0068868_100058156 | |||
| 1171 | Ga0068868_100254238 | |||
| 1172 | Ga0070660_100006096 | |||
| 1173 | Ga0070660_100083714 | |||
| 1174 | Ga0070660_100091470 | |||
| 1175 | Ga0070689_100016831 | |||
| 1176 | Ga0070689_100065316 | |||
| 1177 | Ga0070691_10001450 | |||
| 1178 | Ga0070687_100010183 | |||
| 1179 | Ga0070687_100025480 | |||
| 1180 | Ga0070661_100075460 | |||
| 1181 | Ga0070692_10001330 | |||
| 1182 | Ga0070692_10032664 | |||
| 1183 | Ga0070668_100052491 | |||
| 1184 | Ga0070668_100214941 | |||
| 1185 | Ga0070669_100032918 | |||
| 1186 | Ga0070669_100062781 | |||
| 1187 | Ga0070675_100000240 | |||
| 1188 | Ga0070675_100070918 | |||
| 1189 | Ga0070671_100027986 | |||
| 1190 | Ga0070671_100196451 | |||
| 1191 | Ga0070671_100278529 | |||
| 1192 | Ga0070674_100002264 | |||
| 1193 | Ga0070673_100019462 | |||
| 1194 | Ga0070673_100134704 | |||
| 1195 | Ga0070688_100016686 | |||
| 1196 | Ga0070688_100041792 | |||
| 1197 | Ga0070659_100009275 | |||
| 1198 | Ga0070659_100033735 | |||
| 1199 | Ga0070659_100064249 | |||
| 1200 | Ga0070667_100015593 | |||
| 1201 | Ga0070667_100066927 | |||
| 1202 | Ga0070667_100088578 | |||
| 1203 | Ga0070709_10237690 | |||
| 1204 | Ga0070714_100093931 | |||
| 1205 | Ga0070713_100008105 | |||
| 1206 | Ga0070713_100017182 | |||
| 1207 | Ga0070713_100034300 | |||
| 1208 | Ga0070713_100041015 | |||
| 1209 | Ga0070713_100142923 | |||
| 1210 | Ga0070710_10006165 | |||
| 1211 | Ga0070710_10016385 | |||
| 1212 | Ga0070701_10000039 | |||
| 1213 | Ga0070711_100016158 | |||
| 1214 | Ga0070711_100022759 | |||
| 1215 | Ga0070705_100000768 | |||
| 1216 | Ga0070705_100102717 | |||
| 1217 | Ga0070700_100000735 | |||
| 1218 | Ga0070694_100005074 | |||
| 1219 | Ga0070694_100023281 | |||
| 1220 | Ga0070708_100011083 | |||
| 1221 | Ga0070708_100327900 | |||
| 1222 | Ga0070663_100057916 | |||
| 1223 | Ga0070663_100065616 | |||
| 1224 | Ga0070678_100000998 | |||
| 1225 | Ga0070678_100013593 | |||
| 1226 | Ga0070678_100031955 | |||
| 1227 | Ga0070662_100060345 | |||
| 1228 | Ga0070662_100061564 | |||
| 1229 | Ga0070681_10002988 | |||
| 1230 | Ga0070681_10009201 | |||
| 1231 | Ga0070681_10019515 | |||
| 1232 | Ga0070681_10019918 | |||
| 1233 | Ga0070681_10064905 | |||
| 1234 | Ga0070681_10143822 | |||
| 1235 | Ga0070681_10280825 | |||
| 1236 | Ga0068867_100008309 | |||
| 1237 | Ga0070685_10016125 | |||
| 1238 | Ga0070685_10040878 | |||
| 1239 | Ga0070707_100004536 | |||
| 1240 | Ga0070698_100079951 | |||
| 1241 | Ga0070679_100001814 | |||
| 1242 | Ga0070679_100010765 | |||
| 1243 | Ga0070679_100011317 | |||
| 1244 | Ga0070679_100016730 | |||
| 1245 | Ga0070679_100049458 | |||
| 1246 | Ga0070679_100086604 | |||
| 1247 | Ga0070679_100441582 | |||
| 1248 | Ga0070684_100006735 | |||
| 1249 | Ga0070684_100178396 | |||
| 1250 | Ga0070697_100030782 | |||
| 1251 | Ga0070697_100038587 | |||
| 1252 | Ga0070697_100047284 | |||
| 1253 | Ga0070697_100204273 | |||
| 1254 | Ga0068853_100000437 | |||
| 1255 | Ga0068853_100031350 | |||
| 1256 | Ga0070672_100001847 | |||
| 1257 | Ga0070686_100003301 | |||
| 1258 | Ga0070686_100019694 | |||
| 1259 | Ga0070695_100003423 | |||
| 1260 | Ga0070695_100021124 | |||
| 1261 | Ga0070696_100019038 | |||
| 1262 | Ga0070696_100072002 | |||
| 1263 | Ga0070696_100341126 | |||
| 1264 | Ga0070693_100003347 | |||
| 1265 | Ga0070693_100078512 | |||
| 1266 | Ga0070693_100096188 | |||
| 1267 | Ga0070665_100400073 | |||
| 1268 | Ga0070704_100013544 | |||
| 1269 | Ga0070704_100073537 | |||
| 1270 | Ga0070704_100201039 | |||
| 1271 | Ga0068855_100002138 | |||
| 1272 | Ga0068855_100023725 | |||
| 1273 | Ga0068855_100046002 | |||
| 1274 | Ga0070664_100001002 | |||
| 1275 | Ga0068857_100008801 | |||
| 1276 | Ga0068857_100255119 | |||
| 1277 | Ga0068854_100001976 | |||
| 1278 | Ga0068854_100089710 | |||
| 1279 | Ga0068856_100005280 | |||
| 1280 | Ga0068856_100143713 | |||
| 1281 | Ga0070702_100002858 | |||
| 1282 | Ga0068859_100018024 | |||
| 1283 | Ga0068859_100119803 | |||
| 1284 | Ga0068864_100006180 | |||
| 1285 | Ga0068866_10011870 | |||
| 1286 | Ga0068861_100000248 | |||
| 1287 | Ga0068870_10000157 | |||
| 1288 | Ga0068863_100000674 | |||
| 1289 | Ga0068863_100323821 | |||
| 1290 | Ga0068863_100390688 | |||
| 1291 | Ga0068858_100054434 | |||
| 1292 | Ga0068858_100072251 | |||
| 1293 | Ga0068860_100011546 | |||
| 1294 | Ga0068860_100050047 | |||
| 1295 | Ga0068860_100072707 | |||
| 1296 | Ga0068862_100040120 | |||
| 1297 | Ga0081455_10000059 | |||
| 1298 | Ga0081455_10002427 | |||
| 1299 | Ga0081455_10242350 | |||
| 1300 | Ga0081538_10049508 | |||
| 1301 | Ga0081540_1008452 | |||
| 1302 | Ga0081539_10000140 | |||
| 1303 | Ga0081539_10046544 | |||
| 1304 | Ga0070717_10000161 | |||
| 1305 | Ga0070717_10012075 | |||
| 1306 | Ga0070717_10045154 | |||
| 1307 | Ga0075365_10003405 | |||
| 1308 | Ga0075368_10001688 | |||
| 1309 | Ga0075363_100013917 | |||
| 1310 | Ga0075364_10009796 | |||
| 1311 | Ga0075432_10010678 | |||
| 1312 | Ga0070715_10002352 | |||
| 1313 | Ga0070716_100026605 | |||
| 1314 | Ga0070716_100259043 | |||
| 1315 | Ga0070712_100006221 | |||
| 1316 | Ga0070712_100123444 | |||
| 1317 | Ga0075367_10074959 | |||
| 1318 | Ga0075369_10041306 | |||
| 1319 | Ga0075427_10000100 | |||
| 1320 | Ga0075366_10087695 | |||
| 1321 | Ga0097621_100001613 | |||
| 1322 | Ga0068871_100001066 | |||
| 1323 | Ga0075430_100000070 | |||
| 1324 | Ga0075431_100001221 | |||
| 1325 | Ga0075433_10006220 | |||
| 1326 | Ga0075433_10110695 | |||
| 1327 | Ga0075433_10124808 | |||
| 1328 | Ga0075434_100000212 | |||
| 1329 | Ga0075434_100027125 | |||
| 1330 | Ga0075434_100157948 | |||
| 1331 | Ga0075434_100216040 | |||
| 1332 | Ga0075429_100003999 | |||
| 1333 | Ga0068865_100000131 | |||
| 1334 | Ga0075436_100001731 | |||
| 1335 | Ga0075436_100034998 | |||
| 1336 | Ga0075436_100070908 | |||
| 1337 | Ga0097620_100018022 | |||
| 1338 | Ga0097620_100119802 | |||
| 1339 | Ga0075435_100015735 | |||
| 1340 | Ga0075435_100049577 | |||
| 1341 | Ga0075435_100109551 | |||
| 1342 | Ga0075435_100268392 | |||
| 1343 | Ga0099794_10006018 | |||
| 1344 | Ga0105244_10017643 | |||
| 1345 | Ga0105240_10000411 | |||
| 1346 | Ga0105240_10003526 | |||
| 1347 | Ga0105240_10011914 | |||
| 1348 | Ga0105240_10191619 | |||
| 1349 | Ga0111539_10000138 | |||
| 1350 | Ga0111539_10000684 | |||
| 1351 | Ga0111539_10005247 | |||
| 1352 | Ga0111539_10028103 | |||
| 1353 | Ga0111539_10232912 | |||
| 1354 | Ga0105245_10003161 | |||
| 1355 | Ga0105245_10005778 | |||
| 1356 | Ga0105245_10167920 | |||
| 1357 | Ga0105245_10297231 | |||
| 1358 | Ga0105247_10005112 | |||
| 1359 | Ga0105247_10034021 | |||
| 1360 | Ga0105247_10056044 | |||
| 1361 | Ga0105247_10111516 | |||
| 1362 | Ga0105247_10159395 | |||
| 1363 | Ga0114129_10002312 | |||
| 1364 | Ga0114129_10058044 | |||
| 1365 | Ga0114129_10482426 | |||
| 1366 | Ga0105243_10071183 | |||
| 1367 | Ga0105243_10073860 | |||
| 1368 | Ga0105241_10069318 | |||
| 1369 | Ga0105241_10075502 | |||
| 1370 | Ga0105241_10405603 | |||
| 1371 | Ga0105242_10021762 | |||
| 1372 | Ga0105242_10215419 | |||
| 1373 | Ga0105248_10051300 | |||
| 1374 | Ga0105248_10103407 | |||
| 1375 | Ga0105248_10117464 | |||
| 1376 | Ga0105237_10016490 | |||
| 1377 | Ga0105237_10079338 | |||
| 1378 | Ga0105237_10087884 | |||
| 1379 | Ga0105238_10002477 | |||
| 1380 | Ga0105238_10058977 | |||
| 1381 | Ga0105238_10257445 | |||
| 1382 | Ga0105249_10000711 | |||
| 1383 | Ga0105249_10005299 | |||
| 1384 | Ga0105249_10021879 | |||
| 1385 | Ga0105249_10073357 | |||
| 1386 | Ga0105239_10021637 | |||
| 1387 | Ga0105239_10173107 | |||
| 1388 | Ga0105239_10417110 | |||
| 1389 | Ga0105246_10002665 | |||
| 1390 | Ga0105246_10117875 | |||
| 1391 | Ga0105246_10209764 | |||
| 1392 | Ga0105246_10273185 | |||
| 1393 | Ga0157373_10011307 | |||
| 1394 | Ga0157373_10020584 | |||
| 1395 | Ga0157371_10057880 | |||
| 1396 | Ga0157370_10003496 | |||
| 1397 | Ga0157370_10065204 | |||
| 1398 | Ga0157370_10589985 | |||
| 1399 | Ga0157369_10004403 | |||
| 1400 | Ga0157369_10018324 | |||
| 1401 | Ga0157374_10000671 | |||
| 1402 | Ga0157374_10032272 | |||
| 1403 | Ga0157374_10084810 | |||
| 1404 | Ga0157374_10205183 | |||
| 1405 | Ga0157378_10126975 | |||
| 1406 | Ga0157378_10175656 | |||
| 1407 | Ga0157378_10348032 | |||
| 1408 | Ga0163162_10003419 | |||
| 1409 | Ga0163162_10137663 | |||
| 1410 | Ga0163162_10197380 | |||
| 1411 | Ga0157372_10105543 | |||
| 1412 | Ga0157375_10009189 | |||
| 1413 | Ga0157375_10017721 | |||
| 1414 | Ga0157375_10138520 | |||
| 1415 | Ga0163163_10004312 | |||
| 1416 | Ga0163163_10029813 | |||
| 1417 | Ga0157380_10000678 | |||
| 1418 | Ga0157380_10532272 | |||
| 1419 | Ga0157377_10000570 | |||
| 1420 | Ga0157377_10056043 | |||
| 1421 | Ga0157377_10191287 | |||
| 1422 | Ga0157379_10000345 | |||
| 1423 | Ga0157379_10042501 | |||
| 1424 | Ga0157379_10061412 | |||
| 1425 | Ga0157379_10311399 | |||
| 1426 | Ga0157379_10414874 | |||
| 1427 | Ga0157376_10003644 | |||
| 1428 | Ga0163161_10004669 | |||
| 1429 | Ga0213872_10015714 | |||
| 1430 | Ga0213872_10100322 | |||
| 1431 | Ga0213874_10004551 | |||
| 1432 | Ga0213876_10001266 | |||
| 1433 | Ga0209677_106740 | |||
| 1434 | Ga0209148_1011843 | |||
| 1435 | Ga0207666_1000069 | |||
| 1436 | Ga0207666_1001537 | |||
| 1437 | Ga0207673_1000145 | |||
| 1438 | Ga0209675_1000307 | |||
| 1439 | Ga0209025_1024894 | |||
| 1440 | Ga0209564_1000015 | |||
| 1441 | Ga0209564_1000031 | |||
| 1442 | Ga0209564_1025935 | |||
| 1443 | Ga0209758_1000140 | |||
| 1444 | Ga0209758_1000232 | |||
| 1445 | Ga0209758_1000925 | |||
| 1446 | Ga0209758_1002072 | |||
| 1447 | Ga0209758_1007360 | |||
| 1448 | Ga0209256_1000205 | |||
| 1449 | Ga0209256_1004348 | |||
| 1450 | Ga0209256_1007690 | |||
| 1451 | Ga0207426_1000434 | |||
| 1452 | Ga0207426_1058688 | |||
| 1453 | Ga0209257_1001932 | |||
| 1454 | Ga0207697_10019122 | |||
| 1455 | Ga0207653_10016912 | |||
| 1456 | Ga0207682_10000048 | |||
| 1457 | Ga0207692_10008259 | |||
| 1458 | Ga0207642_10000783 | |||
| 1459 | Ga0207710_10037372 | |||
| 1460 | Ga0207688_10001496 | |||
| 1461 | Ga0207688_10040016 | |||
| 1462 | Ga0207680_10021980 | |||
| 1463 | Ga0207647_10007263 | |||
| 1464 | Ga0207647_10008534 | |||
| 1465 | Ga0207647_10012181 | |||
| 1466 | Ga0207699_10000944 | |||
| 1467 | Ga0207699_10067828 | |||
| 1468 | Ga0207699_10169314 | |||
| 1469 | Ga0207645_10003506 | |||
| 1470 | Ga0207645_10063042 | |||
| 1471 | Ga0207645_10156185 | |||
| 1472 | Ga0207643_10001399 | |||
| 1473 | Ga0207684_10064509 | |||
| 1474 | Ga0207654_10003198 | |||
| 1475 | Ga0207654_10215549 | |||
| 1476 | Ga0207707_10000119 | |||
| 1477 | Ga0207707_10001610 | |||
| 1478 | Ga0207707_10018809 | |||
| 1479 | Ga0207707_10020384 | |||
| 1480 | Ga0207707_10023721 | |||
| 1481 | Ga0207707_10023741 | |||
| 1482 | Ga0207707_10036943 | |||
| 1483 | Ga0207707_10037232 | |||
| 1484 | Ga0207707_10226637 | |||
| 1485 | Ga0207695_10004562 | |||
| 1486 | Ga0207695_10064793 | |||
| 1487 | Ga0207695_10144499 | |||
| 1488 | Ga0207695_10152593 | |||
| 1489 | Ga0207695_10280138 | |||
| 1490 | Ga0207671_10115222 | |||
| 1491 | Ga0207671_10206742 | |||
| 1492 | Ga0207693_10002467 | |||
| 1493 | Ga0207663_10011512 | |||
| 1494 | Ga0207663_10063336 | |||
| 1495 | Ga0207663_10119530 | |||
| 1496 | Ga0207660_10000104 | |||
| 1497 | Ga0207660_10004090 | |||
| 1498 | Ga0207660_10103776 | |||
| 1499 | Ga0207660_10107364 | |||
| 1500 | Ga0207660_10201056 | |||
| 1501 | Ga0207660_10229653 | |||
| 1502 | Ga0207660_10389475 | |||
| 1503 | Ga0207662_10003087 | |||
| 1504 | Ga0207662_10004464 | |||
| 1505 | Ga0207657_10003518 | |||
| 1506 | Ga0207657_10088833 | |||
| 1507 | Ga0207657_10094095 | |||
| 1508 | Ga0207649_10000141 | |||
| 1509 | Ga0207649_10123937 | |||
| 1510 | Ga0207652_10000515 | |||
| 1511 | Ga0207652_10001526 | |||
| 1512 | Ga0207652_10142877 | |||
| 1513 | Ga0207652_10210755 | |||
| 1514 | Ga0207646_10011053 | |||
| 1515 | Ga0207681_10000359 | |||
| 1516 | Ga0207681_10166082 | |||
| 1517 | Ga0207694_10122911 | |||
| 1518 | Ga0207694_10201258 | |||
| 1519 | Ga0207650_10032317 | |||
| 1520 | Ga0207659_10000052 | |||
| 1521 | Ga0207659_10243311 | |||
| 1522 | Ga0207687_10000097 | |||
| 1523 | Ga0207687_10010954 | |||
| 1524 | Ga0207687_10188765 | |||
| 1525 | Ga0207700_10000673 | |||
| 1526 | Ga0207700_10008693 | |||
| 1527 | Ga0207700_10057884 | |||
| 1528 | Ga0207700_10250010 | |||
| 1529 | Ga0207664_10010534 | |||
| 1530 | Ga0207664_10107677 | |||
| 1531 | Ga0207644_10002956 | |||
| 1532 | Ga0207690_10000278 | |||
| 1533 | Ga0207690_10018178 | |||
| 1534 | Ga0207706_10078650 | |||
| 1535 | Ga0207706_10083323 | |||
| 1536 | Ga0207706_10088290 | |||
| 1537 | Ga0207686_10000850 | |||
| 1538 | Ga0207686_10045453 | |||
| 1539 | Ga0207709_10000349 | |||
| 1540 | Ga0207709_10041427 | |||
| 1541 | Ga0207670_10000781 | |||
| 1542 | Ga0207670_10061577 | |||
| 1543 | Ga0207669_10000168 | |||
| 1544 | Ga0207704_10000704 | |||
| 1545 | Ga0207665_10000248 | |||
| 1546 | Ga0207665_10074153 | |||
| 1547 | Ga0207691_10003348 | |||
| 1548 | Ga0207691_10142573 | |||
| 1549 | Ga0207711_10003359 | |||
| 1550 | Ga0207689_10005416 | |||
| 1551 | Ga0207689_10045015 | |||
| 1552 | Ga0207661_10000143 | |||
| 1553 | Ga0207661_10186597 | |||
| 1554 | Ga0207679_10000035 | |||
| 1555 | Ga0207679_10011268 | |||
| 1556 | Ga0207667_10001570 | |||
| 1557 | Ga0207667_10046224 | |||
| 1558 | Ga0207667_10049164 | |||
| 1559 | Ga0207651_10000080 | |||
| 1560 | Ga0207712_10001127 | |||
| 1561 | Ga0207712_10092379 | |||
| 1562 | Ga0207712_10330591 | |||
| 1563 | Ga0207668_10005342 | |||
| 1564 | Ga0207668_10071444 | |||
| 1565 | Ga0207668_10085490 | |||
| 1566 | Ga0207640_10001402 | |||
| 1567 | Ga0207640_10098875 | |||
| 1568 | Ga0207640_10257024 | |||
| 1569 | Ga0207658_10032065 | |||
| 1570 | Ga0207658_10217197 | |||
| 1571 | Ga0207677_10000614 | |||
| 1572 | Ga0207677_10335320 | |||
| 1573 | Ga0207703_10030485 | |||
| 1574 | Ga0207703_10125493 | |||
| 1575 | Ga0207703_10151412 | |||
| 1576 | Ga0207639_10021338 | |||
| 1577 | Ga0207678_10038552 | |||
| 1578 | Ga0207678_10079023 | |||
| 1579 | Ga0207678_10082729 | |||
| 1580 | Ga0207678_10082730 | |||
| 1581 | Ga0207708_10001353 | |||
| 1582 | Ga0207708_10007477 | |||
| 1583 | Ga0207702_10001956 | |||
| 1584 | Ga0207702_10060712 | |||
| 1585 | Ga0207702_10116988 | |||
| 1586 | Ga0207702_10218473 | |||
| 1587 | Ga0207641_10084479 | |||
| 1588 | Ga0207641_10102400 | |||
| 1589 | Ga0207648_10013365 | |||
| 1590 | Ga0207648_10143291 | |||
| 1591 | Ga0207676_10001840 | |||
| 1592 | Ga0207674_10008438 | |||
| 1593 | Ga0207674_10043305 | |||
| 1594 | Ga0207674_10149204 | |||
| 1595 | Ga0207674_10193479 | |||
| 1596 | Ga0207674_10247416 | |||
| 1597 | Ga0207674_10328044 | |||
| 1598 | Ga0207675_100002948 | |||
| 1599 | Ga0207675_100012197 | |||
| 1600 | Ga0207675_100028974 | |||
| 1601 | Ga0207683_10002096 | |||
| 1602 | Ga0207683_10003030 | |||
| 1603 | Ga0207683_10100175 | |||
| 1604 | Ga0207698_10008006 | |||
| 1605 | Ga0209971_1004128 | |||
| 1606 | Ga0209966_1001601 | |||
| 1607 | Ga0209998_10005225 | |||
| 1608 | Ga0209998_10006493 | |||
| 1609 | Ga0209998_10031253 | |||
| 1610 | Ga0209974_10008734 | |||
| 1611 | Ga0209974_10068970 | |||
| 1612 | Ga0207428_10000075 | |||
| 1613 | Ga0207428_10000428 | |||
| 1614 | Ga0207428_10001396 | |||
| 1615 | Ga0207428_10156604 | |||
| 1616 | Ga0268266_10027620 | |||
| 1617 | Ga0268266_10111657 | |||
| 1618 | Ga0268265_10003048 | |||
| 1619 | Ga0268265_10011699 | |||
| 1620 | Ga0268264_10001145 | |||
| 1621 | Ga0268264_10079277 | |||
| 1622 | Ga0268264_10195287 | |||
| 1623 | Ga0265337_1000182 | |||
| 1624 | Ga0307515_10000600 | |||
| 1625 | Ga0265332_10125828 | |||
| 1626 | Ga0265340_10001673 | |||
| 1627 | Ga0265339_10001531 | |||
| 1628 | Ga0265339_10141850 | |||
| 1629 | Ga0265316_10317838 | |||
| 1630 | Ga0307513_10008298 | |||
| 1631 | Ga0265313_10000181 | |||
| 1632 | Ga0307406_10027838 | |||
| 1633 | Ga0316583_10040564 | |||
| 1634 | Ga0307510_10094692 | |||
| 1635 | Ga0373930_0000464 | |||
| 1636 | Ga0373930_0003826 | |||
| 1637 | Ga0373930_0015819 | |||
| 1638 | Ga0373948_0000488 | |||
| 1639 | Ga0373948_0001405 | |||
| 1640 | Ga0373950_0000351 | |||
| 1641 | Ga0373950_0002315 | |||
| 1642 | Ga0373950_0011583 | |||
| 1643 | Ga0373958_0000402 | |||
| 1644 | Ga0373958_0001293 | |||
| 1645 | Ga0373958_0002203 | |||
| 1646 | Ga0373959_0000494 | |||
| 1647 | Ga0373959_0001509 | |||
| 1648 | Ga0373938_0000413 | |||
| 1649 | Ga0373926_0002008 | |||
| 1650 | Ga0373926_0010300 | |||
| 1651 | Ga0373928_0000172 | |||
| 1652 | Ga0373928_0002041 | |||
| 1653 | Ga0373929_0000302 | |||
| 1654 | Ga0373929_0003253 | |||
| 1655 | Ga0373934_0015240 | |||
| 1656 | Ga0373934_0046778 | |||
| 1657 | Ga0373940_0003536 | |||
| 1658 | Ga0373940_0008001 | |||
| 1659 | Ga0373944_0000062 | |||
| 1660 | Ga0373944_0005563 | |||
| 1661 | Ga0373949_0002398 | |||
| 1662 | Ga0373949_0003324 | |||
| 1663 | Ga0373949_0003453 | |||
| 1664 | Ga0373951_0001192 | |||
| 1665 | Ga0373951_0006845 | |||
| 1666 | Ga0373952_0000447 | |||
| 1667 | Ga0373952_0000884 | |||
| 1668 | Ga0373952_0001020 | |||
| 1669 | Ga0373923_0000387 | |||
| 1670 | Ga0373932_0000029 | |||
| 1671 | Ga0373932_0003160 | |||
| 1672 | Ga0373932_0003822 | |||
| 1673 | Ga0373936_0000484 | |||
| 1674 | Ga0373936_0019710 | |||
| 1675 | Ga0373936_0108417 | |||
| 1676 | Ga0373939_0000356 | |||
| 1677 | Ga0373939_0001362 | |||
| 1678 | Ga0373941_0000106 | |||
| 1679 | Ga0373941_0000424 | |||
| 1680 | Ga0373941_0026859 | |||
| 1681 | Ga0373945_0004180 | |||
| 1682 | Ga0373945_0023152 | |||
| 1683 | Ga0373953_0001395 | |||
| 1684 | Ga0373953_0063163 | |||
| 1685 | Ga0373954_0037654 | |||
| 1686 | Ga0373956_0027092 | |||
| 1687 | Ga0373957_0000713 | |||
| 1688 | Ga0373957_0011670 | |||
| 1689 | Ga0373960_0000009 | |||
| 1690 | Ga0373960_0009990 | |||
| 1691 | Ga0373943_0012718 | |||
| 1692 | Ga0373943_0020592 | |||
| 1693 | Ga0373943_0028976 | |||
| 1694 | Ga0373943_0047591 | |||
| 1695 | Ga0373946_0002687 | |||
| 1696 | Ga0373946_0012381 | |||
| 1697 | Ga0373946_0018899 | |||
| 1698 | Ga0373946_0047960 | |||
| 1699 | Ga0373955_0000366 | |||
| 1700 | Ga0373955_0002392 | |||
| 1701 | Ga0373955_0043353 | |||
| 1702 | Ga0373942_0000542 | |||
| 1703 | Ga0373961_0001281 | |||
| 1704 | Ga0373961_0002601 | |||
| 1705 | Ga0373962_0000376 | |||
| 1706 | Ga0373962_0008200 | |||
| 1707 | Ga0373924_0019001 | |||
| 1708 | Ga0373924_0037312 | |||
| 1709 | Ga0373931_0000409 | |||
| 1710 | Ga0373931_0004931 | |||
| 1711 | Ga0373931_0013494 | |||
| 1712 | Ga0373935_0000382 | |||
| 1713 | Ga0373935_0010618 | |||
| 1714 | Ga0373935_0024746 | |||
| 1715 | Ga0373927_0000956 | |||
| 1716 | Ga0373927_0002885 | |||
| 1717 | Ga0373927_0045009 | |||
| 1718 | Ga0373933_0000110 | |||
| 1719 | Ga0373933_0002646 | |||
| 1720 | Ga0373933_0061272 | |||
| 1721 | Ga0373933_0066231 | |||
| 1722 | Ga0373947_0000731 | |||
| 1723 | Ga0373947_0001850 | |||
| 1724 | Ga0373947_0003531 | |||
| 1725 | Ga0373937_0002001 | |||
| 1726 | Ga0373937_0007098 | |||
| 1727 | Ga0373937_0009476 | |||
| 1728 | Ga0373937_0109590 | |||
| 1729 | Ga0373925_0002634 | |||
| 1730 | Ga0373925_0003685 | |||
| 1731 | Ga0373925_0010358 | |||
| 1732 | Ga0373925_0103628 | |||
| 1733 | Ga0373925_0349406 | |||
| 1734 | Ga0395900_0137353 | |||
| 1735 | Ga0395905_0002565 | |||
| 1736 | Ga0395901_0136667 | |||
| 1737 | Ga0395901_0166786 | |||
| 1738 | Ga0436365_0513279 | |||
| 1739 | Ga0436365_1104947 | |||
| 1740 | Ga0436360_1211363 | |||
| 1741 | Ga0436361_0027198 | |||
| 1742 | Ga0436361_0147176 | |||
| 1743 | Ga0436361_1157127 | |||
| 1744 | Ga0436363_0096027 | |||
| 1745 | Ga0436363_0540018 | |||
| 1746 | Ga0439453_0003687 | |||
| 1747 | Ga0439448_0041230 | |||
| 1748 | Ga0439435_0006396 | |||
| 1749 | Ga0466969_0080482 | |||
| 1750 | Ga0466966_0006283 | |||
| 1751 | Ga0466961_0000154 | |||
| 1752 | Ga0466963_0004891 | |||
| 1753 | Ga0466963_0259264 | |||
| 1754 | Ga0453684_0253798 | |||
| 1755 | Ga0466959_0012963 | |||
| 1756 | Ga0451576_0016775 | |||
| 1757 | Ga0495592_0029190 | |||
| 1758 | Ga0495592_0036453 | |||
| 1759 | Ga0495592_0051160 | |||
| 1760 | Ga0495592_0157393 | |||
| 1761 | Ga0495592_0208641 | |||
| 1762 | Ga0495603_0002008 | |||
| 1763 | Ga0495603_0009274 | |||
| 1764 | Ga0495603_0056028 | |||
| 1765 | Ga0495629_0000500 | |||
| 1766 | Ga0495629_0002524 | |||
| 1767 | Ga0495629_0014754 | |||
| 1768 | Ga0495629_0021353 | |||
| 1769 | Ga0495629_0072107 | |||
| 1770 | Ga0495638_0029760 | |||
| 1771 | Ga0495641_0001436 | |||
| 1772 | Ga0495641_0025868 | |||
| 1773 | Ga0495651_0001150 | |||
| 1774 | Ga0495651_0003637 | |||
| 1775 | Ga0495651_0013744 | |||
| 1776 | Ga0495651_0024828 | |||
| 1777 | Ga0495653_0001957 | |||
| 1778 | Ga0495653_0009176 | |||
| 1779 | Ga0495653_0192942 | |||
| 1780 | Ga0495650_0030504 | |||
| 1781 | Ga0495650_0042756 | |||
| 1782 | Ga0495580_0001416 | |||
| 1783 | Ga0495580_0004694 | |||
| 1784 | Ga0495580_0026223 | |||
| 1785 | Ga0495582_0000251 | |||
| 1786 | Ga0495582_0044786 | |||
| 1787 | Ga0495582_0077010 | |||
| 1788 | Ga0495639_0000077 | |||
| 1789 | Ga0495639_0009153 | |||
| 1790 | Ga0495639_0025780 | |||
| 1791 | Ga0495662_0002039 | |||
| 1792 | Ga0495662_0005023 | |||
| 1793 | Ga0495664_0000178 | |||
| 1794 | Ga0495594_0000648 | |||
| 1795 | Ga0495594_0018573 | |||
| 1796 | Ga0495594_0043982 | |||
| 1797 | Ga0495594_0067104 | |||
| 1798 | Ga0495607_0010007 | |||
| 1799 | Ga0495583_0053134 | |||
| 1800 | Ga0495606_0008377 | |||
| 1801 | Ga0495608_0001671 | |||
| 1802 | Ga0495608_0012960 | |||
| 1803 | Ga0495608_0087254 | |||
| 1804 | Ga0495618_0043141 | |||
| 1805 | Ga0495618_0045614 | |||
| 1806 | Ga0495618_0079346 | |||
| 1807 | Ga0495618_0122232 | |||
| 1808 | Ga0495618_0156045 | |||
| 1809 | Ga0495628_0001448 | |||
| 1810 | Ga0495628_0007599 | |||
| 1811 | Ga0495628_0058528 | |||
| 1812 | Ga0495628_0067617 | |||
| 1813 | Ga0495628_0385534 | |||
| 1814 | Ga0495630_0001279 | |||
| 1815 | Ga0495630_0015634 | |||
| 1816 | Ga0495630_0118561 | |||
| 1817 | Ga0495644_0013279 | |||
| 1818 | Ga0495666_0000187 | |||
| 1819 | Ga0495666_0006830 | |||
| 1820 | Ga0495666_0025210 | |||
| 1821 | Ga0495652_0016995 | |||
| 1822 | Ga0495652_0020641 | |||
| 1823 | Ga0495652_0022353 | |||
| 1824 | Ga0495652_0057912 | |||
| 1825 | Ga0495652_0058863 | |||
| 1826 | Ga0495652_0154913 | |||
| 1827 | Ga0495652_0371961 | |||
| 1828 | Ga0495665_0008864 | |||
| 1829 | Ga0495665_0010034 | |||
| 1830 | Ga0495665_0010232 | |||
| 1831 | Ga0495640_0036563 | |||
| 1832 | Ga0495640_0086181 | |||
| 1833 | Ga0495640_0156752 | |||
| 1834 | Ga0495586_0004369 | |||
| 1835 | Ga0495586_0114764 | |||
| 1836 | Ga0495587_0002681 | |||
| 1837 | Ga0495587_0015083 | |||
| 1838 | Ga0495587_0026467 | |||
| 1839 | Ga0495587_0081897 | |||
| 1840 | Ga0495598_0002702 | |||
| 1841 | Ga0495645_0005154 | |||
| 1842 | Ga0495645_0113517 | |||
| 1843 | Ga0495622_0006500 | |||
| 1844 | Ga0495622_0013770 | |||
| 1845 | Ga0495633_0012498 | |||
| 1846 | Ga0495667_0000821 | |||
| 1847 | Ga0495667_0032794 | |||
| 1848 | Ga0495667_0047814 | |||
| 1849 | Ga0495656_0000534 | |||
| 1850 | Ga0495668_0020492 | |||
| 1851 | Ga0495634_0001976 | |||
| 1852 | Ga0495634_0015427 | |||
| 1853 | Ga0495634_0023646 | |||
| 1854 | Ga0495634_0063318 | |||
| 1855 | Ga0495634_0174029 | |||
| 1856 | Ga0495611_0016881 | |||
| 1857 | Ga0495635_0002471 | |||
| 1858 | Ga0495635_0010978 | |||
| 1859 | Ga0495635_0041465 | |||
| 1860 | Ga0495635_0057830 | |||
| 1861 | Ga0495659_0013500 | |||
| 1862 | Ga0495661_0066763 | |||
| 1863 | Ga0495588_0001695 | |||
| 1864 | Ga0495588_0040655 | |||
| 1865 | Ga0495588_0126037 | |||
| 1866 | Ga0495657_0003184 | |||
| 1867 | Ga0495657_0034766 | |||
| 1868 | Ga0495599_0000806 | |||
| 1869 | Ga0495599_0009828 | |||
| 1870 | Ga0495599_0038287 | |||
| 1871 | Ga0495623_0008437 | |||
| 1872 | Ga0495647_0000638 | |||
| 1873 | Ga0495647_0006505 | |||
| 1874 | Ga0495647_0007166 | |||
| 1875 | Ga0495658_0001615 | |||
| 1876 | Ga0495658_0002133 | |||
| 1877 | Ga0495658_0044890 | |||
| 1878 | Ga0495658_0107390 | |||
| 1879 | Ga0495669_0027321 | |||
| 1880 | Ga0495613_0013924 | |||
| 1881 | Ga0495613_0051009 | |||
| 1882 | Ga0495613_0064833 | |||
| 1883 | Ga0495613_0396753 | |||
| 1884 | Ga0495624_0001411 | |||
| 1885 | Ga0495624_0002021 | |||
| 1886 | Ga0495624_0031367 | |||
| 1887 | Ga0495624_0117183 | |||
| 1888 | Ga0495670_0004377 | |||
| 1889 | Ga0495649_0035904 | |||
| 1890 | Ga0495600_0000208 | |||
| 1891 | Ga0495600_0009879 | |||
| 1892 | Ga0495600_0066443 | |||
| 1893 | Ga0495600_0089176 | |||
| 1894 | Ga0495581_0000503 | |||
| 1895 | Ga0495581_0005790 | |||
| 1896 | Ga0495604_0001423 | |||
| 1897 | Ga0495674_0009848 | |||
| 1898 | Ga0495674_0016553 | |||
| 1899 | Ga0495674_0053424 | |||
| 1900 | Ga0495676_0011575 | |||
| 1901 | Ga0495676_0024072 | |||
| 1902 | Ga0495676_0036100 | |||
| 1903 | Ga0495676_0080628 | |||
| 1904 | Ga0495680_0001491 | |||
| 1905 | Ga0495680_0002844 | |||
| 1906 | Ga0495680_0029147 | |||
| 1907 | Ga0495675_0020212 | |||
| 1908 | Ga0495675_0176444 | |||
| 1909 | Ga0495684_0009241 | |||
| 1910 | Ga0495684_0064370 | |||
| 1911 | Ga0495684_0149264 | |||
| 1912 | Ga0495593_0000372 | |||
| 1913 | Ga0495593_0010385 | |||
| 1914 | Ga0495593_0054779 | |||
| 1915 | Ga0495593_0055548 | |||
| 1916 | Ga0495593_0064268 | |||
| 1917 | Ga0495602_0010688 | |||
| 1918 | Ga0495602_0083964 | |||
| 1919 | Ga0495614_0007981 | |||
| 1920 | Ga0495614_0037583 | |||
| 1921 | Ga0496100_0000203 | |||
| 1922 | Ga0496100_0005697 | |||
| 1923 | Ga0496101_0002812 | |||
| 1924 | Ga0496101_0228873 | |||
| 1925 | Ga0496101_0228883 | |||
| 1926 | Ga0496102_0107498 | |||
| 1927 | Ga0496102_0131082 | |||
| 1928 | Ga0496102_0684154 | |||
| 1929 | Ga0496103_0001529 | |||
| 1930 | Ga0496103_0011847 | |||
| 1931 | Ga0496103_0044221 | |||
| 1932 | Ga0496103_0073333 | |||
| 1933 | Ga0496103_0147742 | |||
| 1934 | Ga0496104_0001608 | |||
| 1935 | Ga0496104_0016648 | |||
| 1936 | Ga0496104_0451451 | |||
| 1937 | Ga0496105_0006281 | |||
| 1938 | Ga0496105_0103975 | |||
| 1939 | Ga0496105_0128391 | |||
| 1940 | Ga0496105_0184888 | |||
| 1941 | Ga0496105_0321252 | |||
| 1942 | Ga0496106_0006066 | |||
| 1943 | Ga0496106_0042498 | |||
| 1944 | Ga0496106_0053524 | |||
| 1945 | Ga0496106_0080438 | |||
| 1946 | Ga0496107_0003174 | |||
| 1947 | Ga0496107_0031467 | |||
| 1948 | Ga0496107_0053179 | |||
| 1949 | Ga0496107_0193468 | |||
| 1950 | Ga0496107_0221521 | |||
| 1951 | Ga0496107_0337107 | |||
| 1952 | Ga0496108_0006052 | |||
| 1953 | Ga0496108_0038993 | |||
| 1954 | Ga0496108_0043035 | |||
| 1955 | Ga0496108_0103805 | |||
| 1956 | Ga0496108_0113621 | |||
| 1957 | Ga0496108_0212236 | |||
| 1958 | Ga0496109_0006654 | |||
| 1959 | Ga0496109_0008201 | |||
| 1960 | Ga0496109_0013562 | |||
| 1961 | Ga0496109_0030701 | |||
| 1962 | Ga0496109_0076567 | |||
| 1963 | Ga0496109_0179219 | |||
| 1964 | Ga0496110_0025973 | |||
| 1965 | Ga0496110_0026118 | |||
| 1966 | Ga0496110_0046934 | |||
| 1967 | Ga0496110_0114351 | |||
| 1968 | Ga0496110_0269457 | |||
| 1969 | Ga0496111_0005390 | |||
| 1970 | Ga0496111_0033297 | |||
| 1971 | Ga0496111_0040973 | |||
| 1972 | Ga0496111_0041513 | |||
| 1973 | Ga0496111_0080316 | |||
| 1974 | Ga0496112_0000004 | |||
| 1975 | Ga0496112_0023658 | |||
| 1976 | Ga0496112_0028755 | |||
| 1977 | Ga0496112_0043941 | |||
| 1978 | Ga0496112_0098122 | |||
| 1979 | Ga0496112_0127710 | |||
| 1980 | Ga0496112_0148010 | |||
| 1981 | Ga0496112_0172581 | |||
| 1982 | Ga0496112_0220185 | |||
| 1983 | Ga0496113_0002762 | |||
| 1984 | Ga0496113_0006342 | |||
| 1985 | Ga0496113_0100320 | |||
| 1986 | Ga0496113_0188936 | |||
| 1987 | Ga0496113_0284106 | |||
| 1988 | Ga0496114_0005021 | |||
| 1989 | Ga0496114_0112639 | |||
| 1990 | Ga0496115_0027336 | |||
| 1991 | Ga0496115_0035893 | |||
| 1992 | Ga0496115_0082053 | |||
| 1993 | Ga0496115_0117908 | |||
| 1994 | Ga0496115_0393293 | |||
| 1995 | Ga0496117_0032569 | |||
| 1996 | Ga0496118_0097639 | |||
| 1997 | Ga0496119_0003438 | |||
| 1998 | Ga0496119_0026329 | |||
| 1999 | Ga0496121_0000458 | |||
| 2000 | Ga0496122_0148270 | |||
| 2001 | Ga0496124_0143143 | |||
| 2002 | Ga0496125_0073574 | |||
| 2003 | Ga0496125_0155943 | |||
| 2004 | Ga0496125_0171824 | |||
| 2005 | Ga0496126_0015313 | |||
| 2006 | Ga0496126_0021658 | |||
| 2007 | Ga0496126_0127629 | |||
| 2008 | Ga0496126_0204102 | |||
| 2009 | Ga0496126_0332205 | |||
| 2010 | Ga0501031_0009952 | |||
| 2011 | Ga0501031_0040419 | |||
| 2012 | Ga0501031_0068246 | |||
| 2013 | Ga0501031_0128196 | |||
| 2014 | Ga0501032_0004443 | |||
| 2015 | Ga0501032_0010442 | |||
| 2016 | Ga0501032_0020767 | |||
| 2017 | Ga0501032_0079846 | |||
| 2018 | Ga0501033_0001387 | |||
| 2019 | Ga0501033_0003747 | |||
| 2020 | Ga0501033_0009064 | |||
| 2021 | Ga0501033_0012028 | |||
| 2022 | Ga0501033_0019522 | |||
| 2023 | Ga0501033_0057808 | |||
| 2024 | Ga0501034_0013177 | |||
| 2025 | Ga0501034_0022766 | |||
| 2026 | Ga0501034_0065325 | |||
| 2027 | Ga0501034_0092593 | |||
| 2028 | Ga0501036_0001303 | |||
| 2029 | Ga0501036_0013017 | |||
| 2030 | Ga0501036_0030450 | |||
| 2031 | Ga0501036_0043307 | |||
| 2032 | Ga0501036_0090229 | |||
| 2033 | Ga0501036_0130597 | |||
| 2034 | Ga0501037_0000328 | |||
| 2035 | Ga0501037_0003605 | |||
| 2036 | Ga0501037_0016589 | |||
| 2037 | Ga0501037_0024107 | |||
| 2038 | Ga0501037_0024368 | |||
| 2039 | Ga0501038_0009112 | |||
| 2040 | Ga0501038_0026430 | |||
| 2041 | Ga0501038_0033611 | |||
| 2042 | Ga0501038_0041501 | |||
| 2043 | Ga0501038_0051184 | |||
| 2044 | Ga0501038_0116784 | |||
| 2045 | Ga0501038_0125102 | |||
| 2046 | Ga0501038_0274756 | |||
| 2047 | Ga0501039_0164667 | |||
| 2048 | Ga0501041_0067417 | |||
| 2049 | Ga0501042_0026243 | |||
| 2050 | Ga0501042_0201419 | |||
| 2051 | Ga0501042_0316559 | |||
| 2052 | Ga0501043_0000377 | |||
| 2053 | Ga0501043_0014338 | |||
| 2054 | Ga0501043_0019625 | |||
| 2055 | Ga0501043_0031985 | |||
| 2056 | Ga0501043_0296519 | |||
| 2057 | Ga0501046_0003241 | |||
| 2058 | Ga0501046_0016244 | |||
| 2059 | Ga0501046_0026473 | |||
| 2060 | Ga0501046_0058330 | |||
| 2061 | Ga0501047_0030661 | |||
| 2062 | Ga0501047_0040563 | |||
| 2063 | Ga0501047_0044503 | |||
| 2064 | Ga0501047_0064418 | |||
| 2065 | Ga0501047_0068132 | |||
| 2066 | Ga0501047_0145285 | |||
| 2067 | Ga0501047_0185442 | |||
| 2068 | Ga0501048_0004184 | |||
| 2069 | Ga0501048_0017935 | |||
| 2070 | Ga0501048_0268106 | |||
| 2071 | Ga0501067_0010554 | |||
| 2072 | Ga0501067_0017640 | |||
| 2073 | Ga0501067_0031337 | |||
| 2074 | Ga0501068_0002507 | |||
| 2075 | Ga0501068_0042908 | |||
| 2076 | Ga0501068_0164250 | |||
| 2077 | Ga0501068_0211376 | |||
| 2078 | Ga0501069_0000100 | |||
| 2079 | Ga0501069_0003145 | |||
| 2080 | Ga0501069_0016117 | |||
| 2081 | Ga0501069_0018526 | |||
| 2082 | Ga0501070_0000229 | |||
| 2083 | Ga0501070_0000714 | |||
| 2084 | Ga0501070_0001806 | |||
| 2085 | Ga0501070_0003195 | |||
| 2086 | Ga0501070_0006026 | |||
| 2087 | Ga0501070_0170533 | |||
| 2088 | Ga0501070_0172101 | |||
| 2089 | Ga0501071_0013118 | |||
| 2090 | Ga0501071_0017405 | |||
| 2091 | Ga0501071_0032588 | |||
| 2092 | Ga0501072_0075492 | |||
| 2093 | Ga0501073_0006658 | |||
| 2094 | Ga0501073_0009289 | |||
| 2095 | Ga0501073_0015968 | |||
| 2096 | Ga0501073_0017729 | |||
| 2097 | Ga0501073_0027212 | |||
| 2098 | Ga0501073_0027631 | |||
| 2099 | Ga0501073_0068983 | |||
| 2100 | Ga0501074_0000113 | |||
| 2101 | Ga0501074_0004959 | |||
| 2102 | Ga0501074_0020303 | |||
| 2103 | Ga0501074_0023766 | |||
| 2104 | Ga0501074_0208311 | |||
| 2105 | Ga0501076_0053637 | |||
| 2106 | Ga0501076_0264551 | |||
| 2107 | Ga0501079_0018785 | |||
| 2108 | Ga0501079_0074734 | |||
| 2109 | Ga0501079_0137031 | |||
| 2110 | Ga0501079_0211695 | |||
| 2111 | Ga0501080_0007250 | |||
| 2112 | Ga0501080_0014802 | |||
| 2113 | Ga0501080_0021648 | |||
| 2114 | Ga0501080_0033198 | |||
| 2115 | Ga0501080_0047654 | |||
| 2116 | Ga0501080_0065528 | |||
| 2117 | Ga0501080_0190205 | |||
| 2118 | Ga0501080_0292969 | |||
| 2119 | Ga0501080_0361578 | |||
| 2120 | Ga0501081_0162792 | |||
| 2121 | Ga0501081_0244361 | |||
| 2122 | Ga0501081_0380641 | |||
| 2123 | Ga0501083_0000529 | |||
| 2124 | Ga0501083_0036835 | |||
| 2125 | Ga0501083_0066225 | |||
| 2126 | Ga0501083_0091983 | |||
| 2127 | Ga0501035_0000373 | |||
| 2128 | Ga0501035_0000580 | |||
| 2129 | Ga0501035_0003027 | |||
| 2130 | Ga0501035_0010765 | |||
| 2131 | Ga0501035_0034886 | |||
| 2132 | Ga0501035_0307857 | |||
| 2133 | Ga0501044_0000494 | |||
| 2134 | Ga0501044_0012523 | |||
| 2135 | Ga0501044_0013031 | |||
| 2136 | Ga0501044_0024835 | |||
| 2137 | Ga0501044_0031713 | |||
| 2138 | Ga0501044_0032277 | |||
| 2139 | Ga0501044_0034815 | |||
| 2140 | Ga0501044_0125363 | |||
| 2141 | nmdc:mga00v17_8336_c1 | |||
| 2142 | nmdc:mga0yw44_28739_c1 | |||
| 2143 | nmdc:mga0yw44_40792_c1 | |||
| 2144 | nmdc:mga0k408_71829_c1 | |||
| 2145 | nmdc:mga05p37_30291_c1 | |||
| 2146 | nmdc:mga05p37_32_c1 | |||
| 2147 | nmdc:mga09592_6535_c1 | |||
| 2148 | nmdc:mga0qj67_355_c1 | |||
| 2149 | nmdc:mga06r32_5297_c1 | |||
| 2150 | nmdc:mga08y16_175108_c1 | |||
| 2151 | nmdc:mga08y16_2238_c1 | |||
| 2152 | nmdc:mga08y16_6098_c1 | |||
| 2153 | nmdc:mga0n895_101316_c1 | |||
| 2154 | nmdc:mga0n895_40463_c1 | |||
| 2155 | nmdc:mga0n895_442378_c1 | |||
| 2156 | nmdc:mga0n895_452920_c1 | |||
| 2157 | nmdc:mga0n895_547_c1 | |||
| 2158 | nmdc:mga0n895_67573_c1 | |||
| 2159 | nmdc:mga0n895_8451_c1 | |||
| 2160 | nmdc:mga0rr50_2161_c1 | |||
| 2161 | nmdc:mga0rr50_237205_c1 | |||
| 2162 | nmdc:mga0rr50_24109_c1 | |||
| 2163 | nmdc:mga0rr50_51016_c1 | |||
| 2164 | nmdc:mga08x19_143264_c1 | |||
| 2165 | nmdc:mga08x19_6_c1 | |||
| 2166 | nmdc:mga08x19_91285_c1 | |||
| 2167 | nmdc:mga0a205_19845_c1 | |||
| 2168 | nmdc:mga0a205_278960_c1 | |||
| 2169 | nmdc:mga0a205_629_c1 | |||
| 2170 | Ga0495601_0004297 | |||
| 2171 | Ga0495601_0004847 | |||
| 2172 | Ga0495601_0005893 | |||
| 2173 | Ga0495601_0007409 | |||
| 2174 | Ga0495601_0008232 | |||
| 2175 | Ga0495612_0005828 | |||
| 2176 | Ga0500635_0000553 | |||
| 2177 | Ga0495595_0002810 | |||
| 2178 | Ga0495595_0003138 | |||
| 2179 | Ga0495595_0003361 | |||
| 2180 | Ga0495595_0004354 | |||
| 2181 | Ga0495595_0046712 | |||
| 2182 | Ga0495619_0000016 | |||
| 2183 | Ga0495619_0002830 | |||
| 2184 | Ga0495619_0006052 | |||
| 2185 | Ga0495619_0010377 | |||
| 2186 | Ga0495619_0030196 | |||
| 2187 | Ga0495619_0045414 | |||
| 2188 | Ga0495619_0138516 | |||
| 2189 | Ga0495619_0149951 | |||
| 2190 | Ga0500566_0131967 | |||
| 2191 | Ga0500640_024696 | |||
| 2192 | Ga0500595_023055 | |||
| 2193 | Ga0500607_067427 | |||
| 2194 | Ga0500652_096804 | |||
| 2195 | Ga0500568_0000682 | |||
| 2196 | Ga0500568_0008676 | |||
| 2197 | Ga0500568_0073721 | |||
| 2198 | Ga0500603_001483 | |||
| 2199 | Ga0500604_0019357 | |||
| 2200 | Ga0500637_0099587 | |||
| 2201 | Ga0500609_000759 | |||
| 2202 | Ga0500609_013616 | |||
| 2203 | Ga0501084_0013177 | |||
| 2204 | Ga0501082_0005362 | |||
| 2205 | Ga0501082_0009755 | |||
| 2206 | Ga0501082_0023892 | |||
| 2207 | Ga0501082_0094555 | |||
| 2208 | Ga0501082_0229824 | |||
| 2209 | Ga0501082_0302275 | |||
| 2210 | Ga0466962_0015456 | |||
| 2211 | Ga0530510_0297590 | |||
| 2212 | 2508729138 | |||
| 2213 | 2509078049 | |||
| 2214 | 2511394988 | |||
| 2215 | 2528848582 | |||
| 2216 | 2644494869 | |||
| 2217 | 2644498255 | |||
| 2218 | 2824775347 | |||
| 2219 | 2835312799 | |||
| 2220 | 2879104573 | |||
| 2221 | 2885369174 | |||
| 2222 | 2904570923 | |||
| 2223 | 2904578123 | |||
| 2224 | 2928543017 | |||
| 2225 | 2932817385 | |||
| 2226 | 2932826154 | |||
| 2227 | 2935765185 | |||
| 2228 | 2935960691 | |||
| 2229 | 8020943355 | |||
| 2230 | 8020954546 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2hrz-assembly1.cif.gz_A-2 | the crystal structure of the nucleoside-diphosphate-sugar epimerase from agrobacterium tumefaciens | 0.9846 | 1 | 324 |
| 2hrz-assembly1.cif.gz_A-2 | the crystal structure of the nucleoside-diphosphate-sugar epimerase from agrobacterium tumefaciens | 0.9786 | 1 | 324 |
| 6jyg-assembly1.cif.gz_E | crystal structure of l-threonine dehydrogenase from phytophthora infestans | 0.8996 | 1 | 316 |
| 3wmx-assembly2.cif.gz_B | gale-like l-threonine dehydrogenase from cupriavidus necator (holo form) | 0.894 | 1 | 316 |
| 7cgv-assembly1.cif.gz_C-2 | full consensus l-threonine 3-dehydrogenase, fctdh-iiym (nad+ bound form) | 0.8937 | 1 | 317 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2hrzA02 | Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 | 0.9674 | 175 | 324 | 3.90.25.10 |
| 2hrzA02 | Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 | 0.9578 | 175 | 324 | 3.90.25.10 |
| 2hrzA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9411 | 1 | 302 | 3.40.50.720 |
| 2hrzA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.937 | 1 | 302 | 3.40.50.720 |
| 5k4tA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8857 | 3 | 316 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X3Z7P9-F1-model_v4 | NAD-dependent epimerase | 0.9923 | 155 | 318 |
|
| AF-A0A530CEN0-F1-model_v4 | NAD-dependent epimerase | 0.99 | 192 | 325 |
|
| AF-A0A4Q3HRV7-F1-model_v4 | deleted | 0.9862 | 99 | 324 |
|
| AF-A0A530CEN0-F1-model_v4 | NAD-dependent epimerase | 0.9755 | 192 | 325 |
|
| AF-A0A439CLK9-F1-model_v4 | NAD-dependent epimerase/dehydratase domain-containing protein | 0.9697 | 125 | 316 |
|