F490308
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1116 | 505 | 2232 | 316 |
Family's Representative Sequence
| Representative Sequence | 3300031665|Ga0316575_10018217|Ga0316575_100182173 |
| Length | 303 |
| Sequence | VLFAGTPEFALPALQTLIGSACDIVAVLTQPDRPAGRGKQLRASPVKQLALENGLEVLQPESLKDTGWQEKLAALRPDLMVVVAYGLMIPSWLLDLPPHGCWNIHASLLPRWRGAAPIQRAIEAGDAQTGVCIMQIEPKLDTGPVYQCLATPIEPDDTAGSLHDRLSGLGARALRNCLDMLAANTLPAPVAQDDSRAVYAAKLSKAEAQLDWNLPAAVLERRVRAFNPWPVAWCEMNGERVRIWKAGVADDAGDCKPGELYAGRRLLLVGTADKALKILELQRPGGQRMTAEQYLNALHSQAS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 5 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 7 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 8 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 10 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 11 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 18 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 20 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 26 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 29 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 30 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 31 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 32 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 33 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 34 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Metagenome | Rhizosphere |
| 43 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 44 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 45 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 53 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 54 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 55 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 56 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 58 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 68 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 71 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 91 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 92 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 99 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 101 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 102 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 103 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 104 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 105 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 106 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 107 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 108 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 109 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 110 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 111 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 112 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 113 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 114 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 115 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 116 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 117 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 118 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 119 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 120 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 121 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 122 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 123 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 124 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 125 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 126 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 127 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 128 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 129 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 130 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 131 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 132 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 133 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 134 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 135 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 136 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 137 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 138 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 139 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 140 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 141 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 142 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 143 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 144 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 145 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 146 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 147 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 148 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 149 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 150 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 151 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 152 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 224 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 225 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 226 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 227 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 228 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 229 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 230 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 231 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 232 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 233 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 234 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 235 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 236 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 237 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 238 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 239 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 240 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 246 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 247 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 248 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 249 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 250 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 251 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 252 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 253 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 254 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 255 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 256 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 257 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 258 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 259 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 260 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 261 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 262 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 263 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 264 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 265 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 266 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 267 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 268 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 269 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 270 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 271 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 272 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 273 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 274 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 275 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 276 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 277 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 278 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 279 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 280 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 281 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 282 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 283 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 284 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 285 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 286 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 287 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 288 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 289 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 290 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 291 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 292 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 293 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 294 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 295 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 296 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 297 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 298 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 299 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 300 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 301 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 302 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 303 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 304 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 305 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 306 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 307 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 308 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 309 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 310 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 311 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 312 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 313 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 314 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 315 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 316 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 317 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 318 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 319 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 320 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 321 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 322 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 323 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 324 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 325 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 326 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 327 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 328 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 329 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 330 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 331 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 332 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 333 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 334 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 335 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 336 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 337 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 338 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 339 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 340 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 341 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 342 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 343 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 344 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 345 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 346 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 347 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 348 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 349 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 350 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 351 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 352 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 353 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 354 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 355 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 356 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 357 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 358 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 359 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 360 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 361 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 362 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 363 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 364 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 365 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 366 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 367 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 368 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 369 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 370 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 371 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 372 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 373 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 374 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 375 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 376 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 377 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 378 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 379 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 380 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 381 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 382 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 383 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 384 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 385 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 386 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 387 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 388 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 389 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 390 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 391 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 392 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 393 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 394 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 395 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 396 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 397 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 398 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 399 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 400 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 401 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 402 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 403 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 404 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 405 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 406 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 407 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 408 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 409 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 410 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 411 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 412 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 413 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 414 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 415 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 416 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 417 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 418 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 419 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 420 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 421 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 422 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 423 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 424 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 425 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 426 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 427 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 428 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 429 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 430 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 431 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 432 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 433 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 434 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 435 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 436 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 437 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 438 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 439 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 440 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 441 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 442 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 443 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 444 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 445 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 446 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 447 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 448 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 449 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 450 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 451 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 452 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 453 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 454 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 455 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 456 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 457 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 458 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 459 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 460 | 2990196909 | Pseudomonas mangrovi TC-11 | Isolate | Unclassified |
| 461 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 462 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 463 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 464 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 465 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 466 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 467 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 468 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 469 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 470 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 471 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 472 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 473 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 474 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 475 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 476 | 640427133 | Stutzerimonas stutzeri A1501 | Isolate | Rhizosphere |
| 477 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 478 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 479 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 480 | 8016728285 | Pseudomonas psychrotolerans SORGH_AS 227 | Isolate | Unclassified |
| 481 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 482 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 483 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 484 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 485 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 486 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 487 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 488 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 489 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 490 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 491 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 492 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 493 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 494 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 495 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 496 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 497 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 498 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 499 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 500 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 501 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 502 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 503 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 504 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 505 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 77.15 |
| Metatranscriptomes | 0 |
| Isolates | 22.85 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.18 |
| Bulb | 0 |
| Endosphere | 5.38 |
| Nodule | 2.51 |
| Rhizoplane | 6.81 |
| Rhizosphere | 71.51 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0316575_10018217 | 3300031665 | Bacteria | 2675 |
| 2 | MRS2a_Contig_61 | 2124908027 | Bacteria | 51169 |
| 3 | SwRhRL2b_contig_2749780 | 2162886007 | Bacteria | 1665 |
| 4 | JGI24741J21665_1002934 | 3300001915 | Bacteria | 4262 |
| 5 | JGI25164J39214_1000175 | 3300002772 | Bacteria | 59290 |
| 6 | JGI25164J39214_1000357 | 3300002772 | Bacteria | 28322 |
| 7 | JGI25165J46597_1000175 | 3300003214 | Bacteria | 100117 |
| 8 | JGI25165J46597_1000193 | 3300003214 | Bacteria | 91069 |
| 9 | Ga0055538_1000012 | 3300003751 | Bacteria | 353826 |
| 10 | Ga0055539_1000017 | 3300003752 | Bacteria | 353873 |
| 11 | Ga0055533_1000021 | 3300003756 | Bacteria | 353826 |
| 12 | Ga0055532_1000020 | 3300003758 | Bacteria | 270853 |
| 13 | Ga0055525_1000117 | 3300003759 | Bacteria | 120690 |
| 14 | Ga0055536_1000547 | 3300003781 | Bacteria | 25802 |
| 15 | Ga0055536_1000593 | 3300003781 | Bacteria | 24687 |
| 16 | Ga0055536_1005739 | 3300003781 | Bacteria | 5980 |
| 17 | Ga0055536_1020865 | 3300003781 | Bacteria | 2008 |
| 18 | Ga0055530_10000081 | 3300003791 | Bacteria | 82192 |
| 19 | Ga0055530_10000159 | 3300003791 | Bacteria | 61131 |
| 20 | Ga0055530_10003552 | 3300003791 | Bacteria | 8783 |
| 21 | Ga0055540_1000121 | 3300003792 | Bacteria | 82192 |
| 22 | Ga0055540_1000242 | 3300003792 | Bacteria | 49989 |
| 23 | Ga0055540_1001117 | 3300003792 | Bacteria | 16893 |
| 24 | Ga0055531_10001857 | 3300003794 | Bacteria | 14840 |
| 25 | Ga0055541_1000012 | 3300003841 | Bacteria | 353826 |
| 26 | Ga0058692_1003282 | 3300003856 | Bacteria | 5054 |
| 27 | Ga0065714_10002471 | 3300005288 | Bacteria | 16560 |
| 28 | Ga0065714_10066068 | 3300005288 | Bacteria | 7696 |
| 29 | Ga0065714_10066935 | 3300005288 | Bacteria | 6080 |
| 30 | Ga0065714_10067254 | 3300005288 | Bacteria | 5732 |
| 31 | Ga0065714_10067959 | 3300005288 | Bacteria | 5074 |
| 32 | Ga0065714_10074006 | 3300005288 | Bacteria | 3095 |
| 33 | Ga0065714_10086380 | 3300005288 | Bacteria | 2101 |
| 34 | Ga0065712_10000160 | 3300005290 | Bacteria | 33313 |
| 35 | Ga0065712_10002851 | 3300005290 | Bacteria | 5047 |
| 36 | Ga0065712_10071587 | 3300005290 | Bacteria | 5170 |
| 37 | Ga0065715_10008286 | 3300005293 | Bacteria | 3239 |
| 38 | Ga0070670_100017009 | 3300005331 | Bacteria | 6241 |
| 39 | Ga0070670_100046495 | 3300005331 | Bacteria | 3732 |
| 40 | Ga0070661_100002052 | 3300005344 | Bacteria | 13882 |
| 41 | Ga0070661_100066694 | 3300005344 | Bacteria | 2644 |
| 42 | Ga0070669_100000153 | 3300005353 | Bacteria | 62355 |
| 43 | Ga0070669_100000158 | 3300005353 | Bacteria | 61318 |
| 44 | Ga0070662_100000562 | 3300005457 | Bacteria | 22575 |
| 45 | Ga0068853_100000040 | 3300005539 | Bacteria | 105702 |
| 46 | Ga0070665_100106751 | 3300005548 | Bacteria | 2802 |
| 47 | Ga0070665_100189889 | 3300005548 | Bacteria | 2055 |
| 48 | Ga0070665_100320364 | 3300005548 | Bacteria | 1554 |
| 49 | Ga0070664_100000049 | 3300005564 | Bacteria | 71805 |
| 50 | Ga0070664_100014744 | 3300005564 | Bacteria | 6382 |
| 51 | Ga0068854_100002019 | 3300005578 | Bacteria | 12425 |
| 52 | Ga0068851_10000018 | 3300005834 | Bacteria | 137425 |
| 53 | Ga0075364_10037035 | 3300006051 | Bacteria | 3156 |
| 54 | Ga0075364_10074915 | 3300006051 | Bacteria | 2232 |
| 55 | Ga0075364_10083028 | 3300006051 | Bacteria | 2120 |
| 56 | Ga0075432_10008138 | 3300006058 | Bacteria | 3576 |
| 57 | Ga0075432_10036464 | 3300006058 | Bacteria | 1709 |
| 58 | Ga0099823_1001433 | 3300006944 | Bacteria | 19711 |
| 59 | Ga0099823_1017745 | 3300006944 | Bacteria | 6911 |
| 60 | Ga0079104_1000291 | 3300006946 | Bacteria | 63569 |
| 61 | Ga0079104_1000306 | 3300006946 | Bacteria | 62131 |
| 62 | Ga0079104_1011461 | 3300006946 | Bacteria | 2849 |
| 63 | Ga0105251_10000033 | 3300009011 | Bacteria | 118905 |
| 64 | Ga0105251_10000995 | 3300009011 | Bacteria | 24850 |
| 65 | Ga0105251_10002417 | 3300009011 | Bacteria | 14720 |
| 66 | Ga0105251_10008537 | 3300009011 | Bacteria | 6147 |
| 67 | Ga0105251_10019139 | 3300009011 | Bacteria | 3624 |
| 68 | Ga0105251_10034316 | 3300009011 | Bacteria | 2512 |
| 69 | Ga0105251_10060428 | 3300009011 | Bacteria | 1784 |
| 70 | Ga0105244_10000186 | 3300009036 | Bacteria | 63278 |
| 71 | Ga0105244_10001163 | 3300009036 | Bacteria | 21788 |
| 72 | Ga0105244_10006161 | 3300009036 | Bacteria | 7824 |
| 73 | Ga0105244_10010196 | 3300009036 | Bacteria | 5707 |
| 74 | Ga0105244_10011507 | 3300009036 | Bacteria | 5298 |
| 75 | Ga0105244_10012125 | 3300009036 | Bacteria | 5117 |
| 76 | Ga0105244_10023068 | 3300009036 | Bacteria | 3419 |
| 77 | Ga0105244_10029512 | 3300009036 | Bacteria | 2930 |
| 78 | Ga0105244_10061702 | 3300009036 | Bacteria | 1886 |
| 79 | Ga0105244_10074675 | 3300009036 | Bacteria | 1686 |
| 80 | Ga0105244_10077413 | 3300009036 | Bacteria | 1650 |
| 81 | Ga0105244_10094355 | 3300009036 | Bacteria | 1469 |
| 82 | Ga0105250_10000203 | 3300009092 | Bacteria | 50306 |
| 83 | Ga0105250_10000550 | 3300009092 | Bacteria | 25618 |
| 84 | Ga0105250_10005762 | 3300009092 | Bacteria | 5513 |
| 85 | Ga0105250_10016036 | 3300009092 | Bacteria | 3058 |
| 86 | Ga0105250_10018938 | 3300009092 | Bacteria | 2784 |
| 87 | Ga0105243_10000075 | 3300009148 | Bacteria | 112098 |
| 88 | Ga0105243_10006258 | 3300009148 | Bacteria | 9197 |
| 89 | Ga0105243_10008082 | 3300009148 | Bacteria | 8075 |
| 90 | Ga0105243_10012797 | 3300009148 | Bacteria | 6337 |
| 91 | Ga0105243_10012953 | 3300009148 | Bacteria | 6301 |
| 92 | Ga0105243_10016614 | 3300009148 | Bacteria | 5565 |
| 93 | Ga0105243_10024895 | 3300009148 | Bacteria | 4569 |
| 94 | Ga0105243_10027788 | 3300009148 | Bacteria | 4338 |
| 95 | Ga0105241_10293162 | 3300009174 | Bacteria | 1393 |
| 96 | Ga0105242_10003444 | 3300009176 | Bacteria | 12294 |
| 97 | Ga0105237_10015442 | 3300009545 | Bacteria | 7948 |
| 98 | Ga0105246_10000322 | 3300011119 | Bacteria | 25369 |
| 99 | Ga0105246_10002463 | 3300011119 | Bacteria | 11182 |
| 100 | Ga0105246_10027386 | 3300011119 | Bacteria | 3733 |
| 101 | Ga0157336_1000242 | 3300012477 | Bacteria | 2406 |
| 102 | Ga0157337_1000089 | 3300012483 | Bacteria | 3954 |
| 103 | Ga0157345_1000342 | 3300012498 | Bacteria | 5507 |
| 104 | Ga0157373_10006572 | 3300013100 | Bacteria | 8672 |
| 105 | Ga0157373_10011243 | 3300013100 | Bacteria | 6586 |
| 106 | Ga0157373_10015430 | 3300013100 | Bacteria | 5585 |
| 107 | Ga0157373_10015802 | 3300013100 | Bacteria | 5510 |
| 108 | Ga0157371_10000226 | 3300013102 | Bacteria | 82385 |
| 109 | Ga0157371_10012722 | 3300013102 | Bacteria | 6415 |
| 110 | Ga0157371_10014325 | 3300013102 | Bacteria | 5989 |
| 111 | Ga0157370_10003131 | 3300013104 | Bacteria | 19584 |
| 112 | Ga0157370_10023845 | 3300013104 | Bacteria | 6069 |
| 113 | Ga0157370_10068026 | 3300013104 | Bacteria | 3366 |
| 114 | Ga0157370_10094400 | 3300013104 | Bacteria | 2806 |
| 115 | Ga0157370_10133309 | 3300013104 | Bacteria | 2317 |
| 116 | Ga0157369_10033496 | 3300013105 | Bacteria | 5645 |
| 117 | Ga0157369_10114866 | 3300013105 | Bacteria | 2859 |
| 118 | Ga0157369_10154159 | 3300013105 | Bacteria | 2427 |
| 119 | Ga0163162_10001329 | 3300013306 | Bacteria | 23079 |
| 120 | Ga0157372_10018101 | 3300013307 | Bacteria | 7572 |
| 121 | Ga0157372_10028093 | 3300013307 | Bacteria | 6136 |
| 122 | Ga0157375_10024624 | 3300013308 | Bacteria | 5574 |
| 123 | Ga0182008_10000938 | 3300014497 | Bacteria | 20315 |
| 124 | Ga0182008_10003949 | 3300014497 | Bacteria | 8773 |
| 125 | Ga0182008_10008674 | 3300014497 | Bacteria | 5532 |
| 126 | Ga0182008_10013327 | 3300014497 | Bacteria | 4323 |
| 127 | Ga0182008_10018729 | 3300014497 | Bacteria | 3583 |
| 128 | Ga0182008_10022978 | 3300014497 | Bacteria | 3190 |
| 129 | Ga0182008_10038337 | 3300014497 | Bacteria | 2396 |
| 130 | Ga0182008_10086859 | 3300014497 | Bacteria | 1540 |
| 131 | Ga0182008_10103811 | 3300014497 | Bacteria | 1406 |
| 132 | Ga0182006_1004750 | 3300015261 | Bacteria | 6633 |
| 133 | Ga0182006_1005425 | 3300015261 | Bacteria | 6085 |
| 134 | Ga0182006_1005564 | 3300015261 | Bacteria | 5988 |
| 135 | Ga0182006_1009327 | 3300015261 | Bacteria | 4401 |
| 136 | Ga0182006_1049907 | 3300015261 | Bacteria | 1614 |
| 137 | Ga0182006_1062526 | 3300015261 | Bacteria | 1400 |
| 138 | Ga0182007_10004678 | 3300015262 | Bacteria | 6174 |
| 139 | Ga0182005_1002872 | 3300015265 | Bacteria | 5995 |
| 140 | Ga0182005_1010661 | 3300015265 | Bacteria | 2638 |
| 141 | Ga0182005_1013258 | 3300015265 | Bacteria | 2319 |
| 142 | Ga0163161_10134235 | 3300017792 | Bacteria | 1869 |
| 143 | Ga0163161_10146361 | 3300017792 | Bacteria | 1792 |
| 144 | Ga0163161_10211279 | 3300017792 | Bacteria | 1499 |
| 145 | Ga0163161_10277264 | 3300017792 | Bacteria | 1314 |
| 146 | Ga0209435_101310 | 3300025206 | Bacteria | 3245 |
| 147 | Ga0209760_100020 | 3300025207 | Bacteria | 169879 |
| 148 | Ga0209760_100169 | 3300025207 | Bacteria | 37738 |
| 149 | Ga0209784_100007 | 3300025224 | Bacteria | 747715 |
| 150 | Ga0209566_100009 | 3300025225 | Bacteria | 554018 |
| 151 | Ga0209674_100021 | 3300025226 | Bacteria | 629811 |
| 152 | Ga0209147_100009 | 3300025229 | Bacteria | 747409 |
| 153 | Ga0209563_100018 | 3300025230 | Bacteria | 747850 |
| 154 | Ga0207427_100005 | 3300025231 | Bacteria | 797999 |
| 155 | Ga0207427_100006 | 3300025231 | Bacteria | 785415 |
| 156 | Ga0209437_100013 | 3300025233 | Bacteria | 785457 |
| 157 | Ga0209437_100018 | 3300025233 | Bacteria | 694400 |
| 158 | Ga0209258_100237 | 3300025242 | Bacteria | 102220 |
| 159 | Ga0209646_1000234 | 3300025246 | Bacteria | 57682 |
| 160 | Ga0209677_100012 | 3300025253 | Bacteria | 554018 |
| 161 | Ga0209233_1000021 | 3300025261 | Bacteria | 798078 |
| 162 | Ga0209233_1000022 | 3300025261 | Bacteria | 785415 |
| 163 | Ga0209675_1005173 | 3300025291 | Bacteria | 5542 |
| 164 | Ga0209676_1000015 | 3300025292 | Bacteria | 784458 |
| 165 | Ga0209676_1000157 | 3300025292 | Bacteria | 163094 |
| 166 | Ga0209676_1000222 | 3300025292 | Bacteria | 124695 |
| 167 | Ga0209676_1000242 | 3300025292 | Bacteria | 117224 |
| 168 | Ga0209676_1000583 | 3300025292 | Bacteria | 54696 |
| 169 | Ga0209676_1002004 | 3300025292 | Bacteria | 16080 |
| 170 | Ga0209050_1000030 | 3300025298 | Bacteria | 463381 |
| 171 | Ga0209050_1000061 | 3300025298 | Bacteria | 321435 |
| 172 | Ga0209050_1000296 | 3300025298 | Bacteria | 104732 |
| 173 | Ga0209050_1005565 | 3300025298 | Bacteria | 7840 |
| 174 | Ga0209051_1000088 | 3300025303 | Bacteria | 180480 |
| 175 | Ga0209051_1000143 | 3300025303 | Bacteria | 135182 |
| 176 | Ga0209051_1000487 | 3300025303 | Bacteria | 51194 |
| 177 | Ga0209051_1006284 | 3300025303 | Bacteria | 6732 |
| 178 | Ga0209257_1000143 | 3300025304 | Bacteria | 199975 |
| 179 | Ga0209257_1027342 | 3300025304 | Bacteria | 1901 |
| 180 | Ga0207656_10000009 | 3300025321 | Bacteria | 245637 |
| 181 | Ga0207696_1000055 | 3300025711 | Bacteria | 258289 |
| 182 | Ga0207696_1000127 | 3300025711 | Bacteria | 135531 |
| 183 | Ga0207696_1000151 | 3300025711 | Bacteria | 120171 |
| 184 | Ga0207696_1000165 | 3300025711 | Bacteria | 104683 |
| 185 | Ga0207696_1001549 | 3300025711 | Bacteria | 12278 |
| 186 | Ga0207696_1003732 | 3300025711 | Bacteria | 6810 |
| 187 | Ga0207696_1004751 | 3300025711 | Bacteria | 5781 |
| 188 | Ga0207696_1013295 | 3300025711 | Bacteria | 2875 |
| 189 | Ga0207696_1017423 | 3300025711 | Bacteria | 2380 |
| 190 | Ga0207696_1021743 | 3300025711 | Bacteria | 2050 |
| 191 | Ga0207655_1000135 | 3300025728 | Bacteria | 143597 |
| 192 | Ga0207655_1000348 | 3300025728 | Bacteria | 67077 |
| 193 | Ga0207655_1000603 | 3300025728 | Bacteria | 43527 |
| 194 | Ga0207655_1000652 | 3300025728 | Bacteria | 41403 |
| 195 | Ga0207655_1000662 | 3300025728 | Bacteria | 40724 |
| 196 | Ga0207655_1001765 | 3300025728 | Bacteria | 18889 |
| 197 | Ga0207655_1006522 | 3300025728 | Bacteria | 7715 |
| 198 | Ga0207655_1007418 | 3300025728 | Bacteria | 7113 |
| 199 | Ga0207655_1010161 | 3300025728 | Bacteria | 5745 |
| 200 | Ga0207655_1045398 | 3300025728 | Bacteria | 1835 |
| 201 | Ga0207655_1049995 | 3300025728 | Bacteria | 1702 |
| 202 | Ga0207713_1000103 | 3300025735 | Bacteria | 138415 |
| 203 | Ga0207713_1000126 | 3300025735 | Bacteria | 118913 |
| 204 | Ga0207713_1000692 | 3300025735 | Bacteria | 31614 |
| 205 | Ga0207713_1000735 | 3300025735 | Bacteria | 30569 |
| 206 | Ga0207713_1002220 | 3300025735 | Bacteria | 14390 |
| 207 | Ga0207713_1002937 | 3300025735 | Bacteria | 11920 |
| 208 | Ga0207713_1003840 | 3300025735 | Bacteria | 10043 |
| 209 | Ga0207713_1003859 | 3300025735 | Bacteria | 9999 |
| 210 | Ga0207713_1003907 | 3300025735 | Bacteria | 9920 |
| 211 | Ga0207713_1009074 | 3300025735 | Bacteria | 5649 |
| 212 | Ga0207713_1009075 | 3300025735 | Bacteria | 5649 |
| 213 | Ga0207713_1011679 | 3300025735 | Bacteria | 4753 |
| 214 | Ga0207713_1012398 | 3300025735 | Bacteria | 4563 |
| 215 | Ga0207713_1015569 | 3300025735 | Bacteria | 3896 |
| 216 | Ga0207713_1019564 | 3300025735 | Bacteria | 3306 |
| 217 | Ga0207713_1025943 | 3300025735 | Bacteria | 2695 |
| 218 | Ga0207713_1030420 | 3300025735 | Bacteria | 2404 |
| 219 | Ga0207713_1088745 | 3300025735 | Bacteria | 1092 |
| 220 | Ga0207671_10000027 | 3300025914 | Bacteria | 264907 |
| 221 | Ga0207649_10000007 | 3300025920 | Bacteria | 334217 |
| 222 | Ga0207681_10000488 | 3300025923 | Bacteria | 27801 |
| 223 | Ga0207681_10001509 | 3300025923 | Bacteria | 15021 |
| 224 | Ga0207650_10000178 | 3300025925 | Bacteria | 74821 |
| 225 | Ga0207650_10000210 | 3300025925 | Bacteria | 66574 |
| 226 | Ga0207706_10000050 | 3300025933 | Bacteria | 116811 |
| 227 | Ga0207706_10001275 | 3300025933 | Bacteria | 25420 |
| 228 | Ga0207686_10010242 | 3300025934 | Bacteria | 5100 |
| 229 | Ga0207709_10000107 | 3300025935 | Bacteria | 129240 |
| 230 | Ga0207709_10000269 | 3300025935 | Bacteria | 61223 |
| 231 | Ga0207709_10002112 | 3300025935 | Bacteria | 12786 |
| 232 | Ga0207709_10051282 | 3300025935 | Bacteria | 2529 |
| 233 | Ga0207709_10055190 | 3300025935 | Bacteria | 2453 |
| 234 | Ga0207709_10074275 | 3300025935 | Bacteria | 2169 |
| 235 | Ga0207709_10129988 | 3300025935 | Bacteria | 1715 |
| 236 | Ga0207679_10000013 | 3300025945 | Bacteria | 334197 |
| 237 | Ga0207712_10007685 | 3300025961 | Bacteria | 6817 |
| 238 | Ga0207640_10009942 | 3300025981 | Bacteria | 5343 |
| 239 | Ga0207639_10001234 | 3300026041 | Bacteria | 17314 |
| 240 | Ga0209281_1000091 | 3300027111 | Bacteria | 242588 |
| 241 | Ga0209281_1000237 | 3300027111 | Bacteria | 112688 |
| 242 | Ga0209389_1000065 | 3300027296 | Bacteria | 102064 |
| 243 | Ga0209371_1000231 | 3300027312 | Bacteria | 71359 |
| 244 | Ga0209371_1000445 | 3300027312 | Bacteria | 41588 |
| 245 | Ga0209969_1003756 | 3300027360 | Bacteria | 2105 |
| 246 | Ga0209981_1003805 | 3300027378 | Bacteria | 1965 |
| 247 | Ga0209996_1004309 | 3300027395 | Bacteria | 1808 |
| 248 | Ga0209999_1005748 | 3300027543 | Bacteria | 2232 |
| 249 | Ga0209982_1004394 | 3300027552 | Bacteria | 2017 |
| 250 | Ga0207428_10042158 | 3300027907 | Bacteria | 3692 |
| 251 | Ga0207428_10043727 | 3300027907 | Bacteria | 3616 |
| 252 | Ga0268266_10003207 | 3300028379 | Bacteria | 16549 |
| 253 | Ga0268266_10157208 | 3300028379 | Bacteria | 2054 |
| 254 | Ga0268266_10572784 | 3300028379 | Bacteria | 1083 |
| 255 | Ga0307517_10032796 | 3300028786 | Bacteria | 5989 |
| 256 | Ga0268256_1000192 | 3300030500 | Bacteria | 71359 |
| 257 | Ga0268256_1000402 | 3300030500 | Bacteria | 39342 |
| 258 | Ga0307511_10024751 | 3300030521 | Bacteria | 5553 |
| 259 | Ga0307511_10068194 | 3300030521 | Bacteria | 2630 |
| 260 | Ga0316177_1089383 | 3300030731 | Bacteria | 2008 |
| 261 | Ga0316179_1069431 | 3300030734 | Bacteria | 1932 |
| 262 | Ga0316178_1080449 | 3300030735 | Bacteria | 31707 |
| 263 | Ga0316183_1089988 | 3300030742 | Bacteria | 1768 |
| 264 | Ga0316183_1121923 | 3300030742 | Bacteria | 2900 |
| 265 | Ga0316183_1199248 | 3300030742 | Bacteria | 1594 |
| 266 | Ga0316181_1110545 | 3300030744 | Bacteria | 2151 |
| 267 | Ga0307513_10010765 | 3300031456 | Bacteria | 11429 |
| 268 | Ga0307509_10066245 | 3300031507 | Bacteria | 3790 |
| 269 | Ga0307408_100014056 | 3300031548 | Bacteria | 5318 |
| 270 | Ga0307408_100055360 | 3300031548 | Bacteria | 2872 |
| 271 | Ga0307408_100087097 | 3300031548 | Bacteria | 2349 |
| 272 | Ga0307408_100274335 | 3300031548 | Bacteria | 1401 |
| 273 | Ga0307405_10025032 | 3300031731 | Bacteria | 3420 |
| 274 | Ga0307405_10049058 | 3300031731 | Bacteria | 2607 |
| 275 | Ga0307413_10014349 | 3300031824 | Bacteria | 4020 |
| 276 | Ga0307407_10124207 | 3300031903 | Bacteria | 1641 |
| 277 | Ga0307412_10059225 | 3300031911 | Bacteria | 2565 |
| 278 | Ga0307412_10455015 | 3300031911 | Bacteria | 1055 |
| 279 | Ga0307409_100008613 | 3300031995 | Bacteria | 6203 |
| 280 | Ga0307409_100010758 | 3300031995 | Bacteria | 5715 |
| 281 | Ga0307416_100248799 | 3300032002 | Bacteria | 1728 |
| 282 | Ga0307416_100477053 | 3300032002 | Bacteria | 1306 |
| 283 | Ga0307414_10170457 | 3300032004 | Bacteria | 1739 |
| 284 | Ga0307411_10255064 | 3300032005 | Bacteria | 1381 |
| 285 | Ga0307510_10033908 | 3300033180 | Bacteria | 5725 |
| 286 | Ga0316584_0083827 | 3300036712 | Bacteria | 2387 |
| 287 | Ga0316584_0084182 | 3300036712 | Bacteria | 2382 |
| 288 | Ga0439436_0005819 | 3300041404 | Bacteria | 3778 |
| 289 | Ga0439438_000296 | 3300041405 | Bacteria | 22341 |
| 290 | Ga0439438_000440 | 3300041405 | Bacteria | 18928 |
| 291 | Ga0439438_001725 | 3300041405 | Bacteria | 9624 |
| 292 | Ga0439438_003887 | 3300041405 | Bacteria | 5885 |
| 293 | Ga0439438_008515 | 3300041405 | Bacteria | 3393 |
| 294 | Ga0439438_009972 | 3300041405 | Bacteria | 3040 |
| 295 | Ga0439438_011123 | 3300041405 | Bacteria | 2817 |
| 296 | Ga0439438_015415 | 3300041405 | Bacteria | 2249 |
| 297 | Ga0439447_000380 | 3300041407 | Bacteria | 16186 |
| 298 | Ga0439447_000690 | 3300041407 | Bacteria | 12516 |
| 299 | Ga0439447_001108 | 3300041407 | Bacteria | 9772 |
| 300 | Ga0439447_003266 | 3300041407 | Bacteria | 5765 |
| 301 | Ga0439447_004722 | 3300041407 | Bacteria | 4643 |
| 302 | Ga0439447_038304 | 3300041407 | Bacteria | 1178 |
| 303 | Ga0439466_0000240 | 3300041411 | Bacteria | 21440 |
| 304 | Ga0439466_0002174 | 3300041411 | Bacteria | 7689 |
| 305 | Ga0439466_0002581 | 3300041411 | Bacteria | 7093 |
| 306 | Ga0439466_0002774 | 3300041411 | Bacteria | 6854 |
| 307 | Ga0439466_0003780 | 3300041411 | Bacteria | 5848 |
| 308 | Ga0439466_0003898 | 3300041411 | Bacteria | 5758 |
| 309 | Ga0439466_0004111 | 3300041411 | Bacteria | 5620 |
| 310 | Ga0439466_0008138 | 3300041411 | Bacteria | 3952 |
| 311 | Ga0439466_0011670 | 3300041411 | Bacteria | 3247 |
| 312 | Ga0439431_0008263 | 3300041997 | Bacteria | 2336 |
| 313 | Ga0439437_005172 | 3300042000 | Bacteria | 1433 |
| 314 | Ga0439432_001415 | 3300042006 | Bacteria | 9031 |
| 315 | Ga0439432_003836 | 3300042006 | Bacteria | 5543 |
| 316 | Ga0439432_004227 | 3300042006 | Bacteria | 5251 |
| 317 | Ga0439432_007970 | 3300042006 | Bacteria | 3735 |
| 318 | Ga0439432_008448 | 3300042006 | Bacteria | 3615 |
| 319 | Ga0439432_014077 | 3300042006 | Bacteria | 2710 |
| 320 | Ga0439432_029655 | 3300042006 | Bacteria | 1777 |
| 321 | Ga0439432_032063 | 3300042006 | Bacteria | 1696 |
| 322 | Ga0439432_054155 | 3300042006 | Bacteria | 1246 |
| 323 | Ga0439452_000190 | 3300042010 | Bacteria | 45505 |
| 324 | Ga0439452_001782 | 3300042010 | Bacteria | 8392 |
| 325 | Ga0439452_002240 | 3300042010 | Bacteria | 7252 |
| 326 | Ga0439452_002643 | 3300042010 | Bacteria | 6526 |
| 327 | Ga0439452_002983 | 3300042010 | Bacteria | 6016 |
| 328 | Ga0439452_003229 | 3300042010 | Bacteria | 5766 |
| 329 | Ga0439452_007923 | 3300042010 | Bacteria | 3219 |
| 330 | Ga0439452_010851 | 3300042010 | Bacteria | 2635 |
| 331 | Ga0439455_0004409 | 3300042012 | Bacteria | 2787 |
| 332 | Ga0439456_000021 | 3300042013 | Bacteria | 60440 |
| 333 | Ga0439456_001799 | 3300042013 | Bacteria | 4325 |
| 334 | Ga0439456_009110 | 3300042013 | Bacteria | 2051 |
| 335 | Ga0439456_009135 | 3300042013 | Bacteria | 2047 |
| 336 | Ga0439456_017369 | 3300042013 | Bacteria | 1508 |
| 337 | Ga0439456_030367 | 3300042013 | Bacteria | 1156 |
| 338 | Ga0439463_000264 | 3300042016 | Bacteria | 14461 |
| 339 | Ga0439463_000940 | 3300042016 | Bacteria | 8001 |
| 340 | Ga0439463_007878 | 3300042016 | Bacteria | 2630 |
| 341 | Ga0439463_013062 | 3300042016 | Bacteria | 2042 |
| 342 | Ga0450911_000055 | 3300042115 | Bacteria | 47324 |
| 343 | Ga0450911_000211 | 3300042115 | Bacteria | 22807 |
| 344 | Ga0450911_002007 | 3300042115 | Bacteria | 4225 |
| 345 | Ga0450911_003352 | 3300042115 | Bacteria | 2847 |
| 346 | Ga0450919_000953 | 3300042121 | Bacteria | 3746 |
| 347 | Ga0450922_001398 | 3300042124 | Bacteria | 2374 |
| 348 | Ga0450900_002909 | 3300042136 | Bacteria | 1860 |
| 349 | Ga0450900_006123 | 3300042136 | Bacteria | 1446 |
| 350 | Ga0450902_002249 | 3300042137 | Bacteria | 2727 |
| 351 | Ga0450902_006853 | 3300042137 | Bacteria | 1752 |
| 352 | Ga0450903_002798 | 3300042138 | Bacteria | 3067 |
| 353 | Ga0450903_005738 | 3300042138 | Bacteria | 2071 |
| 354 | Ga0450903_009946 | 3300042138 | Bacteria | 1544 |
| 355 | Ga0450904_000367 | 3300042139 | Bacteria | 9499 |
| 356 | Ga0450905_000365 | 3300042142 | Bacteria | 5422 |
| 357 | Ga0450906_000309 | 3300042145 | Bacteria | 9838 |
| 358 | Ga0450906_004691 | 3300042145 | Bacteria | 2849 |
| 359 | Ga0450907_000110 | 3300042146 | Bacteria | 31083 |
| 360 | Ga0450907_004724 | 3300042146 | Bacteria | 2334 |
| 361 | Ga0450910_000275 | 3300042147 | Bacteria | 5968 |
| 362 | Ga0439446_0000079 | 3300042156 | Bacteria | 15851 |
| 363 | Ga0439446_0006348 | 3300042156 | Bacteria | 3079 |
| 364 | Ga0450908_002350 | 3300042184 | Bacteria | 3706 |
| 365 | Ga0450909_001360 | 3300042185 | Bacteria | 3398 |
| 366 | Ga0450909_008876 | 3300042185 | Bacteria | 1464 |
| 367 | Ga0450909_016365 | 3300042185 | Bacteria | 1095 |
| 368 | Ga0439434_0000244 | 3300042435 | Bacteria | 15200 |
| 369 | Ga0439434_0007094 | 3300042435 | Bacteria | 3275 |
| 370 | Ga0439464_0007532 | 3300042439 | Bacteria | 2847 |
| 371 | Ga0439460_0005294 | 3300042461 | Bacteria | 3162 |
| 372 | Ga0439460_0008161 | 3300042461 | Bacteria | 2640 |
| 373 | Ga0450916_002327 | 3300042530 | Bacteria | 2009 |
| 374 | Ga0450901_001714 | 3300042533 | Bacteria | 2472 |
| 375 | Ga0439440_0002407 | 3300042993 | Bacteria | 3537 |
| 376 | Ga0495617_001971 | 3300046452 | Bacteria | 8591 |
| 377 | Ga0495617_004003 | 3300046452 | Bacteria | 5415 |
| 378 | Ga0495617_021959 | 3300046452 | Bacteria | 2156 |
| 379 | Ga0495627_000296 | 3300046453 | Bacteria | 49348 |
| 380 | Ga0495627_000701 | 3300046453 | Bacteria | 25541 |
| 381 | Ga0495627_001391 | 3300046453 | Bacteria | 14329 |
| 382 | Ga0495627_005214 | 3300046453 | Bacteria | 5279 |
| 383 | Ga0495627_012109 | 3300046453 | Bacteria | 3070 |
| 384 | Ga0495627_016909 | 3300046453 | Bacteria | 2489 |
| 385 | Ga0495603_0005896 | 3300046455 | Bacteria | 7322 |
| 386 | Ga0495590_0003265 | 3300046457 | Bacteria | 6632 |
| 387 | Ga0495590_0013086 | 3300046457 | Bacteria | 3059 |
| 388 | Ga0495590_0020549 | 3300046457 | Bacteria | 2345 |
| 389 | Ga0495590_0020958 | 3300046457 | Bacteria | 2319 |
| 390 | Ga0495591_000164 | 3300046458 | Bacteria | 70760 |
| 391 | Ga0495591_000898 | 3300046458 | Bacteria | 20804 |
| 392 | Ga0495591_001277 | 3300046458 | Bacteria | 16078 |
| 393 | Ga0495591_002623 | 3300046458 | Bacteria | 9854 |
| 394 | Ga0495591_004987 | 3300046458 | Bacteria | 6277 |
| 395 | Ga0495591_006161 | 3300046458 | Bacteria | 5370 |
| 396 | Ga0495591_014256 | 3300046458 | Bacteria | 2867 |
| 397 | Ga0495591_016129 | 3300046458 | Bacteria | 2614 |
| 398 | Ga0495591_016982 | 3300046458 | Bacteria | 2512 |
| 399 | Ga0495591_040625 | 3300046458 | Bacteria | 1324 |
| 400 | Ga0495591_042448 | 3300046458 | Bacteria | 1285 |
| 401 | Ga0495638_0010051 | 3300046460 | Bacteria | 6596 |
| 402 | Ga0495638_0015178 | 3300046460 | Bacteria | 5179 |
| 403 | Ga0495638_0017020 | 3300046460 | Bacteria | 4858 |
| 404 | Ga0495638_0028413 | 3300046460 | Bacteria | 3612 |
| 405 | Ga0495638_0037963 | 3300046460 | Bacteria | 3063 |
| 406 | Ga0495638_0109997 | 3300046460 | Bacteria | 1637 |
| 407 | Ga0495638_0134084 | 3300046460 | Bacteria | 1452 |
| 408 | Ga0495638_0142909 | 3300046460 | Bacteria | 1394 |
| 409 | Ga0495638_0151761 | 3300046460 | Bacteria | 1343 |
| 410 | Ga0495653_0003789 | 3300046463 | Bacteria | 12234 |
| 411 | Ga0495653_0003842 | 3300046463 | Bacteria | 12145 |
| 412 | Ga0495653_0014723 | 3300046463 | Bacteria | 6379 |
| 413 | Ga0495653_0038452 | 3300046463 | Bacteria | 3756 |
| 414 | Ga0495653_0045733 | 3300046463 | Bacteria | 3393 |
| 415 | Ga0495653_0061155 | 3300046463 | Bacteria | 2850 |
| 416 | Ga0495650_0000402 | 3300046471 | Bacteria | 72128 |
| 417 | Ga0495650_0006953 | 3300046471 | Bacteria | 6920 |
| 418 | Ga0495650_0011360 | 3300046471 | Bacteria | 4886 |
| 419 | Ga0495650_0025552 | 3300046471 | Bacteria | 2765 |
| 420 | Ga0495650_0026977 | 3300046471 | Bacteria | 2661 |
| 421 | Ga0495650_0038625 | 3300046471 | Bacteria | 2066 |
| 422 | Ga0495650_0042643 | 3300046471 | Bacteria | 1930 |
| 423 | Ga0495582_0007342 | 3300046473 | Bacteria | 6106 |
| 424 | Ga0495605_0000101 | 3300046474 | Bacteria | 107469 |
| 425 | Ga0495605_0000302 | 3300046474 | Bacteria | 53003 |
| 426 | Ga0495605_0000971 | 3300046474 | Bacteria | 19484 |
| 427 | Ga0495605_0002433 | 3300046474 | Bacteria | 11508 |
| 428 | Ga0495605_0003182 | 3300046474 | Bacteria | 9859 |
| 429 | Ga0495605_0003918 | 3300046474 | Bacteria | 8806 |
| 430 | Ga0495605_0008090 | 3300046474 | Bacteria | 5949 |
| 431 | Ga0495605_0095896 | 3300046474 | Bacteria | 1369 |
| 432 | Ga0495639_0004372 | 3300046475 | Bacteria | 6056 |
| 433 | Ga0495584_0001255 | 3300046491 | Bacteria | 15494 |
| 434 | Ga0495584_0002779 | 3300046491 | Bacteria | 9779 |
| 435 | Ga0495584_0005430 | 3300046491 | Bacteria | 6753 |
| 436 | Ga0495584_0017033 | 3300046491 | Bacteria | 3703 |
| 437 | Ga0495584_0021615 | 3300046491 | Bacteria | 3267 |
| 438 | Ga0495584_0056697 | 3300046491 | Bacteria | 1972 |
| 439 | Ga0495584_0092270 | 3300046491 | Bacteria | 1527 |
| 440 | Ga0495585_0001285 | 3300046492 | Bacteria | 20022 |
| 441 | Ga0495585_0002528 | 3300046492 | Bacteria | 13000 |
| 442 | Ga0495585_0004778 | 3300046492 | Bacteria | 8716 |
| 443 | Ga0495585_0014098 | 3300046492 | Bacteria | 4667 |
| 444 | Ga0495585_0047442 | 3300046492 | Bacteria | 2392 |
| 445 | Ga0495585_0049065 | 3300046492 | Bacteria | 2346 |
| 446 | Ga0495585_0053795 | 3300046492 | Bacteria | 2227 |
| 447 | Ga0495585_0145721 | 3300046492 | Bacteria | 1237 |
| 448 | Ga0495594_0035244 | 3300046499 | Bacteria | 2725 |
| 449 | Ga0495596_0000175 | 3300046500 | Bacteria | 44764 |
| 450 | Ga0495596_0066402 | 3300046500 | Bacteria | 1403 |
| 451 | Ga0495607_0000268 | 3300046501 | Bacteria | 55932 |
| 452 | Ga0495607_0000365 | 3300046501 | Bacteria | 46525 |
| 453 | Ga0495607_0005597 | 3300046501 | Bacteria | 8960 |
| 454 | Ga0495607_0005788 | 3300046501 | Bacteria | 8793 |
| 455 | Ga0495607_0007200 | 3300046501 | Bacteria | 7724 |
| 456 | Ga0495607_0010681 | 3300046501 | Bacteria | 6154 |
| 457 | Ga0495607_0011810 | 3300046501 | Bacteria | 5791 |
| 458 | Ga0495607_0013345 | 3300046501 | Bacteria | 5386 |
| 459 | Ga0495607_0013669 | 3300046501 | Bacteria | 5309 |
| 460 | Ga0495607_0030494 | 3300046501 | Bacteria | 3310 |
| 461 | Ga0495607_0044080 | 3300046501 | Bacteria | 2632 |
| 462 | Ga0495607_0125063 | 3300046501 | Bacteria | 1345 |
| 463 | Ga0495607_0171712 | 3300046501 | Bacteria | 1094 |
| 464 | Ga0495583_0000300 | 3300046506 | Bacteria | 78677 |
| 465 | Ga0495583_0001652 | 3300046506 | Bacteria | 21664 |
| 466 | Ga0495583_0002663 | 3300046506 | Bacteria | 14865 |
| 467 | Ga0495583_0003013 | 3300046506 | Bacteria | 13456 |
| 468 | Ga0495583_0006176 | 3300046506 | Bacteria | 7886 |
| 469 | Ga0495583_0027546 | 3300046506 | Bacteria | 2804 |
| 470 | Ga0495583_0050015 | 3300046506 | Bacteria | 1911 |
| 471 | Ga0495583_0070558 | 3300046506 | Bacteria | 1536 |
| 472 | Ga0495606_0000115 | 3300046507 | Bacteria | 135589 |
| 473 | Ga0495606_0000285 | 3300046507 | Bacteria | 87775 |
| 474 | Ga0495606_0000964 | 3300046507 | Bacteria | 42126 |
| 475 | Ga0495606_0006355 | 3300046507 | Bacteria | 10924 |
| 476 | Ga0495606_0007604 | 3300046507 | Bacteria | 9637 |
| 477 | Ga0495606_0014817 | 3300046507 | Bacteria | 6056 |
| 478 | Ga0495606_0025115 | 3300046507 | Bacteria | 4276 |
| 479 | Ga0495606_0056155 | 3300046507 | Bacteria | 2542 |
| 480 | Ga0495606_0060785 | 3300046507 | Bacteria | 2419 |
| 481 | Ga0495606_0062836 | 3300046507 | Bacteria | 2368 |
| 482 | Ga0495610_0002956 | 3300046512 | Bacteria | 13703 |
| 483 | Ga0495610_0003937 | 3300046512 | Bacteria | 11243 |
| 484 | Ga0495610_0006042 | 3300046512 | Bacteria | 8452 |
| 485 | Ga0495610_0006114 | 3300046512 | Bacteria | 8395 |
| 486 | Ga0495610_0010481 | 3300046512 | Bacteria | 5755 |
| 487 | Ga0495610_0010736 | 3300046512 | Bacteria | 5665 |
| 488 | Ga0495610_0011500 | 3300046512 | Bacteria | 5409 |
| 489 | Ga0495610_0012730 | 3300046512 | Bacteria | 5039 |
| 490 | Ga0495610_0013954 | 3300046512 | Bacteria | 4747 |
| 491 | Ga0495610_0023432 | 3300046512 | Bacteria | 3356 |
| 492 | Ga0495610_0051382 | 3300046512 | Bacteria | 2007 |
| 493 | Ga0495616_0011579 | 3300046513 | Bacteria | 5047 |
| 494 | Ga0495616_0033194 | 3300046513 | Bacteria | 2691 |
| 495 | Ga0495616_0033805 | 3300046513 | Bacteria | 2660 |
| 496 | Ga0495616_0041203 | 3300046513 | Bacteria | 2356 |
| 497 | Ga0495616_0056611 | 3300046513 | Bacteria | 1936 |
| 498 | Ga0495616_0058624 | 3300046513 | Bacteria | 1895 |
| 499 | Ga0495620_0000023 | 3300046515 | Bacteria | 131512 |
| 500 | Ga0495620_0000040 | 3300046515 | Bacteria | 112660 |
| 501 | Ga0495620_0000376 | 3300046515 | Bacteria | 30597 |
| 502 | Ga0495620_0004033 | 3300046515 | Bacteria | 8341 |
| 503 | Ga0495620_0007287 | 3300046515 | Bacteria | 6024 |
| 504 | Ga0495620_0008993 | 3300046515 | Bacteria | 5334 |
| 505 | Ga0495620_0010021 | 3300046515 | Bacteria | 5012 |
| 506 | Ga0495620_0012309 | 3300046515 | Bacteria | 4428 |
| 507 | Ga0495620_0028528 | 3300046515 | Bacteria | 2594 |
| 508 | Ga0495631_0000807 | 3300046518 | Bacteria | 20009 |
| 509 | Ga0495631_0002636 | 3300046518 | Bacteria | 10012 |
| 510 | Ga0495631_0003660 | 3300046518 | Bacteria | 8393 |
| 511 | Ga0495631_0011556 | 3300046518 | Bacteria | 4339 |
| 512 | Ga0495631_0021897 | 3300046518 | Bacteria | 2974 |
| 513 | Ga0495631_0037171 | 3300046518 | Bacteria | 2170 |
| 514 | Ga0495632_0000353 | 3300046519 | Bacteria | 43688 |
| 515 | Ga0495632_0001535 | 3300046519 | Bacteria | 19069 |
| 516 | Ga0495632_0001892 | 3300046519 | Bacteria | 16771 |
| 517 | Ga0495632_0006047 | 3300046519 | Bacteria | 7857 |
| 518 | Ga0495632_0009605 | 3300046519 | Bacteria | 5814 |
| 519 | Ga0495632_0009696 | 3300046519 | Bacteria | 5780 |
| 520 | Ga0495632_0013177 | 3300046519 | Bacteria | 4730 |
| 521 | Ga0495632_0014458 | 3300046519 | Bacteria | 4463 |
| 522 | Ga0495632_0014787 | 3300046519 | Bacteria | 4402 |
| 523 | Ga0495632_0017847 | 3300046519 | Bacteria | 3905 |
| 524 | Ga0495632_0064465 | 3300046519 | Bacteria | 1771 |
| 525 | Ga0495632_0152339 | 3300046519 | Bacteria | 1068 |
| 526 | Ga0495632_0156301 | 3300046519 | Bacteria | 1052 |
| 527 | Ga0495637_0000054 | 3300046520 | Bacteria | 99531 |
| 528 | Ga0495637_0000194 | 3300046520 | Bacteria | 47572 |
| 529 | Ga0495637_0001359 | 3300046520 | Bacteria | 14692 |
| 530 | Ga0495637_0001467 | 3300046520 | Bacteria | 13872 |
| 531 | Ga0495637_0002835 | 3300046520 | Bacteria | 9400 |
| 532 | Ga0495637_0005571 | 3300046520 | Bacteria | 6392 |
| 533 | Ga0495637_0006074 | 3300046520 | Bacteria | 6098 |
| 534 | Ga0495637_0006097 | 3300046520 | Bacteria | 6070 |
| 535 | Ga0495637_0007743 | 3300046520 | Bacteria | 5312 |
| 536 | Ga0495637_0056099 | 3300046520 | Bacteria | 1631 |
| 537 | Ga0495637_0061985 | 3300046520 | Bacteria | 1532 |
| 538 | Ga0495637_0070823 | 3300046520 | Bacteria | 1407 |
| 539 | Ga0495643_0000280 | 3300046522 | Bacteria | 72628 |
| 540 | Ga0495643_0000460 | 3300046522 | Bacteria | 51847 |
| 541 | Ga0495643_0001333 | 3300046522 | Bacteria | 23352 |
| 542 | Ga0495643_0003285 | 3300046522 | Bacteria | 11942 |
| 543 | Ga0495643_0008958 | 3300046522 | Bacteria | 6287 |
| 544 | Ga0495643_0028711 | 3300046522 | Bacteria | 3115 |
| 545 | Ga0495643_0036074 | 3300046522 | Bacteria | 2718 |
| 546 | Ga0495643_0044905 | 3300046522 | Bacteria | 2400 |
| 547 | Ga0495643_0074277 | 3300046522 | Bacteria | 1781 |
| 548 | Ga0495643_0100321 | 3300046522 | Bacteria | 1484 |
| 549 | Ga0495644_0001093 | 3300046523 | Bacteria | 11203 |
| 550 | Ga0495644_0008585 | 3300046523 | Bacteria | 3933 |
| 551 | Ga0495644_0063253 | 3300046523 | Bacteria | 1391 |
| 552 | Ga0495644_0073552 | 3300046523 | Bacteria | 1285 |
| 553 | Ga0495648_0001218 | 3300046524 | Bacteria | 25789 |
| 554 | Ga0495648_0002215 | 3300046524 | Bacteria | 18204 |
| 555 | Ga0495648_0002926 | 3300046524 | Bacteria | 15343 |
| 556 | Ga0495648_0006423 | 3300046524 | Bacteria | 9598 |
| 557 | Ga0495648_0007250 | 3300046524 | Bacteria | 8901 |
| 558 | Ga0495648_0014356 | 3300046524 | Bacteria | 5802 |
| 559 | Ga0495648_0015979 | 3300046524 | Bacteria | 5422 |
| 560 | Ga0495648_0017577 | 3300046524 | Bacteria | 5105 |
| 561 | Ga0495648_0018458 | 3300046524 | Bacteria | 4936 |
| 562 | Ga0495648_0039218 | 3300046524 | Bacteria | 3016 |
| 563 | Ga0495648_0044656 | 3300046524 | Bacteria | 2764 |
| 564 | Ga0495666_0007271 | 3300046526 | Bacteria | 5555 |
| 565 | Ga0495666_0030808 | 3300046526 | Bacteria | 2630 |
| 566 | Ga0495642_0000530 | 3300046528 | Bacteria | 19384 |
| 567 | Ga0495642_0003931 | 3300046528 | Bacteria | 5813 |
| 568 | Ga0495642_0011373 | 3300046528 | Bacteria | 3418 |
| 569 | Ga0495654_0001074 | 3300046530 | Bacteria | 19916 |
| 570 | Ga0495654_0001863 | 3300046530 | Bacteria | 14044 |
| 571 | Ga0495654_0004272 | 3300046530 | Bacteria | 8532 |
| 572 | Ga0495654_0004926 | 3300046530 | Bacteria | 7854 |
| 573 | Ga0495654_0007882 | 3300046530 | Bacteria | 5922 |
| 574 | Ga0495654_0008140 | 3300046530 | Bacteria | 5807 |
| 575 | Ga0495654_0018594 | 3300046530 | Bacteria | 3639 |
| 576 | Ga0495654_0032698 | 3300046530 | Bacteria | 2635 |
| 577 | Ga0495654_0052389 | 3300046530 | Bacteria | 1987 |
| 578 | Ga0495654_0119126 | 3300046530 | Bacteria | 1196 |
| 579 | Ga0495654_0140575 | 3300046530 | Bacteria | 1076 |
| 580 | Ga0495586_0039845 | 3300046535 | Bacteria | 2526 |
| 581 | Ga0495587_0003815 | 3300046536 | Bacteria | 9997 |
| 582 | Ga0495587_0115538 | 3300046536 | Bacteria | 1539 |
| 583 | Ga0495609_0000061 | 3300046538 | Bacteria | 139848 |
| 584 | Ga0495609_0000100 | 3300046538 | Bacteria | 100831 |
| 585 | Ga0495609_0000178 | 3300046538 | Bacteria | 64164 |
| 586 | Ga0495609_0025169 | 3300046538 | Bacteria | 2729 |
| 587 | Ga0495609_0030557 | 3300046538 | Bacteria | 2452 |
| 588 | Ga0495609_0033362 | 3300046538 | Bacteria | 2337 |
| 589 | Ga0495609_0057505 | 3300046538 | Bacteria | 1721 |
| 590 | Ga0495597_0000121 | 3300046542 | Bacteria | 70801 |
| 591 | Ga0495597_0023133 | 3300046542 | Bacteria | 2876 |
| 592 | Ga0495597_0030573 | 3300046542 | Bacteria | 2454 |
| 593 | Ga0495597_0032404 | 3300046542 | Bacteria | 2372 |
| 594 | Ga0495597_0067047 | 3300046542 | Bacteria | 1554 |
| 595 | Ga0495597_0090955 | 3300046542 | Bacteria | 1295 |
| 596 | Ga0495645_0147243 | 3300046543 | Bacteria | 1639 |
| 597 | Ga0495622_0008643 | 3300046557 | Bacteria | 4718 |
| 598 | Ga0495622_0017305 | 3300046557 | Bacteria | 3355 |
| 599 | Ga0495622_0058951 | 3300046557 | Bacteria | 1777 |
| 600 | Ga0495633_0000191 | 3300046558 | Bacteria | 78838 |
| 601 | Ga0495633_0030976 | 3300046558 | Bacteria | 2596 |
| 602 | Ga0495668_0008556 | 3300046616 | Bacteria | 6370 |
| 603 | Ga0495668_0009359 | 3300046616 | Bacteria | 6023 |
| 604 | Ga0495668_0025629 | 3300046616 | Bacteria | 3349 |
| 605 | Ga0495668_0033263 | 3300046616 | Bacteria | 2897 |
| 606 | Ga0495668_0036664 | 3300046616 | Bacteria | 2747 |
| 607 | Ga0495634_0012719 | 3300046642 | Bacteria | 6091 |
| 608 | Ga0495634_0090380 | 3300046642 | Bacteria | 1989 |
| 609 | Ga0495611_0000539 | 3300046648 | Bacteria | 22207 |
| 610 | Ga0495611_0001529 | 3300046648 | Bacteria | 11385 |
| 611 | Ga0495611_0059730 | 3300046648 | Bacteria | 1731 |
| 612 | Ga0495625_0000147 | 3300046660 | Bacteria | 107983 |
| 613 | Ga0495625_0023415 | 3300046660 | Bacteria | 4718 |
| 614 | Ga0495625_0034672 | 3300046660 | Bacteria | 3723 |
| 615 | Ga0495625_0059005 | 3300046660 | Bacteria | 2724 |
| 616 | Ga0495625_0107502 | 3300046660 | Bacteria | 1909 |
| 617 | Ga0495635_0000604 | 3300046663 | Bacteria | 23105 |
| 618 | Ga0495659_0002389 | 3300046664 | Bacteria | 6063 |
| 619 | Ga0495659_0004322 | 3300046664 | Bacteria | 4474 |
| 620 | Ga0495661_0000165 | 3300046665 | Bacteria | 78666 |
| 621 | Ga0495661_0000282 | 3300046665 | Bacteria | 57833 |
| 622 | Ga0495661_0000315 | 3300046665 | Bacteria | 54229 |
| 623 | Ga0495661_0000463 | 3300046665 | Bacteria | 43094 |
| 624 | Ga0495661_0002401 | 3300046665 | Bacteria | 14454 |
| 625 | Ga0495661_0014406 | 3300046665 | Bacteria | 5298 |
| 626 | Ga0495661_0025512 | 3300046665 | Bacteria | 3816 |
| 627 | Ga0495661_0036084 | 3300046665 | Bacteria | 3097 |
| 628 | Ga0495661_0111889 | 3300046665 | Bacteria | 1520 |
| 629 | Ga0495661_0144908 | 3300046665 | Bacteria | 1288 |
| 630 | Ga0495588_0076149 | 3300046674 | Bacteria | 1748 |
| 631 | Ga0495623_0026764 | 3300046679 | Bacteria | 3711 |
| 632 | Ga0495646_0031537 | 3300046680 | Bacteria | 3301 |
| 633 | Ga0495646_0142047 | 3300046680 | Bacteria | 1341 |
| 634 | Ga0495669_0010487 | 3300046684 | Bacteria | 3917 |
| 635 | Ga0495613_0027732 | 3300046689 | Bacteria | 4215 |
| 636 | Ga0495613_0303292 | 3300046689 | Bacteria | 1105 |
| 637 | Ga0495624_0034097 | 3300046690 | Bacteria | 3295 |
| 638 | Ga0495670_0004276 | 3300046691 | Bacteria | 6992 |
| 639 | Ga0495670_0005838 | 3300046691 | Bacteria | 6031 |
| 640 | Ga0495670_0031544 | 3300046691 | Bacteria | 2634 |
| 641 | Ga0495670_0065003 | 3300046691 | Bacteria | 1838 |
| 642 | Ga0495671_0000442 | 3300046692 | Bacteria | 32850 |
| 643 | Ga0495671_0000471 | 3300046692 | Bacteria | 31523 |
| 644 | Ga0495671_0004890 | 3300046692 | Bacteria | 7924 |
| 645 | Ga0495671_0012137 | 3300046692 | Bacteria | 4709 |
| 646 | Ga0495671_0015315 | 3300046692 | Bacteria | 4111 |
| 647 | Ga0495671_0030969 | 3300046692 | Bacteria | 2737 |
| 648 | Ga0495671_0047897 | 3300046692 | Bacteria | 2133 |
| 649 | Ga0495671_0122815 | 3300046692 | Bacteria | 1266 |
| 650 | Ga0495649_0001612 | 3300046694 | Bacteria | 16811 |
| 651 | Ga0495649_0008675 | 3300046694 | Bacteria | 6103 |
| 652 | Ga0495649_0009370 | 3300046694 | Bacteria | 5825 |
| 653 | Ga0495649_0011587 | 3300046694 | Bacteria | 5166 |
| 654 | Ga0495649_0024453 | 3300046694 | Bacteria | 3368 |
| 655 | Ga0495649_0024463 | 3300046694 | Bacteria | 3367 |
| 656 | Ga0495649_0024819 | 3300046694 | Bacteria | 3342 |
| 657 | Ga0495649_0026853 | 3300046694 | Bacteria | 3197 |
| 658 | Ga0495649_0041235 | 3300046694 | Bacteria | 2525 |
| 659 | Ga0495649_0042328 | 3300046694 | Bacteria | 2488 |
| 660 | Ga0495649_0086350 | 3300046694 | Bacteria | 1674 |
| 661 | Ga0495649_0161274 | 3300046694 | Bacteria | 1175 |
| 662 | Ga0495589_0009577 | 3300046794 | Bacteria | 5037 |
| 663 | Ga0495589_0018147 | 3300046794 | Bacteria | 3609 |
| 664 | Ga0495589_0035008 | 3300046794 | Bacteria | 2519 |
| 665 | Ga0495589_0036685 | 3300046794 | Bacteria | 2456 |
| 666 | Ga0495589_0050308 | 3300046794 | Bacteria | 2061 |
| 667 | Ga0495589_0073111 | 3300046794 | Bacteria | 1673 |
| 668 | Ga0495589_0089115 | 3300046794 | Bacteria | 1498 |
| 669 | Ga0495660_0002249 | 3300046810 | Bacteria | 12425 |
| 670 | Ga0495660_0002584 | 3300046810 | Bacteria | 11503 |
| 671 | Ga0495660_0003663 | 3300046810 | Bacteria | 9456 |
| 672 | Ga0495660_0013969 | 3300046810 | Bacteria | 4655 |
| 673 | Ga0495660_0024180 | 3300046810 | Bacteria | 3461 |
| 674 | Ga0495660_0024950 | 3300046810 | Bacteria | 3399 |
| 675 | Ga0495660_0031961 | 3300046810 | Bacteria | 2957 |
| 676 | Ga0495660_0044275 | 3300046810 | Bacteria | 2449 |
| 677 | Ga0495660_0048195 | 3300046810 | Bacteria | 2330 |
| 678 | Ga0495660_0053515 | 3300046810 | Bacteria | 2190 |
| 679 | Ga0495660_0057105 | 3300046810 | Bacteria | 2106 |
| 680 | Ga0495604_0017122 | 3300047317 | Bacteria | 5797 |
| 681 | Ga0495604_0060498 | 3300047317 | Bacteria | 2900 |
| 682 | Ga0495604_0080944 | 3300047317 | Bacteria | 2432 |
| 683 | Ga0495674_0032307 | 3300047319 | Bacteria | 4748 |
| 684 | Ga0495672_0002590 | 3300047320 | Bacteria | 16392 |
| 685 | Ga0495672_0003292 | 3300047320 | Bacteria | 13971 |
| 686 | Ga0495672_0004877 | 3300047320 | Bacteria | 10791 |
| 687 | Ga0495672_0012275 | 3300047320 | Bacteria | 5991 |
| 688 | Ga0495672_0014189 | 3300047320 | Bacteria | 5466 |
| 689 | Ga0495672_0017754 | 3300047320 | Bacteria | 4748 |
| 690 | Ga0495672_0031184 | 3300047320 | Bacteria | 3330 |
| 691 | Ga0495672_0031509 | 3300047320 | Bacteria | 3310 |
| 692 | Ga0495672_0037053 | 3300047320 | Bacteria | 2988 |
| 693 | Ga0495672_0040170 | 3300047320 | Bacteria | 2839 |
| 694 | Ga0495672_0052547 | 3300047320 | Bacteria | 2392 |
| 695 | Ga0495672_0060902 | 3300047320 | Bacteria | 2177 |
| 696 | Ga0495672_0061247 | 3300047320 | Bacteria | 2169 |
| 697 | Ga0495672_0081398 | 3300047320 | Bacteria | 1803 |
| 698 | Ga0495672_0111035 | 3300047320 | Bacteria | 1471 |
| 699 | Ga0495672_0132380 | 3300047320 | Bacteria | 1310 |
| 700 | Ga0495676_0000027 | 3300047321 | Bacteria | 141955 |
| 701 | Ga0495676_0017905 | 3300047321 | Bacteria | 6253 |
| 702 | Ga0495676_0024131 | 3300047321 | Bacteria | 5268 |
| 703 | Ga0495680_0002978 | 3300047322 | Bacteria | 16922 |
| 704 | Ga0495680_0064621 | 3300047322 | Bacteria | 2805 |
| 705 | Ga0495680_0088326 | 3300047322 | Bacteria | 2329 |
| 706 | Ga0495683_0000127 | 3300047323 | Bacteria | 75779 |
| 707 | Ga0495683_0001020 | 3300047323 | Bacteria | 19493 |
| 708 | Ga0495683_0001698 | 3300047323 | Bacteria | 13995 |
| 709 | Ga0495683_0006921 | 3300047323 | Bacteria | 6160 |
| 710 | Ga0495683_0013630 | 3300047323 | Bacteria | 4247 |
| 711 | Ga0495683_0036955 | 3300047323 | Bacteria | 2478 |
| 712 | Ga0495683_0066536 | 3300047323 | Bacteria | 1775 |
| 713 | Ga0495683_0121746 | 3300047323 | Bacteria | 1237 |
| 714 | Ga0495687_008752 | 3300047443 | Bacteria | 5749 |
| 715 | Ga0495687_019335 | 3300047443 | Bacteria | 3346 |
| 716 | Ga0495675_0072084 | 3300047444 | Bacteria | 2179 |
| 717 | Ga0495677_0003730 | 3300047445 | Bacteria | 5895 |
| 718 | Ga0495679_000096 | 3300047446 | Bacteria | 80131 |
| 719 | Ga0495679_001683 | 3300047446 | Bacteria | 12269 |
| 720 | Ga0495679_005660 | 3300047446 | Bacteria | 5510 |
| 721 | Ga0495679_018601 | 3300047446 | Bacteria | 2462 |
| 722 | Ga0495673_0001299 | 3300047469 | Bacteria | 20334 |
| 723 | Ga0495673_0001329 | 3300047469 | Bacteria | 20068 |
| 724 | Ga0495673_0001337 | 3300047469 | Bacteria | 20018 |
| 725 | Ga0495673_0004104 | 3300047469 | Bacteria | 9245 |
| 726 | Ga0495673_0005473 | 3300047469 | Bacteria | 7667 |
| 727 | Ga0495673_0005824 | 3300047469 | Bacteria | 7372 |
| 728 | Ga0495673_0014201 | 3300047469 | Bacteria | 4147 |
| 729 | Ga0495673_0017126 | 3300047469 | Bacteria | 3687 |
| 730 | Ga0495673_0030946 | 3300047469 | Bacteria | 2509 |
| 731 | Ga0495673_0044348 | 3300047469 | Bacteria | 1983 |
| 732 | Ga0495673_0062745 | 3300047469 | Bacteria | 1586 |
| 733 | Ga0495673_0095788 | 3300047469 | Bacteria | 1206 |
| 734 | Ga0495681_0008700 | 3300047470 | Bacteria | 6335 |
| 735 | Ga0495681_0009013 | 3300047470 | Bacteria | 6192 |
| 736 | Ga0495681_0011503 | 3300047470 | Bacteria | 5264 |
| 737 | Ga0495681_0019355 | 3300047470 | Bacteria | 3720 |
| 738 | Ga0495681_0023579 | 3300047470 | Bacteria | 3265 |
| 739 | Ga0495681_0055149 | 3300047470 | Bacteria | 1854 |
| 740 | Ga0495681_0066586 | 3300047470 | Bacteria | 1643 |
| 741 | Ga0495681_0075792 | 3300047470 | Bacteria | 1513 |
| 742 | Ga0495681_0088152 | 3300047470 | Bacteria | 1374 |
| 743 | Ga0495686_0016571 | 3300047472 | Bacteria | 4995 |
| 744 | Ga0495686_0037419 | 3300047472 | Bacteria | 3108 |
| 745 | Ga0495686_0061776 | 3300047472 | Bacteria | 2326 |
| 746 | Ga0495686_0134454 | 3300047472 | Bacteria | 1463 |
| 747 | Ga0495593_0028813 | 3300047673 | Bacteria | 3048 |
| 748 | Ga0495593_0105229 | 3300047673 | Bacteria | 1444 |
| 749 | Ga0495602_0091614 | 3300048088 | Bacteria | 2520 |
| 750 | Ga0495626_0000067 | 3300048091 | Bacteria | 139969 |
| 751 | Ga0495626_0000507 | 3300048091 | Bacteria | 38997 |
| 752 | Ga0495626_0000684 | 3300048091 | Bacteria | 32479 |
| 753 | Ga0495626_0002907 | 3300048091 | Bacteria | 11407 |
| 754 | Ga0495626_0007520 | 3300048091 | Bacteria | 6052 |
| 755 | Ga0495626_0010124 | 3300048091 | Bacteria | 5058 |
| 756 | Ga0495626_0017435 | 3300048091 | Bacteria | 3625 |
| 757 | Ga0495626_0018889 | 3300048091 | Bacteria | 3452 |
| 758 | Ga0495626_0040640 | 3300048091 | Bacteria | 2195 |
| 759 | Ga0495626_0097113 | 3300048091 | Bacteria | 1288 |
| 760 | Ga0496102_0017650 | 3300048905 | Bacteria | 6253 |
| 761 | Ga0496102_0124175 | 3300048905 | Bacteria | 2412 |
| 762 | Ga0496102_0208387 | 3300048905 | Bacteria | 1843 |
| 763 | Ga0496103_0009954 | 3300048906 | Bacteria | 5622 |
| 764 | Ga0496104_0397920 | 3300048907 | Bacteria | 1290 |
| 765 | Ga0496110_0173561 | 3300048913 | Bacteria | 1956 |
| 766 | Ga0496110_0306598 | 3300048913 | Bacteria | 1446 |
| 767 | Ga0496111_0040892 | 3300048914 | Bacteria | 3326 |
| 768 | Ga0496114_0054349 | 3300048917 | Bacteria | 3339 |
| 769 | Ga0496116_0000242 | 3300048919 | Bacteria | 99455 |
| 770 | Ga0496116_0002441 | 3300048919 | Bacteria | 19563 |
| 771 | Ga0496116_0015602 | 3300048919 | Bacteria | 5997 |
| 772 | Ga0496116_0016890 | 3300048919 | Bacteria | 5691 |
| 773 | Ga0496116_0143991 | 3300048919 | Bacteria | 1335 |
| 774 | Ga0496117_0000270 | 3300048920 | Bacteria | 97077 |
| 775 | Ga0496117_0001400 | 3300048920 | Bacteria | 35026 |
| 776 | Ga0496117_0008847 | 3300048920 | Bacteria | 9501 |
| 777 | Ga0496117_0009764 | 3300048920 | Bacteria | 8853 |
| 778 | Ga0496117_0011796 | 3300048920 | Bacteria | 7783 |
| 779 | Ga0496117_0020455 | 3300048920 | Bacteria | 5394 |
| 780 | Ga0496117_0084105 | 3300048920 | Bacteria | 2077 |
| 781 | Ga0496117_0114029 | 3300048920 | Bacteria | 1676 |
| 782 | Ga0496118_0000635 | 3300048921 | Bacteria | 57514 |
| 783 | Ga0496118_0001057 | 3300048921 | Bacteria | 42974 |
| 784 | Ga0496118_0007753 | 3300048921 | Bacteria | 11269 |
| 785 | Ga0496118_0016858 | 3300048921 | Bacteria | 6676 |
| 786 | Ga0496118_0024056 | 3300048921 | Bacteria | 5269 |
| 787 | Ga0496118_0030353 | 3300048921 | Bacteria | 4513 |
| 788 | Ga0496118_0068469 | 3300048921 | Bacteria | 2577 |
| 789 | Ga0496118_0103282 | 3300048921 | Bacteria | 1917 |
| 790 | Ga0496118_0119699 | 3300048921 | Bacteria | 1720 |
| 791 | Ga0496118_0206938 | 3300048921 | Bacteria | 1155 |
| 792 | Ga0496119_0000927 | 3300048922 | Bacteria | 37935 |
| 793 | Ga0496119_0106180 | 3300048922 | Bacteria | 1567 |
| 794 | Ga0496120_0001153 | 3300048923 | Bacteria | 33865 |
| 795 | Ga0496120_0006057 | 3300048923 | Bacteria | 9395 |
| 796 | Ga0496121_0000318 | 3300048924 | Bacteria | 100833 |
| 797 | Ga0496121_0001431 | 3300048924 | Bacteria | 40302 |
| 798 | Ga0496121_0003532 | 3300048924 | Bacteria | 22182 |
| 799 | Ga0496121_0090791 | 3300048924 | Bacteria | 2387 |
| 800 | Ga0496121_0102831 | 3300048924 | Bacteria | 2199 |
| 801 | Ga0496121_0129648 | 3300048924 | Bacteria | 1890 |
| 802 | Ga0496122_0002044 | 3300048925 | Bacteria | 29954 |
| 803 | Ga0496122_0002319 | 3300048925 | Bacteria | 27466 |
| 804 | Ga0496122_0037098 | 3300048925 | Bacteria | 3929 |
| 805 | Ga0496122_0072746 | 3300048925 | Bacteria | 2442 |
| 806 | Ga0496122_0171749 | 3300048925 | Bacteria | 1305 |
| 807 | Ga0496123_0000243 | 3300048926 | Bacteria | 109767 |
| 808 | Ga0496123_0002575 | 3300048926 | Bacteria | 22073 |
| 809 | Ga0496123_0003264 | 3300048926 | Bacteria | 18397 |
| 810 | Ga0496123_0020385 | 3300048926 | Bacteria | 5187 |
| 811 | Ga0496123_0045948 | 3300048926 | Bacteria | 2967 |
| 812 | Ga0496123_0064851 | 3300048926 | Bacteria | 2325 |
| 813 | Ga0496123_0066692 | 3300048926 | Bacteria | 2278 |
| 814 | Ga0496123_0066933 | 3300048926 | Bacteria | 2272 |
| 815 | Ga0496124_0000751 | 3300048927 | Bacteria | 53223 |
| 816 | Ga0496124_0004281 | 3300048927 | Bacteria | 16771 |
| 817 | Ga0496124_0004505 | 3300048927 | Bacteria | 16250 |
| 818 | Ga0496124_0007674 | 3300048927 | Bacteria | 11414 |
| 819 | Ga0496124_0009354 | 3300048927 | Bacteria | 10097 |
| 820 | Ga0496124_0011231 | 3300048927 | Bacteria | 8975 |
| 821 | Ga0496124_0012961 | 3300048927 | Bacteria | 8174 |
| 822 | Ga0496124_0016449 | 3300048927 | Bacteria | 7029 |
| 823 | Ga0496124_0019159 | 3300048927 | Bacteria | 6384 |
| 824 | Ga0496124_0026911 | 3300048927 | Bacteria | 5177 |
| 825 | Ga0496124_0028798 | 3300048927 | Bacteria | 4961 |
| 826 | Ga0496124_0044655 | 3300048927 | Bacteria | 3800 |
| 827 | Ga0496124_0115377 | 3300048927 | Bacteria | 2155 |
| 828 | Ga0496124_0143382 | 3300048927 | Bacteria | 1882 |
| 829 | Ga0496124_0147283 | 3300048927 | Bacteria | 1851 |
| 830 | Ga0496124_0265737 | 3300048927 | Bacteria | 1259 |
| 831 | Ga0496124_0372013 | 3300048927 | Bacteria | 1002 |
| 832 | Ga0496125_0000659 | 3300048928 | Bacteria | 57535 |
| 833 | Ga0496125_0009328 | 3300048928 | Bacteria | 10115 |
| 834 | Ga0496125_0033305 | 3300048928 | Bacteria | 4561 |
| 835 | Ga0496125_0059322 | 3300048928 | Bacteria | 3084 |
| 836 | Ga0496125_0073867 | 3300048928 | Bacteria | 2648 |
| 837 | Ga0496125_0093947 | 3300048928 | Bacteria | 2236 |
| 838 | Ga0496125_0108688 | 3300048928 | Bacteria | 2016 |
| 839 | Ga0496126_0049489 | 3300048929 | Bacteria | 3837 |
| 840 | Ga0495678_000093 | 3300049459 | Bacteria | 113086 |
| 841 | Ga0495678_001871 | 3300049459 | Bacteria | 15324 |
| 842 | Ga0495678_005859 | 3300049459 | Bacteria | 6655 |
| 843 | Ga0495678_007267 | 3300049459 | Bacteria | 5765 |
| 844 | Ga0495678_015613 | 3300049459 | Bacteria | 3490 |
| 845 | Ga0495678_022409 | 3300049459 | Bacteria | 2761 |
| 846 | Ga0495678_025410 | 3300049459 | Bacteria | 2543 |
| 847 | Ga0495678_027770 | 3300049459 | Bacteria | 2396 |
| 848 | Ga0495678_028913 | 3300049459 | Bacteria | 2332 |
| 849 | Ga0495678_045152 | 3300049459 | Bacteria | 1739 |
| 850 | Ga0495682_0000413 | 3300049460 | Bacteria | 30397 |
| 851 | Ga0495682_0012344 | 3300049460 | Bacteria | 3275 |
| 852 | Ga0495682_0024734 | 3300049460 | Bacteria | 2237 |
| 853 | Ga0501032_0039091 | 3300049569 | Bacteria | 3228 |
| 854 | Ga0501034_0000164 | 3300049571 | Bacteria | 125152 |
| 855 | Ga0501039_0225027 | 3300049575 | Bacteria | 1475 |
| 856 | Ga0501241_004287 | 3300049758 | Bacteria | 2679 |
| 857 | Ga0501226_000008 | 3300049853 | Bacteria | 199119 |
| 858 | nmdc:mga03683_104331_c1 | 3300050489 | Bacteria | 1248 |
| 859 | Ga0500618_003287 | 3300053125 | Bacteria | 5612 |
| 860 | Ga0500659_0003689 | 3300053135 | Bacteria | 8914 |
| 861 | Ga0500573_0003716 | 3300053140 | Bacteria | 7941 |
| 862 | 2510282754 | 2510065053 | Bacteria | 5005518 |
| 863 | 2510295410 | 2510065055 | Bacteria | 5037935 |
| 864 | 2510310966 | 2510065058 | Bacteria | 5005894 |
| 865 | 2511256297 | 2511231004 | Bacteria | 6669789 |
| 866 | 2511265776 | 2511231006 | Bacteria | 6794709 |
| 867 | 2511274338 | 2511231007 | Bacteria | 6306603 |
| 868 | 2511279850 | 2511231008 | Bacteria | 6624100 |
| 869 | 2511289702 | 2511231010 | Bacteria | 6373152 |
| 870 | 2511293293 | 2511231011 | Bacteria | 6149768 |
| 871 | 2511298935 | 2511231012 | Bacteria | 6738011 |
| 872 | 2511313087 | 2511231014 | Bacteria | 6462302 |
| 873 | 2511322249 | 2511231015 | Bacteria | 6598026 |
| 874 | 2511325238 | 2511231016 | Bacteria | 6704427 |
| 875 | 2511332222 | 2511231017 | Bacteria | 6503007 |
| 876 | 2511337658 | 2511231018 | Bacteria | 6436256 |
| 877 | 2511345504 | 2511231019 | Bacteria | 6520662 |
| 878 | 2511347996 | 2511231020 | Bacteria | 6115223 |
| 879 | 2511359140 | 2511231021 | Bacteria | 7302637 |
| 880 | 2511366140 | 2511231022 | Bacteria | 6719296 |
| 881 | 2511370506 | 2511231023 | Bacteria | 6808468 |
| 882 | 2511376298 | 2511231024 | Bacteria | 5835885 |
| 883 | 2511412458 | 2511231031 | Bacteria | 6558529 |
| 884 | 2511822048 | 2511231156 | Bacteria | 6845832 |
| 885 | 2512325299 | 2512047018 | Bacteria | 6663241 |
| 886 | 2554812357 | 2554235132 | Bacteria | 6772433 |
| 887 | 2555245246 | 2554235231 | Bacteria | 5215788 |
| 888 | 2555666961 | 2554235341 | Bacteria | 6867980 |
| 889 | 2583795396 | 2582580891 | Bacteria | 6800976 |
| 890 | 2597855211 | 2597489887 | Bacteria | 6666321 |
| 891 | 2597861211 | 2597489888 | Bacteria | 6179543 |
| 892 | 2597866958 | 2597489889 | Bacteria | 6297495 |
| 893 | 2599327809 | 2599185155 | Bacteria | 5827168 |
| 894 | 2599355634 | 2599185160 | Bacteria | 6844013 |
| 895 | 2599362964 | 2599185161 | Bacteria | 6960462 |
| 896 | 2599368730 | 2599185162 | Bacteria | 6957254 |
| 897 | 2599376073 | 2599185163 | Bacteria | 6995158 |
| 898 | 2599380740 | 2599185164 | Bacteria | 6841688 |
| 899 | 2599387744 | 2599185165 | Bacteria | 6843250 |
| 900 | 2599394931 | 2599185166 | Bacteria | 6959206 |
| 901 | 2599401098 | 2599185167 | Bacteria | 6353609 |
| 902 | 2599406696 | 2599185168 | Bacteria | 6997636 |
| 903 | 2599449569 | 2599185179 | Bacteria | 6611171 |
| 904 | 2599462468 | 2599185181 | Bacteria | 6844519 |
| 905 | 2599468110 | 2599185182 | Bacteria | 6883168 |
| 906 | 2599487337 | 2599185185 | Bacteria | 6652270 |
| 907 | 2599491485 | 2599185186 | Bacteria | 6831633 |
| 908 | 2599503831 | 2599185188 | Bacteria | 6164180 |
| 909 | 2599506038 | 2599185189 | Bacteria | 5862825 |
| 910 | 2599511641 | 2599185190 | Bacteria | 6285678 |
| 911 | 2599516615 | 2599185191 | Bacteria | 6297582 |
| 912 | 2599617068 | 2599185212 | Bacteria | 6765997 |
| 913 | 2599767776 | 2599185248 | Bacteria | 6696816 |
| 914 | 2599804307 | 2599185257 | Bacteria | 6492581 |
| 915 | 2599879332 | 2599185288 | Bacteria | 6666191 |
| 916 | 2599887907 | 2599185289 | Bacteria | 6778765 |
| 917 | 2599893144 | 2599185290 | Bacteria | 6289611 |
| 918 | 2599899402 | 2599185291 | Bacteria | 6775623 |
| 919 | 2599933261 | 2599185300 | Bacteria | 6062622 |
| 920 | 2599941989 | 2599185302 | Bacteria | 5954930 |
| 921 | 2599948722 | 2599185303 | Bacteria | 6512725 |
| 922 | 2599954970 | 2599185304 | Bacteria | 5951361 |
| 923 | 2599963575 | 2599185305 | Bacteria | 6748700 |
| 924 | 2599969562 | 2599185306 | Bacteria | 6637356 |
| 925 | 2599972681 | 2599185307 | Bacteria | 6194719 |
| 926 | 2599981048 | 2599185308 | Bacteria | 6621546 |
| 927 | 2599986277 | 2599185309 | Bacteria | 5969593 |
| 928 | 2599991330 | 2599185310 | Bacteria | 6014457 |
| 929 | 2599997211 | 2599185311 | Bacteria | 6354990 |
| 930 | 2600000841 | 2599185312 | Bacteria | 5912071 |
| 931 | 2600007459 | 2599185313 | Bacteria | 6658188 |
| 932 | 2600014895 | 2599185314 | Bacteria | 6621749 |
| 933 | 2600020200 | 2599185315 | Bacteria | 6771107 |
| 934 | 2600027152 | 2599185316 | Bacteria | 6320029 |
| 935 | 2600033186 | 2599185317 | Bacteria | 6435722 |
| 936 | 2600039397 | 2599185318 | Bacteria | 6961590 |
| 937 | 2600044279 | 2599185319 | Bacteria | 6637840 |
| 938 | 2600050061 | 2599185320 | Bacteria | 5963263 |
| 939 | 2600054691 | 2599185321 | Bacteria | 6764560 |
| 940 | 2600062874 | 2599185322 | Bacteria | 6763055 |
| 941 | 2600065293 | 2599185323 | Bacteria | 6688755 |
| 942 | 2600073234 | 2599185324 | Bacteria | 6590677 |
| 943 | 2600078999 | 2599185325 | Bacteria | 6324919 |
| 944 | 2600215090 | 2599185356 | Bacteria | 6843884 |
| 945 | 2600358761 | 2600254930 | Bacteria | 6431253 |
| 946 | 2600363179 | 2600254931 | Bacteria | 6734225 |
| 947 | 2601627703 | 2600255283 | Bacteria | 6061572 |
| 948 | 2601693285 | 2600255296 | Bacteria | 5784754 |
| 949 | 2601775256 | 2600255313 | Bacteria | 6842543 |
| 950 | 2601798205 | 2600255318 | Bacteria | 6383414 |
| 951 | 2606077093 | 2603880185 | Bacteria | 6379190 |
| 952 | 2606129661 | 2603880199 | Bacteria | 6377649 |
| 953 | 2608384377 | 2606217733 | Bacteria | 6360972 |
| 954 | 2621296534 | 2619619299 | Bacteria | 6649820 |
| 955 | 2624477790 | 2623620443 | Bacteria | 6427864 |
| 956 | 2624489374 | 2623620446 | Bacteria | 6500345 |
| 957 | 2643843180 | 2643221565 | Bacteria | 6216018 |
| 958 | 2643873501 | 2643221571 | Bacteria | 6228673 |
| 959 | 2643956049 | 2643221589 | Bacteria | 6250934 |
| 960 | 2644020171 | 2643221602 | Bacteria | 6249926 |
| 961 | 2644184183 | 2643221633 | Bacteria | 6733554 |
| 962 | 2644282847 | 2643221650 | Bacteria | 7029547 |
| 963 | 2644624482 | 2643221713 | Bacteria | 6554480 |
| 964 | 2652546997 | 2651869719 | Bacteria | 6047974 |
| 965 | 2671091906 | 2667528170 | Bacteria | 6786960 |
| 966 | 2671099605 | 2667528171 | Bacteria | 6900659 |
| 967 | 2671129610 | 2667528176 | Bacteria | 6724917 |
| 968 | 2671771316 | 2671180172 | Bacteria | 6495783 |
| 969 | 2677900458 | 2675903420 | Bacteria | 6247433 |
| 970 | 2678266521 | 2675903515 | Bacteria | 6580491 |
| 971 | 2715749526 | 2713897148 | Bacteria | 5883533 |
| 972 | 2715754527 | 2713897149 | Bacteria | 6506249 |
| 973 | 2723246115 | 2721755607 | Bacteria | 5841722 |
| 974 | 2729146374 | 2728369097 | Bacteria | 4333476 |
| 975 | 2738673480 | 2738541265 | Bacteria | 6594665 |
| 976 | 2738690600 | 2738541271 | Bacteria | 5657310 |
| 977 | 2738751873 | 2738541282 | Bacteria | 6593925 |
| 978 | 2738807555 | 2738541294 | Bacteria | 6925949 |
| 979 | 2738860914 | 2738541303 | Bacteria | 6591772 |
| 980 | 2738894915 | 2738541309 | Bacteria | 6926455 |
| 981 | 2739200966 | 2738543004 | Bacteria | 6381073 |
| 982 | 2739261803 | 2738543015 | Bacteria | 6750701 |
| 983 | 2739266374 | 2738543016 | Bacteria | 5657564 |
| 984 | 2739285961 | 2738543020 | Bacteria | 5718238 |
| 985 | 2739291274 | 2738543021 | Bacteria | 5718241 |
| 986 | 2739312177 | 2738543025 | Bacteria | 6600348 |
| 987 | 2743740782 | 2740892503 | Bacteria | 6855563 |
| 988 | 2745007751 | 2744054620 | Bacteria | 6551379 |
| 989 | 2765581228 | 2765235841 | Bacteria | 6137024 |
| 990 | 2774118049 | 2773857670 | Bacteria | 6407454 |
| 991 | 2784261491 | 2784132063 | Bacteria | 6262788 |
| 992 | 2784316536 | 2784132072 | Bacteria | 6596533 |
| 993 | 2794593619 | 2791355520 | Bacteria | 5948615 |
| 994 | 2807405807 | 2806310737 | Bacteria | 5751088 |
| 995 | 2807454142 | 2806310745 | Bacteria | 5742165 |
| 996 | 2808858641 | 2808606361 | Bacteria | 6136259 |
| 997 | 2808905920 | 2808606373 | Bacteria | 4423627 |
| 998 | 2808923926 | 2808606376 | Bacteria | 6248667 |
| 999 | 2808928131 | 2808606377 | Bacteria | 6646337 |
| 1000 | 2808938601 | 2808606378 | Bacteria | 6177535 |
| 1001 | 2808940355 | 2808606379 | Bacteria | 5022697 |
| 1002 | 2808946219 | 2808606380 | Bacteria | 6248705 |
| 1003 | 2808950687 | 2808606381 | Bacteria | 6646461 |
| 1004 | 2808960658 | 2808606382 | Bacteria | 6841132 |
| 1005 | 2808967146 | 2808606383 | Bacteria | 6138645 |
| 1006 | 2808980133 | 2808606385 | Bacteria | 6711065 |
| 1007 | 2808995853 | 2808606388 | Bacteria | 6706662 |
| 1008 | 2809001956 | 2808606389 | Bacteria | 6138126 |
| 1009 | 2809217547 | 2808606445 | Bacteria | 6057339 |
| 1010 | 2812369751 | 2811994881 | Bacteria | 6298475 |
| 1011 | 2817487987 | 2816332298 | Bacteria | 6852809 |
| 1012 | 2819655450 | 2818991456 | Bacteria | 6123676 |
| 1013 | 2819704752 | 2818991464 | Bacteria | 6907494 |
| 1014 | 2823426054 | 2823421272 | Bacteria | 5372474 |
| 1015 | 2825654691 | 2825651385 | Bacteria | 6715909 |
| 1016 | 2826581737 | 2826581358 | Bacteria | 5963467 |
| 1017 | 2834031244 | 2834028612 | Bacteria | 6354979 |
| 1018 | 2842807544 | 2842805378 | Bacteria | 5385175 |
| 1019 | 2842817079 | 2842815866 | Bacteria | 5947510 |
| 1020 | 2842828461 | 2842826826 | Bacteria | 5974129 |
| 1021 | 2842833764 | 2842832357 | Bacteria | 5959113 |
| 1022 | 2842838218 | 2842837860 | Bacteria | 6066181 |
| 1023 | 2842845997 | 2842843487 | Bacteria | 6004777 |
| 1024 | 2842852041 | 2842849001 | Bacteria | 5924277 |
| 1025 | 2842855983 | 2842854478 | Bacteria | 6143501 |
| 1026 | 2844667446 | 2844665904 | Bacteria | 6817974 |
| 1027 | 2852616643 | 2852612431 | Bacteria | 6885235 |
| 1028 | 2852662596 | 2852657418 | Bacteria | 6472974 |
| 1029 | 2852671611 | 2852667396 | Bacteria | 6885555 |
| 1030 | 2860345234 | 2860339153 | Bacteria | 6846989 |
| 1031 | 2860868010 | 2860867994 | Bacteria | 5645326 |
| 1032 | 2878029733 | 2878029506 | Bacteria | 6418441 |
| 1033 | 2880230687 | 2880230671 | Bacteria | 6140320 |
| 1034 | 2904518632 | 2904518522 | Bacteria | 6068986 |
| 1035 | 2904553425 | 2904550169 | Bacteria | 6221258 |
| 1036 | 2908446589 | 2908446538 | Bacteria | 6829095 |
| 1037 | 2912963809 | 2912963787 | Bacteria | 5646108 |
| 1038 | 2913036909 | 2913036834 | Bacteria | 6704877 |
| 1039 | 2917070695 | 2917070673 | Bacteria | 6868303 |
| 1040 | 2919068013 | 2919063839 | Bacteria | 6302690 |
| 1041 | 2919126099 | 2919125081 | Bacteria | 5385106 |
| 1042 | 2919156119 | 2919155634 | Bacteria | 4860545 |
| 1043 | 2919388852 | 2919385768 | Bacteria | 5897293 |
| 1044 | 2919457889 | 2919456309 | Bacteria | 6586567 |
| 1045 | 2919487028 | 2919481497 | Bacteria | 6907839 |
| 1046 | 2919487816 | 2919487758 | Bacteria | 5929766 |
| 1047 | 2919702421 | 2919697872 | Bacteria | 6553725 |
| 1048 | 2923153614 | 2923153595 | Bacteria | 6870622 |
| 1049 | 2923523838 | 2923519811 | Bacteria | 6298479 |
| 1050 | 2923589339 | 2923586266 | Bacteria | 6565975 |
| 1051 | 2926064472 | 2926063275 | Bacteria | 5285848 |
| 1052 | 2929144379 | 2929144301 | Bacteria | 6622272 |
| 1053 | 2929189894 | 2929189879 | Bacteria | 5930554 |
| 1054 | 2931372294 | 2931369376 | Bacteria | 6847892 |
| 1055 | 2931390955 | 2931390751 | Bacteria | 6273349 |
| 1056 | 2931398433 | 2931396565 | Bacteria | 7251677 |
| 1057 | 2935357970 | 2935353572 | Unclassified | 6955622 |
| 1058 | 2939640539 | 2939636861 | Bacteria | 6297853 |
| 1059 | 2939654410 | 2939651529 | Bacteria | 5895393 |
| 1060 | 2945930590 | 2945928738 | Bacteria | 6053221 |
| 1061 | 2945967164 | 2945961074 | Bacteria | 7342064 |
| 1062 | 2946012937 | 2946006987 | Bacteria | 6705746 |
| 1063 | 2946028199 | 2946027586 | Bacteria | 6049274 |
| 1064 | 2947234720 | 2947233263 | Bacteria | 6439278 |
| 1065 | 2969304489 | 2969304461 | Bacteria | 6601805 |
| 1066 | 2974293759 | 2974289157 | Bacteria | 6080362 |
| 1067 | 2984292501 | 2984286254 | Bacteria | 6702062 |
| 1068 | 2984500126 | 2984499530 | Bacteria | 5020881 |
| 1069 | 2984506490 | 2984504281 | Bacteria | 5262371 |
| 1070 | 2988731841 | 2988728565 | Bacteria | 6124362 |
| 1071 | 2990197880 | 2990196909 | Bacteria | 4054280 |
| 1072 | 2998140057 | 2998139840 | Bacteria | 6073514 |
| 1073 | 3007254967 | 3007252601 | Bacteria | 4559114 |
| 1074 | 3007316239 | 3007315729 | Bacteria | 5076637 |
| 1075 | 3007399061 | 3007395558 | Bacteria | 6755444 |
| 1076 | 3007419597 | 3007419365 | Bacteria | 7026924 |
| 1077 | 3007517476 | 3007511990 | Bacteria | 6481491 |
| 1078 | 3007616470 | 3007614139 | Bacteria | 6053559 |
| 1079 | 3007622585 | 3007619802 | Bacteria | 6411688 |
| 1080 | 3007722045 | 3007718800 | Bacteria | 5971527 |
| 1081 | 3007804231 | 3007803356 | Bacteria | 5931491 |
| 1082 | 3007859502 | 3007855910 | Bacteria | 5637581 |
| 1083 | 3007864769 | 3007861166 | Bacteria | 6045338 |
| 1084 | 3007871903 | 3007866637 | Bacteria | 5899198 |
| 1085 | 3007876303 | 3007872151 | Bacteria | 5268868 |
| 1086 | 637317364 | 637000220 | Bacteria | 7074893 |
| 1087 | 640485976 | 640427133 | Bacteria | 4567418 |
| 1088 | 651173889 | 651053060 | Bacteria | 4689946 |
| 1089 | 8011356179 | 8011350971 | Bacteria | 6158957 |
| 1090 | 8015687871 | 8015687852 | Bacteria | 6613826 |
| 1091 | 8016731501 | 8016728285 | Bacteria | 5263933 |
| 1092 | 8019769458 | 8019769354 | Bacteria | 6924660 |
| 1093 | 8019779644 | 8019775933 | Bacteria | 6858656 |
| 1094 | 8029995193 | 8029995093 | Bacteria | 5990776 |
| 1095 | 8052494609 | 8052494512 | Bacteria | 5765634 |
| 1096 | 8054290000 | 8054285046 | Bacteria | 6919322 |
| 1097 | 8054349297 | 8054347763 | Bacteria | 5901107 |
| 1098 | 8054503562 | 8054503363 | Bacteria | 6101651 |
| 1099 | 8054929654 | 8054929484 | Bacteria | 5599761 |
| 1100 | 8055770974 | 8055770955 | Bacteria | 6827675 |
| 1101 | 8055817924 | 8055817908 | Bacteria | 6609162 |
| 1102 | 8055881637 | 8055878733 | Bacteria | 5907058 |
| 1103 | 8056116307 | 8056115690 | Bacteria | 5527654 |
| 1104 | 8056120740 | 8056120720 | Bacteria | 5758328 |
| 1105 | 8056126077 | 8056125926 | Bacteria | 6228218 |
| 1106 | 8056131895 | 8056131705 | Bacteria | 6107031 |
| 1107 | 8056137436 | 8056137416 | Bacteria | 6147080 |
| 1108 | 8056143317 | 8056143049 | Bacteria | 6307666 |
| 1109 | 8056151207 | 8056148874 | Bacteria | 6479865 |
| 1110 | 8056160055 | 8056155041 | Bacteria | 6486948 |
| 1111 | 8056163920 | 8056161164 | Bacteria | 6106669 |
| 1112 | 8056170989 | 8056166840 | Bacteria | 5820959 |
| 1113 | 8056177121 | 8056172158 | Bacteria | 6133900 |
| 1114 | 8056182213 | 8056177738 | Bacteria | 6748268 |
| 1115 | 8056570788 | 8056569372 | Bacteria | 5997322 |
| 1116 | 8057802253 | 8057798959 | Bacteria | 6713499 |
| 1117 | Ga0316575_10018217 | |||
| 1118 | MRS2a_Contig_61 | |||
| 1119 | SwRhRL2b_contig_2749780 | |||
| 1120 | JGI24741J21665_1002934 | |||
| 1121 | JGI25164J39214_1000175 | |||
| 1122 | JGI25164J39214_1000357 | |||
| 1123 | JGI25165J46597_1000175 | |||
| 1124 | JGI25165J46597_1000193 | |||
| 1125 | Ga0055538_1000012 | |||
| 1126 | Ga0055539_1000017 | |||
| 1127 | Ga0055533_1000021 | |||
| 1128 | Ga0055532_1000020 | |||
| 1129 | Ga0055525_1000117 | |||
| 1130 | Ga0055536_1000547 | |||
| 1131 | Ga0055536_1000593 | |||
| 1132 | Ga0055536_1005739 | |||
| 1133 | Ga0055536_1020865 | |||
| 1134 | Ga0055530_10000081 | |||
| 1135 | Ga0055530_10000159 | |||
| 1136 | Ga0055530_10003552 | |||
| 1137 | Ga0055540_1000121 | |||
| 1138 | Ga0055540_1000242 | |||
| 1139 | Ga0055540_1001117 | |||
| 1140 | Ga0055531_10001857 | |||
| 1141 | Ga0055541_1000012 | |||
| 1142 | Ga0058692_1003282 | |||
| 1143 | Ga0065714_10002471 | |||
| 1144 | Ga0065714_10066068 | |||
| 1145 | Ga0065714_10066935 | |||
| 1146 | Ga0065714_10067254 | |||
| 1147 | Ga0065714_10067959 | |||
| 1148 | Ga0065714_10074006 | |||
| 1149 | Ga0065714_10086380 | |||
| 1150 | Ga0065712_10000160 | |||
| 1151 | Ga0065712_10002851 | |||
| 1152 | Ga0065712_10071587 | |||
| 1153 | Ga0065715_10008286 | |||
| 1154 | Ga0070670_100017009 | |||
| 1155 | Ga0070670_100046495 | |||
| 1156 | Ga0070661_100002052 | |||
| 1157 | Ga0070661_100066694 | |||
| 1158 | Ga0070669_100000153 | |||
| 1159 | Ga0070669_100000158 | |||
| 1160 | Ga0070662_100000562 | |||
| 1161 | Ga0068853_100000040 | |||
| 1162 | Ga0070665_100106751 | |||
| 1163 | Ga0070665_100189889 | |||
| 1164 | Ga0070665_100320364 | |||
| 1165 | Ga0070664_100000049 | |||
| 1166 | Ga0070664_100014744 | |||
| 1167 | Ga0068854_100002019 | |||
| 1168 | Ga0068851_10000018 | |||
| 1169 | Ga0075364_10037035 | |||
| 1170 | Ga0075364_10074915 | |||
| 1171 | Ga0075364_10083028 | |||
| 1172 | Ga0075432_10008138 | |||
| 1173 | Ga0075432_10036464 | |||
| 1174 | Ga0099823_1001433 | |||
| 1175 | Ga0099823_1017745 | |||
| 1176 | Ga0079104_1000291 | |||
| 1177 | Ga0079104_1000306 | |||
| 1178 | Ga0079104_1011461 | |||
| 1179 | Ga0105251_10000033 | |||
| 1180 | Ga0105251_10000995 | |||
| 1181 | Ga0105251_10002417 | |||
| 1182 | Ga0105251_10008537 | |||
| 1183 | Ga0105251_10019139 | |||
| 1184 | Ga0105251_10034316 | |||
| 1185 | Ga0105251_10060428 | |||
| 1186 | Ga0105244_10000186 | |||
| 1187 | Ga0105244_10001163 | |||
| 1188 | Ga0105244_10006161 | |||
| 1189 | Ga0105244_10010196 | |||
| 1190 | Ga0105244_10011507 | |||
| 1191 | Ga0105244_10012125 | |||
| 1192 | Ga0105244_10023068 | |||
| 1193 | Ga0105244_10029512 | |||
| 1194 | Ga0105244_10061702 | |||
| 1195 | Ga0105244_10074675 | |||
| 1196 | Ga0105244_10077413 | |||
| 1197 | Ga0105244_10094355 | |||
| 1198 | Ga0105250_10000203 | |||
| 1199 | Ga0105250_10000550 | |||
| 1200 | Ga0105250_10005762 | |||
| 1201 | Ga0105250_10016036 | |||
| 1202 | Ga0105250_10018938 | |||
| 1203 | Ga0105243_10000075 | |||
| 1204 | Ga0105243_10006258 | |||
| 1205 | Ga0105243_10008082 | |||
| 1206 | Ga0105243_10012797 | |||
| 1207 | Ga0105243_10012953 | |||
| 1208 | Ga0105243_10016614 | |||
| 1209 | Ga0105243_10024895 | |||
| 1210 | Ga0105243_10027788 | |||
| 1211 | Ga0105241_10293162 | |||
| 1212 | Ga0105242_10003444 | |||
| 1213 | Ga0105237_10015442 | |||
| 1214 | Ga0105246_10000322 | |||
| 1215 | Ga0105246_10002463 | |||
| 1216 | Ga0105246_10027386 | |||
| 1217 | Ga0157336_1000242 | |||
| 1218 | Ga0157337_1000089 | |||
| 1219 | Ga0157345_1000342 | |||
| 1220 | Ga0157373_10006572 | |||
| 1221 | Ga0157373_10011243 | |||
| 1222 | Ga0157373_10015430 | |||
| 1223 | Ga0157373_10015802 | |||
| 1224 | Ga0157371_10000226 | |||
| 1225 | Ga0157371_10012722 | |||
| 1226 | Ga0157371_10014325 | |||
| 1227 | Ga0157370_10003131 | |||
| 1228 | Ga0157370_10023845 | |||
| 1229 | Ga0157370_10068026 | |||
| 1230 | Ga0157370_10094400 | |||
| 1231 | Ga0157370_10133309 | |||
| 1232 | Ga0157369_10033496 | |||
| 1233 | Ga0157369_10114866 | |||
| 1234 | Ga0157369_10154159 | |||
| 1235 | Ga0163162_10001329 | |||
| 1236 | Ga0157372_10018101 | |||
| 1237 | Ga0157372_10028093 | |||
| 1238 | Ga0157375_10024624 | |||
| 1239 | Ga0182008_10000938 | |||
| 1240 | Ga0182008_10003949 | |||
| 1241 | Ga0182008_10008674 | |||
| 1242 | Ga0182008_10013327 | |||
| 1243 | Ga0182008_10018729 | |||
| 1244 | Ga0182008_10022978 | |||
| 1245 | Ga0182008_10038337 | |||
| 1246 | Ga0182008_10086859 | |||
| 1247 | Ga0182008_10103811 | |||
| 1248 | Ga0182006_1004750 | |||
| 1249 | Ga0182006_1005425 | |||
| 1250 | Ga0182006_1005564 | |||
| 1251 | Ga0182006_1009327 | |||
| 1252 | Ga0182006_1049907 | |||
| 1253 | Ga0182006_1062526 | |||
| 1254 | Ga0182007_10004678 | |||
| 1255 | Ga0182005_1002872 | |||
| 1256 | Ga0182005_1010661 | |||
| 1257 | Ga0182005_1013258 | |||
| 1258 | Ga0163161_10134235 | |||
| 1259 | Ga0163161_10146361 | |||
| 1260 | Ga0163161_10211279 | |||
| 1261 | Ga0163161_10277264 | |||
| 1262 | Ga0209435_101310 | |||
| 1263 | Ga0209760_100020 | |||
| 1264 | Ga0209760_100169 | |||
| 1265 | Ga0209784_100007 | |||
| 1266 | Ga0209566_100009 | |||
| 1267 | Ga0209674_100021 | |||
| 1268 | Ga0209147_100009 | |||
| 1269 | Ga0209563_100018 | |||
| 1270 | Ga0207427_100005 | |||
| 1271 | Ga0207427_100006 | |||
| 1272 | Ga0209437_100013 | |||
| 1273 | Ga0209437_100018 | |||
| 1274 | Ga0209258_100237 | |||
| 1275 | Ga0209646_1000234 | |||
| 1276 | Ga0209677_100012 | |||
| 1277 | Ga0209233_1000021 | |||
| 1278 | Ga0209233_1000022 | |||
| 1279 | Ga0209675_1005173 | |||
| 1280 | Ga0209676_1000015 | |||
| 1281 | Ga0209676_1000157 | |||
| 1282 | Ga0209676_1000222 | |||
| 1283 | Ga0209676_1000242 | |||
| 1284 | Ga0209676_1000583 | |||
| 1285 | Ga0209676_1002004 | |||
| 1286 | Ga0209050_1000030 | |||
| 1287 | Ga0209050_1000061 | |||
| 1288 | Ga0209050_1000296 | |||
| 1289 | Ga0209050_1005565 | |||
| 1290 | Ga0209051_1000088 | |||
| 1291 | Ga0209051_1000143 | |||
| 1292 | Ga0209051_1000487 | |||
| 1293 | Ga0209051_1006284 | |||
| 1294 | Ga0209257_1000143 | |||
| 1295 | Ga0209257_1027342 | |||
| 1296 | Ga0207656_10000009 | |||
| 1297 | Ga0207696_1000055 | |||
| 1298 | Ga0207696_1000127 | |||
| 1299 | Ga0207696_1000151 | |||
| 1300 | Ga0207696_1000165 | |||
| 1301 | Ga0207696_1001549 | |||
| 1302 | Ga0207696_1003732 | |||
| 1303 | Ga0207696_1004751 | |||
| 1304 | Ga0207696_1013295 | |||
| 1305 | Ga0207696_1017423 | |||
| 1306 | Ga0207696_1021743 | |||
| 1307 | Ga0207655_1000135 | |||
| 1308 | Ga0207655_1000348 | |||
| 1309 | Ga0207655_1000603 | |||
| 1310 | Ga0207655_1000652 | |||
| 1311 | Ga0207655_1000662 | |||
| 1312 | Ga0207655_1001765 | |||
| 1313 | Ga0207655_1006522 | |||
| 1314 | Ga0207655_1007418 | |||
| 1315 | Ga0207655_1010161 | |||
| 1316 | Ga0207655_1045398 | |||
| 1317 | Ga0207655_1049995 | |||
| 1318 | Ga0207713_1000103 | |||
| 1319 | Ga0207713_1000126 | |||
| 1320 | Ga0207713_1000692 | |||
| 1321 | Ga0207713_1000735 | |||
| 1322 | Ga0207713_1002220 | |||
| 1323 | Ga0207713_1002937 | |||
| 1324 | Ga0207713_1003840 | |||
| 1325 | Ga0207713_1003859 | |||
| 1326 | Ga0207713_1003907 | |||
| 1327 | Ga0207713_1009074 | |||
| 1328 | Ga0207713_1009075 | |||
| 1329 | Ga0207713_1011679 | |||
| 1330 | Ga0207713_1012398 | |||
| 1331 | Ga0207713_1015569 | |||
| 1332 | Ga0207713_1019564 | |||
| 1333 | Ga0207713_1025943 | |||
| 1334 | Ga0207713_1030420 | |||
| 1335 | Ga0207713_1088745 | |||
| 1336 | Ga0207671_10000027 | |||
| 1337 | Ga0207649_10000007 | |||
| 1338 | Ga0207681_10000488 | |||
| 1339 | Ga0207681_10001509 | |||
| 1340 | Ga0207650_10000178 | |||
| 1341 | Ga0207650_10000210 | |||
| 1342 | Ga0207706_10000050 | |||
| 1343 | Ga0207706_10001275 | |||
| 1344 | Ga0207686_10010242 | |||
| 1345 | Ga0207709_10000107 | |||
| 1346 | Ga0207709_10000269 | |||
| 1347 | Ga0207709_10002112 | |||
| 1348 | Ga0207709_10051282 | |||
| 1349 | Ga0207709_10055190 | |||
| 1350 | Ga0207709_10074275 | |||
| 1351 | Ga0207709_10129988 | |||
| 1352 | Ga0207679_10000013 | |||
| 1353 | Ga0207712_10007685 | |||
| 1354 | Ga0207640_10009942 | |||
| 1355 | Ga0207639_10001234 | |||
| 1356 | Ga0209281_1000091 | |||
| 1357 | Ga0209281_1000237 | |||
| 1358 | Ga0209389_1000065 | |||
| 1359 | Ga0209371_1000231 | |||
| 1360 | Ga0209371_1000445 | |||
| 1361 | Ga0209969_1003756 | |||
| 1362 | Ga0209981_1003805 | |||
| 1363 | Ga0209996_1004309 | |||
| 1364 | Ga0209999_1005748 | |||
| 1365 | Ga0209982_1004394 | |||
| 1366 | Ga0207428_10042158 | |||
| 1367 | Ga0207428_10043727 | |||
| 1368 | Ga0268266_10003207 | |||
| 1369 | Ga0268266_10157208 | |||
| 1370 | Ga0268266_10572784 | |||
| 1371 | Ga0307517_10032796 | |||
| 1372 | Ga0268256_1000192 | |||
| 1373 | Ga0268256_1000402 | |||
| 1374 | Ga0307511_10024751 | |||
| 1375 | Ga0307511_10068194 | |||
| 1376 | Ga0316177_1089383 | |||
| 1377 | Ga0316179_1069431 | |||
| 1378 | Ga0316178_1080449 | |||
| 1379 | Ga0316183_1089988 | |||
| 1380 | Ga0316183_1121923 | |||
| 1381 | Ga0316183_1199248 | |||
| 1382 | Ga0316181_1110545 | |||
| 1383 | Ga0307513_10010765 | |||
| 1384 | Ga0307509_10066245 | |||
| 1385 | Ga0307408_100014056 | |||
| 1386 | Ga0307408_100055360 | |||
| 1387 | Ga0307408_100087097 | |||
| 1388 | Ga0307408_100274335 | |||
| 1389 | Ga0307405_10025032 | |||
| 1390 | Ga0307405_10049058 | |||
| 1391 | Ga0307413_10014349 | |||
| 1392 | Ga0307407_10124207 | |||
| 1393 | Ga0307412_10059225 | |||
| 1394 | Ga0307412_10455015 | |||
| 1395 | Ga0307409_100008613 | |||
| 1396 | Ga0307409_100010758 | |||
| 1397 | Ga0307416_100248799 | |||
| 1398 | Ga0307416_100477053 | |||
| 1399 | Ga0307414_10170457 | |||
| 1400 | Ga0307411_10255064 | |||
| 1401 | Ga0307510_10033908 | |||
| 1402 | Ga0316584_0083827 | |||
| 1403 | Ga0316584_0084182 | |||
| 1404 | Ga0439436_0005819 | |||
| 1405 | Ga0439438_000296 | |||
| 1406 | Ga0439438_000440 | |||
| 1407 | Ga0439438_001725 | |||
| 1408 | Ga0439438_003887 | |||
| 1409 | Ga0439438_008515 | |||
| 1410 | Ga0439438_009972 | |||
| 1411 | Ga0439438_011123 | |||
| 1412 | Ga0439438_015415 | |||
| 1413 | Ga0439447_000380 | |||
| 1414 | Ga0439447_000690 | |||
| 1415 | Ga0439447_001108 | |||
| 1416 | Ga0439447_003266 | |||
| 1417 | Ga0439447_004722 | |||
| 1418 | Ga0439447_038304 | |||
| 1419 | Ga0439466_0000240 | |||
| 1420 | Ga0439466_0002174 | |||
| 1421 | Ga0439466_0002581 | |||
| 1422 | Ga0439466_0002774 | |||
| 1423 | Ga0439466_0003780 | |||
| 1424 | Ga0439466_0003898 | |||
| 1425 | Ga0439466_0004111 | |||
| 1426 | Ga0439466_0008138 | |||
| 1427 | Ga0439466_0011670 | |||
| 1428 | Ga0439431_0008263 | |||
| 1429 | Ga0439437_005172 | |||
| 1430 | Ga0439432_001415 | |||
| 1431 | Ga0439432_003836 | |||
| 1432 | Ga0439432_004227 | |||
| 1433 | Ga0439432_007970 | |||
| 1434 | Ga0439432_008448 | |||
| 1435 | Ga0439432_014077 | |||
| 1436 | Ga0439432_029655 | |||
| 1437 | Ga0439432_032063 | |||
| 1438 | Ga0439432_054155 | |||
| 1439 | Ga0439452_000190 | |||
| 1440 | Ga0439452_001782 | |||
| 1441 | Ga0439452_002240 | |||
| 1442 | Ga0439452_002643 | |||
| 1443 | Ga0439452_002983 | |||
| 1444 | Ga0439452_003229 | |||
| 1445 | Ga0439452_007923 | |||
| 1446 | Ga0439452_010851 | |||
| 1447 | Ga0439455_0004409 | |||
| 1448 | Ga0439456_000021 | |||
| 1449 | Ga0439456_001799 | |||
| 1450 | Ga0439456_009110 | |||
| 1451 | Ga0439456_009135 | |||
| 1452 | Ga0439456_017369 | |||
| 1453 | Ga0439456_030367 | |||
| 1454 | Ga0439463_000264 | |||
| 1455 | Ga0439463_000940 | |||
| 1456 | Ga0439463_007878 | |||
| 1457 | Ga0439463_013062 | |||
| 1458 | Ga0450911_000055 | |||
| 1459 | Ga0450911_000211 | |||
| 1460 | Ga0450911_002007 | |||
| 1461 | Ga0450911_003352 | |||
| 1462 | Ga0450919_000953 | |||
| 1463 | Ga0450922_001398 | |||
| 1464 | Ga0450900_002909 | |||
| 1465 | Ga0450900_006123 | |||
| 1466 | Ga0450902_002249 | |||
| 1467 | Ga0450902_006853 | |||
| 1468 | Ga0450903_002798 | |||
| 1469 | Ga0450903_005738 | |||
| 1470 | Ga0450903_009946 | |||
| 1471 | Ga0450904_000367 | |||
| 1472 | Ga0450905_000365 | |||
| 1473 | Ga0450906_000309 | |||
| 1474 | Ga0450906_004691 | |||
| 1475 | Ga0450907_000110 | |||
| 1476 | Ga0450907_004724 | |||
| 1477 | Ga0450910_000275 | |||
| 1478 | Ga0439446_0000079 | |||
| 1479 | Ga0439446_0006348 | |||
| 1480 | Ga0450908_002350 | |||
| 1481 | Ga0450909_001360 | |||
| 1482 | Ga0450909_008876 | |||
| 1483 | Ga0450909_016365 | |||
| 1484 | Ga0439434_0000244 | |||
| 1485 | Ga0439434_0007094 | |||
| 1486 | Ga0439464_0007532 | |||
| 1487 | Ga0439460_0005294 | |||
| 1488 | Ga0439460_0008161 | |||
| 1489 | Ga0450916_002327 | |||
| 1490 | Ga0450901_001714 | |||
| 1491 | Ga0439440_0002407 | |||
| 1492 | Ga0495617_001971 | |||
| 1493 | Ga0495617_004003 | |||
| 1494 | Ga0495617_021959 | |||
| 1495 | Ga0495627_000296 | |||
| 1496 | Ga0495627_000701 | |||
| 1497 | Ga0495627_001391 | |||
| 1498 | Ga0495627_005214 | |||
| 1499 | Ga0495627_012109 | |||
| 1500 | Ga0495627_016909 | |||
| 1501 | Ga0495603_0005896 | |||
| 1502 | Ga0495590_0003265 | |||
| 1503 | Ga0495590_0013086 | |||
| 1504 | Ga0495590_0020549 | |||
| 1505 | Ga0495590_0020958 | |||
| 1506 | Ga0495591_000164 | |||
| 1507 | Ga0495591_000898 | |||
| 1508 | Ga0495591_001277 | |||
| 1509 | Ga0495591_002623 | |||
| 1510 | Ga0495591_004987 | |||
| 1511 | Ga0495591_006161 | |||
| 1512 | Ga0495591_014256 | |||
| 1513 | Ga0495591_016129 | |||
| 1514 | Ga0495591_016982 | |||
| 1515 | Ga0495591_040625 | |||
| 1516 | Ga0495591_042448 | |||
| 1517 | Ga0495638_0010051 | |||
| 1518 | Ga0495638_0015178 | |||
| 1519 | Ga0495638_0017020 | |||
| 1520 | Ga0495638_0028413 | |||
| 1521 | Ga0495638_0037963 | |||
| 1522 | Ga0495638_0109997 | |||
| 1523 | Ga0495638_0134084 | |||
| 1524 | Ga0495638_0142909 | |||
| 1525 | Ga0495638_0151761 | |||
| 1526 | Ga0495653_0003789 | |||
| 1527 | Ga0495653_0003842 | |||
| 1528 | Ga0495653_0014723 | |||
| 1529 | Ga0495653_0038452 | |||
| 1530 | Ga0495653_0045733 | |||
| 1531 | Ga0495653_0061155 | |||
| 1532 | Ga0495650_0000402 | |||
| 1533 | Ga0495650_0006953 | |||
| 1534 | Ga0495650_0011360 | |||
| 1535 | Ga0495650_0025552 | |||
| 1536 | Ga0495650_0026977 | |||
| 1537 | Ga0495650_0038625 | |||
| 1538 | Ga0495650_0042643 | |||
| 1539 | Ga0495582_0007342 | |||
| 1540 | Ga0495605_0000101 | |||
| 1541 | Ga0495605_0000302 | |||
| 1542 | Ga0495605_0000971 | |||
| 1543 | Ga0495605_0002433 | |||
| 1544 | Ga0495605_0003182 | |||
| 1545 | Ga0495605_0003918 | |||
| 1546 | Ga0495605_0008090 | |||
| 1547 | Ga0495605_0095896 | |||
| 1548 | Ga0495639_0004372 | |||
| 1549 | Ga0495584_0001255 | |||
| 1550 | Ga0495584_0002779 | |||
| 1551 | Ga0495584_0005430 | |||
| 1552 | Ga0495584_0017033 | |||
| 1553 | Ga0495584_0021615 | |||
| 1554 | Ga0495584_0056697 | |||
| 1555 | Ga0495584_0092270 | |||
| 1556 | Ga0495585_0001285 | |||
| 1557 | Ga0495585_0002528 | |||
| 1558 | Ga0495585_0004778 | |||
| 1559 | Ga0495585_0014098 | |||
| 1560 | Ga0495585_0047442 | |||
| 1561 | Ga0495585_0049065 | |||
| 1562 | Ga0495585_0053795 | |||
| 1563 | Ga0495585_0145721 | |||
| 1564 | Ga0495594_0035244 | |||
| 1565 | Ga0495596_0000175 | |||
| 1566 | Ga0495596_0066402 | |||
| 1567 | Ga0495607_0000268 | |||
| 1568 | Ga0495607_0000365 | |||
| 1569 | Ga0495607_0005597 | |||
| 1570 | Ga0495607_0005788 | |||
| 1571 | Ga0495607_0007200 | |||
| 1572 | Ga0495607_0010681 | |||
| 1573 | Ga0495607_0011810 | |||
| 1574 | Ga0495607_0013345 | |||
| 1575 | Ga0495607_0013669 | |||
| 1576 | Ga0495607_0030494 | |||
| 1577 | Ga0495607_0044080 | |||
| 1578 | Ga0495607_0125063 | |||
| 1579 | Ga0495607_0171712 | |||
| 1580 | Ga0495583_0000300 | |||
| 1581 | Ga0495583_0001652 | |||
| 1582 | Ga0495583_0002663 | |||
| 1583 | Ga0495583_0003013 | |||
| 1584 | Ga0495583_0006176 | |||
| 1585 | Ga0495583_0027546 | |||
| 1586 | Ga0495583_0050015 | |||
| 1587 | Ga0495583_0070558 | |||
| 1588 | Ga0495606_0000115 | |||
| 1589 | Ga0495606_0000285 | |||
| 1590 | Ga0495606_0000964 | |||
| 1591 | Ga0495606_0006355 | |||
| 1592 | Ga0495606_0007604 | |||
| 1593 | Ga0495606_0014817 | |||
| 1594 | Ga0495606_0025115 | |||
| 1595 | Ga0495606_0056155 | |||
| 1596 | Ga0495606_0060785 | |||
| 1597 | Ga0495606_0062836 | |||
| 1598 | Ga0495610_0002956 | |||
| 1599 | Ga0495610_0003937 | |||
| 1600 | Ga0495610_0006042 | |||
| 1601 | Ga0495610_0006114 | |||
| 1602 | Ga0495610_0010481 | |||
| 1603 | Ga0495610_0010736 | |||
| 1604 | Ga0495610_0011500 | |||
| 1605 | Ga0495610_0012730 | |||
| 1606 | Ga0495610_0013954 | |||
| 1607 | Ga0495610_0023432 | |||
| 1608 | Ga0495610_0051382 | |||
| 1609 | Ga0495616_0011579 | |||
| 1610 | Ga0495616_0033194 | |||
| 1611 | Ga0495616_0033805 | |||
| 1612 | Ga0495616_0041203 | |||
| 1613 | Ga0495616_0056611 | |||
| 1614 | Ga0495616_0058624 | |||
| 1615 | Ga0495620_0000023 | |||
| 1616 | Ga0495620_0000040 | |||
| 1617 | Ga0495620_0000376 | |||
| 1618 | Ga0495620_0004033 | |||
| 1619 | Ga0495620_0007287 | |||
| 1620 | Ga0495620_0008993 | |||
| 1621 | Ga0495620_0010021 | |||
| 1622 | Ga0495620_0012309 | |||
| 1623 | Ga0495620_0028528 | |||
| 1624 | Ga0495631_0000807 | |||
| 1625 | Ga0495631_0002636 | |||
| 1626 | Ga0495631_0003660 | |||
| 1627 | Ga0495631_0011556 | |||
| 1628 | Ga0495631_0021897 | |||
| 1629 | Ga0495631_0037171 | |||
| 1630 | Ga0495632_0000353 | |||
| 1631 | Ga0495632_0001535 | |||
| 1632 | Ga0495632_0001892 | |||
| 1633 | Ga0495632_0006047 | |||
| 1634 | Ga0495632_0009605 | |||
| 1635 | Ga0495632_0009696 | |||
| 1636 | Ga0495632_0013177 | |||
| 1637 | Ga0495632_0014458 | |||
| 1638 | Ga0495632_0014787 | |||
| 1639 | Ga0495632_0017847 | |||
| 1640 | Ga0495632_0064465 | |||
| 1641 | Ga0495632_0152339 | |||
| 1642 | Ga0495632_0156301 | |||
| 1643 | Ga0495637_0000054 | |||
| 1644 | Ga0495637_0000194 | |||
| 1645 | Ga0495637_0001359 | |||
| 1646 | Ga0495637_0001467 | |||
| 1647 | Ga0495637_0002835 | |||
| 1648 | Ga0495637_0005571 | |||
| 1649 | Ga0495637_0006074 | |||
| 1650 | Ga0495637_0006097 | |||
| 1651 | Ga0495637_0007743 | |||
| 1652 | Ga0495637_0056099 | |||
| 1653 | Ga0495637_0061985 | |||
| 1654 | Ga0495637_0070823 | |||
| 1655 | Ga0495643_0000280 | |||
| 1656 | Ga0495643_0000460 | |||
| 1657 | Ga0495643_0001333 | |||
| 1658 | Ga0495643_0003285 | |||
| 1659 | Ga0495643_0008958 | |||
| 1660 | Ga0495643_0028711 | |||
| 1661 | Ga0495643_0036074 | |||
| 1662 | Ga0495643_0044905 | |||
| 1663 | Ga0495643_0074277 | |||
| 1664 | Ga0495643_0100321 | |||
| 1665 | Ga0495644_0001093 | |||
| 1666 | Ga0495644_0008585 | |||
| 1667 | Ga0495644_0063253 | |||
| 1668 | Ga0495644_0073552 | |||
| 1669 | Ga0495648_0001218 | |||
| 1670 | Ga0495648_0002215 | |||
| 1671 | Ga0495648_0002926 | |||
| 1672 | Ga0495648_0006423 | |||
| 1673 | Ga0495648_0007250 | |||
| 1674 | Ga0495648_0014356 | |||
| 1675 | Ga0495648_0015979 | |||
| 1676 | Ga0495648_0017577 | |||
| 1677 | Ga0495648_0018458 | |||
| 1678 | Ga0495648_0039218 | |||
| 1679 | Ga0495648_0044656 | |||
| 1680 | Ga0495666_0007271 | |||
| 1681 | Ga0495666_0030808 | |||
| 1682 | Ga0495642_0000530 | |||
| 1683 | Ga0495642_0003931 | |||
| 1684 | Ga0495642_0011373 | |||
| 1685 | Ga0495654_0001074 | |||
| 1686 | Ga0495654_0001863 | |||
| 1687 | Ga0495654_0004272 | |||
| 1688 | Ga0495654_0004926 | |||
| 1689 | Ga0495654_0007882 | |||
| 1690 | Ga0495654_0008140 | |||
| 1691 | Ga0495654_0018594 | |||
| 1692 | Ga0495654_0032698 | |||
| 1693 | Ga0495654_0052389 | |||
| 1694 | Ga0495654_0119126 | |||
| 1695 | Ga0495654_0140575 | |||
| 1696 | Ga0495586_0039845 | |||
| 1697 | Ga0495587_0003815 | |||
| 1698 | Ga0495587_0115538 | |||
| 1699 | Ga0495609_0000061 | |||
| 1700 | Ga0495609_0000100 | |||
| 1701 | Ga0495609_0000178 | |||
| 1702 | Ga0495609_0025169 | |||
| 1703 | Ga0495609_0030557 | |||
| 1704 | Ga0495609_0033362 | |||
| 1705 | Ga0495609_0057505 | |||
| 1706 | Ga0495597_0000121 | |||
| 1707 | Ga0495597_0023133 | |||
| 1708 | Ga0495597_0030573 | |||
| 1709 | Ga0495597_0032404 | |||
| 1710 | Ga0495597_0067047 | |||
| 1711 | Ga0495597_0090955 | |||
| 1712 | Ga0495645_0147243 | |||
| 1713 | Ga0495622_0008643 | |||
| 1714 | Ga0495622_0017305 | |||
| 1715 | Ga0495622_0058951 | |||
| 1716 | Ga0495633_0000191 | |||
| 1717 | Ga0495633_0030976 | |||
| 1718 | Ga0495668_0008556 | |||
| 1719 | Ga0495668_0009359 | |||
| 1720 | Ga0495668_0025629 | |||
| 1721 | Ga0495668_0033263 | |||
| 1722 | Ga0495668_0036664 | |||
| 1723 | Ga0495634_0012719 | |||
| 1724 | Ga0495634_0090380 | |||
| 1725 | Ga0495611_0000539 | |||
| 1726 | Ga0495611_0001529 | |||
| 1727 | Ga0495611_0059730 | |||
| 1728 | Ga0495625_0000147 | |||
| 1729 | Ga0495625_0023415 | |||
| 1730 | Ga0495625_0034672 | |||
| 1731 | Ga0495625_0059005 | |||
| 1732 | Ga0495625_0107502 | |||
| 1733 | Ga0495635_0000604 | |||
| 1734 | Ga0495659_0002389 | |||
| 1735 | Ga0495659_0004322 | |||
| 1736 | Ga0495661_0000165 | |||
| 1737 | Ga0495661_0000282 | |||
| 1738 | Ga0495661_0000315 | |||
| 1739 | Ga0495661_0000463 | |||
| 1740 | Ga0495661_0002401 | |||
| 1741 | Ga0495661_0014406 | |||
| 1742 | Ga0495661_0025512 | |||
| 1743 | Ga0495661_0036084 | |||
| 1744 | Ga0495661_0111889 | |||
| 1745 | Ga0495661_0144908 | |||
| 1746 | Ga0495588_0076149 | |||
| 1747 | Ga0495623_0026764 | |||
| 1748 | Ga0495646_0031537 | |||
| 1749 | Ga0495646_0142047 | |||
| 1750 | Ga0495669_0010487 | |||
| 1751 | Ga0495613_0027732 | |||
| 1752 | Ga0495613_0303292 | |||
| 1753 | Ga0495624_0034097 | |||
| 1754 | Ga0495670_0004276 | |||
| 1755 | Ga0495670_0005838 | |||
| 1756 | Ga0495670_0031544 | |||
| 1757 | Ga0495670_0065003 | |||
| 1758 | Ga0495671_0000442 | |||
| 1759 | Ga0495671_0000471 | |||
| 1760 | Ga0495671_0004890 | |||
| 1761 | Ga0495671_0012137 | |||
| 1762 | Ga0495671_0015315 | |||
| 1763 | Ga0495671_0030969 | |||
| 1764 | Ga0495671_0047897 | |||
| 1765 | Ga0495671_0122815 | |||
| 1766 | Ga0495649_0001612 | |||
| 1767 | Ga0495649_0008675 | |||
| 1768 | Ga0495649_0009370 | |||
| 1769 | Ga0495649_0011587 | |||
| 1770 | Ga0495649_0024453 | |||
| 1771 | Ga0495649_0024463 | |||
| 1772 | Ga0495649_0024819 | |||
| 1773 | Ga0495649_0026853 | |||
| 1774 | Ga0495649_0041235 | |||
| 1775 | Ga0495649_0042328 | |||
| 1776 | Ga0495649_0086350 | |||
| 1777 | Ga0495649_0161274 | |||
| 1778 | Ga0495589_0009577 | |||
| 1779 | Ga0495589_0018147 | |||
| 1780 | Ga0495589_0035008 | |||
| 1781 | Ga0495589_0036685 | |||
| 1782 | Ga0495589_0050308 | |||
| 1783 | Ga0495589_0073111 | |||
| 1784 | Ga0495589_0089115 | |||
| 1785 | Ga0495660_0002249 | |||
| 1786 | Ga0495660_0002584 | |||
| 1787 | Ga0495660_0003663 | |||
| 1788 | Ga0495660_0013969 | |||
| 1789 | Ga0495660_0024180 | |||
| 1790 | Ga0495660_0024950 | |||
| 1791 | Ga0495660_0031961 | |||
| 1792 | Ga0495660_0044275 | |||
| 1793 | Ga0495660_0048195 | |||
| 1794 | Ga0495660_0053515 | |||
| 1795 | Ga0495660_0057105 | |||
| 1796 | Ga0495604_0017122 | |||
| 1797 | Ga0495604_0060498 | |||
| 1798 | Ga0495604_0080944 | |||
| 1799 | Ga0495674_0032307 | |||
| 1800 | Ga0495672_0002590 | |||
| 1801 | Ga0495672_0003292 | |||
| 1802 | Ga0495672_0004877 | |||
| 1803 | Ga0495672_0012275 | |||
| 1804 | Ga0495672_0014189 | |||
| 1805 | Ga0495672_0017754 | |||
| 1806 | Ga0495672_0031184 | |||
| 1807 | Ga0495672_0031509 | |||
| 1808 | Ga0495672_0037053 | |||
| 1809 | Ga0495672_0040170 | |||
| 1810 | Ga0495672_0052547 | |||
| 1811 | Ga0495672_0060902 | |||
| 1812 | Ga0495672_0061247 | |||
| 1813 | Ga0495672_0081398 | |||
| 1814 | Ga0495672_0111035 | |||
| 1815 | Ga0495672_0132380 | |||
| 1816 | Ga0495676_0000027 | |||
| 1817 | Ga0495676_0017905 | |||
| 1818 | Ga0495676_0024131 | |||
| 1819 | Ga0495680_0002978 | |||
| 1820 | Ga0495680_0064621 | |||
| 1821 | Ga0495680_0088326 | |||
| 1822 | Ga0495683_0000127 | |||
| 1823 | Ga0495683_0001020 | |||
| 1824 | Ga0495683_0001698 | |||
| 1825 | Ga0495683_0006921 | |||
| 1826 | Ga0495683_0013630 | |||
| 1827 | Ga0495683_0036955 | |||
| 1828 | Ga0495683_0066536 | |||
| 1829 | Ga0495683_0121746 | |||
| 1830 | Ga0495687_008752 | |||
| 1831 | Ga0495687_019335 | |||
| 1832 | Ga0495675_0072084 | |||
| 1833 | Ga0495677_0003730 | |||
| 1834 | Ga0495679_000096 | |||
| 1835 | Ga0495679_001683 | |||
| 1836 | Ga0495679_005660 | |||
| 1837 | Ga0495679_018601 | |||
| 1838 | Ga0495673_0001299 | |||
| 1839 | Ga0495673_0001329 | |||
| 1840 | Ga0495673_0001337 | |||
| 1841 | Ga0495673_0004104 | |||
| 1842 | Ga0495673_0005473 | |||
| 1843 | Ga0495673_0005824 | |||
| 1844 | Ga0495673_0014201 | |||
| 1845 | Ga0495673_0017126 | |||
| 1846 | Ga0495673_0030946 | |||
| 1847 | Ga0495673_0044348 | |||
| 1848 | Ga0495673_0062745 | |||
| 1849 | Ga0495673_0095788 | |||
| 1850 | Ga0495681_0008700 | |||
| 1851 | Ga0495681_0009013 | |||
| 1852 | Ga0495681_0011503 | |||
| 1853 | Ga0495681_0019355 | |||
| 1854 | Ga0495681_0023579 | |||
| 1855 | Ga0495681_0055149 | |||
| 1856 | Ga0495681_0066586 | |||
| 1857 | Ga0495681_0075792 | |||
| 1858 | Ga0495681_0088152 | |||
| 1859 | Ga0495686_0016571 | |||
| 1860 | Ga0495686_0037419 | |||
| 1861 | Ga0495686_0061776 | |||
| 1862 | Ga0495686_0134454 | |||
| 1863 | Ga0495593_0028813 | |||
| 1864 | Ga0495593_0105229 | |||
| 1865 | Ga0495602_0091614 | |||
| 1866 | Ga0495626_0000067 | |||
| 1867 | Ga0495626_0000507 | |||
| 1868 | Ga0495626_0000684 | |||
| 1869 | Ga0495626_0002907 | |||
| 1870 | Ga0495626_0007520 | |||
| 1871 | Ga0495626_0010124 | |||
| 1872 | Ga0495626_0017435 | |||
| 1873 | Ga0495626_0018889 | |||
| 1874 | Ga0495626_0040640 | |||
| 1875 | Ga0495626_0097113 | |||
| 1876 | Ga0496102_0017650 | |||
| 1877 | Ga0496102_0124175 | |||
| 1878 | Ga0496102_0208387 | |||
| 1879 | Ga0496103_0009954 | |||
| 1880 | Ga0496104_0397920 | |||
| 1881 | Ga0496110_0173561 | |||
| 1882 | Ga0496110_0306598 | |||
| 1883 | Ga0496111_0040892 | |||
| 1884 | Ga0496114_0054349 | |||
| 1885 | Ga0496116_0000242 | |||
| 1886 | Ga0496116_0002441 | |||
| 1887 | Ga0496116_0015602 | |||
| 1888 | Ga0496116_0016890 | |||
| 1889 | Ga0496116_0143991 | |||
| 1890 | Ga0496117_0000270 | |||
| 1891 | Ga0496117_0001400 | |||
| 1892 | Ga0496117_0008847 | |||
| 1893 | Ga0496117_0009764 | |||
| 1894 | Ga0496117_0011796 | |||
| 1895 | Ga0496117_0020455 | |||
| 1896 | Ga0496117_0084105 | |||
| 1897 | Ga0496117_0114029 | |||
| 1898 | Ga0496118_0000635 | |||
| 1899 | Ga0496118_0001057 | |||
| 1900 | Ga0496118_0007753 | |||
| 1901 | Ga0496118_0016858 | |||
| 1902 | Ga0496118_0024056 | |||
| 1903 | Ga0496118_0030353 | |||
| 1904 | Ga0496118_0068469 | |||
| 1905 | Ga0496118_0103282 | |||
| 1906 | Ga0496118_0119699 | |||
| 1907 | Ga0496118_0206938 | |||
| 1908 | Ga0496119_0000927 | |||
| 1909 | Ga0496119_0106180 | |||
| 1910 | Ga0496120_0001153 | |||
| 1911 | Ga0496120_0006057 | |||
| 1912 | Ga0496121_0000318 | |||
| 1913 | Ga0496121_0001431 | |||
| 1914 | Ga0496121_0003532 | |||
| 1915 | Ga0496121_0090791 | |||
| 1916 | Ga0496121_0102831 | |||
| 1917 | Ga0496121_0129648 | |||
| 1918 | Ga0496122_0002044 | |||
| 1919 | Ga0496122_0002319 | |||
| 1920 | Ga0496122_0037098 | |||
| 1921 | Ga0496122_0072746 | |||
| 1922 | Ga0496122_0171749 | |||
| 1923 | Ga0496123_0000243 | |||
| 1924 | Ga0496123_0002575 | |||
| 1925 | Ga0496123_0003264 | |||
| 1926 | Ga0496123_0020385 | |||
| 1927 | Ga0496123_0045948 | |||
| 1928 | Ga0496123_0064851 | |||
| 1929 | Ga0496123_0066692 | |||
| 1930 | Ga0496123_0066933 | |||
| 1931 | Ga0496124_0000751 | |||
| 1932 | Ga0496124_0004281 | |||
| 1933 | Ga0496124_0004505 | |||
| 1934 | Ga0496124_0007674 | |||
| 1935 | Ga0496124_0009354 | |||
| 1936 | Ga0496124_0011231 | |||
| 1937 | Ga0496124_0012961 | |||
| 1938 | Ga0496124_0016449 | |||
| 1939 | Ga0496124_0019159 | |||
| 1940 | Ga0496124_0026911 | |||
| 1941 | Ga0496124_0028798 | |||
| 1942 | Ga0496124_0044655 | |||
| 1943 | Ga0496124_0115377 | |||
| 1944 | Ga0496124_0143382 | |||
| 1945 | Ga0496124_0147283 | |||
| 1946 | Ga0496124_0265737 | |||
| 1947 | Ga0496124_0372013 | |||
| 1948 | Ga0496125_0000659 | |||
| 1949 | Ga0496125_0009328 | |||
| 1950 | Ga0496125_0033305 | |||
| 1951 | Ga0496125_0059322 | |||
| 1952 | Ga0496125_0073867 | |||
| 1953 | Ga0496125_0093947 | |||
| 1954 | Ga0496125_0108688 | |||
| 1955 | Ga0496126_0049489 | |||
| 1956 | Ga0495678_000093 | |||
| 1957 | Ga0495678_001871 | |||
| 1958 | Ga0495678_005859 | |||
| 1959 | Ga0495678_007267 | |||
| 1960 | Ga0495678_015613 | |||
| 1961 | Ga0495678_022409 | |||
| 1962 | Ga0495678_025410 | |||
| 1963 | Ga0495678_027770 | |||
| 1964 | Ga0495678_028913 | |||
| 1965 | Ga0495678_045152 | |||
| 1966 | Ga0495682_0000413 | |||
| 1967 | Ga0495682_0012344 | |||
| 1968 | Ga0495682_0024734 | |||
| 1969 | Ga0501032_0039091 | |||
| 1970 | Ga0501034_0000164 | |||
| 1971 | Ga0501039_0225027 | |||
| 1972 | Ga0501241_004287 | |||
| 1973 | Ga0501226_000008 | |||
| 1974 | nmdc:mga03683_104331_c1 | |||
| 1975 | Ga0500618_003287 | |||
| 1976 | Ga0500659_0003689 | |||
| 1977 | Ga0500573_0003716 | |||
| 1978 | 2510282754 | |||
| 1979 | 2510295410 | |||
| 1980 | 2510310966 | |||
| 1981 | 2511256297 | |||
| 1982 | 2511265776 | |||
| 1983 | 2511274338 | |||
| 1984 | 2511279850 | |||
| 1985 | 2511289702 | |||
| 1986 | 2511293293 | |||
| 1987 | 2511298935 | |||
| 1988 | 2511313087 | |||
| 1989 | 2511322249 | |||
| 1990 | 2511325238 | |||
| 1991 | 2511332222 | |||
| 1992 | 2511337658 | |||
| 1993 | 2511345504 | |||
| 1994 | 2511347996 | |||
| 1995 | 2511359140 | |||
| 1996 | 2511366140 | |||
| 1997 | 2511370506 | |||
| 1998 | 2511376298 | |||
| 1999 | 2511412458 | |||
| 2000 | 2511822048 | |||
| 2001 | 2512325299 | |||
| 2002 | 2554812357 | |||
| 2003 | 2555245246 | |||
| 2004 | 2555666961 | |||
| 2005 | 2583795396 | |||
| 2006 | 2597855211 | |||
| 2007 | 2597861211 | |||
| 2008 | 2597866958 | |||
| 2009 | 2599327809 | |||
| 2010 | 2599355634 | |||
| 2011 | 2599362964 | |||
| 2012 | 2599368730 | |||
| 2013 | 2599376073 | |||
| 2014 | 2599380740 | |||
| 2015 | 2599387744 | |||
| 2016 | 2599394931 | |||
| 2017 | 2599401098 | |||
| 2018 | 2599406696 | |||
| 2019 | 2599449569 | |||
| 2020 | 2599462468 | |||
| 2021 | 2599468110 | |||
| 2022 | 2599487337 | |||
| 2023 | 2599491485 | |||
| 2024 | 2599503831 | |||
| 2025 | 2599506038 | |||
| 2026 | 2599511641 | |||
| 2027 | 2599516615 | |||
| 2028 | 2599617068 | |||
| 2029 | 2599767776 | |||
| 2030 | 2599804307 | |||
| 2031 | 2599879332 | |||
| 2032 | 2599887907 | |||
| 2033 | 2599893144 | |||
| 2034 | 2599899402 | |||
| 2035 | 2599933261 | |||
| 2036 | 2599941989 | |||
| 2037 | 2599948722 | |||
| 2038 | 2599954970 | |||
| 2039 | 2599963575 | |||
| 2040 | 2599969562 | |||
| 2041 | 2599972681 | |||
| 2042 | 2599981048 | |||
| 2043 | 2599986277 | |||
| 2044 | 2599991330 | |||
| 2045 | 2599997211 | |||
| 2046 | 2600000841 | |||
| 2047 | 2600007459 | |||
| 2048 | 2600014895 | |||
| 2049 | 2600020200 | |||
| 2050 | 2600027152 | |||
| 2051 | 2600033186 | |||
| 2052 | 2600039397 | |||
| 2053 | 2600044279 | |||
| 2054 | 2600050061 | |||
| 2055 | 2600054691 | |||
| 2056 | 2600062874 | |||
| 2057 | 2600065293 | |||
| 2058 | 2600073234 | |||
| 2059 | 2600078999 | |||
| 2060 | 2600215090 | |||
| 2061 | 2600358761 | |||
| 2062 | 2600363179 | |||
| 2063 | 2601627703 | |||
| 2064 | 2601693285 | |||
| 2065 | 2601775256 | |||
| 2066 | 2601798205 | |||
| 2067 | 2606077093 | |||
| 2068 | 2606129661 | |||
| 2069 | 2608384377 | |||
| 2070 | 2621296534 | |||
| 2071 | 2624477790 | |||
| 2072 | 2624489374 | |||
| 2073 | 2643843180 | |||
| 2074 | 2643873501 | |||
| 2075 | 2643956049 | |||
| 2076 | 2644020171 | |||
| 2077 | 2644184183 | |||
| 2078 | 2644282847 | |||
| 2079 | 2644624482 | |||
| 2080 | 2652546997 | |||
| 2081 | 2671091906 | |||
| 2082 | 2671099605 | |||
| 2083 | 2671129610 | |||
| 2084 | 2671771316 | |||
| 2085 | 2677900458 | |||
| 2086 | 2678266521 | |||
| 2087 | 2715749526 | |||
| 2088 | 2715754527 | |||
| 2089 | 2723246115 | |||
| 2090 | 2729146374 | |||
| 2091 | 2738673480 | |||
| 2092 | 2738690600 | |||
| 2093 | 2738751873 | |||
| 2094 | 2738807555 | |||
| 2095 | 2738860914 | |||
| 2096 | 2738894915 | |||
| 2097 | 2739200966 | |||
| 2098 | 2739261803 | |||
| 2099 | 2739266374 | |||
| 2100 | 2739285961 | |||
| 2101 | 2739291274 | |||
| 2102 | 2739312177 | |||
| 2103 | 2743740782 | |||
| 2104 | 2745007751 | |||
| 2105 | 2765581228 | |||
| 2106 | 2774118049 | |||
| 2107 | 2784261491 | |||
| 2108 | 2784316536 | |||
| 2109 | 2794593619 | |||
| 2110 | 2807405807 | |||
| 2111 | 2807454142 | |||
| 2112 | 2808858641 | |||
| 2113 | 2808905920 | |||
| 2114 | 2808923926 | |||
| 2115 | 2808928131 | |||
| 2116 | 2808938601 | |||
| 2117 | 2808940355 | |||
| 2118 | 2808946219 | |||
| 2119 | 2808950687 | |||
| 2120 | 2808960658 | |||
| 2121 | 2808967146 | |||
| 2122 | 2808980133 | |||
| 2123 | 2808995853 | |||
| 2124 | 2809001956 | |||
| 2125 | 2809217547 | |||
| 2126 | 2812369751 | |||
| 2127 | 2817487987 | |||
| 2128 | 2819655450 | |||
| 2129 | 2819704752 | |||
| 2130 | 2823426054 | |||
| 2131 | 2825654691 | |||
| 2132 | 2826581737 | |||
| 2133 | 2834031244 | |||
| 2134 | 2842807544 | |||
| 2135 | 2842817079 | |||
| 2136 | 2842828461 | |||
| 2137 | 2842833764 | |||
| 2138 | 2842838218 | |||
| 2139 | 2842845997 | |||
| 2140 | 2842852041 | |||
| 2141 | 2842855983 | |||
| 2142 | 2844667446 | |||
| 2143 | 2852616643 | |||
| 2144 | 2852662596 | |||
| 2145 | 2852671611 | |||
| 2146 | 2860345234 | |||
| 2147 | 2860868010 | |||
| 2148 | 2878029733 | |||
| 2149 | 2880230687 | |||
| 2150 | 2904518632 | |||
| 2151 | 2904553425 | |||
| 2152 | 2908446589 | |||
| 2153 | 2912963809 | |||
| 2154 | 2913036909 | |||
| 2155 | 2917070695 | |||
| 2156 | 2919068013 | |||
| 2157 | 2919126099 | |||
| 2158 | 2919156119 | |||
| 2159 | 2919388852 | |||
| 2160 | 2919457889 | |||
| 2161 | 2919487028 | |||
| 2162 | 2919487816 | |||
| 2163 | 2919702421 | |||
| 2164 | 2923153614 | |||
| 2165 | 2923523838 | |||
| 2166 | 2923589339 | |||
| 2167 | 2926064472 | |||
| 2168 | 2929144379 | |||
| 2169 | 2929189894 | |||
| 2170 | 2931372294 | |||
| 2171 | 2931390955 | |||
| 2172 | 2931398433 | |||
| 2173 | 2935357970 | |||
| 2174 | 2939640539 | |||
| 2175 | 2939654410 | |||
| 2176 | 2945930590 | |||
| 2177 | 2945967164 | |||
| 2178 | 2946012937 | |||
| 2179 | 2946028199 | |||
| 2180 | 2947234720 | |||
| 2181 | 2969304489 | |||
| 2182 | 2974293759 | |||
| 2183 | 2984292501 | |||
| 2184 | 2984500126 | |||
| 2185 | 2984506490 | |||
| 2186 | 2988731841 | |||
| 2187 | 2990197880 | |||
| 2188 | 2998140057 | |||
| 2189 | 3007254967 | |||
| 2190 | 3007316239 | |||
| 2191 | 3007399061 | |||
| 2192 | 3007419597 | |||
| 2193 | 3007517476 | |||
| 2194 | 3007616470 | |||
| 2195 | 3007622585 | |||
| 2196 | 3007722045 | |||
| 2197 | 3007804231 | |||
| 2198 | 3007859502 | |||
| 2199 | 3007864769 | |||
| 2200 | 3007871903 | |||
| 2201 | 3007876303 | |||
| 2202 | 637317364 | |||
| 2203 | 640485976 | |||
| 2204 | 651173889 | |||
| 2205 | 8011356179 | |||
| 2206 | 8015687871 | |||
| 2207 | 8016731501 | |||
| 2208 | 8019769458 | |||
| 2209 | 8019779644 | |||
| 2210 | 8029995193 | |||
| 2211 | 8052494609 | |||
| 2212 | 8054290000 | |||
| 2213 | 8054349297 | |||
| 2214 | 8054503562 | |||
| 2215 | 8054929654 | |||
| 2216 | 8055770974 | |||
| 2217 | 8055817924 | |||
| 2218 | 8055881637 | |||
| 2219 | 8056116307 | |||
| 2220 | 8056120740 | |||
| 2221 | 8056126077 | |||
| 2222 | 8056131895 | |||
| 2223 | 8056137436 | |||
| 2224 | 8056143317 | |||
| 2225 | 8056151207 | |||
| 2226 | 8056160055 | |||
| 2227 | 8056163920 | |||
| 2228 | 8056170989 | |||
| 2229 | 8056177121 | |||
| 2230 | 8056182213 | |||
| 2231 | 8056570788 | |||
| 2232 | 8057802253 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5uai-assembly1.cif.gz_A | crystal structure of methionyl-trna formyltransferase from pseudomonas aeruginosa | 0.9709 | 5 | 313 |
| 5uai-assembly1.cif.gz_A | crystal structure of methionyl-trna formyltransferase from pseudomonas aeruginosa | 0.9647 | 5 | 313 |
| 3q0i-assembly1.cif.gz_A | methionyl-trna formyltransferase from vibrio cholerae | 0.963 | 5 | 312 |
| 3q0i-assembly1.cif.gz_A | methionyl-trna formyltransferase from vibrio cholerae | 0.9536 | 5 | 312 |
| 3r8x-assembly1.cif.gz_A | crystal structure of methionyl-trna formyltransferase from yersinia pestis complexed with l-methionine | 0.9462 | 1 | 311 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5uaiB02 | Alpha Beta;Roll;Methionyl-tRNA Fmet Formyltransferase; Chain A, domain 2;Formyl transferase, C-terminal domain | 0.9937 | 211 | 311 | 3.10.25.10 |
| 5uaiB02 | Alpha Beta;Roll;Methionyl-tRNA Fmet Formyltransferase; Chain A, domain 2;Formyl transferase, C-terminal domain | 0.9651 | 211 | 311 | 3.10.25.10 |
| 3tqqA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.9517 | 5 | 209 | 3.40.50.170 |
| af_Q2FZ68_206_310_3.10.25.10 | Alpha Beta;Roll;Methionyl-tRNA Fmet Formyltransferase; Chain A, domain 2;Formyl transferase, C-terminal domain | 0.9423 | 211 | 311 | 3.10.25.10 |
| 3tqqA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain | 0.9422 | 5 | 209 | 3.40.50.170 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C1MXF4-F1-model_v4 | Methionyl-tRNA formyltransferase (EC 2.1.2.9) | 0.9664 | 152 | 314 |
GO:0004479
GO:0005829 |
| AF-A0A449IHQ0-F1-model_v4 | Methionyl-tRNA formyltransferase (EC 2.1.2.9) | 0.9662 | 1 | 315 |
GO:0004479
GO:0005829 |
| AF-A0A1J4VFA6-F1-model_v4 | Methionyl-tRNA formyltransferase (EC 2.1.2.9) | 0.9623 | 108 | 312 |
GO:0004479
GO:0005829 |
| AF-A0A447KN32-F1-model_v4 | Methionyl-tRNA formyltransferase (EC 2.1.2.9) | 0.9588 | 103 | 311 |
GO:0004479
GO:0005829 |
| AF-A0A7R8ZV97-F1-model_v4 | Methionyl-tRNA formyltransferase, mitochondrial (EC 2.1.2.9) | 0.9586 | 11 | 282 |
GO:0004479
GO:0005829 GO:0006629 GO:0008962 |