F490328
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1117 | 764 | 2234 | 401 |
Family's Representative Sequence
| Representative Sequence | 3300049530|Ga0501314_000141|Ga0501314_000141_836_2218 |
| Length | 460 |
| Sequence | MRLPIYLDYSATTPVDPRVAQKMSECLLVDGNFGNPASRSHVFGWKAEEAVENARRQVAELVNADPREIVWTSGATESDNLAIKGVAHFYSSKGKHIVTSKIEHKAVLDTCRQLEREGFEVTYIEPGEDGLITPAMVEAALREDTVLASIMHVNNEIGTINDIAAIGELTRSRGVLFHVDAAQSTGKVEIDLEKLKVDLMSFSAHKTYGPKGVGALYVRRKPRVRLEAQTHGGGHERGMRSGTLATHQCVGMGEAFRIAKEEMVQENQRVLALRDRFYKQLEGMEELYVNGSLTQRVPHNLNLSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGATTSWRTVRSASPSVASPPRRKSXXXXARWPTRSTSCVTCRRSGTCSKKVSTYPRSNGRHTDFRVACRAAPDERGIAAWHTVKRSLTTTRTRATSARWMQRTRTSVPAWSARRPAAT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 6 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 8 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 9 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 10 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 11 | 3300003479 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 12 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 26 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 29 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 33 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 34 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 63 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 64 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 65 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 67 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 69 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 70 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 71 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 72 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 73 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 74 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 99 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 100 | 3300015679 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 | Metagenome | Unclassified |
| 101 | 3300015680 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 | Metagenome | Rhizosphere |
| 102 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 103 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 104 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 109 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 110 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 112 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 123 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 124 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 127 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 185 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 186 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 195 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 197 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 198 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 199 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 200 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 201 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 202 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 203 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 204 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 205 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 206 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 207 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 208 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 209 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 210 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 211 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 212 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 213 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 214 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 215 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 216 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 217 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 218 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 219 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 220 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 221 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 222 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 223 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 224 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 225 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 226 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 227 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 228 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 229 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 230 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 231 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 232 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 233 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 234 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 235 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 236 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 237 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 238 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 239 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 240 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 241 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 242 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 243 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 244 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 245 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 246 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 247 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 248 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 249 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 250 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 251 | 3300044669 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E | Metagenome | Unclassified |
| 252 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 253 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 254 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 255 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 256 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 257 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 313 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 314 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 315 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 318 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 319 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 320 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 321 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 322 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 323 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 324 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 325 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 326 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 327 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 328 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 329 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 330 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 331 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 346 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 347 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 348 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 349 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 352 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 353 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 354 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 355 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 356 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 357 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 358 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 359 | 2508501071 | Serratia proteamaculans S4 | Isolate | Rhizosphere |
| 360 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 361 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 362 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 363 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 364 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 365 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 366 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 367 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 368 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 369 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 370 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 371 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 372 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 373 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 374 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 375 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 376 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 377 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 378 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 379 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 380 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 381 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 382 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 383 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 384 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 385 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 386 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 387 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 388 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 389 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 390 | 2547132416 | Enterobacter sp. MR1 | Isolate | Rhizoplane |
| 391 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 392 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 393 | 2554235234 | Klebsiella michiganensis SA2 | Isolate | Unclassified |
| 394 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 395 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 396 | 2596583598 | Ralstonia sp. UNCCL144 | Isolate | Unclassified |
| 397 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 398 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 399 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 400 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 401 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 402 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 403 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 404 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 405 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 406 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 407 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 408 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 409 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 410 | 2599185169 | Klebsiella quasipneumoniae NFPP35 | Isolate | Rhizoplane |
| 411 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 412 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 413 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 414 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 415 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 416 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 417 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 418 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 419 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 420 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 421 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 422 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 423 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 424 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 425 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 426 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 427 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 428 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 429 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 430 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 431 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 432 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 433 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 434 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 435 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 436 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 437 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 438 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 439 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 440 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 441 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 442 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 443 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 444 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 445 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 446 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 447 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 448 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 449 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 450 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 451 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 452 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 453 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 454 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 455 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 456 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 457 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 458 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 459 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 460 | 2600255254 | Klebsiella quasipneumoniae NFIX15 | Isolate | Rhizoplane |
| 461 | 2600255255 | Klebsiella quasipneumoniae NFIX23 | Isolate | Rhizoplane |
| 462 | 2600255280 | Klebsiella quasipneumoniae NFIX42 | Isolate | Rhizoplane |
| 463 | 2600255281 | Klebsiella quasipneumoniae NFIX43 | Isolate | Rhizoplane |
| 464 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 465 | 2600255287 | Klebsiella quasipneumoniae NFIX11 | Isolate | Rhizoplane |
| 466 | 2600255288 | Klebsiella quasipneumoniae NFIX14 | Isolate | Rhizoplane |
| 467 | 2600255289 | Klebsiella quasipneumoniae NFIX16 | Isolate | Rhizoplane |
| 468 | 2600255290 | Klebsiella quasipneumoniae NFIX17 | Isolate | Rhizoplane |
| 469 | 2600255291 | Klebsiella quasipneumoniae NFIX19 | Isolate | Rhizoplane |
| 470 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 471 | 2600255298 | Klebsiella quasipneumoniae NFIX21 | Isolate | Rhizoplane |
| 472 | 2600255299 | Klebsiella quasipneumoniae NFIX22 | Isolate | Rhizoplane |
| 473 | 2600255300 | Klebsiella quasipneumoniae NFIX30 | Isolate | Rhizoplane |
| 474 | 2600255301 | Klebsiella quasipneumoniae NFIX33 | Isolate | Rhizoplane |
| 475 | 2600255302 | Klebsiella quasipneumoniae NFIX35 | Isolate | Rhizoplane |
| 476 | 2600255303 | Klebsiella quasipneumoniae NFIX36 | Isolate | Rhizoplane |
| 477 | 2600255304 | Klebsiella quasipneumoniae NFIX37 | Isolate | Rhizoplane |
| 478 | 2600255305 | Klebsiella quasipneumoniae NFIX41 | Isolate | Rhizoplane |
| 479 | 2600255306 | Klebsiella quasipneumoniae NFIX44 | Isolate | Rhizoplane |
| 480 | 2600255307 | Klebsiella quasipneumoniae NFIX56 | Isolate | Rhizoplane |
| 481 | 2600255309 | Klebsiella sp. NFIX53 | Isolate | Rhizoplane |
| 482 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 483 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 484 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 485 | 2600255392 | Klebsiella quasipneumoniae NFIX54 | Isolate | Rhizoplane |
| 486 | 2602042047 | Enterobacter sp. NFIX59 | Isolate | Rhizoplane |
| 487 | 2602042052 | Klebsiella quasipneumoniae NFIX18 | Isolate | Rhizoplane |
| 488 | 2602042053 | Klebsiella quasipneumoniae NFIX12 | Isolate | Rhizoplane |
| 489 | 2602042066 | Enterobacter sp. NFIX45 | Isolate | Rhizoplane |
| 490 | 2602042067 | Enterobacter sp. NFIX58 | Isolate | Rhizoplane |
| 491 | 2602042103 | Klebsiella quasipneumoniae NFIX29 | Isolate | Rhizoplane |
| 492 | 2602042104 | Klebsiella quasipneumoniae NFIX26 | Isolate | Rhizoplane |
| 493 | 2602042105 | Klebsiella quasipneumoniae NFIX25 | Isolate | Rhizoplane |
| 494 | 2602042106 | Klebsiella quasipneumoniae NFIX13 | Isolate | Rhizoplane |
| 495 | 2602042109 | Klebsiella aerogenes NFIX39 | Isolate | Rhizoplane |
| 496 | 2602042110 | Klebsiella quasipneumoniae NFIX40 | Isolate | Rhizoplane |
| 497 | 2602042111 | Klebsiella quasipneumoniae NFIX20 | Isolate | Rhizoplane |
| 498 | 2603880178 | Klebsiella quasipneumoniae NFIX34 | Isolate | Rhizoplane |
| 499 | 2603880184 | Klebsiella quasipneumoniae NFIX27 | Isolate | Rhizoplane |
| 500 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 501 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 502 | 2603880202 | Klebsiella quasipneumoniae NFIX38 | Isolate | Rhizoplane |
| 503 | 2603880211 | Klebsiella quasipneumoniae NFIX24 | Isolate | Rhizoplane |
| 504 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 505 | 2609459761 | Enterobacter sp. NFR05 | Isolate | Rhizoplane |
| 506 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 507 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 508 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 509 | 2636415599 | Klebsiella variicola DX120E | Isolate | Unclassified |
| 510 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 511 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 512 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 513 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 514 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 515 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 516 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 517 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 518 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 519 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 520 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 521 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 522 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 523 | 2667528172 | Enterobacteriaceae bacterium NFIX31 | Isolate | Rhizoplane |
| 524 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 525 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 526 | 2675903046 | Klebsiella quasipneumoniae NFIX52 | Isolate | Rhizoplane |
| 527 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 528 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 529 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 530 | 2681812866 | Enterobacter asburiae NFIX55 | Isolate | Rhizoplane |
| 531 | 2681812869 | Enterobacter ludwigii NFPP41 | Isolate | Rhizoplane |
| 532 | 2690315857 | Rheinheimera sp. EpRS3 | Isolate | Unclassified |
| 533 | 2706794495 | Dickeya zeae ZJU1202 | Isolate | Unclassified |
| 534 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 535 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 536 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 537 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 538 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 539 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 540 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 541 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 542 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 543 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 544 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 545 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 546 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 547 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 548 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 549 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 550 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 551 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 552 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 553 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 554 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 555 | 2751185917 | Enterobacter sp. HK169 | Isolate | Unclassified |
| 556 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 557 | 2765235842 | Enterobacter ludwigii AA4 | Isolate | Unclassified |
| 558 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 559 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 560 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 561 | 2775506706 | Enterobacter asburiae 1216 | Isolate | Unclassified |
| 562 | 2775507074 | Klebsiella sp. D5A | Isolate | Unclassified |
| 563 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 564 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 565 | 2791354903 | Mangrovibacter phragmitis MP23 | Isolate | Unclassified |
| 566 | 2791355275 | Enterobacter sp. Sa187 | Isolate | Unclassified |
| 567 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 568 | 2806310673 | Serratia quinivorans NCTC 13189 | Isolate | Rhizosphere |
| 569 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 570 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 571 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 572 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 573 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 574 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 575 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 576 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 577 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 578 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 579 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 580 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 581 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 582 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 583 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 584 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 585 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 586 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 587 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 588 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 589 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 590 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 591 | 2821118458 | Enterobacter asburiae 609 | Isolate | Unclassified |
| 592 | 2823373977 | Enterobacter ludwigii NCR3 | Isolate | Rhizosphere |
| 593 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 594 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 595 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 596 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 597 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 598 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 599 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 600 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 601 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 602 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 603 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 604 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 605 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 606 | 2844425489 | Enterobacter cloacae SBP-8 | Isolate | Rhizosphere |
| 607 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 608 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 609 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 610 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 611 | 2854601825 | Dickeya dianthicola SS70 | Isolate | Stem Tuber |
| 612 | 2855195626 | Pectobacterium atrosepticum SS26 | Isolate | Stem Tuber |
| 613 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 614 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 615 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 616 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 617 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 618 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 619 | 2871282230 | Pectobacterium parmentieri SS90 | Isolate | Stem Tuber |
| 620 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 621 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 622 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 623 | 2884086401 | Kluyvera sp. PO2S7 | Isolate | Rhizosphere |
| 624 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 625 | 2887630918 | Psychrosphaera haliotis UCD-MCMsp1aY | Isolate | Unclassified |
| 626 | 2888373701 | Serratia rhizosphaerae KUDC3025 | Isolate | Rhizosphere |
| 627 | 2891670763 | Buttiauxella sp. B2 | Isolate | Rhizosphere |
| 628 | 2900051742 | Pectobacterium zantedeschiae 2M | Isolate | Stem Tuber |
| 629 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 630 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 631 | 2904513164 | Klebsiella variicola 1431 | Isolate | Rhizosphere |
| 632 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 633 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 634 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 635 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 636 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 637 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 638 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 639 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 640 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 641 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 642 | 2919108558 | Klebsiella sp. 1400 | Isolate | Rhizosphere |
| 643 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 644 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 645 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 646 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 647 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 648 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 649 | 2919497567 | Shewanella putrefaciens 3469 | Isolate | Unclassified |
| 650 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 651 | 2919534386 | Rheinheimera pacifica 3879 | Isolate | Unclassified |
| 652 | 2919688452 | Pararheinheimera soli 4138 | Isolate | Unclassified |
| 653 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 654 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 655 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 656 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 657 | 2923634449 | Enterobacter kobei SLBN-76 | Isolate | Rhizosphere |
| 658 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 659 | 2927833300 | Enterobacter sp. SLBN-59 | Isolate | Rhizosphere |
| 660 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 661 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 662 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 663 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 664 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 665 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 666 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 667 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 668 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 669 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 670 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 671 | 2937539931 | Pantoea sp. LS15 | Isolate | Unclassified |
| 672 | 2939568625 | Lelliottia sp. 489 | Isolate | Rhizosphere |
| 673 | 2939573065 | Citrobacter sp. 506 | Isolate | Rhizosphere |
| 674 | 2939607340 | Leclercia sp. 1548 | Isolate | Rhizosphere |
| 675 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 676 | 2939642701 | Lelliottia nimipressuralis 2756 | Isolate | Rhizosphere |
| 677 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 678 | 2941479691 | |||
| 679 | 2945874760 | Phytobacter diazotrophicus UAEU22 | Isolate | Rhizosphere |
| 680 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 681 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 682 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 683 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 684 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 685 | 2952252522 | Salinicola sp. DM10 | Isolate | Unclassified |
| 686 | 2969079654 | Klebsiella variicola E57-7 | Isolate | Unclassified |
| 687 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 688 | 2971820967 | Klebsiella sp. MPUS7 | Isolate | Rhizosphere |
| 689 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 690 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 691 | 2974310843 | Enterobacter sp. SORGH_AS 287 | Isolate | Unclassified |
| 692 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 693 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 694 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 695 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 696 | 2984559226 | Klebsiella variicola SORGH_AS834 | Isolate | Aerial Root |
| 697 | 2984595703 | Klebsiella variicola SORGH_AS1070 | Isolate | Aerial Root |
| 698 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 699 | 2990196909 | Pseudomonas mangrovi TC-11 | Isolate | Unclassified |
| 700 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 701 | 2998344455 | Vogesella urethralis SLBN-145 | Isolate | Rhizosphere |
| 702 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 703 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 704 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 705 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 706 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 707 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 708 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 709 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 710 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 711 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 712 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 713 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 714 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 715 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 716 | 640427133 | Stutzerimonas stutzeri A1501 | Isolate | Rhizosphere |
| 717 | 640753048 | Serratia proteamaculans 568 | Isolate | Endosphere |
| 718 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 719 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 720 | 8002745576 | Marinomonas spartinae USM8 | Isolate | Rhizosphere |
| 721 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
| 722 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 723 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 724 | 8016728285 | Pseudomonas psychrotolerans SORGH_AS 227 | Isolate | Unclassified |
| 725 | 8018221730 | Enterobacter sp. CM29 | Isolate | Unclassified |
| 726 | 8018405270 | Enterobacter sp. 198 | Isolate | Rhizosphere |
| 727 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 728 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 729 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 730 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 731 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 732 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 733 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 734 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 735 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 736 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 737 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 738 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 739 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 740 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 741 | 8054849141 | Dryocola clanedunensis H11S18 | Isolate | Rhizosphere |
| 742 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 743 | 8055087960 | Silvania hatchlandensis H19S6 | Isolate | Rhizosphere |
| 744 | 8055092621 | Silvania confinis H4N4 | Isolate | Rhizosphere |
| 745 | 8055097453 | Leclercia tamurae H6W5 | Isolate | Rhizosphere |
| 746 | 8055225921 | Achromobacter panacis KCTC 42751 | Isolate | Rhizosphere |
| 747 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 748 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 749 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 750 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 751 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 752 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 753 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 754 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 755 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 756 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 757 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 758 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 759 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 760 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 761 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 762 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 763 | 8057304971 | Scandinavium manionii H17S15 | Isolate | Rhizosphere |
| 764 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 60.34 |
| Metatranscriptomes | 3.04 |
| Isolates | 36.62 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.36 |
| Bulb | 0 |
| Endosphere | 8.24 |
| Nodule | 3.49 |
| Rhizoplane | 11.28 |
| Rhizosphere | 57.48 |
| Stem | 0 |
| Stem Tuber | 0.36 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501314_000141 | 3300049530 | Bacteria | 3563 |
| 2 | MRS2a_Contig_20 | 2124908027 | Bacteria | 32039 |
| 3 | JGI24740J21852_10000304 | 3300001979 | Bacteria | 20859 |
| 4 | JGI24740J21852_10014032 | 3300001979 | Bacteria | 2969 |
| 5 | JGI24735J21928_10008524 | 3300002067 | Bacteria | 3310 |
| 6 | JGI25156J39149_1004627 | 3300002705 | Bacteria | 4148 |
| 7 | JGI25162J39368_1000034 | 3300002737 | Bacteria | 183428 |
| 8 | JGI25162J39368_1000267 | 3300002737 | Bacteria | 50233 |
| 9 | JGI25154J39366_1000649 | 3300002738 | Bacteria | 16270 |
| 10 | JGI25154J39366_1003474 | 3300002738 | Bacteria | 3286 |
| 11 | JGI25164J39214_1000018 | 3300002772 | Bacteria | 185215 |
| 12 | JGI25164J39214_1000207 | 3300002772 | Bacteria | 50241 |
| 13 | JGI25150J39212_1011928 | 3300002774 | Bacteria | 1556 |
| 14 | JGI25165J46597_1000123 | 3300003214 | Bacteria | 131481 |
| 15 | JGI25165J46597_1000376 | 3300003214 | Bacteria | 49186 |
| 16 | Ga0006556J51387_1030706 | 3300003479 | Bacteria | 2642 |
| 17 | Ga0055538_1000028 | 3300003751 | Bacteria | 215806 |
| 18 | Ga0055539_1000037 | 3300003752 | Bacteria | 215806 |
| 19 | Ga0055539_1003753 | 3300003752 | Bacteria | 2075 |
| 20 | Ga0055533_1000047 | 3300003756 | Bacteria | 215806 |
| 21 | Ga0055533_1002398 | 3300003756 | Bacteria | 4273 |
| 22 | Ga0055532_1000065 | 3300003758 | Bacteria | 141003 |
| 23 | Ga0055525_1000215 | 3300003759 | Bacteria | 64175 |
| 24 | Ga0055527_1002163 | 3300003760 | Bacteria | 3487 |
| 25 | Ga0055527_1002411 | 3300003760 | Bacteria | 3179 |
| 26 | Ga0055535_1003690 | 3300003761 | Bacteria | 4148 |
| 27 | Ga0055536_1001163 | 3300003781 | Bacteria | 16447 |
| 28 | Ga0055528_1013242 | 3300003790 | Bacteria | 3140 |
| 29 | Ga0055530_10004141 | 3300003791 | Bacteria | 7674 |
| 30 | Ga0055530_10004237 | 3300003791 | Bacteria | 7526 |
| 31 | Ga0055540_1003422 | 3300003792 | Bacteria | 7674 |
| 32 | Ga0055540_1003920 | 3300003792 | Bacteria | 6972 |
| 33 | Ga0055540_1005813 | 3300003792 | Bacteria | 5066 |
| 34 | Ga0055531_10004391 | 3300003794 | Bacteria | 8606 |
| 35 | Ga0055541_1000025 | 3300003841 | Bacteria | 215806 |
| 36 | Ga0055541_1003150 | 3300003841 | Bacteria | 3155 |
| 37 | Ga0058692_1000635 | 3300003856 | Bacteria | 14495 |
| 38 | Ga0058692_1020442 | 3300003856 | Bacteria | 1391 |
| 39 | Ga0065714_10000015 | 3300005288 | Bacteria | 19127 |
| 40 | Ga0065714_10065484 | 3300005288 | Bacteria | 9800 |
| 41 | Ga0065714_10066406 | 3300005288 | Bacteria | 6920 |
| 42 | Ga0065714_10093370 | 3300005288 | Bacteria | 1849 |
| 43 | Ga0065704_10072138 | 3300005289 | Bacteria | 9076 |
| 44 | Ga0065704_10076944 | 3300005289 | Bacteria | 4914 |
| 45 | Ga0065712_10003570 | 3300005290 | Bacteria | 5875 |
| 46 | Ga0065712_10067801 | 3300005290 | Bacteria | 32034 |
| 47 | Ga0070658_10167595 | 3300005327 | Bacteria | 1844 |
| 48 | Ga0070683_100001860 | 3300005329 | Bacteria | 16469 |
| 49 | Ga0070670_100001421 | 3300005331 | Bacteria | 19245 |
| 50 | Ga0070670_100179989 | 3300005331 | Bacteria | 1835 |
| 51 | Ga0068869_100027291 | 3300005334 | Bacteria | 3980 |
| 52 | Ga0068869_100032957 | 3300005334 | Bacteria | 3654 |
| 53 | Ga0068868_100000153 | 3300005338 | Bacteria | 44713 |
| 54 | Ga0070660_100000038 | 3300005339 | Bacteria | 77397 |
| 55 | Ga0070660_100063879 | 3300005339 | Bacteria | 2863 |
| 56 | Ga0070661_100000022 | 3300005344 | Bacteria | 127714 |
| 57 | Ga0070661_100002241 | 3300005344 | Bacteria | 13262 |
| 58 | Ga0070669_100004428 | 3300005353 | Bacteria | 10128 |
| 59 | Ga0070669_100178220 | 3300005353 | Bacteria | 1661 |
| 60 | Ga0070675_100000465 | 3300005354 | Bacteria | 27680 |
| 61 | Ga0070671_100001721 | 3300005355 | Bacteria | 16617 |
| 62 | Ga0070688_100020256 | 3300005365 | Bacteria | 3865 |
| 63 | Ga0070659_100000050 | 3300005366 | Bacteria | 97735 |
| 64 | Ga0070659_100003967 | 3300005366 | Bacteria | 10534 |
| 65 | Ga0070659_100069037 | 3300005366 | Bacteria | 2805 |
| 66 | Ga0070667_100013661 | 3300005367 | Bacteria | 6709 |
| 67 | Ga0070714_100090543 | 3300005435 | Bacteria | 2679 |
| 68 | Ga0070663_100005963 | 3300005455 | Bacteria | 7293 |
| 69 | Ga0070678_100000364 | 3300005456 | Bacteria | 21100 |
| 70 | Ga0070678_100093039 | 3300005456 | Bacteria | 2317 |
| 71 | Ga0070662_100001253 | 3300005457 | Bacteria | 15586 |
| 72 | Ga0068867_100098689 | 3300005459 | Bacteria | 2227 |
| 73 | Ga0070679_100018846 | 3300005530 | Bacteria | 6701 |
| 74 | Ga0070684_100008061 | 3300005535 | Bacteria | 8223 |
| 75 | Ga0068853_100003013 | 3300005539 | Bacteria | 12861 |
| 76 | Ga0070672_100000119 | 3300005543 | Bacteria | 40242 |
| 77 | Ga0070696_100072638 | 3300005546 | Bacteria | 2423 |
| 78 | Ga0070665_100001059 | 3300005548 | Bacteria | 34416 |
| 79 | Ga0070665_100141462 | 3300005548 | Bacteria | 2409 |
| 80 | Ga0068855_100001651 | 3300005563 | Bacteria | 27931 |
| 81 | Ga0068855_100008249 | 3300005563 | Bacteria | 12592 |
| 82 | Ga0068855_100092724 | 3300005563 | Bacteria | 3483 |
| 83 | Ga0070664_100002152 | 3300005564 | Bacteria | 15794 |
| 84 | Ga0070664_100003141 | 3300005564 | Bacteria | 13352 |
| 85 | Ga0068857_100000265 | 3300005577 | Bacteria | 35453 |
| 86 | Ga0068854_100002231 | 3300005578 | Bacteria | 11923 |
| 87 | Ga0068854_100006385 | 3300005578 | Bacteria | 7499 |
| 88 | Ga0068856_100001616 | 3300005614 | Bacteria | 23579 |
| 89 | Ga0068852_100001062 | 3300005616 | Bacteria | 18131 |
| 90 | Ga0068852_100020940 | 3300005616 | Bacteria | 5208 |
| 91 | Ga0068852_100138394 | 3300005616 | Bacteria | 2250 |
| 92 | Ga0068864_100006456 | 3300005618 | Bacteria | 9607 |
| 93 | Ga0068851_10000044 | 3300005834 | Bacteria | 83228 |
| 94 | Ga0068851_10000937 | 3300005834 | Bacteria | 12630 |
| 95 | Ga0068851_10021856 | 3300005834 | Bacteria | 3109 |
| 96 | Ga0068858_100233335 | 3300005842 | Bacteria | 1744 |
| 97 | Ga0068862_100272819 | 3300005844 | Bacteria | 1547 |
| 98 | Ga0075365_10209567 | 3300006038 | Bacteria | 1366 |
| 99 | Ga0075364_10007007 | 3300006051 | Bacteria | 6659 |
| 100 | Ga0075364_10010639 | 3300006051 | Bacteria | 5564 |
| 101 | Ga0070712_100126976 | 3300006175 | Bacteria | 1928 |
| 102 | Ga0075366_10000114 | 3300006195 | Bacteria | 33061 |
| 103 | Ga0075366_10014314 | 3300006195 | Bacteria | 4531 |
| 104 | Ga0097621_100000386 | 3300006237 | Bacteria | 30676 |
| 105 | Ga0068871_100004108 | 3300006358 | Bacteria | 10067 |
| 106 | Ga0068871_100099235 | 3300006358 | Bacteria | 2437 |
| 107 | Ga0075430_100037846 | 3300006846 | Bacteria | 4090 |
| 108 | Ga0075431_100029182 | 3300006847 | Bacteria | 5674 |
| 109 | Ga0068865_100038530 | 3300006881 | Bacteria | 3236 |
| 110 | Ga0099823_1000165 | 3300006944 | Bacteria | 35591 |
| 111 | Ga0079104_1000075 | 3300006946 | Bacteria | 148544 |
| 112 | Ga0079104_1000155 | 3300006946 | Bacteria | 97065 |
| 113 | Ga0079104_1000365 | 3300006946 | Bacteria | 53914 |
| 114 | Ga0079104_1001490 | 3300006946 | Bacteria | 15588 |
| 115 | Ga0079104_1024697 | 3300006946 | Bacteria | 1578 |
| 116 | Ga0105251_10000057 | 3300009011 | Bacteria | 104178 |
| 117 | Ga0105251_10002699 | 3300009011 | Bacteria | 13633 |
| 118 | Ga0105251_10003084 | 3300009011 | Bacteria | 12384 |
| 119 | Ga0105251_10007038 | 3300009011 | Bacteria | 7016 |
| 120 | Ga0105251_10010297 | 3300009011 | Bacteria | 5436 |
| 121 | Ga0105251_10024042 | 3300009011 | Bacteria | 3134 |
| 122 | Ga0105251_10032626 | 3300009011 | Bacteria | 2593 |
| 123 | Ga0105244_10000074 | 3300009036 | Bacteria | 113999 |
| 124 | Ga0105244_10000329 | 3300009036 | Bacteria | 45045 |
| 125 | Ga0105244_10016005 | 3300009036 | Bacteria | 4286 |
| 126 | Ga0105244_10019386 | 3300009036 | Bacteria | 3799 |
| 127 | Ga0105244_10029820 | 3300009036 | Bacteria | 2909 |
| 128 | Ga0105244_10034909 | 3300009036 | Bacteria | 2645 |
| 129 | Ga0105244_10039490 | 3300009036 | Bacteria | 2456 |
| 130 | Ga0105244_10041671 | 3300009036 | Bacteria | 2378 |
| 131 | Ga0105244_10048906 | 3300009036 | Bacteria | 2163 |
| 132 | Ga0105244_10051809 | 3300009036 | Bacteria | 2091 |
| 133 | Ga0105244_10088593 | 3300009036 | Bacteria | 1524 |
| 134 | Ga0105250_10000105 | 3300009092 | Bacteria | 75608 |
| 135 | Ga0105250_10002957 | 3300009092 | Bacteria | 8271 |
| 136 | Ga0105250_10007801 | 3300009092 | Bacteria | 4581 |
| 137 | Ga0105240_10014742 | 3300009093 | Bacteria | 10661 |
| 138 | Ga0105240_10073092 | 3300009093 | Bacteria | 4235 |
| 139 | Ga0111539_10141908 | 3300009094 | Bacteria | 2812 |
| 140 | Ga0105245_10030665 | 3300009098 | Bacteria | 4755 |
| 141 | Ga0105243_10000257 | 3300009148 | Bacteria | 60860 |
| 142 | Ga0105243_10003279 | 3300009148 | Bacteria | 13149 |
| 143 | Ga0105243_10011277 | 3300009148 | Bacteria | 6760 |
| 144 | Ga0105243_10014467 | 3300009148 | Bacteria | 5973 |
| 145 | Ga0105243_10085876 | 3300009148 | Bacteria | 2580 |
| 146 | Ga0105241_10007611 | 3300009174 | Bacteria | 7960 |
| 147 | Ga0105242_10000604 | 3300009176 | Bacteria | 28166 |
| 148 | Ga0105248_10007111 | 3300009177 | Bacteria | 12261 |
| 149 | Ga0105248_10044796 | 3300009177 | Bacteria | 4962 |
| 150 | Ga0105237_10002667 | 3300009545 | Bacteria | 21926 |
| 151 | Ga0105237_10385957 | 3300009545 | Bacteria | 1405 |
| 152 | Ga0105237_10386025 | 3300009545 | Bacteria | 1405 |
| 153 | Ga0105238_10027224 | 3300009551 | Bacteria | 5825 |
| 154 | Ga0105238_10062449 | 3300009551 | Bacteria | 3726 |
| 155 | Ga0105249_10056467 | 3300009553 | Bacteria | 3594 |
| 156 | Ga0105246_10007820 | 3300011119 | Bacteria | 6559 |
| 157 | Ga0105246_10149448 | 3300011119 | Bacteria | 1766 |
| 158 | Ga0105246_10237290 | 3300011119 | Bacteria | 1439 |
| 159 | Ga0157373_10033783 | 3300013100 | Bacteria | 3676 |
| 160 | Ga0157373_10040717 | 3300013100 | Bacteria | 3324 |
| 161 | Ga0157373_10068658 | 3300013100 | Bacteria | 2505 |
| 162 | Ga0157371_10000319 | 3300013102 | Bacteria | 62459 |
| 163 | Ga0157371_10017491 | 3300013102 | Bacteria | 5325 |
| 164 | Ga0157371_10139527 | 3300013102 | Bacteria | 1727 |
| 165 | Ga0157370_10000158 | 3300013104 | Bacteria | 83884 |
| 166 | Ga0157370_10005151 | 3300013104 | Bacteria | 14739 |
| 167 | Ga0157370_10291204 | 3300013104 | Bacteria | 1508 |
| 168 | Ga0157369_10004387 | 3300013105 | Bacteria | 16660 |
| 169 | Ga0157374_10000275 | 3300013296 | Bacteria | 47712 |
| 170 | Ga0157378_10007964 | 3300013297 | Bacteria | 9249 |
| 171 | Ga0157372_10002346 | 3300013307 | Bacteria | 20483 |
| 172 | Ga0157372_10042119 | 3300013307 | Bacteria | 5049 |
| 173 | Ga0157372_10069996 | 3300013307 | Bacteria | 3947 |
| 174 | Ga0157372_10394725 | 3300013307 | Bacteria | 1612 |
| 175 | Ga0157375_10000644 | 3300013308 | Bacteria | 30997 |
| 176 | Ga0157375_10425930 | 3300013308 | Bacteria | 1493 |
| 177 | Ga0157377_10008750 | 3300014745 | Bacteria | 4948 |
| 178 | Ga0157376_10006609 | 3300014969 | Bacteria | 8204 |
| 179 | Ga0182006_1000024 | 3300015261 | Bacteria | 257431 |
| 180 | Ga0182006_1005123 | 3300015261 | Bacteria | 6298 |
| 181 | Ga0182007_10002743 | 3300015262 | Bacteria | 8607 |
| 182 | Ga0183366_1001 | 3300015679 | Bacteria | 2743932 |
| 183 | Ga0183370_1001 | 3300015680 | Bacteria | 2743932 |
| 184 | Ga0183369_1001 | 3300015685 | Bacteria | 2743932 |
| 185 | Ga0183368_1001 | 3300015687 | Bacteria | 2743932 |
| 186 | Ga0163161_10190962 | 3300017792 | Bacteria | 1575 |
| 187 | Ga0163161_10292215 | 3300017792 | Bacteria | 1281 |
| 188 | Ga0206356_10486280 | 3300020070 | Bacteria | 4370 |
| 189 | Ga0206351_10240908 | 3300020077 | Bacteria | 4341 |
| 190 | Ga0206352_10757900 | 3300020078 | Bacteria | 3056 |
| 191 | Ga0213872_10003644 | 3300021361 | Bacteria | 8443 |
| 192 | Ga0213876_10000065 | 3300021384 | Bacteria | 128435 |
| 193 | Ga0224712_10029285 | 3300022467 | Bacteria | 1976 |
| 194 | Ga0209435_101129 | 3300025206 | Bacteria | 3680 |
| 195 | Ga0209760_100144 | 3300025207 | Bacteria | 44880 |
| 196 | Ga0209760_100239 | 3300025207 | Bacteria | 23066 |
| 197 | Ga0209784_100032 | 3300025224 | Bacteria | 314079 |
| 198 | Ga0209784_101717 | 3300025224 | Bacteria | 2627 |
| 199 | Ga0209566_100036 | 3300025225 | Bacteria | 314079 |
| 200 | Ga0209566_100561 | 3300025225 | Bacteria | 24375 |
| 201 | Ga0209566_101093 | 3300025225 | Bacteria | 10535 |
| 202 | Ga0209674_100054 | 3300025226 | Bacteria | 314079 |
| 203 | Ga0209674_100122 | 3300025226 | Bacteria | 131720 |
| 204 | Ga0209672_100014 | 3300025228 | Bacteria | 546252 |
| 205 | Ga0209672_100023 | 3300025228 | Bacteria | 371758 |
| 206 | Ga0209672_102420 | 3300025228 | Bacteria | 4611 |
| 207 | Ga0209672_103191 | 3300025228 | Bacteria | 3500 |
| 208 | Ga0209147_100055 | 3300025229 | Bacteria | 262412 |
| 209 | Ga0209147_100127 | 3300025229 | Bacteria | 123986 |
| 210 | Ga0209147_100171 | 3300025229 | Bacteria | 86726 |
| 211 | Ga0209147_100911 | 3300025229 | Bacteria | 13301 |
| 212 | Ga0209563_100055 | 3300025230 | Bacteria | 314079 |
| 213 | Ga0207427_100007 | 3300025231 | Bacteria | 746220 |
| 214 | Ga0207427_100038 | 3300025231 | Bacteria | 292975 |
| 215 | Ga0209437_100006 | 3300025233 | Bacteria | 1042724 |
| 216 | Ga0209437_100009 | 3300025233 | Bacteria | 915954 |
| 217 | Ga0209258_100134 | 3300025242 | Bacteria | 174683 |
| 218 | Ga0209258_100183 | 3300025242 | Bacteria | 136466 |
| 219 | Ga0209258_100283 | 3300025242 | Bacteria | 83776 |
| 220 | Ga0209646_1000022 | 3300025246 | Bacteria | 446621 |
| 221 | Ga0209646_1000847 | 3300025246 | Bacteria | 10298 |
| 222 | Ga0209026_1004035 | 3300025250 | Bacteria | 4545 |
| 223 | Ga0209677_100033 | 3300025253 | Bacteria | 314079 |
| 224 | Ga0209677_109356 | 3300025253 | Bacteria | 1767 |
| 225 | Ga0209148_1000021 | 3300025254 | Bacteria | 714645 |
| 226 | Ga0209148_1000035 | 3300025254 | Bacteria | 548413 |
| 227 | Ga0209148_1000651 | 3300025254 | Bacteria | 29976 |
| 228 | Ga0209148_1002826 | 3300025254 | Bacteria | 5387 |
| 229 | Ga0209759_1001746 | 3300025256 | Bacteria | 11158 |
| 230 | Ga0209759_1004108 | 3300025256 | Bacteria | 5557 |
| 231 | Ga0209759_1007458 | 3300025256 | Bacteria | 3515 |
| 232 | Ga0209233_1000059 | 3300025261 | Bacteria | 414562 |
| 233 | Ga0209233_1000074 | 3300025261 | Bacteria | 357367 |
| 234 | Ga0209455_1000072 | 3300025272 | Bacteria | 293074 |
| 235 | Ga0209455_1001880 | 3300025272 | Bacteria | 8751 |
| 236 | Ga0209455_1006914 | 3300025272 | Bacteria | 3287 |
| 237 | Ga0209673_1000140 | 3300025273 | Bacteria | 157575 |
| 238 | Ga0209675_1001271 | 3300025291 | Bacteria | 15087 |
| 239 | Ga0209676_1000006 | 3300025292 | Bacteria | 1039588 |
| 240 | Ga0209676_1000010 | 3300025292 | Bacteria | 954025 |
| 241 | Ga0209676_1000306 | 3300025292 | Bacteria | 97332 |
| 242 | Ga0209676_1002335 | 3300025292 | Bacteria | 13714 |
| 243 | Ga0209564_1004606 | 3300025295 | Bacteria | 8315 |
| 244 | Ga0209050_1000019 | 3300025298 | Bacteria | 608757 |
| 245 | Ga0209050_1000060 | 3300025298 | Bacteria | 321699 |
| 246 | Ga0209050_1000065 | 3300025298 | Bacteria | 313668 |
| 247 | Ga0209050_1004114 | 3300025298 | Bacteria | 10135 |
| 248 | Ga0209051_1000037 | 3300025303 | Bacteria | 321747 |
| 249 | Ga0209051_1000266 | 3300025303 | Bacteria | 87354 |
| 250 | Ga0209051_1000463 | 3300025303 | Bacteria | 53154 |
| 251 | Ga0209257_1000119 | 3300025304 | Bacteria | 225893 |
| 252 | Ga0207656_10000022 | 3300025321 | Bacteria | 106345 |
| 253 | Ga0207696_1000112 | 3300025711 | Bacteria | 154384 |
| 254 | Ga0207696_1000120 | 3300025711 | Bacteria | 146581 |
| 255 | Ga0207696_1000131 | 3300025711 | Bacteria | 132958 |
| 256 | Ga0207696_1000166 | 3300025711 | Bacteria | 104368 |
| 257 | Ga0207696_1000485 | 3300025711 | Bacteria | 33493 |
| 258 | Ga0207696_1000990 | 3300025711 | Bacteria | 17117 |
| 259 | Ga0207696_1007372 | 3300025711 | Bacteria | 4313 |
| 260 | Ga0207655_1000002 | 3300025728 | Bacteria | 1148694 |
| 261 | Ga0207655_1000004 | 3300025728 | Bacteria | 1021221 |
| 262 | Ga0207655_1000005 | 3300025728 | Bacteria | 917277 |
| 263 | Ga0207655_1000015 | 3300025728 | Bacteria | 600662 |
| 264 | Ga0207655_1000062 | 3300025728 | Bacteria | 258054 |
| 265 | Ga0207655_1000257 | 3300025728 | Bacteria | 84213 |
| 266 | Ga0207655_1001086 | 3300025728 | Bacteria | 26822 |
| 267 | Ga0207655_1012723 | 3300025728 | Bacteria | 4889 |
| 268 | Ga0207655_1019306 | 3300025728 | Bacteria | 3570 |
| 269 | Ga0207655_1025865 | 3300025728 | Bacteria | 2836 |
| 270 | Ga0207655_1035319 | 3300025728 | Bacteria | 2234 |
| 271 | Ga0207713_1000014 | 3300025735 | Bacteria | 432450 |
| 272 | Ga0207713_1000052 | 3300025735 | Bacteria | 222663 |
| 273 | Ga0207713_1000069 | 3300025735 | Bacteria | 191229 |
| 274 | Ga0207713_1000084 | 3300025735 | Bacteria | 160822 |
| 275 | Ga0207713_1000163 | 3300025735 | Bacteria | 98277 |
| 276 | Ga0207713_1002948 | 3300025735 | Bacteria | 11898 |
| 277 | Ga0207713_1004327 | 3300025735 | Bacteria | 9251 |
| 278 | Ga0207713_1005426 | 3300025735 | Bacteria | 7983 |
| 279 | Ga0207713_1006369 | 3300025735 | Bacteria | 7202 |
| 280 | Ga0207713_1008005 | 3300025735 | Bacteria | 6146 |
| 281 | Ga0207713_1014384 | 3300025735 | Bacteria | 4117 |
| 282 | Ga0207713_1021964 | 3300025735 | Bacteria | 3045 |
| 283 | Ga0207713_1035803 | 3300025735 | Bacteria | 2138 |
| 284 | Ga0207713_1039075 | 3300025735 | Bacteria | 2006 |
| 285 | Ga0207713_1045154 | 3300025735 | Bacteria | 1802 |
| 286 | Ga0207713_1063602 | 3300025735 | Bacteria | 1393 |
| 287 | Ga0207682_10000530 | 3300025893 | Bacteria | 17514 |
| 288 | Ga0207688_10002856 | 3300025901 | Bacteria | 9385 |
| 289 | Ga0207647_10006507 | 3300025904 | Bacteria | 8491 |
| 290 | Ga0207654_10014171 | 3300025911 | Bacteria | 4114 |
| 291 | Ga0207695_10003559 | 3300025913 | Bacteria | 21821 |
| 292 | Ga0207695_10018612 | 3300025913 | Bacteria | 8025 |
| 293 | Ga0207671_10000034 | 3300025914 | Bacteria | 245048 |
| 294 | Ga0207693_10192410 | 3300025915 | Bacteria | 1605 |
| 295 | Ga0207662_10015248 | 3300025918 | Bacteria | 4324 |
| 296 | Ga0207657_10000122 | 3300025919 | Bacteria | 77380 |
| 297 | Ga0207657_10006957 | 3300025919 | Bacteria | 11651 |
| 298 | Ga0207649_10000006 | 3300025920 | Bacteria | 349180 |
| 299 | Ga0207649_10006146 | 3300025920 | Bacteria | 6518 |
| 300 | Ga0207652_10034250 | 3300025921 | Bacteria | 4279 |
| 301 | Ga0207681_10007548 | 3300025923 | Bacteria | 6665 |
| 302 | Ga0207694_10030390 | 3300025924 | Bacteria | 4125 |
| 303 | Ga0207694_10061904 | 3300025924 | Bacteria | 2913 |
| 304 | Ga0207650_10002050 | 3300025925 | Bacteria | 14095 |
| 305 | Ga0207650_10011609 | 3300025925 | Bacteria | 6068 |
| 306 | Ga0207650_10021032 | 3300025925 | Bacteria | 4609 |
| 307 | Ga0207659_10169557 | 3300025926 | Bacteria | 1721 |
| 308 | Ga0207700_10009038 | 3300025928 | Bacteria | 6203 |
| 309 | Ga0207664_10056724 | 3300025929 | Bacteria | 3111 |
| 310 | Ga0207644_10002410 | 3300025931 | Bacteria | 12052 |
| 311 | Ga0207690_10000047 | 3300025932 | Bacteria | 116333 |
| 312 | Ga0207690_10004220 | 3300025932 | Bacteria | 8494 |
| 313 | Ga0207706_10003482 | 3300025933 | Bacteria | 15022 |
| 314 | Ga0207706_10024374 | 3300025933 | Bacteria | 5424 |
| 315 | Ga0207706_10026622 | 3300025933 | Bacteria | 5175 |
| 316 | Ga0207686_10002336 | 3300025934 | Bacteria | 10371 |
| 317 | Ga0207709_10000013 | 3300025935 | Bacteria | 531977 |
| 318 | Ga0207709_10000810 | 3300025935 | Bacteria | 24267 |
| 319 | Ga0207704_10083487 | 3300025938 | Bacteria | 2073 |
| 320 | Ga0207691_10001306 | 3300025940 | Bacteria | 24861 |
| 321 | Ga0207691_10066699 | 3300025940 | Bacteria | 3256 |
| 322 | Ga0207711_10066851 | 3300025941 | Bacteria | 3110 |
| 323 | Ga0207689_10089681 | 3300025942 | Bacteria | 2525 |
| 324 | Ga0207661_10000776 | 3300025944 | Bacteria | 20749 |
| 325 | Ga0207679_10000010 | 3300025945 | Bacteria | 349180 |
| 326 | Ga0207679_10001299 | 3300025945 | Bacteria | 15788 |
| 327 | Ga0207679_10100188 | 3300025945 | Bacteria | 2264 |
| 328 | Ga0207667_10023027 | 3300025949 | Bacteria | 6865 |
| 329 | Ga0207667_10023756 | 3300025949 | Bacteria | 6746 |
| 330 | Ga0207651_10003247 | 3300025960 | Bacteria | 7963 |
| 331 | Ga0207712_10169511 | 3300025961 | Bacteria | 1705 |
| 332 | Ga0207640_10002050 | 3300025981 | Bacteria | 10893 |
| 333 | Ga0207640_10011078 | 3300025981 | Bacteria | 5095 |
| 334 | Ga0207658_10018826 | 3300025986 | Bacteria | 4775 |
| 335 | Ga0207677_10001373 | 3300026023 | Bacteria | 13002 |
| 336 | Ga0207703_10069307 | 3300026035 | Bacteria | 2908 |
| 337 | Ga0207703_10139026 | 3300026035 | Bacteria | 2106 |
| 338 | Ga0207639_10000940 | 3300026041 | Bacteria | 19719 |
| 339 | Ga0207678_10000251 | 3300026067 | Bacteria | 48485 |
| 340 | Ga0207708_10016466 | 3300026075 | Bacteria | 5559 |
| 341 | Ga0207648_10002780 | 3300026089 | Bacteria | 18571 |
| 342 | Ga0207648_10023686 | 3300026089 | Bacteria | 5495 |
| 343 | Ga0207676_10044614 | 3300026095 | Bacteria | 3421 |
| 344 | Ga0207674_10001076 | 3300026116 | Bacteria | 35504 |
| 345 | Ga0207675_100019530 | 3300026118 | Bacteria | 6325 |
| 346 | Ga0207675_100213327 | 3300026118 | Bacteria | 1858 |
| 347 | Ga0207683_10015967 | 3300026121 | Bacteria | 6390 |
| 348 | Ga0207698_10019123 | 3300026142 | Bacteria | 4681 |
| 349 | Ga0209281_1000004 | 3300027111 | Bacteria | 1253949 |
| 350 | Ga0209281_1000010 | 3300027111 | Bacteria | 726106 |
| 351 | Ga0209281_1000013 | 3300027111 | Bacteria | 653449 |
| 352 | Ga0209281_1000014 | 3300027111 | Bacteria | 643021 |
| 353 | Ga0209281_1000171 | 3300027111 | Bacteria | 153284 |
| 354 | Ga0209281_1000901 | 3300027111 | Bacteria | 24924 |
| 355 | Ga0209281_1001390 | 3300027111 | Bacteria | 14794 |
| 356 | Ga0209281_1001407 | 3300027111 | Bacteria | 14472 |
| 357 | Ga0209389_1000058 | 3300027296 | Bacteria | 107349 |
| 358 | Ga0209371_1000001 | 3300027312 | Bacteria | 2771503 |
| 359 | Ga0209371_1000135 | 3300027312 | Bacteria | 121718 |
| 360 | Ga0209371_1000158 | 3300027312 | Bacteria | 105459 |
| 361 | Ga0209371_1000186 | 3300027312 | Bacteria | 90597 |
| 362 | Ga0209371_1000218 | 3300027312 | Bacteria | 77448 |
| 363 | Ga0209371_1000596 | 3300027312 | Bacteria | 32351 |
| 364 | Ga0209371_1001007 | 3300027312 | Bacteria | 21606 |
| 365 | Ga0209371_1008901 | 3300027312 | Bacteria | 3263 |
| 366 | Ga0209371_1009641 | 3300027312 | Bacteria | 3049 |
| 367 | Ga0209969_1004544 | 3300027360 | Bacteria | 1942 |
| 368 | Ga0209984_1001334 | 3300027424 | Bacteria | 2665 |
| 369 | Ga0209968_1014170 | 3300027526 | Bacteria | 1254 |
| 370 | Ga0209999_1007854 | 3300027543 | Bacteria | 1918 |
| 371 | Ga0209983_1004857 | 3300027665 | Bacteria | 2807 |
| 372 | Ga0209971_1000531 | 3300027682 | Bacteria | 10050 |
| 373 | Ga0209974_10004317 | 3300027876 | Bacteria | 5055 |
| 374 | Ga0207428_10069479 | 3300027907 | Bacteria | 2769 |
| 375 | Ga0268266_10000213 | 3300028379 | Bacteria | 100912 |
| 376 | Ga0265318_10005455 | 3300028577 | Bacteria | 5970 |
| 377 | Ga0265324_10000120 | 3300029957 | Bacteria | 61840 |
| 378 | Ga0268256_1000001 | 3300030500 | Bacteria | 2771065 |
| 379 | Ga0268256_1000069 | 3300030500 | Bacteria | 195391 |
| 380 | Ga0268256_1000150 | 3300030500 | Bacteria | 93793 |
| 381 | Ga0268256_1000174 | 3300030500 | Bacteria | 77446 |
| 382 | Ga0268256_1000624 | 3300030500 | Bacteria | 27498 |
| 383 | Ga0268256_1001247 | 3300030500 | Bacteria | 15920 |
| 384 | Ga0268256_1001292 | 3300030500 | Bacteria | 15496 |
| 385 | Ga0316178_1044274 | 3300030735 | Bacteria | 26041 |
| 386 | Ga0316181_1071710 | 3300030744 | Bacteria | 2930 |
| 387 | Ga0265328_10001472 | 3300031239 | Bacteria | 10850 |
| 388 | Ga0265320_10035951 | 3300031240 | Bacteria | 2507 |
| 389 | Ga0265331_10000638 | 3300031250 | Bacteria | 30301 |
| 390 | Ga0265327_10000005 | 3300031251 | Bacteria | 790146 |
| 391 | Ga0307408_100000045 | 3300031548 | Bacteria | 169484 |
| 392 | Ga0316575_10026727 | 3300031665 | Bacteria | 2243 |
| 393 | Ga0316575_10060686 | 3300031665 | Bacteria | 1511 |
| 394 | Ga0316579_10030613 | 3300031691 | Bacteria | 2461 |
| 395 | Ga0265314_10000371 | 3300031711 | Bacteria | 61424 |
| 396 | Ga0265314_10000675 | 3300031711 | Bacteria | 41616 |
| 397 | Ga0265342_10022919 | 3300031712 | Bacteria | 3961 |
| 398 | Ga0316576_10083911 | 3300031727 | Bacteria | 2367 |
| 399 | Ga0316576_10097473 | 3300031727 | Bacteria | 2195 |
| 400 | Ga0316578_10007566 | 3300031728 | Bacteria | 5457 |
| 401 | Ga0316578_10033120 | 3300031728 | Bacteria | 2957 |
| 402 | Ga0316577_10027089 | 3300031733 | Bacteria | 3195 |
| 403 | Ga0307412_10001384 | 3300031911 | Bacteria | 13466 |
| 404 | Ga0307416_100123729 | 3300032002 | Bacteria | 2312 |
| 405 | Ga0316583_10007306 | 3300032133 | Bacteria | 3975 |
| 406 | Ga0316583_10012242 | 3300032133 | Bacteria | 3096 |
| 407 | Ga0316585_10006273 | 3300032137 | Bacteria | 3393 |
| 408 | Ga0316593_10000339 | 3300032168 | Bacteria | 8111 |
| 409 | Ga0316593_10000373 | 3300032168 | Bacteria | 7941 |
| 410 | Ga0316593_10002184 | 3300032168 | Bacteria | 4572 |
| 411 | Ga0316593_10003965 | 3300032168 | Bacteria | 3743 |
| 412 | Ga0316593_10004344 | 3300032168 | Bacteria | 3631 |
| 413 | Ga0316593_10005056 | 3300032168 | Bacteria | 3445 |
| 414 | Ga0316593_10010512 | 3300032168 | Bacteria | 2656 |
| 415 | Ga0316593_10015578 | 3300032168 | Bacteria | 2290 |
| 416 | Ga0316593_10025916 | 3300032168 | Bacteria | 1871 |
| 417 | Ga0316586_1000458 | 3300033527 | Bacteria | 3968 |
| 418 | Ga0316586_1007252 | 3300033527 | Bacteria | 1613 |
| 419 | Ga0316588_1002377 | 3300033528 | Bacteria | 3271 |
| 420 | Ga0316588_1002600 | 3300033528 | Bacteria | 3162 |
| 421 | Ga0316588_1010778 | 3300033528 | Bacteria | 1936 |
| 422 | Ga0316587_1002090 | 3300033529 | Bacteria | 2610 |
| 423 | Ga0316587_1005710 | 3300033529 | Bacteria | 1877 |
| 424 | Ga0316587_1010475 | 3300033529 | Bacteria | 1484 |
| 425 | Ga0316596_1001721 | 3300033541 | Bacteria | 4532 |
| 426 | Ga0316596_1002870 | 3300033541 | Bacteria | 3729 |
| 427 | Ga0316596_1003418 | 3300033541 | Bacteria | 3476 |
| 428 | Ga0316596_1003444 | 3300033541 | Bacteria | 3469 |
| 429 | Ga0316596_1003520 | 3300033541 | Bacteria | 3441 |
| 430 | Ga0316596_1003678 | 3300033541 | Bacteria | 3383 |
| 431 | Ga0316596_1005106 | 3300033541 | Bacteria | 2984 |
| 432 | Ga0316596_1007805 | 3300033541 | Bacteria | 2534 |
| 433 | Ga0316596_1018876 | 3300033541 | Bacteria | 1745 |
| 434 | Ga0316574_0001412 | 3300035398 | Bacteria | 11385 |
| 435 | Ga0316582_0001138 | 3300036647 | Bacteria | 11320 |
| 436 | Ga0316584_0003189 | 3300036712 | Bacteria | 10613 |
| 437 | Ga0316584_0044351 | 3300036712 | Bacteria | 3316 |
| 438 | Ga0237819_00403 | 3300038705 | Bacteria | 15062 |
| 439 | Ga0400484_04886 | 3300038725 | Bacteria | 7749 |
| 440 | Ga0400484_05073 | 3300038725 | Bacteria | 3051 |
| 441 | Ga0400484_22058 | 3300038725 | Bacteria | 14206 |
| 442 | Ga0400490_31882 | 3300038726 | Bacteria | 1440 |
| 443 | Ga0400491_03673 | 3300038727 | Bacteria | 2844 |
| 444 | Ga0400491_15408 | 3300038727 | Bacteria | 4156 |
| 445 | Ga0400485_14652 | 3300038735 | Bacteria | 151508 |
| 446 | Ga0400485_15325 | 3300038735 | Bacteria | 3169 |
| 447 | Ga0400488_34854 | 3300038741 | Bacteria | 17853 |
| 448 | Ga0400488_50469 | 3300038741 | Bacteria | 6489 |
| 449 | Ga0400488_52701 | 3300038741 | Bacteria | 6097 |
| 450 | Ga0400486_01330 | 3300038742 | Bacteria | 81885 |
| 451 | Ga0400483_072402 | 3300039062 | Bacteria | 2464 |
| 452 | Ga0400483_075161 | 3300039062 | Bacteria | 103046 |
| 453 | Ga0400483_117255 | 3300039062 | Bacteria | 2878 |
| 454 | Ga0400483_261257 | 3300039062 | Bacteria | 4154 |
| 455 | Ga0400487_44591 | 3300039110 | Bacteria | 86495 |
| 456 | Ga0400487_65366 | 3300039110 | Bacteria | 123063 |
| 457 | Ga0436365_0787909 | 3300039437 | Bacteria | 2838 |
| 458 | Ga0436365_1613017 | 3300039437 | Bacteria | 128504 |
| 459 | Ga0439436_0000404 | 3300041404 | Bacteria | 10814 |
| 460 | Ga0439438_000472 | 3300041405 | Bacteria | 18213 |
| 461 | Ga0439438_000983 | 3300041405 | Bacteria | 12753 |
| 462 | Ga0439447_000424 | 3300041407 | Bacteria | 15743 |
| 463 | Ga0439447_009647 | 3300041407 | Bacteria | 2910 |
| 464 | Ga0439447_029151 | 3300041407 | Bacteria | 1399 |
| 465 | Ga0439466_0036753 | 3300041411 | Bacteria | 1652 |
| 466 | Ga0451798_0922051 | 3300041458 | Bacteria | 1371 |
| 467 | Ga0451853_1858486 | 3300041512 | Bacteria | 5832 |
| 468 | Ga0439437_000337 | 3300042000 | Bacteria | 4423 |
| 469 | Ga0439432_001369 | 3300042006 | Bacteria | 9233 |
| 470 | Ga0439452_000002 | 3300042010 | Bacteria | 1377577 |
| 471 | Ga0439452_008032 | 3300042010 | Bacteria | 3194 |
| 472 | Ga0439456_000066 | 3300042013 | Bacteria | 37099 |
| 473 | Ga0439456_008039 | 3300042013 | Bacteria | 2177 |
| 474 | Ga0450911_000020 | 3300042115 | Bacteria | 101786 |
| 475 | Ga0450902_000371 | 3300042137 | Bacteria | 5491 |
| 476 | Ga0450905_000060 | 3300042142 | Bacteria | 9846 |
| 477 | Ga0439446_0001264 | 3300042156 | Bacteria | 5683 |
| 478 | Ga0439446_0011421 | 3300042156 | Bacteria | 2411 |
| 479 | Ga0439434_0001323 | 3300042435 | Bacteria | 7144 |
| 480 | Ga0451577_0000002 | 3300042876 | Bacteria | 1731375 |
| 481 | Ga0451577_0003438 | 3300042876 | Bacteria | 17632 |
| 482 | Ga0451577_0028906 | 3300042876 | Bacteria | 5013 |
| 483 | Ga0466981_0000031 | 3300044669 | Bacteria | 66141 |
| 484 | Ga0453683_0000003 | 3300044673 | Bacteria | 942572 |
| 485 | Ga0453683_0004681 | 3300044673 | Bacteria | 9650 |
| 486 | Ga0466961_0098867 | 3300044693 | Bacteria | 1839 |
| 487 | Ga0453684_0000002 | 3300044712 | Bacteria | 1731375 |
| 488 | Ga0453684_0003424 | 3300044712 | Bacteria | 35791 |
| 489 | Ga0453684_0012830 | 3300044712 | Bacteria | 13734 |
| 490 | Ga0451576_0000004 | 3300045051 | Bacteria | 1312238 |
| 491 | Ga0451576_0000765 | 3300045051 | Bacteria | 63455 |
| 492 | Ga0451576_0012879 | 3300045051 | Bacteria | 9374 |
| 493 | Ga0451576_0032565 | 3300045051 | Bacteria | 5548 |
| 494 | Ga0451576_0035924 | 3300045051 | Bacteria | 5255 |
| 495 | Ga0466958_0054852 | 3300045836 | Bacteria | 2417 |
| 496 | Ga0495617_036160 | 3300046452 | Bacteria | 1656 |
| 497 | Ga0495627_000021 | 3300046453 | Bacteria | 282454 |
| 498 | Ga0495627_000107 | 3300046453 | Bacteria | 102518 |
| 499 | Ga0495627_010987 | 3300046453 | Bacteria | 3264 |
| 500 | Ga0495603_0059346 | 3300046455 | Bacteria | 2262 |
| 501 | Ga0495591_000066 | 3300046458 | Bacteria | 121317 |
| 502 | Ga0495591_000085 | 3300046458 | Bacteria | 105096 |
| 503 | Ga0495591_013748 | 3300046458 | Bacteria | 2944 |
| 504 | Ga0495653_0027433 | 3300046463 | Bacteria | 4557 |
| 505 | Ga0495653_0087216 | 3300046463 | Bacteria | 2293 |
| 506 | Ga0495650_0000326 | 3300046471 | Bacteria | 85267 |
| 507 | Ga0495650_0000735 | 3300046471 | Bacteria | 41108 |
| 508 | Ga0495650_0002598 | 3300046471 | Bacteria | 14185 |
| 509 | Ga0495605_0000014 | 3300046474 | Bacteria | 305393 |
| 510 | Ga0495605_0000491 | 3300046474 | Bacteria | 34170 |
| 511 | Ga0495605_0001437 | 3300046474 | Bacteria | 15613 |
| 512 | Ga0495605_0017246 | 3300046474 | Bacteria | 3892 |
| 513 | Ga0495605_0029213 | 3300046474 | Bacteria | 2840 |
| 514 | Ga0495605_0029668 | 3300046474 | Bacteria | 2811 |
| 515 | Ga0495605_0084688 | 3300046474 | Bacteria | 1478 |
| 516 | Ga0495584_0013902 | 3300046491 | Bacteria | 4100 |
| 517 | Ga0495584_0073636 | 3300046491 | Bacteria | 1716 |
| 518 | Ga0495585_0047044 | 3300046492 | Bacteria | 2403 |
| 519 | Ga0495596_0040801 | 3300046500 | Bacteria | 1831 |
| 520 | Ga0495607_0003108 | 3300046501 | Bacteria | 12892 |
| 521 | Ga0495607_0003293 | 3300046501 | Bacteria | 12409 |
| 522 | Ga0495607_0006180 | 3300046501 | Bacteria | 8465 |
| 523 | Ga0495607_0007074 | 3300046501 | Bacteria | 7805 |
| 524 | Ga0495607_0021845 | 3300046501 | Bacteria | 4024 |
| 525 | Ga0495607_0041636 | 3300046501 | Bacteria | 2727 |
| 526 | Ga0495607_0050695 | 3300046501 | Bacteria | 2414 |
| 527 | Ga0495607_0098168 | 3300046501 | Bacteria | 1573 |
| 528 | Ga0495583_0000066 | 3300046506 | Bacteria | 191372 |
| 529 | Ga0495583_0001531 | 3300046506 | Bacteria | 22916 |
| 530 | Ga0495583_0004380 | 3300046506 | Bacteria | 10155 |
| 531 | Ga0495583_0059872 | 3300046506 | Bacteria | 1704 |
| 532 | Ga0495606_0000441 | 3300046507 | Bacteria | 68151 |
| 533 | Ga0495606_0000482 | 3300046507 | Bacteria | 65236 |
| 534 | Ga0495606_0004806 | 3300046507 | Bacteria | 13270 |
| 535 | Ga0495610_0012835 | 3300046512 | Bacteria | 5011 |
| 536 | Ga0495620_0000048 | 3300046515 | Bacteria | 106392 |
| 537 | Ga0495620_0000295 | 3300046515 | Bacteria | 35409 |
| 538 | Ga0495620_0019943 | 3300046515 | Bacteria | 3283 |
| 539 | Ga0495628_0001261 | 3300046516 | Bacteria | 23181 |
| 540 | Ga0495630_0000532 | 3300046517 | Bacteria | 27978 |
| 541 | Ga0495632_0001963 | 3300046519 | Bacteria | 16364 |
| 542 | Ga0495632_0029363 | 3300046519 | Bacteria | 2863 |
| 543 | Ga0495637_0001452 | 3300046520 | Bacteria | 13951 |
| 544 | Ga0495637_0010475 | 3300046520 | Bacteria | 4481 |
| 545 | Ga0495643_0000103 | 3300046522 | Bacteria | 140814 |
| 546 | Ga0495643_0002539 | 3300046522 | Bacteria | 14282 |
| 547 | Ga0495648_0021753 | 3300046524 | Bacteria | 4435 |
| 548 | Ga0495652_0005769 | 3300046529 | Bacteria | 11591 |
| 549 | Ga0495654_0000964 | 3300046530 | Bacteria | 21224 |
| 550 | Ga0495654_0003334 | 3300046530 | Bacteria | 9895 |
| 551 | Ga0495654_0006365 | 3300046530 | Bacteria | 6713 |
| 552 | Ga0495654_0030708 | 3300046530 | Bacteria | 2732 |
| 553 | Ga0495665_0000068 | 3300046531 | Bacteria | 43382 |
| 554 | Ga0495586_0000403 | 3300046535 | Bacteria | 26253 |
| 555 | Ga0495587_0030390 | 3300046536 | Bacteria | 3277 |
| 556 | Ga0495609_0000006 | 3300046538 | Bacteria | 431833 |
| 557 | Ga0495609_0000099 | 3300046538 | Bacteria | 101070 |
| 558 | Ga0495609_0001353 | 3300046538 | Bacteria | 16531 |
| 559 | Ga0495609_0007053 | 3300046538 | Bacteria | 5655 |
| 560 | Ga0495597_0002748 | 3300046542 | Bacteria | 10831 |
| 561 | Ga0495645_0110230 | 3300046543 | Bacteria | 1948 |
| 562 | Ga0495633_0003207 | 3300046558 | Bacteria | 11046 |
| 563 | Ga0495634_0111270 | 3300046642 | Bacteria | 1760 |
| 564 | Ga0495611_0000129 | 3300046648 | Bacteria | 52574 |
| 565 | Ga0495625_0000050 | 3300046660 | Bacteria | 197065 |
| 566 | Ga0495625_0002671 | 3300046660 | Bacteria | 18973 |
| 567 | Ga0495661_0000167 | 3300046665 | Bacteria | 78075 |
| 568 | Ga0495661_0000255 | 3300046665 | Bacteria | 61417 |
| 569 | Ga0495661_0002070 | 3300046665 | Bacteria | 15749 |
| 570 | Ga0495661_0002852 | 3300046665 | Bacteria | 13078 |
| 571 | Ga0495661_0017562 | 3300046665 | Bacteria | 4723 |
| 572 | Ga0495623_0019398 | 3300046679 | Bacteria | 4396 |
| 573 | Ga0495646_0015137 | 3300046680 | Bacteria | 4900 |
| 574 | Ga0495669_0062712 | 3300046684 | Bacteria | 1684 |
| 575 | Ga0495624_0012967 | 3300046690 | Bacteria | 5684 |
| 576 | Ga0495624_0062219 | 3300046690 | Bacteria | 2336 |
| 577 | Ga0495670_0004153 | 3300046691 | Bacteria | 7096 |
| 578 | Ga0495671_0007992 | 3300046692 | Bacteria | 5979 |
| 579 | Ga0495671_0015431 | 3300046692 | Bacteria | 4091 |
| 580 | Ga0495671_0017747 | 3300046692 | Bacteria | 3785 |
| 581 | Ga0495671_0043198 | 3300046692 | Bacteria | 2262 |
| 582 | Ga0495649_0003418 | 3300046694 | Bacteria | 10729 |
| 583 | Ga0495649_0006783 | 3300046694 | Bacteria | 7091 |
| 584 | Ga0495649_0008276 | 3300046694 | Bacteria | 6265 |
| 585 | Ga0495649_0041701 | 3300046694 | Bacteria | 2508 |
| 586 | Ga0495660_0003959 | 3300046810 | Bacteria | 9047 |
| 587 | Ga0495581_0003933 | 3300047315 | Bacteria | 8555 |
| 588 | Ga0495636_0070760 | 3300047318 | Bacteria | 1488 |
| 589 | Ga0495674_0000546 | 3300047319 | Bacteria | 34881 |
| 590 | Ga0495672_0000156 | 3300047320 | Bacteria | 98712 |
| 591 | Ga0495672_0000655 | 3300047320 | Bacteria | 38461 |
| 592 | Ga0495672_0001704 | 3300047320 | Bacteria | 21311 |
| 593 | Ga0495672_0042370 | 3300047320 | Bacteria | 2746 |
| 594 | Ga0495672_0106592 | 3300047320 | Bacteria | 1510 |
| 595 | Ga0495672_0113672 | 3300047320 | Bacteria | 1449 |
| 596 | Ga0495676_0000024 | 3300047321 | Bacteria | 150285 |
| 597 | Ga0495676_0009185 | 3300047321 | Bacteria | 9008 |
| 598 | Ga0495680_0094161 | 3300047322 | Bacteria | 2241 |
| 599 | Ga0495680_0113150 | 3300047322 | Bacteria | 2009 |
| 600 | Ga0495683_0000056 | 3300047323 | Bacteria | 118944 |
| 601 | Ga0495683_0000525 | 3300047323 | Bacteria | 29046 |
| 602 | Ga0495679_000098 | 3300047446 | Bacteria | 79186 |
| 603 | Ga0495679_000169 | 3300047446 | Bacteria | 59122 |
| 604 | Ga0495673_0000071 | 3300047469 | Bacteria | 217117 |
| 605 | Ga0495673_0003132 | 3300047469 | Bacteria | 11077 |
| 606 | Ga0495673_0006373 | 3300047469 | Bacteria | 6943 |
| 607 | Ga0495673_0013144 | 3300047469 | Bacteria | 4359 |
| 608 | Ga0495673_0029281 | 3300047469 | Bacteria | 2600 |
| 609 | Ga0495673_0037464 | 3300047469 | Bacteria | 2214 |
| 610 | Ga0495673_0063599 | 3300047469 | Bacteria | 1573 |
| 611 | Ga0495673_0094690 | 3300047469 | Bacteria | 1215 |
| 612 | Ga0495681_0003261 | 3300047470 | Bacteria | 11316 |
| 613 | Ga0495593_0040334 | 3300047673 | Bacteria | 2513 |
| 614 | Ga0495593_0051205 | 3300047673 | Bacteria | 2185 |
| 615 | Ga0495602_0112160 | 3300048088 | Bacteria | 2213 |
| 616 | Ga0495626_0000061 | 3300048091 | Bacteria | 144886 |
| 617 | Ga0496102_0015543 | 3300048905 | Bacteria | 6632 |
| 618 | Ga0496104_0015221 | 3300048907 | Bacteria | 6964 |
| 619 | Ga0496105_0210121 | 3300048908 | Bacteria | 1586 |
| 620 | Ga0496108_0003010 | 3300048911 | Bacteria | 13546 |
| 621 | Ga0496109_0001294 | 3300048912 | Bacteria | 20728 |
| 622 | Ga0496110_0013126 | 3300048913 | Bacteria | 6839 |
| 623 | Ga0496115_0003367 | 3300048918 | Bacteria | 11467 |
| 624 | Ga0496116_0006865 | 3300048919 | Bacteria | 10222 |
| 625 | Ga0496116_0017001 | 3300048919 | Bacteria | 5666 |
| 626 | Ga0496116_0017716 | 3300048919 | Bacteria | 5518 |
| 627 | Ga0496117_0010834 | 3300048920 | Bacteria | 8226 |
| 628 | Ga0496117_0024754 | 3300048920 | Bacteria | 4735 |
| 629 | Ga0496117_0027654 | 3300048920 | Bacteria | 4411 |
| 630 | Ga0496117_0042773 | 3300048920 | Bacteria | 3302 |
| 631 | Ga0496117_0156894 | 3300048920 | Bacteria | 1338 |
| 632 | Ga0496118_0002565 | 3300048921 | Bacteria | 24273 |
| 633 | Ga0496118_0005100 | 3300048921 | Bacteria | 15099 |
| 634 | Ga0496118_0034936 | 3300048921 | Bacteria | 4092 |
| 635 | Ga0496119_0000100 | 3300048922 | Bacteria | 125646 |
| 636 | Ga0496119_0013887 | 3300048922 | Bacteria | 6358 |
| 637 | Ga0496119_0031959 | 3300048922 | Bacteria | 3516 |
| 638 | Ga0496119_0032849 | 3300048922 | Bacteria | 3453 |
| 639 | Ga0496119_0056370 | 3300048922 | Bacteria | 2381 |
| 640 | Ga0496120_0002036 | 3300048923 | Bacteria | 21906 |
| 641 | Ga0496120_0008007 | 3300048923 | Bacteria | 7777 |
| 642 | Ga0496120_0048955 | 3300048923 | Bacteria | 2428 |
| 643 | Ga0496121_0000478 | 3300048924 | Bacteria | 77761 |
| 644 | Ga0496121_0003129 | 3300048924 | Bacteria | 23876 |
| 645 | Ga0496121_0005829 | 3300048924 | Bacteria | 15622 |
| 646 | Ga0496121_0012769 | 3300048924 | Bacteria | 9097 |
| 647 | Ga0496121_0016343 | 3300048924 | Bacteria | 7668 |
| 648 | Ga0496121_0045276 | 3300048924 | Bacteria | 3782 |
| 649 | Ga0496122_0000077 | 3300048925 | Bacteria | 218099 |
| 650 | Ga0496122_0000619 | 3300048925 | Bacteria | 72800 |
| 651 | Ga0496122_0000849 | 3300048925 | Bacteria | 57536 |
| 652 | Ga0496122_0003105 | 3300048925 | Bacteria | 22308 |
| 653 | Ga0496122_0006285 | 3300048925 | Bacteria | 13705 |
| 654 | Ga0496122_0021150 | 3300048925 | Bacteria | 5837 |
| 655 | Ga0496122_0021441 | 3300048925 | Bacteria | 5783 |
| 656 | Ga0496122_0050474 | 3300048925 | Bacteria | 3172 |
| 657 | Ga0496123_0000012 | 3300048926 | Bacteria | 458760 |
| 658 | Ga0496123_0000080 | 3300048926 | Bacteria | 190247 |
| 659 | Ga0496123_0001875 | 3300048926 | Bacteria | 27530 |
| 660 | Ga0496123_0002289 | 3300048926 | Bacteria | 24041 |
| 661 | Ga0496123_0043399 | 3300048926 | Bacteria | 3089 |
| 662 | Ga0496123_0045913 | 3300048926 | Bacteria | 2968 |
| 663 | Ga0496124_0000692 | 3300048927 | Bacteria | 55225 |
| 664 | Ga0496124_0042806 | 3300048927 | Bacteria | 3895 |
| 665 | Ga0496124_0050600 | 3300048927 | Bacteria | 3539 |
| 666 | Ga0496124_0075774 | 3300048927 | Bacteria | 2778 |
| 667 | Ga0496124_0086074 | 3300048927 | Bacteria | 2573 |
| 668 | Ga0496125_0000146 | 3300048928 | Bacteria | 154919 |
| 669 | Ga0496125_0000405 | 3300048928 | Bacteria | 80765 |
| 670 | Ga0496125_0001820 | 3300048928 | Bacteria | 29445 |
| 671 | Ga0496125_0121290 | 3300048928 | Bacteria | 1864 |
| 672 | Ga0496126_0001340 | 3300048929 | Bacteria | 39083 |
| 673 | Ga0496126_0127921 | 3300048929 | Bacteria | 2197 |
| 674 | Ga0501307_001781 | 3300049162 | Bacteria | 1901 |
| 675 | Ga0495678_001660 | 3300049459 | Bacteria | 16917 |
| 676 | Ga0495678_002720 | 3300049459 | Bacteria | 11643 |
| 677 | Ga0495678_006819 | 3300049459 | Bacteria | 6011 |
| 678 | Ga0495682_0000381 | 3300049460 | Bacteria | 32155 |
| 679 | Ga0495682_0002162 | 3300049460 | Bacteria | 9517 |
| 680 | Ga0501031_0012416 | 3300049568 | Bacteria | 5556 |
| 681 | Ga0501032_0018657 | 3300049569 | Bacteria | 4857 |
| 682 | Ga0501033_0008532 | 3300049570 | Bacteria | 7929 |
| 683 | Ga0501034_0000557 | 3300049571 | Bacteria | 58990 |
| 684 | Ga0501036_0176215 | 3300049572 | Bacteria | 1800 |
| 685 | Ga0501037_0003038 | 3300049573 | Bacteria | 12180 |
| 686 | Ga0501037_0003661 | 3300049573 | Bacteria | 11151 |
| 687 | Ga0501037_0077989 | 3300049573 | Bacteria | 2404 |
| 688 | Ga0501038_0104428 | 3300049574 | Bacteria | 2355 |
| 689 | Ga0501039_0197198 | 3300049575 | Bacteria | 1583 |
| 690 | Ga0501043_0008317 | 3300049579 | Bacteria | 8170 |
| 691 | Ga0501046_0003807 | 3300049580 | Bacteria | 13803 |
| 692 | Ga0501046_0096090 | 3300049580 | Bacteria | 2276 |
| 693 | Ga0501035_0018195 | 3300049822 | Bacteria | 6471 |
| 694 | Ga0501044_0000379 | 3300049823 | Bacteria | 55288 |
| 695 | Ga0501044_0007220 | 3300049823 | Bacteria | 12219 |
| 696 | Ga0501226_000012 | 3300049853 | Bacteria | 175419 |
| 697 | nmdc:mga00v17_27196_c1 | 3300050491 | Bacteria | 3338 |
| 698 | nmdc:mga0yw44_237069_c1 | 3300050492 | Bacteria | 1212 |
| 699 | nmdc:mga0k408_148845_c1 | 3300050493 | Bacteria | 1394 |
| 700 | nmdc:mga0k408_172_c1 | 3300050493 | Bacteria | 34042 |
| 701 | nmdc:mga0k408_27749_c1 | 3300050493 | Bacteria | 3216 |
| 702 | nmdc:mga0qj67_39095_c1 | 3300050509 | Bacteria | 3724 |
| 703 | nmdc:mga06r32_10037_c1 | 3300050510 | Bacteria | 8547 |
| 704 | Ga0500618_022833 | 3300053125 | Bacteria | 1517 |
| 705 | Ga0500659_0003758 | 3300053135 | Bacteria | 8820 |
| 706 | Ga0500590_063226 | 3300053148 | Bacteria | 1856 |
| 707 | Ga0587091_000885 | 3300059511 | Bacteria | 2946 |
| 708 | Ga0466962_0050274 | 3300061719 | Bacteria | 1992 |
| 709 | 2501071258 | 2501025501 | Bacteria | 7768574 |
| 710 | 2501079474 | 2501025502 | Bacteria | 9641094 |
| 711 | 2501414141 | 2501025504 | Bacteria | 8008976 |
| 712 | 2508853694 | 2508501071 | Bacteria | 5454741 |
| 713 | 2510251514 | 2510065045 | Bacteria | 7761063 |
| 714 | 2510280950 | 2510065053 | Bacteria | 5005518 |
| 715 | 2510294918 | 2510065055 | Bacteria | 5037935 |
| 716 | 2510309097 | 2510065058 | Bacteria | 5005894 |
| 717 | 2511093830 | 2510917013 | Bacteria | 9951648 |
| 718 | 2511094605 | 2510917014 | Bacteria | 8296963 |
| 719 | 2511104309 | 2510917015 | Bacteria | 7950052 |
| 720 | 2511256590 | 2511231004 | Bacteria | 6669789 |
| 721 | 2511267479 | 2511231006 | Bacteria | 6794709 |
| 722 | 2511274242 | 2511231007 | Bacteria | 6306603 |
| 723 | 2511279896 | 2511231008 | Bacteria | 6624100 |
| 724 | 2511291148 | 2511231010 | Bacteria | 6373152 |
| 725 | 2511295712 | 2511231011 | Bacteria | 6149768 |
| 726 | 2511301382 | 2511231012 | Bacteria | 6738011 |
| 727 | 2511311899 | 2511231014 | Bacteria | 6462302 |
| 728 | 2511320563 | 2511231015 | Bacteria | 6598026 |
| 729 | 2511329232 | 2511231016 | Bacteria | 6704427 |
| 730 | 2511333839 | 2511231017 | Bacteria | 6503007 |
| 731 | 2511336549 | 2511231018 | Bacteria | 6436256 |
| 732 | 2511346115 | 2511231019 | Bacteria | 6520662 |
| 733 | 2511352581 | 2511231020 | Bacteria | 6115223 |
| 734 | 2511355749 | 2511231021 | Bacteria | 7302637 |
| 735 | 2511362572 | 2511231022 | Bacteria | 6719296 |
| 736 | 2511370652 | 2511231023 | Bacteria | 6808468 |
| 737 | 2511374378 | 2511231024 | Bacteria | 5835885 |
| 738 | 2511414874 | 2511231031 | Bacteria | 6558529 |
| 739 | 2511823000 | 2511231156 | Bacteria | 6845832 |
| 740 | 2512324297 | 2512047018 | Bacteria | 6663241 |
| 741 | 2512345528 | 2512047030 | Bacteria | 9031815 |
| 742 | 2515680814 | 2515154122 | Bacteria | 8609520 |
| 743 | 2548648378 | 2547132416 | Bacteria | 4633861 |
| 744 | 2554813474 | 2554235132 | Bacteria | 6772433 |
| 745 | 2555245485 | 2554235231 | Bacteria | 5215788 |
| 746 | 2555260051 | 2554235234 | Bacteria | 5762085 |
| 747 | 2555671893 | 2554235341 | Bacteria | 6867980 |
| 748 | 2583794385 | 2582580891 | Bacteria | 6800976 |
| 749 | 2597028884 | 2596583598 | Bacteria | 5251611 |
| 750 | 2597859976 | 2597489887 | Bacteria | 6666321 |
| 751 | 2597865843 | 2597489888 | Bacteria | 6179543 |
| 752 | 2597871655 | 2597489889 | Bacteria | 6297495 |
| 753 | 2599328342 | 2599185155 | Bacteria | 5827168 |
| 754 | 2599353952 | 2599185160 | Bacteria | 6844013 |
| 755 | 2599360367 | 2599185161 | Bacteria | 6960462 |
| 756 | 2599366689 | 2599185162 | Bacteria | 6957254 |
| 757 | 2599373478 | 2599185163 | Bacteria | 6995158 |
| 758 | 2599379060 | 2599185164 | Bacteria | 6841688 |
| 759 | 2599385962 | 2599185165 | Bacteria | 6843250 |
| 760 | 2599392337 | 2599185166 | Bacteria | 6959206 |
| 761 | 2599399813 | 2599185167 | Bacteria | 6353609 |
| 762 | 2599404103 | 2599185168 | Bacteria | 6997636 |
| 763 | 2599412558 | 2599185169 | Bacteria | 5441380 |
| 764 | 2599454514 | 2599185179 | Bacteria | 6611171 |
| 765 | 2599460786 | 2599185181 | Bacteria | 6844519 |
| 766 | 2599470335 | 2599185182 | Bacteria | 6883168 |
| 767 | 2599482804 | 2599185185 | Bacteria | 6652270 |
| 768 | 2599489807 | 2599185186 | Bacteria | 6831633 |
| 769 | 2599501105 | 2599185188 | Bacteria | 6164180 |
| 770 | 2599508322 | 2599185189 | Bacteria | 5862825 |
| 771 | 2599515642 | 2599185190 | Bacteria | 6285678 |
| 772 | 2599521609 | 2599185191 | Bacteria | 6297582 |
| 773 | 2599613930 | 2599185212 | Bacteria | 6765997 |
| 774 | 2599736779 | 2599185239 | Bacteria | 8686614 |
| 775 | 2599744851 | 2599185240 | Bacteria | 7968121 |
| 776 | 2599770823 | 2599185248 | Bacteria | 6696816 |
| 777 | 2599803470 | 2599185257 | Bacteria | 6492581 |
| 778 | 2599881856 | 2599185288 | Bacteria | 6666191 |
| 779 | 2599886702 | 2599185289 | Bacteria | 6778765 |
| 780 | 2599895021 | 2599185290 | Bacteria | 6289611 |
| 781 | 2599897072 | 2599185291 | Bacteria | 6775623 |
| 782 | 2599904997 | 2599185292 | Bacteria | 6290804 |
| 783 | 2599934661 | 2599185300 | Bacteria | 6062622 |
| 784 | 2599943067 | 2599185302 | Bacteria | 5954930 |
| 785 | 2599951630 | 2599185303 | Bacteria | 6512725 |
| 786 | 2599953894 | 2599185304 | Bacteria | 5951361 |
| 787 | 2599959398 | 2599185305 | Bacteria | 6748700 |
| 788 | 2599968080 | 2599185306 | Bacteria | 6637356 |
| 789 | 2599974750 | 2599185307 | Bacteria | 6194719 |
| 790 | 2599979197 | 2599185308 | Bacteria | 6621546 |
| 791 | 2599985363 | 2599185309 | Bacteria | 5969593 |
| 792 | 2599987287 | 2599185310 | Bacteria | 6014457 |
| 793 | 2599995389 | 2599185311 | Bacteria | 6354990 |
| 794 | 2599999884 | 2599185312 | Bacteria | 5912071 |
| 795 | 2600008662 | 2599185313 | Bacteria | 6658188 |
| 796 | 2600013082 | 2599185314 | Bacteria | 6621749 |
| 797 | 2600016593 | 2599185315 | Bacteria | 6771107 |
| 798 | 2600025390 | 2599185316 | Bacteria | 6320029 |
| 799 | 2600029555 | 2599185317 | Bacteria | 6435722 |
| 800 | 2600038105 | 2599185318 | Bacteria | 6961590 |
| 801 | 2600041403 | 2599185319 | Bacteria | 6637840 |
| 802 | 2600045614 | 2599185320 | Bacteria | 5963263 |
| 803 | 2600056176 | 2599185321 | Bacteria | 6764560 |
| 804 | 2600058525 | 2599185322 | Bacteria | 6763055 |
| 805 | 2600063798 | 2599185323 | Bacteria | 6688755 |
| 806 | 2600073575 | 2599185324 | Bacteria | 6590677 |
| 807 | 2600079765 | 2599185325 | Bacteria | 6324919 |
| 808 | 2600205785 | 2599185355 | Bacteria | 7968906 |
| 809 | 2600213401 | 2599185356 | Bacteria | 6843884 |
| 810 | 2600358233 | 2600254930 | Bacteria | 6431253 |
| 811 | 2600365247 | 2600254931 | Bacteria | 6734225 |
| 812 | 2600442503 | 2600254954 | Bacteria | 5100516 |
| 813 | 2601524084 | 2600255254 | Bacteria | 5281859 |
| 814 | 2601529238 | 2600255255 | Bacteria | 5282785 |
| 815 | 2601616072 | 2600255280 | Bacteria | 5292309 |
| 816 | 2601620797 | 2600255281 | Bacteria | 5288753 |
| 817 | 2601626293 | 2600255283 | Bacteria | 6061572 |
| 818 | 2601644139 | 2600255287 | Bacteria | 5210468 |
| 819 | 2601649194 | 2600255288 | Bacteria | 5282738 |
| 820 | 2601654121 | 2600255289 | Bacteria | 5281907 |
| 821 | 2601659543 | 2600255290 | Bacteria | 5282218 |
| 822 | 2601663964 | 2600255291 | Bacteria | 5217298 |
| 823 | 2601692712 | 2600255296 | Bacteria | 5784754 |
| 824 | 2601696921 | 2600255298 | Bacteria | 5215185 |
| 825 | 2601701970 | 2600255299 | Bacteria | 5218662 |
| 826 | 2601706865 | 2600255300 | Bacteria | 5287774 |
| 827 | 2601712184 | 2600255301 | Bacteria | 5280532 |
| 828 | 2601717382 | 2600255302 | Bacteria | 5288235 |
| 829 | 2601722350 | 2600255303 | Bacteria | 5219315 |
| 830 | 2601727310 | 2600255304 | Bacteria | 5283973 |
| 831 | 2601732625 | 2600255305 | Bacteria | 5282329 |
| 832 | 2601736860 | 2600255306 | Bacteria | 5281613 |
| 833 | 2601743197 | 2600255307 | Bacteria | 5439064 |
| 834 | 2601753991 | 2600255309 | Bacteria | 5431045 |
| 835 | 2601773568 | 2600255313 | Bacteria | 6842543 |
| 836 | 2601799773 | 2600255318 | Bacteria | 6383414 |
| 837 | 2602012438 | 2600255389 | Bacteria | 5275336 |
| 838 | 2602021085 | 2600255392 | Bacteria | 5437392 |
| 839 | 2603645613 | 2602042047 | Bacteria | 4697674 |
| 840 | 2603662122 | 2602042052 | Bacteria | 5215873 |
| 841 | 2603667021 | 2602042053 | Bacteria | 5214361 |
| 842 | 2603699522 | 2602042066 | Bacteria | 4423871 |
| 843 | 2603705581 | 2602042067 | Bacteria | 4863713 |
| 844 | 2603839734 | 2602042103 | Bacteria | 5284714 |
| 845 | 2603844808 | 2602042104 | Bacteria | 5281639 |
| 846 | 2603850185 | 2602042105 | Bacteria | 5282303 |
| 847 | 2603854951 | 2602042106 | Bacteria | 5282744 |
| 848 | 2603867699 | 2602042109 | Bacteria | 5152801 |
| 849 | 2603872527 | 2602042110 | Bacteria | 5283285 |
| 850 | 2603877833 | 2602042111 | Bacteria | 5212080 |
| 851 | 2606050014 | 2603880178 | Bacteria | 5283018 |
| 852 | 2606071674 | 2603880184 | Bacteria | 5217896 |
| 853 | 2606074042 | 2603880185 | Bacteria | 6379190 |
| 854 | 2606126313 | 2603880199 | Bacteria | 6377649 |
| 855 | 2606147395 | 2603880202 | Bacteria | 5284684 |
| 856 | 2606177904 | 2603880211 | Bacteria | 5284226 |
| 857 | 2608381351 | 2606217733 | Bacteria | 6360972 |
| 858 | 2609909413 | 2609459761 | Bacteria | 5513740 |
| 859 | 2621297700 | 2619619299 | Bacteria | 6649820 |
| 860 | 2624482585 | 2623620443 | Bacteria | 6427864 |
| 861 | 2624494114 | 2623620446 | Bacteria | 6500345 |
| 862 | 2637223888 | 2636415599 | Bacteria | 5718434 |
| 863 | 2643844212 | 2643221565 | Bacteria | 6216018 |
| 864 | 2643860364 | 2643221569 | Bacteria | 6064337 |
| 865 | 2643870107 | 2643221571 | Bacteria | 6228673 |
| 866 | 2643952348 | 2643221589 | Bacteria | 6250934 |
| 867 | 2643979413 | 2643221594 | Bacteria | 5811388 |
| 868 | 2644023889 | 2643221602 | Bacteria | 6249926 |
| 869 | 2644119901 | 2643221621 | Bacteria | 6212786 |
| 870 | 2644188012 | 2643221633 | Bacteria | 6733554 |
| 871 | 2644281618 | 2643221650 | Bacteria | 7029547 |
| 872 | 2644623372 | 2643221713 | Bacteria | 6554480 |
| 873 | 2652543495 | 2651869719 | Bacteria | 6047974 |
| 874 | 2671093267 | 2667528170 | Bacteria | 6786960 |
| 875 | 2671096536 | 2667528171 | Bacteria | 6900659 |
| 876 | 2671105444 | 2667528172 | Bacteria | 5170840 |
| 877 | 2671127958 | 2667528176 | Bacteria | 6724917 |
| 878 | 2671770962 | 2671180172 | Bacteria | 6495783 |
| 879 | 2676405301 | 2675903046 | Bacteria | 5451247 |
| 880 | 2676742980 | 2675903129 | Bacteria | 7964495 |
| 881 | 2677897997 | 2675903420 | Bacteria | 6247433 |
| 882 | 2678261532 | 2675903515 | Bacteria | 6580491 |
| 883 | 2681994889 | 2681812866 | Bacteria | 4552357 |
| 884 | 2682006633 | 2681812869 | Bacteria | 5014465 |
| 885 | 2691329463 | 2690315857 | Bacteria | 4396207 |
| 886 | 2707099692 | 2706794495 | Bacteria | 4536932 |
| 887 | 2715752086 | 2713897148 | Bacteria | 5883533 |
| 888 | 2715755017 | 2713897149 | Bacteria | 6506249 |
| 889 | 2718635791 | 2718217725 | Bacteria | 5758958 |
| 890 | 2719640628 | 2718217991 | Bacteria | 7829542 |
| 891 | 2723250571 | 2721755607 | Bacteria | 5841722 |
| 892 | 2723878539 | 2721755763 | Bacteria | 4464185 |
| 893 | 2729147796 | 2728369097 | Bacteria | 4333476 |
| 894 | 2738670945 | 2738541265 | Bacteria | 6594665 |
| 895 | 2738689816 | 2738541271 | Bacteria | 5657310 |
| 896 | 2738749339 | 2738541282 | Bacteria | 6593925 |
| 897 | 2738811362 | 2738541294 | Bacteria | 6925949 |
| 898 | 2738858380 | 2738541303 | Bacteria | 6591772 |
| 899 | 2738898722 | 2738541309 | Bacteria | 6926455 |
| 900 | 2739198326 | 2738543004 | Bacteria | 6381073 |
| 901 | 2739256908 | 2738543015 | Bacteria | 6750701 |
| 902 | 2739265590 | 2738543016 | Bacteria | 5657564 |
| 903 | 2739286692 | 2738543020 | Bacteria | 5718238 |
| 904 | 2739292005 | 2738543021 | Bacteria | 5718241 |
| 905 | 2739315509 | 2738543025 | Bacteria | 6600348 |
| 906 | 2743739519 | 2740892503 | Bacteria | 6855563 |
| 907 | 2745007881 | 2744054620 | Bacteria | 6551379 |
| 908 | 2753857113 | 2751185917 | Bacteria | 4551186 |
| 909 | 2765582059 | 2765235841 | Bacteria | 6137024 |
| 910 | 2765590212 | 2765235842 | Bacteria | 4799256 |
| 911 | 2774120659 | 2773857670 | Bacteria | 6407454 |
| 912 | 2774132113 | 2773857672 | Bacteria | 4993178 |
| 913 | 2774133466 | 2773857673 | Bacteria | 6513460 |
| 914 | 2775541105 | 2775506706 | Bacteria | 4873073 |
| 915 | 2777023204 | 2775507074 | Bacteria | 5532402 |
| 916 | 2784262653 | 2784132063 | Bacteria | 6262788 |
| 917 | 2784313505 | 2784132072 | Bacteria | 6596533 |
| 918 | 2791922660 | 2791354903 | Bacteria | 4937680 |
| 919 | 2793404583 | 2791355275 | Bacteria | 4429597 |
| 920 | 2794594334 | 2791355520 | Bacteria | 5948615 |
| 921 | 2807178172 | 2806310673 | Bacteria | 4801221 |
| 922 | 2807406681 | 2806310737 | Bacteria | 5751088 |
| 923 | 2807455013 | 2806310745 | Bacteria | 5742165 |
| 924 | 2808854055 | 2808606361 | Bacteria | 6136259 |
| 925 | 2808906871 | 2808606373 | Bacteria | 4423627 |
| 926 | 2808923346 | 2808606376 | Bacteria | 6248667 |
| 927 | 2808930355 | 2808606377 | Bacteria | 6646337 |
| 928 | 2808934087 | 2808606378 | Bacteria | 6177535 |
| 929 | 2808941092 | 2808606379 | Bacteria | 5022697 |
| 930 | 2808945379 | 2808606380 | Bacteria | 6248705 |
| 931 | 2808952477 | 2808606381 | Bacteria | 6646461 |
| 932 | 2808956716 | 2808606382 | Bacteria | 6841132 |
| 933 | 2808962512 | 2808606383 | Bacteria | 6138645 |
| 934 | 2808980271 | 2808606385 | Bacteria | 6711065 |
| 935 | 2808995906 | 2808606388 | Bacteria | 6706662 |
| 936 | 2808997447 | 2808606389 | Bacteria | 6138126 |
| 937 | 2809035684 | 2808606395 | Bacteria | 6020352 |
| 938 | 2809218466 | 2808606445 | Bacteria | 6057339 |
| 939 | 2812370849 | 2811994881 | Bacteria | 6298475 |
| 940 | 2817493165 | 2816332298 | Bacteria | 6852809 |
| 941 | 2819631303 | 2818991452 | Bacteria | 8442785 |
| 942 | 2819656270 | 2818991456 | Bacteria | 6123676 |
| 943 | 2819701629 | 2818991464 | Bacteria | 6907494 |
| 944 | 2821121250 | 2821118458 | Bacteria | 4714306 |
| 945 | 2823375866 | 2823373977 | Bacteria | 4779415 |
| 946 | 2823422498 | 2823421272 | Bacteria | 5372474 |
| 947 | 2825653769 | 2825651385 | Bacteria | 6715909 |
| 948 | 2826584103 | 2826581358 | Bacteria | 5963467 |
| 949 | 2834034264 | 2834028612 | Bacteria | 6354979 |
| 950 | 2834641795 | 2834641062 | Bacteria | 5559922 |
| 951 | 2842809327 | 2842805378 | Bacteria | 5385175 |
| 952 | 2842819616 | 2842815866 | Bacteria | 5947510 |
| 953 | 2842829794 | 2842826826 | Bacteria | 5974129 |
| 954 | 2842837434 | 2842832357 | Bacteria | 5959113 |
| 955 | 2842841863 | 2842837860 | Bacteria | 6066181 |
| 956 | 2842845229 | 2842843487 | Bacteria | 6004777 |
| 957 | 2842849722 | 2842849001 | Bacteria | 5924277 |
| 958 | 2842857294 | 2842854478 | Bacteria | 6143501 |
| 959 | 2844428556 | 2844425489 | Bacteria | 4854065 |
| 960 | 2844666057 | 2844665904 | Bacteria | 6817974 |
| 961 | 2852612443 | 2852612431 | Bacteria | 6885235 |
| 962 | 2852660676 | 2852657418 | Bacteria | 6472974 |
| 963 | 2852669821 | 2852667396 | Bacteria | 6885555 |
| 964 | 2854602831 | 2854601825 | Bacteria | 4797592 |
| 965 | 2855195876 | 2855195626 | Bacteria | 4927512 |
| 966 | 2857539041 | 2857537821 | Bacteria | 5248181 |
| 967 | 2858956141 | 2858950400 | Bacteria | 6783797 |
| 968 | 2860344422 | 2860339153 | Bacteria | 6846989 |
| 969 | 2860872246 | 2860867994 | Bacteria | 5645326 |
| 970 | 2863427382 | 2863421361 | Bacteria | 7300805 |
| 971 | 2870070850 | 2870068957 | Bacteria | 8925310 |
| 972 | 2871286037 | 2871282230 | Bacteria | 4917173 |
| 973 | 2878034517 | 2878029506 | Bacteria | 6418441 |
| 974 | 2880235159 | 2880230671 | Bacteria | 6140320 |
| 975 | 2881414905 | 2881412998 | Bacteria | 6492157 |
| 976 | 2884087636 | 2884086401 | Bacteria | 5005459 |
| 977 | 2885272972 | 2885270888 | Bacteria | 9831543 |
| 978 | 2887632615 | 2887630918 | Bacteria | 3239855 |
| 979 | 2888377065 | 2888373701 | Bacteria | 5098052 |
| 980 | 2891675323 | 2891670763 | Bacteria | 4967099 |
| 981 | 2900053263 | 2900051742 | Bacteria | 4985156 |
| 982 | 2900578635 | 2900577576 | Bacteria | 5438534 |
| 983 | 2902683732 | 2902682994 | Bacteria | 8951596 |
| 984 | 2904517864 | 2904513164 | Bacteria | 5476410 |
| 985 | 2904521528 | 2904518522 | Bacteria | 6068986 |
| 986 | 2904551079 | 2904550169 | Bacteria | 6221258 |
| 987 | 2904570001 | 2904564687 | Bacteria | 7609577 |
| 988 | 2904576088 | 2904571731 | Bacteria | 7608790 |
| 989 | 2908451759 | 2908446538 | Bacteria | 6829095 |
| 990 | 2912964696 | 2912963787 | Bacteria | 5646108 |
| 991 | 2913037880 | 2913036834 | Bacteria | 6704877 |
| 992 | 2917075765 | 2917070673 | Bacteria | 6868303 |
| 993 | 2917835059 | 2917832318 | Bacteria | 5346010 |
| 994 | 2919066424 | 2919063839 | Bacteria | 6302690 |
| 995 | 2919111175 | 2919108558 | Bacteria | 5897419 |
| 996 | 2919128997 | 2919125081 | Bacteria | 5385106 |
| 997 | 2919157857 | 2919155634 | Bacteria | 4860545 |
| 998 | 2919388588 | 2919385768 | Bacteria | 5897293 |
| 999 | 2919459554 | 2919456309 | Bacteria | 6586567 |
| 1000 | 2919482771 | 2919481497 | Bacteria | 6907839 |
| 1001 | 2919490090 | 2919487758 | Bacteria | 5929766 |
| 1002 | 2919500265 | 2919497567 | Bacteria | 4408621 |
| 1003 | 2919505095 | 2919501602 | Bacteria | 5286340 |
| 1004 | 2919536168 | 2919534386 | Bacteria | 4577686 |
| 1005 | 2919689696 | 2919688452 | Bacteria | 4595932 |
| 1006 | 2919699970 | 2919697872 | Bacteria | 6553725 |
| 1007 | 2923158604 | 2923153595 | Bacteria | 6870622 |
| 1008 | 2923524954 | 2923519811 | Bacteria | 6298479 |
| 1009 | 2923591815 | 2923586266 | Bacteria | 6565975 |
| 1010 | 2923636110 | 2923634449 | Bacteria | 4753480 |
| 1011 | 2926066772 | 2926063275 | Bacteria | 5285848 |
| 1012 | 2927837400 | 2927833300 | Bacteria | 4923934 |
| 1013 | 2928062907 | 2928058823 | Bacteria | 5520022 |
| 1014 | 2928162875 | 2928157003 | Bacteria | 7522202 |
| 1015 | 2928169547 | 2928163908 | Bacteria | 7561269 |
| 1016 | 2928171565 | 2928170801 | Bacteria | 8785406 |
| 1017 | 2928542565 | 2928536128 | Bacteria | 7657547 |
| 1018 | 2929145324 | 2929144301 | Bacteria | 6622272 |
| 1019 | 2929194370 | 2929189879 | Bacteria | 5930554 |
| 1020 | 2931371335 | 2931369376 | Bacteria | 6847892 |
| 1021 | 2931395635 | 2931390751 | Bacteria | 6273349 |
| 1022 | 2931397203 | 2931396565 | Bacteria | 7251677 |
| 1023 | 2935356751 | 2935353572 | Unclassified | 6955622 |
| 1024 | 2937542233 | 2937539931 | Bacteria | 4639830 |
| 1025 | 2939570205 | 2939568625 | Bacteria | 4542555 |
| 1026 | 2939575633 | 2939573065 | Bacteria | 4926053 |
| 1027 | 2939608490 | 2939607340 | Bacteria | 4719256 |
| 1028 | 2939638156 | 2939636861 | Bacteria | 6297853 |
| 1029 | 2939642752 | 2939642701 | Bacteria | 4475280 |
| 1030 | 2939652194 | 2939651529 | Bacteria | 5895393 |
| 1031 | 2941485633 | |||
| 1032 | 2945876547 | 2945874760 | Bacteria | 5527237 |
| 1033 | 2945931690 | 2945928738 | Bacteria | 6053221 |
| 1034 | 2945961328 | 2945961074 | Bacteria | 7342064 |
| 1035 | 2946007768 | 2946006987 | Bacteria | 6705746 |
| 1036 | 2946032858 | 2946027586 | Bacteria | 6049274 |
| 1037 | 2947233621 | 2947233263 | Bacteria | 6439278 |
| 1038 | 2952253617 | 2952252522 | Bacteria | 4171745 |
| 1039 | 2969080900 | 2969079654 | Bacteria | 5439582 |
| 1040 | 2969309305 | 2969304461 | Bacteria | 6601805 |
| 1041 | 2971822299 | 2971820967 | Bacteria | 5823634 |
| 1042 | 2974289335 | 2974289157 | Bacteria | 6080362 |
| 1043 | 2974301145 | 2974298342 | Bacteria | 4840922 |
| 1044 | 2974310899 | 2974310843 | Bacteria | 4947816 |
| 1045 | 2981996828 | 2981990288 | Bacteria | 7590678 |
| 1046 | 2984287572 | 2984286254 | Bacteria | 6702062 |
| 1047 | 2984503621 | 2984499530 | Bacteria | 5020881 |
| 1048 | 2984507806 | 2984504281 | Bacteria | 5262371 |
| 1049 | 2984563361 | 2984559226 | Bacteria | 5683096 |
| 1050 | 2984596096 | 2984595703 | Bacteria | 5682994 |
| 1051 | 2988732852 | 2988728565 | Bacteria | 6124362 |
| 1052 | 2990200661 | 2990196909 | Bacteria | 4054280 |
| 1053 | 2998144572 | 2998139840 | Bacteria | 6073514 |
| 1054 | 2998345744 | 2998344455 | Bacteria | 4222996 |
| 1055 | 3007253782 | 3007252601 | Bacteria | 4559114 |
| 1056 | 3007317476 | 3007315729 | Bacteria | 5076637 |
| 1057 | 3007398229 | 3007395558 | Bacteria | 6755444 |
| 1058 | 3007420652 | 3007419365 | Bacteria | 7026924 |
| 1059 | 3007512389 | 3007511990 | Bacteria | 6481491 |
| 1060 | 3007618425 | 3007614139 | Bacteria | 6053559 |
| 1061 | 3007624384 | 3007619802 | Bacteria | 6411688 |
| 1062 | 3007723385 | 3007718800 | Bacteria | 5971527 |
| 1063 | 3007804686 | 3007803356 | Bacteria | 5931491 |
| 1064 | 3007858451 | 3007855910 | Bacteria | 5637581 |
| 1065 | 3007866034 | 3007861166 | Bacteria | 6045338 |
| 1066 | 3007871227 | 3007866637 | Bacteria | 5899198 |
| 1067 | 3007875943 | 3007872151 | Bacteria | 5268868 |
| 1068 | 637322300 | 637000220 | Bacteria | 7074893 |
| 1069 | 640488986 | 640427133 | Bacteria | 4567418 |
| 1070 | 640939178 | 640753048 | Bacteria | 5495657 |
| 1071 | 642418897 | 641736154 | Bacteria | 7689995 |
| 1072 | 651177075 | 651053060 | Bacteria | 4689946 |
| 1073 | 8002748388 | 8002745576 | Bacteria | 4840272 |
| 1074 | 8003404661 | 8003400568 | Bacteria | 5535898 |
| 1075 | 8011353517 | 8011350971 | Bacteria | 6158957 |
| 1076 | 8015692687 | 8015687852 | Bacteria | 6613826 |
| 1077 | 8016730042 | 8016728285 | Bacteria | 5263933 |
| 1078 | 8018224362 | 8018221730 | Bacteria | 4616064 |
| 1079 | 8018409049 | 8018405270 | Bacteria | 4978981 |
| 1080 | 8018846954 | 8018845410 | Bacteria | 8933938 |
| 1081 | 8019771672 | 8019769354 | Bacteria | 6924660 |
| 1082 | 8019776636 | 8019775933 | Bacteria | 6858656 |
| 1083 | 8020944915 | 8020938398 | Bacteria | 7472757 |
| 1084 | 8020945492 | 8020945358 | Bacteria | 8467355 |
| 1085 | 8020957048 | 8020953355 | Bacteria | 7439080 |
| 1086 | 8021122094 | 8021120328 | Bacteria | 8782274 |
| 1087 | 8029996307 | 8029995093 | Bacteria | 5990776 |
| 1088 | 8034964215 | 8034962539 | Bacteria | 4884839 |
| 1089 | 8039102593 | 8039098773 | Bacteria | 6602928 |
| 1090 | 8052499089 | 8052494512 | Bacteria | 5765634 |
| 1091 | 8054286585 | 8054285046 | Bacteria | 6919322 |
| 1092 | 8054351080 | 8054347763 | Bacteria | 5901107 |
| 1093 | 8054508153 | 8054503363 | Bacteria | 6101651 |
| 1094 | 8054852160 | 8054849141 | Bacteria | 5232694 |
| 1095 | 8054934348 | 8054929484 | Bacteria | 5599761 |
| 1096 | 8055089880 | 8055087960 | Bacteria | 4784273 |
| 1097 | 8055095688 | 8055092621 | Bacteria | 4873875 |
| 1098 | 8055100436 | 8055097453 | Bacteria | 4865496 |
| 1099 | 8055228240 | 8055225921 | Bacteria | 3341787 |
| 1100 | 8055775921 | 8055770955 | Bacteria | 6827675 |
| 1101 | 8055823106 | 8055817908 | Bacteria | 6609162 |
| 1102 | 8055883451 | 8055878733 | Bacteria | 5907058 |
| 1103 | 8056120447 | 8056115690 | Bacteria | 5527654 |
| 1104 | 8056121727 | 8056120720 | Bacteria | 5758328 |
| 1105 | 8056127055 | 8056125926 | Bacteria | 6228218 |
| 1106 | 8056136516 | 8056131705 | Bacteria | 6107031 |
| 1107 | 8056142059 | 8056137416 | Bacteria | 6147080 |
| 1108 | 8056147951 | 8056143049 | Bacteria | 6307666 |
| 1109 | 8056153416 | 8056148874 | Bacteria | 6479865 |
| 1110 | 8056155566 | 8056155041 | Bacteria | 6486948 |
| 1111 | 8056162793 | 8056161164 | Bacteria | 6106669 |
| 1112 | 8056172001 | 8056166840 | Bacteria | 5820959 |
| 1113 | 8056172667 | 8056172158 | Bacteria | 6133900 |
| 1114 | 8056180604 | 8056177738 | Bacteria | 6748268 |
| 1115 | 8056574503 | 8056569372 | Bacteria | 5997322 |
| 1116 | 8057306564 | 8057304971 | Bacteria | 4649742 |
| 1117 | 8057804775 | 8057798959 | Bacteria | 6713499 |
| 1118 | Ga0501314_000141 | |||
| 1119 | MRS2a_Contig_20 | |||
| 1120 | JGI24740J21852_10000304 | |||
| 1121 | JGI24740J21852_10014032 | |||
| 1122 | JGI24735J21928_10008524 | |||
| 1123 | JGI25156J39149_1004627 | |||
| 1124 | JGI25162J39368_1000034 | |||
| 1125 | JGI25162J39368_1000267 | |||
| 1126 | JGI25154J39366_1000649 | |||
| 1127 | JGI25154J39366_1003474 | |||
| 1128 | JGI25164J39214_1000018 | |||
| 1129 | JGI25164J39214_1000207 | |||
| 1130 | JGI25150J39212_1011928 | |||
| 1131 | JGI25165J46597_1000123 | |||
| 1132 | JGI25165J46597_1000376 | |||
| 1133 | Ga0006556J51387_1030706 | |||
| 1134 | Ga0055538_1000028 | |||
| 1135 | Ga0055539_1000037 | |||
| 1136 | Ga0055539_1003753 | |||
| 1137 | Ga0055533_1000047 | |||
| 1138 | Ga0055533_1002398 | |||
| 1139 | Ga0055532_1000065 | |||
| 1140 | Ga0055525_1000215 | |||
| 1141 | Ga0055527_1002163 | |||
| 1142 | Ga0055527_1002411 | |||
| 1143 | Ga0055535_1003690 | |||
| 1144 | Ga0055536_1001163 | |||
| 1145 | Ga0055528_1013242 | |||
| 1146 | Ga0055530_10004141 | |||
| 1147 | Ga0055530_10004237 | |||
| 1148 | Ga0055540_1003422 | |||
| 1149 | Ga0055540_1003920 | |||
| 1150 | Ga0055540_1005813 | |||
| 1151 | Ga0055531_10004391 | |||
| 1152 | Ga0055541_1000025 | |||
| 1153 | Ga0055541_1003150 | |||
| 1154 | Ga0058692_1000635 | |||
| 1155 | Ga0058692_1020442 | |||
| 1156 | Ga0065714_10000015 | |||
| 1157 | Ga0065714_10065484 | |||
| 1158 | Ga0065714_10066406 | |||
| 1159 | Ga0065714_10093370 | |||
| 1160 | Ga0065704_10072138 | |||
| 1161 | Ga0065704_10076944 | |||
| 1162 | Ga0065712_10003570 | |||
| 1163 | Ga0065712_10067801 | |||
| 1164 | Ga0070658_10167595 | |||
| 1165 | Ga0070683_100001860 | |||
| 1166 | Ga0070670_100001421 | |||
| 1167 | Ga0070670_100179989 | |||
| 1168 | Ga0068869_100027291 | |||
| 1169 | Ga0068869_100032957 | |||
| 1170 | Ga0068868_100000153 | |||
| 1171 | Ga0070660_100000038 | |||
| 1172 | Ga0070660_100063879 | |||
| 1173 | Ga0070661_100000022 | |||
| 1174 | Ga0070661_100002241 | |||
| 1175 | Ga0070669_100004428 | |||
| 1176 | Ga0070669_100178220 | |||
| 1177 | Ga0070675_100000465 | |||
| 1178 | Ga0070671_100001721 | |||
| 1179 | Ga0070688_100020256 | |||
| 1180 | Ga0070659_100000050 | |||
| 1181 | Ga0070659_100003967 | |||
| 1182 | Ga0070659_100069037 | |||
| 1183 | Ga0070667_100013661 | |||
| 1184 | Ga0070714_100090543 | |||
| 1185 | Ga0070663_100005963 | |||
| 1186 | Ga0070678_100000364 | |||
| 1187 | Ga0070678_100093039 | |||
| 1188 | Ga0070662_100001253 | |||
| 1189 | Ga0068867_100098689 | |||
| 1190 | Ga0070679_100018846 | |||
| 1191 | Ga0070684_100008061 | |||
| 1192 | Ga0068853_100003013 | |||
| 1193 | Ga0070672_100000119 | |||
| 1194 | Ga0070696_100072638 | |||
| 1195 | Ga0070665_100001059 | |||
| 1196 | Ga0070665_100141462 | |||
| 1197 | Ga0068855_100001651 | |||
| 1198 | Ga0068855_100008249 | |||
| 1199 | Ga0068855_100092724 | |||
| 1200 | Ga0070664_100002152 | |||
| 1201 | Ga0070664_100003141 | |||
| 1202 | Ga0068857_100000265 | |||
| 1203 | Ga0068854_100002231 | |||
| 1204 | Ga0068854_100006385 | |||
| 1205 | Ga0068856_100001616 | |||
| 1206 | Ga0068852_100001062 | |||
| 1207 | Ga0068852_100020940 | |||
| 1208 | Ga0068852_100138394 | |||
| 1209 | Ga0068864_100006456 | |||
| 1210 | Ga0068851_10000044 | |||
| 1211 | Ga0068851_10000937 | |||
| 1212 | Ga0068851_10021856 | |||
| 1213 | Ga0068858_100233335 | |||
| 1214 | Ga0068862_100272819 | |||
| 1215 | Ga0075365_10209567 | |||
| 1216 | Ga0075364_10007007 | |||
| 1217 | Ga0075364_10010639 | |||
| 1218 | Ga0070712_100126976 | |||
| 1219 | Ga0075366_10000114 | |||
| 1220 | Ga0075366_10014314 | |||
| 1221 | Ga0097621_100000386 | |||
| 1222 | Ga0068871_100004108 | |||
| 1223 | Ga0068871_100099235 | |||
| 1224 | Ga0075430_100037846 | |||
| 1225 | Ga0075431_100029182 | |||
| 1226 | Ga0068865_100038530 | |||
| 1227 | Ga0099823_1000165 | |||
| 1228 | Ga0079104_1000075 | |||
| 1229 | Ga0079104_1000155 | |||
| 1230 | Ga0079104_1000365 | |||
| 1231 | Ga0079104_1001490 | |||
| 1232 | Ga0079104_1024697 | |||
| 1233 | Ga0105251_10000057 | |||
| 1234 | Ga0105251_10002699 | |||
| 1235 | Ga0105251_10003084 | |||
| 1236 | Ga0105251_10007038 | |||
| 1237 | Ga0105251_10010297 | |||
| 1238 | Ga0105251_10024042 | |||
| 1239 | Ga0105251_10032626 | |||
| 1240 | Ga0105244_10000074 | |||
| 1241 | Ga0105244_10000329 | |||
| 1242 | Ga0105244_10016005 | |||
| 1243 | Ga0105244_10019386 | |||
| 1244 | Ga0105244_10029820 | |||
| 1245 | Ga0105244_10034909 | |||
| 1246 | Ga0105244_10039490 | |||
| 1247 | Ga0105244_10041671 | |||
| 1248 | Ga0105244_10048906 | |||
| 1249 | Ga0105244_10051809 | |||
| 1250 | Ga0105244_10088593 | |||
| 1251 | Ga0105250_10000105 | |||
| 1252 | Ga0105250_10002957 | |||
| 1253 | Ga0105250_10007801 | |||
| 1254 | Ga0105240_10014742 | |||
| 1255 | Ga0105240_10073092 | |||
| 1256 | Ga0111539_10141908 | |||
| 1257 | Ga0105245_10030665 | |||
| 1258 | Ga0105243_10000257 | |||
| 1259 | Ga0105243_10003279 | |||
| 1260 | Ga0105243_10011277 | |||
| 1261 | Ga0105243_10014467 | |||
| 1262 | Ga0105243_10085876 | |||
| 1263 | Ga0105241_10007611 | |||
| 1264 | Ga0105242_10000604 | |||
| 1265 | Ga0105248_10007111 | |||
| 1266 | Ga0105248_10044796 | |||
| 1267 | Ga0105237_10002667 | |||
| 1268 | Ga0105237_10385957 | |||
| 1269 | Ga0105237_10386025 | |||
| 1270 | Ga0105238_10027224 | |||
| 1271 | Ga0105238_10062449 | |||
| 1272 | Ga0105249_10056467 | |||
| 1273 | Ga0105246_10007820 | |||
| 1274 | Ga0105246_10149448 | |||
| 1275 | Ga0105246_10237290 | |||
| 1276 | Ga0157373_10033783 | |||
| 1277 | Ga0157373_10040717 | |||
| 1278 | Ga0157373_10068658 | |||
| 1279 | Ga0157371_10000319 | |||
| 1280 | Ga0157371_10017491 | |||
| 1281 | Ga0157371_10139527 | |||
| 1282 | Ga0157370_10000158 | |||
| 1283 | Ga0157370_10005151 | |||
| 1284 | Ga0157370_10291204 | |||
| 1285 | Ga0157369_10004387 | |||
| 1286 | Ga0157374_10000275 | |||
| 1287 | Ga0157378_10007964 | |||
| 1288 | Ga0157372_10002346 | |||
| 1289 | Ga0157372_10042119 | |||
| 1290 | Ga0157372_10069996 | |||
| 1291 | Ga0157372_10394725 | |||
| 1292 | Ga0157375_10000644 | |||
| 1293 | Ga0157375_10425930 | |||
| 1294 | Ga0157377_10008750 | |||
| 1295 | Ga0157376_10006609 | |||
| 1296 | Ga0182006_1000024 | |||
| 1297 | Ga0182006_1005123 | |||
| 1298 | Ga0182007_10002743 | |||
| 1299 | Ga0183366_1001 | |||
| 1300 | Ga0183370_1001 | |||
| 1301 | Ga0183369_1001 | |||
| 1302 | Ga0183368_1001 | |||
| 1303 | Ga0163161_10190962 | |||
| 1304 | Ga0163161_10292215 | |||
| 1305 | Ga0206356_10486280 | |||
| 1306 | Ga0206351_10240908 | |||
| 1307 | Ga0206352_10757900 | |||
| 1308 | Ga0213872_10003644 | |||
| 1309 | Ga0213876_10000065 | |||
| 1310 | Ga0224712_10029285 | |||
| 1311 | Ga0209435_101129 | |||
| 1312 | Ga0209760_100144 | |||
| 1313 | Ga0209760_100239 | |||
| 1314 | Ga0209784_100032 | |||
| 1315 | Ga0209784_101717 | |||
| 1316 | Ga0209566_100036 | |||
| 1317 | Ga0209566_100561 | |||
| 1318 | Ga0209566_101093 | |||
| 1319 | Ga0209674_100054 | |||
| 1320 | Ga0209674_100122 | |||
| 1321 | Ga0209672_100014 | |||
| 1322 | Ga0209672_100023 | |||
| 1323 | Ga0209672_102420 | |||
| 1324 | Ga0209672_103191 | |||
| 1325 | Ga0209147_100055 | |||
| 1326 | Ga0209147_100127 | |||
| 1327 | Ga0209147_100171 | |||
| 1328 | Ga0209147_100911 | |||
| 1329 | Ga0209563_100055 | |||
| 1330 | Ga0207427_100007 | |||
| 1331 | Ga0207427_100038 | |||
| 1332 | Ga0209437_100006 | |||
| 1333 | Ga0209437_100009 | |||
| 1334 | Ga0209258_100134 | |||
| 1335 | Ga0209258_100183 | |||
| 1336 | Ga0209258_100283 | |||
| 1337 | Ga0209646_1000022 | |||
| 1338 | Ga0209646_1000847 | |||
| 1339 | Ga0209026_1004035 | |||
| 1340 | Ga0209677_100033 | |||
| 1341 | Ga0209677_109356 | |||
| 1342 | Ga0209148_1000021 | |||
| 1343 | Ga0209148_1000035 | |||
| 1344 | Ga0209148_1000651 | |||
| 1345 | Ga0209148_1002826 | |||
| 1346 | Ga0209759_1001746 | |||
| 1347 | Ga0209759_1004108 | |||
| 1348 | Ga0209759_1007458 | |||
| 1349 | Ga0209233_1000059 | |||
| 1350 | Ga0209233_1000074 | |||
| 1351 | Ga0209455_1000072 | |||
| 1352 | Ga0209455_1001880 | |||
| 1353 | Ga0209455_1006914 | |||
| 1354 | Ga0209673_1000140 | |||
| 1355 | Ga0209675_1001271 | |||
| 1356 | Ga0209676_1000006 | |||
| 1357 | Ga0209676_1000010 | |||
| 1358 | Ga0209676_1000306 | |||
| 1359 | Ga0209676_1002335 | |||
| 1360 | Ga0209564_1004606 | |||
| 1361 | Ga0209050_1000019 | |||
| 1362 | Ga0209050_1000060 | |||
| 1363 | Ga0209050_1000065 | |||
| 1364 | Ga0209050_1004114 | |||
| 1365 | Ga0209051_1000037 | |||
| 1366 | Ga0209051_1000266 | |||
| 1367 | Ga0209051_1000463 | |||
| 1368 | Ga0209257_1000119 | |||
| 1369 | Ga0207656_10000022 | |||
| 1370 | Ga0207696_1000112 | |||
| 1371 | Ga0207696_1000120 | |||
| 1372 | Ga0207696_1000131 | |||
| 1373 | Ga0207696_1000166 | |||
| 1374 | Ga0207696_1000485 | |||
| 1375 | Ga0207696_1000990 | |||
| 1376 | Ga0207696_1007372 | |||
| 1377 | Ga0207655_1000002 | |||
| 1378 | Ga0207655_1000004 | |||
| 1379 | Ga0207655_1000005 | |||
| 1380 | Ga0207655_1000015 | |||
| 1381 | Ga0207655_1000062 | |||
| 1382 | Ga0207655_1000257 | |||
| 1383 | Ga0207655_1001086 | |||
| 1384 | Ga0207655_1012723 | |||
| 1385 | Ga0207655_1019306 | |||
| 1386 | Ga0207655_1025865 | |||
| 1387 | Ga0207655_1035319 | |||
| 1388 | Ga0207713_1000014 | |||
| 1389 | Ga0207713_1000052 | |||
| 1390 | Ga0207713_1000069 | |||
| 1391 | Ga0207713_1000084 | |||
| 1392 | Ga0207713_1000163 | |||
| 1393 | Ga0207713_1002948 | |||
| 1394 | Ga0207713_1004327 | |||
| 1395 | Ga0207713_1005426 | |||
| 1396 | Ga0207713_1006369 | |||
| 1397 | Ga0207713_1008005 | |||
| 1398 | Ga0207713_1014384 | |||
| 1399 | Ga0207713_1021964 | |||
| 1400 | Ga0207713_1035803 | |||
| 1401 | Ga0207713_1039075 | |||
| 1402 | Ga0207713_1045154 | |||
| 1403 | Ga0207713_1063602 | |||
| 1404 | Ga0207682_10000530 | |||
| 1405 | Ga0207688_10002856 | |||
| 1406 | Ga0207647_10006507 | |||
| 1407 | Ga0207654_10014171 | |||
| 1408 | Ga0207695_10003559 | |||
| 1409 | Ga0207695_10018612 | |||
| 1410 | Ga0207671_10000034 | |||
| 1411 | Ga0207693_10192410 | |||
| 1412 | Ga0207662_10015248 | |||
| 1413 | Ga0207657_10000122 | |||
| 1414 | Ga0207657_10006957 | |||
| 1415 | Ga0207649_10000006 | |||
| 1416 | Ga0207649_10006146 | |||
| 1417 | Ga0207652_10034250 | |||
| 1418 | Ga0207681_10007548 | |||
| 1419 | Ga0207694_10030390 | |||
| 1420 | Ga0207694_10061904 | |||
| 1421 | Ga0207650_10002050 | |||
| 1422 | Ga0207650_10011609 | |||
| 1423 | Ga0207650_10021032 | |||
| 1424 | Ga0207659_10169557 | |||
| 1425 | Ga0207700_10009038 | |||
| 1426 | Ga0207664_10056724 | |||
| 1427 | Ga0207644_10002410 | |||
| 1428 | Ga0207690_10000047 | |||
| 1429 | Ga0207690_10004220 | |||
| 1430 | Ga0207706_10003482 | |||
| 1431 | Ga0207706_10024374 | |||
| 1432 | Ga0207706_10026622 | |||
| 1433 | Ga0207686_10002336 | |||
| 1434 | Ga0207709_10000013 | |||
| 1435 | Ga0207709_10000810 | |||
| 1436 | Ga0207704_10083487 | |||
| 1437 | Ga0207691_10001306 | |||
| 1438 | Ga0207691_10066699 | |||
| 1439 | Ga0207711_10066851 | |||
| 1440 | Ga0207689_10089681 | |||
| 1441 | Ga0207661_10000776 | |||
| 1442 | Ga0207679_10000010 | |||
| 1443 | Ga0207679_10001299 | |||
| 1444 | Ga0207679_10100188 | |||
| 1445 | Ga0207667_10023027 | |||
| 1446 | Ga0207667_10023756 | |||
| 1447 | Ga0207651_10003247 | |||
| 1448 | Ga0207712_10169511 | |||
| 1449 | Ga0207640_10002050 | |||
| 1450 | Ga0207640_10011078 | |||
| 1451 | Ga0207658_10018826 | |||
| 1452 | Ga0207677_10001373 | |||
| 1453 | Ga0207703_10069307 | |||
| 1454 | Ga0207703_10139026 | |||
| 1455 | Ga0207639_10000940 | |||
| 1456 | Ga0207678_10000251 | |||
| 1457 | Ga0207708_10016466 | |||
| 1458 | Ga0207648_10002780 | |||
| 1459 | Ga0207648_10023686 | |||
| 1460 | Ga0207676_10044614 | |||
| 1461 | Ga0207674_10001076 | |||
| 1462 | Ga0207675_100019530 | |||
| 1463 | Ga0207675_100213327 | |||
| 1464 | Ga0207683_10015967 | |||
| 1465 | Ga0207698_10019123 | |||
| 1466 | Ga0209281_1000004 | |||
| 1467 | Ga0209281_1000010 | |||
| 1468 | Ga0209281_1000013 | |||
| 1469 | Ga0209281_1000014 | |||
| 1470 | Ga0209281_1000171 | |||
| 1471 | Ga0209281_1000901 | |||
| 1472 | Ga0209281_1001390 | |||
| 1473 | Ga0209281_1001407 | |||
| 1474 | Ga0209389_1000058 | |||
| 1475 | Ga0209371_1000001 | |||
| 1476 | Ga0209371_1000135 | |||
| 1477 | Ga0209371_1000158 | |||
| 1478 | Ga0209371_1000186 | |||
| 1479 | Ga0209371_1000218 | |||
| 1480 | Ga0209371_1000596 | |||
| 1481 | Ga0209371_1001007 | |||
| 1482 | Ga0209371_1008901 | |||
| 1483 | Ga0209371_1009641 | |||
| 1484 | Ga0209969_1004544 | |||
| 1485 | Ga0209984_1001334 | |||
| 1486 | Ga0209968_1014170 | |||
| 1487 | Ga0209999_1007854 | |||
| 1488 | Ga0209983_1004857 | |||
| 1489 | Ga0209971_1000531 | |||
| 1490 | Ga0209974_10004317 | |||
| 1491 | Ga0207428_10069479 | |||
| 1492 | Ga0268266_10000213 | |||
| 1493 | Ga0265318_10005455 | |||
| 1494 | Ga0265324_10000120 | |||
| 1495 | Ga0268256_1000001 | |||
| 1496 | Ga0268256_1000069 | |||
| 1497 | Ga0268256_1000150 | |||
| 1498 | Ga0268256_1000174 | |||
| 1499 | Ga0268256_1000624 | |||
| 1500 | Ga0268256_1001247 | |||
| 1501 | Ga0268256_1001292 | |||
| 1502 | Ga0316178_1044274 | |||
| 1503 | Ga0316181_1071710 | |||
| 1504 | Ga0265328_10001472 | |||
| 1505 | Ga0265320_10035951 | |||
| 1506 | Ga0265331_10000638 | |||
| 1507 | Ga0265327_10000005 | |||
| 1508 | Ga0307408_100000045 | |||
| 1509 | Ga0316575_10026727 | |||
| 1510 | Ga0316575_10060686 | |||
| 1511 | Ga0316579_10030613 | |||
| 1512 | Ga0265314_10000371 | |||
| 1513 | Ga0265314_10000675 | |||
| 1514 | Ga0265342_10022919 | |||
| 1515 | Ga0316576_10083911 | |||
| 1516 | Ga0316576_10097473 | |||
| 1517 | Ga0316578_10007566 | |||
| 1518 | Ga0316578_10033120 | |||
| 1519 | Ga0316577_10027089 | |||
| 1520 | Ga0307412_10001384 | |||
| 1521 | Ga0307416_100123729 | |||
| 1522 | Ga0316583_10007306 | |||
| 1523 | Ga0316583_10012242 | |||
| 1524 | Ga0316585_10006273 | |||
| 1525 | Ga0316593_10000339 | |||
| 1526 | Ga0316593_10000373 | |||
| 1527 | Ga0316593_10002184 | |||
| 1528 | Ga0316593_10003965 | |||
| 1529 | Ga0316593_10004344 | |||
| 1530 | Ga0316593_10005056 | |||
| 1531 | Ga0316593_10010512 | |||
| 1532 | Ga0316593_10015578 | |||
| 1533 | Ga0316593_10025916 | |||
| 1534 | Ga0316586_1000458 | |||
| 1535 | Ga0316586_1007252 | |||
| 1536 | Ga0316588_1002377 | |||
| 1537 | Ga0316588_1002600 | |||
| 1538 | Ga0316588_1010778 | |||
| 1539 | Ga0316587_1002090 | |||
| 1540 | Ga0316587_1005710 | |||
| 1541 | Ga0316587_1010475 | |||
| 1542 | Ga0316596_1001721 | |||
| 1543 | Ga0316596_1002870 | |||
| 1544 | Ga0316596_1003418 | |||
| 1545 | Ga0316596_1003444 | |||
| 1546 | Ga0316596_1003520 | |||
| 1547 | Ga0316596_1003678 | |||
| 1548 | Ga0316596_1005106 | |||
| 1549 | Ga0316596_1007805 | |||
| 1550 | Ga0316596_1018876 | |||
| 1551 | Ga0316574_0001412 | |||
| 1552 | Ga0316582_0001138 | |||
| 1553 | Ga0316584_0003189 | |||
| 1554 | Ga0316584_0044351 | |||
| 1555 | Ga0237819_00403 | |||
| 1556 | Ga0400484_04886 | |||
| 1557 | Ga0400484_05073 | |||
| 1558 | Ga0400484_22058 | |||
| 1559 | Ga0400490_31882 | |||
| 1560 | Ga0400491_03673 | |||
| 1561 | Ga0400491_15408 | |||
| 1562 | Ga0400485_14652 | |||
| 1563 | Ga0400485_15325 | |||
| 1564 | Ga0400488_34854 | |||
| 1565 | Ga0400488_50469 | |||
| 1566 | Ga0400488_52701 | |||
| 1567 | Ga0400486_01330 | |||
| 1568 | Ga0400483_072402 | |||
| 1569 | Ga0400483_075161 | |||
| 1570 | Ga0400483_117255 | |||
| 1571 | Ga0400483_261257 | |||
| 1572 | Ga0400487_44591 | |||
| 1573 | Ga0400487_65366 | |||
| 1574 | Ga0436365_0787909 | |||
| 1575 | Ga0436365_1613017 | |||
| 1576 | Ga0439436_0000404 | |||
| 1577 | Ga0439438_000472 | |||
| 1578 | Ga0439438_000983 | |||
| 1579 | Ga0439447_000424 | |||
| 1580 | Ga0439447_009647 | |||
| 1581 | Ga0439447_029151 | |||
| 1582 | Ga0439466_0036753 | |||
| 1583 | Ga0451798_0922051 | |||
| 1584 | Ga0451853_1858486 | |||
| 1585 | Ga0439437_000337 | |||
| 1586 | Ga0439432_001369 | |||
| 1587 | Ga0439452_000002 | |||
| 1588 | Ga0439452_008032 | |||
| 1589 | Ga0439456_000066 | |||
| 1590 | Ga0439456_008039 | |||
| 1591 | Ga0450911_000020 | |||
| 1592 | Ga0450902_000371 | |||
| 1593 | Ga0450905_000060 | |||
| 1594 | Ga0439446_0001264 | |||
| 1595 | Ga0439446_0011421 | |||
| 1596 | Ga0439434_0001323 | |||
| 1597 | Ga0451577_0000002 | |||
| 1598 | Ga0451577_0003438 | |||
| 1599 | Ga0451577_0028906 | |||
| 1600 | Ga0466981_0000031 | |||
| 1601 | Ga0453683_0000003 | |||
| 1602 | Ga0453683_0004681 | |||
| 1603 | Ga0466961_0098867 | |||
| 1604 | Ga0453684_0000002 | |||
| 1605 | Ga0453684_0003424 | |||
| 1606 | Ga0453684_0012830 | |||
| 1607 | Ga0451576_0000004 | |||
| 1608 | Ga0451576_0000765 | |||
| 1609 | Ga0451576_0012879 | |||
| 1610 | Ga0451576_0032565 | |||
| 1611 | Ga0451576_0035924 | |||
| 1612 | Ga0466958_0054852 | |||
| 1613 | Ga0495617_036160 | |||
| 1614 | Ga0495627_000021 | |||
| 1615 | Ga0495627_000107 | |||
| 1616 | Ga0495627_010987 | |||
| 1617 | Ga0495603_0059346 | |||
| 1618 | Ga0495591_000066 | |||
| 1619 | Ga0495591_000085 | |||
| 1620 | Ga0495591_013748 | |||
| 1621 | Ga0495653_0027433 | |||
| 1622 | Ga0495653_0087216 | |||
| 1623 | Ga0495650_0000326 | |||
| 1624 | Ga0495650_0000735 | |||
| 1625 | Ga0495650_0002598 | |||
| 1626 | Ga0495605_0000014 | |||
| 1627 | Ga0495605_0000491 | |||
| 1628 | Ga0495605_0001437 | |||
| 1629 | Ga0495605_0017246 | |||
| 1630 | Ga0495605_0029213 | |||
| 1631 | Ga0495605_0029668 | |||
| 1632 | Ga0495605_0084688 | |||
| 1633 | Ga0495584_0013902 | |||
| 1634 | Ga0495584_0073636 | |||
| 1635 | Ga0495585_0047044 | |||
| 1636 | Ga0495596_0040801 | |||
| 1637 | Ga0495607_0003108 | |||
| 1638 | Ga0495607_0003293 | |||
| 1639 | Ga0495607_0006180 | |||
| 1640 | Ga0495607_0007074 | |||
| 1641 | Ga0495607_0021845 | |||
| 1642 | Ga0495607_0041636 | |||
| 1643 | Ga0495607_0050695 | |||
| 1644 | Ga0495607_0098168 | |||
| 1645 | Ga0495583_0000066 | |||
| 1646 | Ga0495583_0001531 | |||
| 1647 | Ga0495583_0004380 | |||
| 1648 | Ga0495583_0059872 | |||
| 1649 | Ga0495606_0000441 | |||
| 1650 | Ga0495606_0000482 | |||
| 1651 | Ga0495606_0004806 | |||
| 1652 | Ga0495610_0012835 | |||
| 1653 | Ga0495620_0000048 | |||
| 1654 | Ga0495620_0000295 | |||
| 1655 | Ga0495620_0019943 | |||
| 1656 | Ga0495628_0001261 | |||
| 1657 | Ga0495630_0000532 | |||
| 1658 | Ga0495632_0001963 | |||
| 1659 | Ga0495632_0029363 | |||
| 1660 | Ga0495637_0001452 | |||
| 1661 | Ga0495637_0010475 | |||
| 1662 | Ga0495643_0000103 | |||
| 1663 | Ga0495643_0002539 | |||
| 1664 | Ga0495648_0021753 | |||
| 1665 | Ga0495652_0005769 | |||
| 1666 | Ga0495654_0000964 | |||
| 1667 | Ga0495654_0003334 | |||
| 1668 | Ga0495654_0006365 | |||
| 1669 | Ga0495654_0030708 | |||
| 1670 | Ga0495665_0000068 | |||
| 1671 | Ga0495586_0000403 | |||
| 1672 | Ga0495587_0030390 | |||
| 1673 | Ga0495609_0000006 | |||
| 1674 | Ga0495609_0000099 | |||
| 1675 | Ga0495609_0001353 | |||
| 1676 | Ga0495609_0007053 | |||
| 1677 | Ga0495597_0002748 | |||
| 1678 | Ga0495645_0110230 | |||
| 1679 | Ga0495633_0003207 | |||
| 1680 | Ga0495634_0111270 | |||
| 1681 | Ga0495611_0000129 | |||
| 1682 | Ga0495625_0000050 | |||
| 1683 | Ga0495625_0002671 | |||
| 1684 | Ga0495661_0000167 | |||
| 1685 | Ga0495661_0000255 | |||
| 1686 | Ga0495661_0002070 | |||
| 1687 | Ga0495661_0002852 | |||
| 1688 | Ga0495661_0017562 | |||
| 1689 | Ga0495623_0019398 | |||
| 1690 | Ga0495646_0015137 | |||
| 1691 | Ga0495669_0062712 | |||
| 1692 | Ga0495624_0012967 | |||
| 1693 | Ga0495624_0062219 | |||
| 1694 | Ga0495670_0004153 | |||
| 1695 | Ga0495671_0007992 | |||
| 1696 | Ga0495671_0015431 | |||
| 1697 | Ga0495671_0017747 | |||
| 1698 | Ga0495671_0043198 | |||
| 1699 | Ga0495649_0003418 | |||
| 1700 | Ga0495649_0006783 | |||
| 1701 | Ga0495649_0008276 | |||
| 1702 | Ga0495649_0041701 | |||
| 1703 | Ga0495660_0003959 | |||
| 1704 | Ga0495581_0003933 | |||
| 1705 | Ga0495636_0070760 | |||
| 1706 | Ga0495674_0000546 | |||
| 1707 | Ga0495672_0000156 | |||
| 1708 | Ga0495672_0000655 | |||
| 1709 | Ga0495672_0001704 | |||
| 1710 | Ga0495672_0042370 | |||
| 1711 | Ga0495672_0106592 | |||
| 1712 | Ga0495672_0113672 | |||
| 1713 | Ga0495676_0000024 | |||
| 1714 | Ga0495676_0009185 | |||
| 1715 | Ga0495680_0094161 | |||
| 1716 | Ga0495680_0113150 | |||
| 1717 | Ga0495683_0000056 | |||
| 1718 | Ga0495683_0000525 | |||
| 1719 | Ga0495679_000098 | |||
| 1720 | Ga0495679_000169 | |||
| 1721 | Ga0495673_0000071 | |||
| 1722 | Ga0495673_0003132 | |||
| 1723 | Ga0495673_0006373 | |||
| 1724 | Ga0495673_0013144 | |||
| 1725 | Ga0495673_0029281 | |||
| 1726 | Ga0495673_0037464 | |||
| 1727 | Ga0495673_0063599 | |||
| 1728 | Ga0495673_0094690 | |||
| 1729 | Ga0495681_0003261 | |||
| 1730 | Ga0495593_0040334 | |||
| 1731 | Ga0495593_0051205 | |||
| 1732 | Ga0495602_0112160 | |||
| 1733 | Ga0495626_0000061 | |||
| 1734 | Ga0496102_0015543 | |||
| 1735 | Ga0496104_0015221 | |||
| 1736 | Ga0496105_0210121 | |||
| 1737 | Ga0496108_0003010 | |||
| 1738 | Ga0496109_0001294 | |||
| 1739 | Ga0496110_0013126 | |||
| 1740 | Ga0496115_0003367 | |||
| 1741 | Ga0496116_0006865 | |||
| 1742 | Ga0496116_0017001 | |||
| 1743 | Ga0496116_0017716 | |||
| 1744 | Ga0496117_0010834 | |||
| 1745 | Ga0496117_0024754 | |||
| 1746 | Ga0496117_0027654 | |||
| 1747 | Ga0496117_0042773 | |||
| 1748 | Ga0496117_0156894 | |||
| 1749 | Ga0496118_0002565 | |||
| 1750 | Ga0496118_0005100 | |||
| 1751 | Ga0496118_0034936 | |||
| 1752 | Ga0496119_0000100 | |||
| 1753 | Ga0496119_0013887 | |||
| 1754 | Ga0496119_0031959 | |||
| 1755 | Ga0496119_0032849 | |||
| 1756 | Ga0496119_0056370 | |||
| 1757 | Ga0496120_0002036 | |||
| 1758 | Ga0496120_0008007 | |||
| 1759 | Ga0496120_0048955 | |||
| 1760 | Ga0496121_0000478 | |||
| 1761 | Ga0496121_0003129 | |||
| 1762 | Ga0496121_0005829 | |||
| 1763 | Ga0496121_0012769 | |||
| 1764 | Ga0496121_0016343 | |||
| 1765 | Ga0496121_0045276 | |||
| 1766 | Ga0496122_0000077 | |||
| 1767 | Ga0496122_0000619 | |||
| 1768 | Ga0496122_0000849 | |||
| 1769 | Ga0496122_0003105 | |||
| 1770 | Ga0496122_0006285 | |||
| 1771 | Ga0496122_0021150 | |||
| 1772 | Ga0496122_0021441 | |||
| 1773 | Ga0496122_0050474 | |||
| 1774 | Ga0496123_0000012 | |||
| 1775 | Ga0496123_0000080 | |||
| 1776 | Ga0496123_0001875 | |||
| 1777 | Ga0496123_0002289 | |||
| 1778 | Ga0496123_0043399 | |||
| 1779 | Ga0496123_0045913 | |||
| 1780 | Ga0496124_0000692 | |||
| 1781 | Ga0496124_0042806 | |||
| 1782 | Ga0496124_0050600 | |||
| 1783 | Ga0496124_0075774 | |||
| 1784 | Ga0496124_0086074 | |||
| 1785 | Ga0496125_0000146 | |||
| 1786 | Ga0496125_0000405 | |||
| 1787 | Ga0496125_0001820 | |||
| 1788 | Ga0496125_0121290 | |||
| 1789 | Ga0496126_0001340 | |||
| 1790 | Ga0496126_0127921 | |||
| 1791 | Ga0501307_001781 | |||
| 1792 | Ga0495678_001660 | |||
| 1793 | Ga0495678_002720 | |||
| 1794 | Ga0495678_006819 | |||
| 1795 | Ga0495682_0000381 | |||
| 1796 | Ga0495682_0002162 | |||
| 1797 | Ga0501031_0012416 | |||
| 1798 | Ga0501032_0018657 | |||
| 1799 | Ga0501033_0008532 | |||
| 1800 | Ga0501034_0000557 | |||
| 1801 | Ga0501036_0176215 | |||
| 1802 | Ga0501037_0003038 | |||
| 1803 | Ga0501037_0003661 | |||
| 1804 | Ga0501037_0077989 | |||
| 1805 | Ga0501038_0104428 | |||
| 1806 | Ga0501039_0197198 | |||
| 1807 | Ga0501043_0008317 | |||
| 1808 | Ga0501046_0003807 | |||
| 1809 | Ga0501046_0096090 | |||
| 1810 | Ga0501035_0018195 | |||
| 1811 | Ga0501044_0000379 | |||
| 1812 | Ga0501044_0007220 | |||
| 1813 | Ga0501226_000012 | |||
| 1814 | nmdc:mga00v17_27196_c1 | |||
| 1815 | nmdc:mga0yw44_237069_c1 | |||
| 1816 | nmdc:mga0k408_148845_c1 | |||
| 1817 | nmdc:mga0k408_172_c1 | |||
| 1818 | nmdc:mga0k408_27749_c1 | |||
| 1819 | nmdc:mga0qj67_39095_c1 | |||
| 1820 | nmdc:mga06r32_10037_c1 | |||
| 1821 | Ga0500618_022833 | |||
| 1822 | Ga0500659_0003758 | |||
| 1823 | Ga0500590_063226 | |||
| 1824 | Ga0587091_000885 | |||
| 1825 | Ga0466962_0050274 | |||
| 1826 | 2501071258 | |||
| 1827 | 2501079474 | |||
| 1828 | 2501414141 | |||
| 1829 | 2508853694 | |||
| 1830 | 2510251514 | |||
| 1831 | 2510280950 | |||
| 1832 | 2510294918 | |||
| 1833 | 2510309097 | |||
| 1834 | 2511093830 | |||
| 1835 | 2511094605 | |||
| 1836 | 2511104309 | |||
| 1837 | 2511256590 | |||
| 1838 | 2511267479 | |||
| 1839 | 2511274242 | |||
| 1840 | 2511279896 | |||
| 1841 | 2511291148 | |||
| 1842 | 2511295712 | |||
| 1843 | 2511301382 | |||
| 1844 | 2511311899 | |||
| 1845 | 2511320563 | |||
| 1846 | 2511329232 | |||
| 1847 | 2511333839 | |||
| 1848 | 2511336549 | |||
| 1849 | 2511346115 | |||
| 1850 | 2511352581 | |||
| 1851 | 2511355749 | |||
| 1852 | 2511362572 | |||
| 1853 | 2511370652 | |||
| 1854 | 2511374378 | |||
| 1855 | 2511414874 | |||
| 1856 | 2511823000 | |||
| 1857 | 2512324297 | |||
| 1858 | 2512345528 | |||
| 1859 | 2515680814 | |||
| 1860 | 2548648378 | |||
| 1861 | 2554813474 | |||
| 1862 | 2555245485 | |||
| 1863 | 2555260051 | |||
| 1864 | 2555671893 | |||
| 1865 | 2583794385 | |||
| 1866 | 2597028884 | |||
| 1867 | 2597859976 | |||
| 1868 | 2597865843 | |||
| 1869 | 2597871655 | |||
| 1870 | 2599328342 | |||
| 1871 | 2599353952 | |||
| 1872 | 2599360367 | |||
| 1873 | 2599366689 | |||
| 1874 | 2599373478 | |||
| 1875 | 2599379060 | |||
| 1876 | 2599385962 | |||
| 1877 | 2599392337 | |||
| 1878 | 2599399813 | |||
| 1879 | 2599404103 | |||
| 1880 | 2599412558 | |||
| 1881 | 2599454514 | |||
| 1882 | 2599460786 | |||
| 1883 | 2599470335 | |||
| 1884 | 2599482804 | |||
| 1885 | 2599489807 | |||
| 1886 | 2599501105 | |||
| 1887 | 2599508322 | |||
| 1888 | 2599515642 | |||
| 1889 | 2599521609 | |||
| 1890 | 2599613930 | |||
| 1891 | 2599736779 | |||
| 1892 | 2599744851 | |||
| 1893 | 2599770823 | |||
| 1894 | 2599803470 | |||
| 1895 | 2599881856 | |||
| 1896 | 2599886702 | |||
| 1897 | 2599895021 | |||
| 1898 | 2599897072 | |||
| 1899 | 2599904997 | |||
| 1900 | 2599934661 | |||
| 1901 | 2599943067 | |||
| 1902 | 2599951630 | |||
| 1903 | 2599953894 | |||
| 1904 | 2599959398 | |||
| 1905 | 2599968080 | |||
| 1906 | 2599974750 | |||
| 1907 | 2599979197 | |||
| 1908 | 2599985363 | |||
| 1909 | 2599987287 | |||
| 1910 | 2599995389 | |||
| 1911 | 2599999884 | |||
| 1912 | 2600008662 | |||
| 1913 | 2600013082 | |||
| 1914 | 2600016593 | |||
| 1915 | 2600025390 | |||
| 1916 | 2600029555 | |||
| 1917 | 2600038105 | |||
| 1918 | 2600041403 | |||
| 1919 | 2600045614 | |||
| 1920 | 2600056176 | |||
| 1921 | 2600058525 | |||
| 1922 | 2600063798 | |||
| 1923 | 2600073575 | |||
| 1924 | 2600079765 | |||
| 1925 | 2600205785 | |||
| 1926 | 2600213401 | |||
| 1927 | 2600358233 | |||
| 1928 | 2600365247 | |||
| 1929 | 2600442503 | |||
| 1930 | 2601524084 | |||
| 1931 | 2601529238 | |||
| 1932 | 2601616072 | |||
| 1933 | 2601620797 | |||
| 1934 | 2601626293 | |||
| 1935 | 2601644139 | |||
| 1936 | 2601649194 | |||
| 1937 | 2601654121 | |||
| 1938 | 2601659543 | |||
| 1939 | 2601663964 | |||
| 1940 | 2601692712 | |||
| 1941 | 2601696921 | |||
| 1942 | 2601701970 | |||
| 1943 | 2601706865 | |||
| 1944 | 2601712184 | |||
| 1945 | 2601717382 | |||
| 1946 | 2601722350 | |||
| 1947 | 2601727310 | |||
| 1948 | 2601732625 | |||
| 1949 | 2601736860 | |||
| 1950 | 2601743197 | |||
| 1951 | 2601753991 | |||
| 1952 | 2601773568 | |||
| 1953 | 2601799773 | |||
| 1954 | 2602012438 | |||
| 1955 | 2602021085 | |||
| 1956 | 2603645613 | |||
| 1957 | 2603662122 | |||
| 1958 | 2603667021 | |||
| 1959 | 2603699522 | |||
| 1960 | 2603705581 | |||
| 1961 | 2603839734 | |||
| 1962 | 2603844808 | |||
| 1963 | 2603850185 | |||
| 1964 | 2603854951 | |||
| 1965 | 2603867699 | |||
| 1966 | 2603872527 | |||
| 1967 | 2603877833 | |||
| 1968 | 2606050014 | |||
| 1969 | 2606071674 | |||
| 1970 | 2606074042 | |||
| 1971 | 2606126313 | |||
| 1972 | 2606147395 | |||
| 1973 | 2606177904 | |||
| 1974 | 2608381351 | |||
| 1975 | 2609909413 | |||
| 1976 | 2621297700 | |||
| 1977 | 2624482585 | |||
| 1978 | 2624494114 | |||
| 1979 | 2637223888 | |||
| 1980 | 2643844212 | |||
| 1981 | 2643860364 | |||
| 1982 | 2643870107 | |||
| 1983 | 2643952348 | |||
| 1984 | 2643979413 | |||
| 1985 | 2644023889 | |||
| 1986 | 2644119901 | |||
| 1987 | 2644188012 | |||
| 1988 | 2644281618 | |||
| 1989 | 2644623372 | |||
| 1990 | 2652543495 | |||
| 1991 | 2671093267 | |||
| 1992 | 2671096536 | |||
| 1993 | 2671105444 | |||
| 1994 | 2671127958 | |||
| 1995 | 2671770962 | |||
| 1996 | 2676405301 | |||
| 1997 | 2676742980 | |||
| 1998 | 2677897997 | |||
| 1999 | 2678261532 | |||
| 2000 | 2681994889 | |||
| 2001 | 2682006633 | |||
| 2002 | 2691329463 | |||
| 2003 | 2707099692 | |||
| 2004 | 2715752086 | |||
| 2005 | 2715755017 | |||
| 2006 | 2718635791 | |||
| 2007 | 2719640628 | |||
| 2008 | 2723250571 | |||
| 2009 | 2723878539 | |||
| 2010 | 2729147796 | |||
| 2011 | 2738670945 | |||
| 2012 | 2738689816 | |||
| 2013 | 2738749339 | |||
| 2014 | 2738811362 | |||
| 2015 | 2738858380 | |||
| 2016 | 2738898722 | |||
| 2017 | 2739198326 | |||
| 2018 | 2739256908 | |||
| 2019 | 2739265590 | |||
| 2020 | 2739286692 | |||
| 2021 | 2739292005 | |||
| 2022 | 2739315509 | |||
| 2023 | 2743739519 | |||
| 2024 | 2745007881 | |||
| 2025 | 2753857113 | |||
| 2026 | 2765582059 | |||
| 2027 | 2765590212 | |||
| 2028 | 2774120659 | |||
| 2029 | 2774132113 | |||
| 2030 | 2774133466 | |||
| 2031 | 2775541105 | |||
| 2032 | 2777023204 | |||
| 2033 | 2784262653 | |||
| 2034 | 2784313505 | |||
| 2035 | 2791922660 | |||
| 2036 | 2793404583 | |||
| 2037 | 2794594334 | |||
| 2038 | 2807178172 | |||
| 2039 | 2807406681 | |||
| 2040 | 2807455013 | |||
| 2041 | 2808854055 | |||
| 2042 | 2808906871 | |||
| 2043 | 2808923346 | |||
| 2044 | 2808930355 | |||
| 2045 | 2808934087 | |||
| 2046 | 2808941092 | |||
| 2047 | 2808945379 | |||
| 2048 | 2808952477 | |||
| 2049 | 2808956716 | |||
| 2050 | 2808962512 | |||
| 2051 | 2808980271 | |||
| 2052 | 2808995906 | |||
| 2053 | 2808997447 | |||
| 2054 | 2809035684 | |||
| 2055 | 2809218466 | |||
| 2056 | 2812370849 | |||
| 2057 | 2817493165 | |||
| 2058 | 2819631303 | |||
| 2059 | 2819656270 | |||
| 2060 | 2819701629 | |||
| 2061 | 2821121250 | |||
| 2062 | 2823375866 | |||
| 2063 | 2823422498 | |||
| 2064 | 2825653769 | |||
| 2065 | 2826584103 | |||
| 2066 | 2834034264 | |||
| 2067 | 2834641795 | |||
| 2068 | 2842809327 | |||
| 2069 | 2842819616 | |||
| 2070 | 2842829794 | |||
| 2071 | 2842837434 | |||
| 2072 | 2842841863 | |||
| 2073 | 2842845229 | |||
| 2074 | 2842849722 | |||
| 2075 | 2842857294 | |||
| 2076 | 2844428556 | |||
| 2077 | 2844666057 | |||
| 2078 | 2852612443 | |||
| 2079 | 2852660676 | |||
| 2080 | 2852669821 | |||
| 2081 | 2854602831 | |||
| 2082 | 2855195876 | |||
| 2083 | 2857539041 | |||
| 2084 | 2858956141 | |||
| 2085 | 2860344422 | |||
| 2086 | 2860872246 | |||
| 2087 | 2863427382 | |||
| 2088 | 2870070850 | |||
| 2089 | 2871286037 | |||
| 2090 | 2878034517 | |||
| 2091 | 2880235159 | |||
| 2092 | 2881414905 | |||
| 2093 | 2884087636 | |||
| 2094 | 2885272972 | |||
| 2095 | 2887632615 | |||
| 2096 | 2888377065 | |||
| 2097 | 2891675323 | |||
| 2098 | 2900053263 | |||
| 2099 | 2900578635 | |||
| 2100 | 2902683732 | |||
| 2101 | 2904517864 | |||
| 2102 | 2904521528 | |||
| 2103 | 2904551079 | |||
| 2104 | 2904570001 | |||
| 2105 | 2904576088 | |||
| 2106 | 2908451759 | |||
| 2107 | 2912964696 | |||
| 2108 | 2913037880 | |||
| 2109 | 2917075765 | |||
| 2110 | 2917835059 | |||
| 2111 | 2919066424 | |||
| 2112 | 2919111175 | |||
| 2113 | 2919128997 | |||
| 2114 | 2919157857 | |||
| 2115 | 2919388588 | |||
| 2116 | 2919459554 | |||
| 2117 | 2919482771 | |||
| 2118 | 2919490090 | |||
| 2119 | 2919500265 | |||
| 2120 | 2919505095 | |||
| 2121 | 2919536168 | |||
| 2122 | 2919689696 | |||
| 2123 | 2919699970 | |||
| 2124 | 2923158604 | |||
| 2125 | 2923524954 | |||
| 2126 | 2923591815 | |||
| 2127 | 2923636110 | |||
| 2128 | 2926066772 | |||
| 2129 | 2927837400 | |||
| 2130 | 2928062907 | |||
| 2131 | 2928162875 | |||
| 2132 | 2928169547 | |||
| 2133 | 2928171565 | |||
| 2134 | 2928542565 | |||
| 2135 | 2929145324 | |||
| 2136 | 2929194370 | |||
| 2137 | 2931371335 | |||
| 2138 | 2931395635 | |||
| 2139 | 2931397203 | |||
| 2140 | 2935356751 | |||
| 2141 | 2937542233 | |||
| 2142 | 2939570205 | |||
| 2143 | 2939575633 | |||
| 2144 | 2939608490 | |||
| 2145 | 2939638156 | |||
| 2146 | 2939642752 | |||
| 2147 | 2939652194 | |||
| 2148 | 2941485633 | |||
| 2149 | 2945876547 | |||
| 2150 | 2945931690 | |||
| 2151 | 2945961328 | |||
| 2152 | 2946007768 | |||
| 2153 | 2946032858 | |||
| 2154 | 2947233621 | |||
| 2155 | 2952253617 | |||
| 2156 | 2969080900 | |||
| 2157 | 2969309305 | |||
| 2158 | 2971822299 | |||
| 2159 | 2974289335 | |||
| 2160 | 2974301145 | |||
| 2161 | 2974310899 | |||
| 2162 | 2981996828 | |||
| 2163 | 2984287572 | |||
| 2164 | 2984503621 | |||
| 2165 | 2984507806 | |||
| 2166 | 2984563361 | |||
| 2167 | 2984596096 | |||
| 2168 | 2988732852 | |||
| 2169 | 2990200661 | |||
| 2170 | 2998144572 | |||
| 2171 | 2998345744 | |||
| 2172 | 3007253782 | |||
| 2173 | 3007317476 | |||
| 2174 | 3007398229 | |||
| 2175 | 3007420652 | |||
| 2176 | 3007512389 | |||
| 2177 | 3007618425 | |||
| 2178 | 3007624384 | |||
| 2179 | 3007723385 | |||
| 2180 | 3007804686 | |||
| 2181 | 3007858451 | |||
| 2182 | 3007866034 | |||
| 2183 | 3007871227 | |||
| 2184 | 3007875943 | |||
| 2185 | 637322300 | |||
| 2186 | 640488986 | |||
| 2187 | 640939178 | |||
| 2188 | 642418897 | |||
| 2189 | 651177075 | |||
| 2190 | 8002748388 | |||
| 2191 | 8003404661 | |||
| 2192 | 8011353517 | |||
| 2193 | 8015692687 | |||
| 2194 | 8016730042 | |||
| 2195 | 8018224362 | |||
| 2196 | 8018409049 | |||
| 2197 | 8018846954 | |||
| 2198 | 8019771672 | |||
| 2199 | 8019776636 | |||
| 2200 | 8020944915 | |||
| 2201 | 8020945492 | |||
| 2202 | 8020957048 | |||
| 2203 | 8021122094 | |||
| 2204 | 8029996307 | |||
| 2205 | 8034964215 | |||
| 2206 | 8039102593 | |||
| 2207 | 8052499089 | |||
| 2208 | 8054286585 | |||
| 2209 | 8054351080 | |||
| 2210 | 8054508153 | |||
| 2211 | 8054852160 | |||
| 2212 | 8054934348 | |||
| 2213 | 8055089880 | |||
| 2214 | 8055095688 | |||
| 2215 | 8055100436 | |||
| 2216 | 8055228240 | |||
| 2217 | 8055775921 | |||
| 2218 | 8055823106 | |||
| 2219 | 8055883451 | |||
| 2220 | 8056120447 | |||
| 2221 | 8056121727 | |||
| 2222 | 8056127055 | |||
| 2223 | 8056136516 | |||
| 2224 | 8056142059 | |||
| 2225 | 8056147951 | |||
| 2226 | 8056153416 | |||
| 2227 | 8056155566 | |||
| 2228 | 8056162793 | |||
| 2229 | 8056172001 | |||
| 2230 | 8056172667 | |||
| 2231 | 8056180604 | |||
| 2232 | 8056574503 | |||
| 2233 | 8057306564 | |||
| 2234 | 8057804775 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7mhv-assembly1.cif.gz_A-2 | crystal structure of cysteine desulfurase nifs from legionella pneumophila philadelphia 1 in complex with pyridoxal 5'-phosphate | 0.9856 | 4 | 382 |
| 1p3w-assembly1.cif.gz_A | x-ray crystal structure of e. coli iscs | 0.9832 | 2 | 389 |
| 3lvj-assembly1.cif.gz_A | crystal structure of e.coli iscs-tusa complex (form 1) | 0.9805 | 1 | 388 |
| 7mhv-assembly1.cif.gz_A-2 | crystal structure of cysteine desulfurase nifs from legionella pneumophila philadelphia 1 in complex with pyridoxal 5'-phosphate | 0.9803 | 4 | 382 |
| 3lvl-assembly1.cif.gz_B-2 | crystal structure of e.coli iscs-iscu complex | 0.9797 | 1 | 389 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3lvjA02 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9881 | 16 | 259 | 3.40.640.10 |
| 3lvmB01 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9777 | 266 | 389 | 3.90.1150.10 |
| af_O61741_269_382_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9742 | 261 | 371 | 3.90.1150.10 |
| 3lvjA02 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9723 | 16 | 259 | 3.40.640.10 |
| af_P87185_350_473_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9713 | 268 | 387 | 3.90.1150.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5J6C683-F1-model_v4 | Putative cysteine desulfurase | 0.9928 | 101 | 219 |
GO:0005739
GO:0005829 GO:0016226 GO:0031071 GO:0046872 GO:0051536 |
| AF-A0A2G2NN41-F1-model_v4 | deleted | 0.9909 | 2 | 183 |
|
| AF-A0A2U3N0P9-F1-model_v4 | Cysteine desulfurase IscS (EC 2.8.1.7) | 0.989 | 1 | 402 |
GO:0005737
GO:0030170 GO:0031071 GO:0044571 GO:0046872 GO:0051537 |
| AF-A0A5J6CA55-F1-model_v4 | Putative cysteine desulfurase | 0.9871 | 129 | 219 |
GO:0005739
GO:0005829 GO:0016226 GO:0031071 GO:0046872 GO:0051536 |
| AF-A0A7R9L7V5-F1-model_v4 | cysteine desulfurase (EC 2.8.1.7) | 0.987 | 6 | 402 |
GO:0030170
GO:0031071 GO:0044571 GO:0046872 GO:0051536 |