F490331

General Info

Members Datasets Scaffolds Average Seq Length
1117 303 2234 189

Family's Representative Sequence

Representative Sequence 3300053083|Ga0495655_0028173|Ga0495655_0028173_114_788
Length 224
Sequence LPIAERDRRQSNQSAIINWNLAMFLVVGLGNPGMEYAQTRHNLGFMLVDKLAGEADISVKRRECQSLIGSGVIEAERVKLVTPQTFMNLSGEAVSCLTSKYEIEATKSLIVISDDLALPFGSIRLRPRGSAGGHNGLKSIIASLGTNEFMRLRVGIQPEHPLSDSKKFVLSEFSREEKRALDEILERSAQAVRSVIGDGIAKAMSLFNSEGQSAKGRGHEGENT

Samples

Sample ID Description Type Environment
1 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001432 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
83 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
89 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
96 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
127 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
194 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
197 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
198 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
199 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
200 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
201 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
202 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
203 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
204 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
205 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
206 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
207 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
208 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
209 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
210 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
211 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
212 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
213 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
214 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
215 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
216 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
217 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
218 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
219 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
220 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
221 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
222 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
223 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
224 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
225 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
226 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
227 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
228 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
229 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
230 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
231 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
232 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
233 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
234 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
235 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
236 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
237 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
238 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
239 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
240 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
241 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
242 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
243 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
244 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
245 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
246 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
247 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
248 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
249 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
250 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
251 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
252 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
253 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
254 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
255 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
256 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
257 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
258 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
259 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
264 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
265 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
266 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
267 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
268 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
269 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
270 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
271 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
272 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
273 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
274 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
275 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
276 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
277 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
278 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
279 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
280 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
281 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
282 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
283 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
284 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
285 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
286 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
287 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
288 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
289 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
290 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
291 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
292 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
293 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
295 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
296 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
297 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
298 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
299 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
300 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
301 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
302 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere
303 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.19
Metatranscriptomes 0.09
Isolates 0.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.27
Nodule 0
Rhizoplane 0.98
Rhizosphere 97.31
Stem 0
Stem Tuber 0
Unclassified 15.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495655_0028173 3300053083 Bacteria 1339
2 MBSR1b_contig_13888860 2162886012 Bacteria 1290
3 MBSR1b_contig_7836939 2162886012 Bacteria 823
4 MBSR1b_contig_9885525 2162886012 Bacteria 1446
5 JGI24034J14986_101222 3300001432 Unclassified 1490
6 JGI24748J21848_1000059 3300002074 Bacteria 45110
7 JGI24034J26672_10000030 3300002239 Bacteria 97515
8 JGI24751J29686_10000094 3300002459 Bacteria 49568
9 JGI25406J46586_10006607 3300003203 Bacteria 5330
10 JGI25406J46586_10013396 3300003203 Unclassified 3524
11 rootL2_10082721 3300003322 Unclassified 2636
12 Ga0065704_10009690 3300005289 Unclassified 2113
13 Ga0065704_10074449 3300005289 Bacteria 6264
14 Ga0065704_10112333 3300005289 Bacteria 1936
15 Ga0065704_10139794 3300005289 Bacteria 1530
16 Ga0065704_10465483 3300005289 Unclassified 693
17 Ga0065712_10101532 3300005290 Bacteria 2031
18 Ga0065712_10130378 3300005290 Bacteria 1557
19 Ga0065715_10002145 3300005293 Bacteria 6344
20 Ga0065715_10005331 3300005293 Bacteria 3207
21 Ga0065715_10011053 3300005293 Bacteria 2737
22 Ga0065715_10023037 3300005293 Unclassified 1327
23 Ga0065715_10133615 3300005293 Bacteria 1969
24 Ga0065715_10165915 3300005293 Bacteria 1587
25 Ga0065715_10172243 3300005293 Unclassified 1538
26 Ga0065715_10199667 3300005293 Bacteria 1364
27 Ga0065707_10096902 3300005295 Bacteria 3213
28 Ga0065707_10097201 3300005295 Bacteria 3196
29 Ga0065707_10101801 3300005295 Bacteria 2844
30 Ga0065707_10116895 3300005295 Bacteria 2224
31 Ga0065707_10189441 3300005295 Bacteria 1370
32 Ga0070676_10014792 3300005328 Bacteria 4293
33 Ga0070676_10069640 3300005328 Bacteria 2109
34 Ga0070683_100239140 3300005329 Unclassified 1727
35 Ga0070683_100545983 3300005329 Bacteria 1108
36 Ga0070690_100006398 3300005330 Bacteria 6673
37 Ga0070690_100009295 3300005330 Bacteria 5691
38 Ga0070690_100026546 3300005330 Bacteria 3574
39 Ga0070690_100091763 3300005330 Unclassified 2002
40 Ga0070690_100194711 3300005330 Bacteria 1407
41 Ga0070690_100906204 3300005330 Unclassified 690
42 Ga0070670_100000266 3300005331 Bacteria 46547
43 Ga0070670_100015660 3300005331 Bacteria 6509
44 Ga0070670_100641021 3300005331 Bacteria 953
45 Ga0070670_100668399 3300005331 Bacteria 933
46 Ga0070670_100684556 3300005331 Bacteria 921
47 Ga0070677_10398845 3300005333 Bacteria 724
48 Ga0070677_10590430 3300005333 Unclassified 614
49 Ga0068869_100006571 3300005334 Bacteria 7377
50 Ga0068869_100024548 3300005334 Bacteria 4175
51 Ga0068869_100089018 3300005334 Bacteria 2318
52 Ga0068869_100502677 3300005334 Bacteria 1012
53 Ga0068869_100638346 3300005334 Bacteria 903
54 Ga0070666_10006766 3300005335 Bacteria 7060
55 Ga0070666_10024479 3300005335 Bacteria 3933
56 Ga0070666_10040447 3300005335 Bacteria 3112
57 Ga0070680_100017772 3300005336 Bacteria 5610
58 Ga0070680_100058398 3300005336 Bacteria 3154
59 Ga0070680_100250231 3300005336 Bacteria 1498
60 Ga0070680_100376428 3300005336 Bacteria 1209
61 Ga0070680_100404011 3300005336 Viruses 1164
62 Ga0070682_100000196 3300005337 Bacteria 45226
63 Ga0070682_100083692 3300005337 Bacteria 2071
64 Ga0070682_100109824 3300005337 Bacteria 1836
65 Ga0070682_100111307 3300005337 Bacteria 1825
66 Ga0068868_100016973 3300005338 Bacteria 5418
67 Ga0068868_100076941 3300005338 Bacteria 2669
68 Ga0068868_100098626 3300005338 Bacteria 2362
69 Ga0068868_100142306 3300005338 Bacteria 1970
70 Ga0068868_100769604 3300005338 Bacteria 866
71 Ga0068868_100876580 3300005338 Unclassified 814
72 Ga0070660_100033881 3300005339 Bacteria 3853
73 Ga0070660_100752707 3300005339 Unclassified 818
74 Ga0070689_100054301 3300005340 Bacteria 3101
75 Ga0070689_100087182 3300005340 Bacteria 2455
76 Ga0070689_100113315 3300005340 Bacteria 2159
77 Ga0070687_100016815 3300005343 Bacteria 3348
78 Ga0070687_100102327 3300005343 Bacteria 1606
79 Ga0070687_100217413 3300005343 Bacteria 1168
80 Ga0070661_100039974 3300005344 Bacteria 3419
81 Ga0070661_100042505 3300005344 Bacteria 3318
82 Ga0070661_100174201 3300005344 Bacteria 1635
83 Ga0070661_100542158 3300005344 Bacteria 935
84 Ga0070692_10315098 3300005345 Bacteria 960
85 Ga0070692_10315740 3300005345 Bacteria 959
86 Ga0070692_10356044 3300005345 Bacteria 911
87 Ga0070668_100209418 3300005347 Unclassified 1603
88 Ga0070669_100000464 3300005353 Bacteria 30717
89 Ga0070669_100021933 3300005353 Bacteria 4567
90 Ga0070669_100074347 3300005353 Bacteria 2519
91 Ga0070669_100232806 3300005353 Bacteria 1461
92 Ga0070669_100410620 3300005353 Bacteria 1109
93 Ga0070669_100427108 3300005353 Bacteria 1088
94 Ga0070675_100236786 3300005354 Bacteria 1594
95 Ga0070675_100242593 3300005354 Unclassified 1575
96 Ga0070675_100481069 3300005354 Bacteria 1117
97 Ga0070675_100568140 3300005354 Bacteria 1027
98 Ga0070675_100793265 3300005354 Bacteria 865
99 Ga0070675_101043219 3300005354 Unclassified 751
100 Ga0070675_101059397 3300005354 Bacteria 745
101 Ga0070671_100018380 3300005355 Bacteria 5678
102 Ga0070671_100055064 3300005355 Bacteria 3308
103 Ga0070671_100061586 3300005355 Bacteria 3125
104 Ga0070671_100110364 3300005355 Bacteria 2310
105 Ga0070671_100185395 3300005355 Unclassified 1763
106 Ga0070671_100369288 3300005355 Bacteria 1225
107 Ga0070671_100377635 3300005355 Bacteria 1211
108 Ga0070671_100381549 3300005355 Unclassified 1204
109 Ga0070674_100153833 3300005356 Bacteria 1738
110 Ga0070674_100208205 3300005356 Bacteria 1514
111 Ga0070673_100145442 3300005364 Bacteria 2003
112 Ga0070673_100259499 3300005364 Bacteria 1518
113 Ga0070673_100367778 3300005364 Unclassified 1280
114 Ga0070673_100375132 3300005364 Bacteria 1267
115 Ga0070673_100387522 3300005364 Bacteria 1247
116 Ga0070673_100411349 3300005364 Bacteria 1211
117 Ga0070673_100414265 3300005364 Bacteria 1207
118 Ga0070673_100421136 3300005364 Unclassified 1197
119 Ga0070659_100033428 3300005366 Bacteria 3994
120 Ga0070659_100059680 3300005366 Unclassified 3012
121 Ga0070659_100415701 3300005366 Bacteria 1137
122 Ga0070667_100144360 3300005367 Bacteria 2086
123 Ga0070667_100677177 3300005367 Bacteria 953
124 Ga0070703_10000162 3300005406 Bacteria 33577
125 Ga0070703_10000306 3300005406 Bacteria 22445
126 Ga0070709_10000033 3300005434 Bacteria 116407
127 Ga0070701_10130721 3300005438 Viruses 1426
128 Ga0070701_10447508 3300005438 Unclassified 828
129 Ga0070701_10558890 3300005438 Bacteria 752
130 Ga0070711_100000074 3300005439 Bacteria 56976
131 Ga0070705_100036474 3300005440 Bacteria 2765
132 Ga0070705_100043051 3300005440 Unclassified 2585
133 Ga0070705_100053116 3300005440 Bacteria 2370
134 Ga0070705_100118388 3300005440 Bacteria 1706
135 Ga0070705_100794932 3300005440 Unclassified 752
136 Ga0070700_100020041 3300005441 Bacteria 3868
137 Ga0070700_100037401 3300005441 Bacteria 2951
138 Ga0070700_100053848 3300005441 Bacteria 2513
139 Ga0070700_100167144 3300005441 Bacteria 1520
140 Ga0070700_100179874 3300005441 Bacteria 1471
141 Ga0070700_100654817 3300005441 Bacteria 830
142 Ga0070700_101023452 3300005441 Bacteria 680
143 Ga0070694_100048440 3300005444 Bacteria 2859
144 Ga0070694_100089749 3300005444 Bacteria 2154
145 Ga0070694_100407549 3300005444 Unclassified 1066
146 Ga0070694_100429967 3300005444 Bacteria 1039
147 Ga0070694_100599636 3300005444 Bacteria 887
148 Ga0070694_100840341 3300005444 Bacteria 755
149 Ga0070708_100003084 3300005445 Bacteria 12954
150 Ga0070708_100050439 3300005445 Unclassified 3685
151 Ga0070708_100187481 3300005445 Bacteria 1935
152 Ga0070708_100774445 3300005445 Bacteria 902
153 Ga0070708_100834475 3300005445 Bacteria 866
154 Ga0070708_101084326 3300005445 Bacteria 750
155 Ga0070678_100010464 3300005456 Bacteria 5670
156 Ga0070678_101224901 3300005456 Bacteria 697
157 Ga0070678_101259911 3300005456 Bacteria 687
158 Ga0070662_100004210 3300005457 Bacteria 9062
159 Ga0070662_100060995 3300005457 Bacteria 2752
160 Ga0070662_100103442 3300005457 Bacteria 2160
161 Ga0070662_100282071 3300005457 Bacteria 1345
162 Ga0070662_100840831 3300005457 Bacteria 781
163 Ga0070681_10003215 3300005458 Bacteria 15224
164 Ga0070681_10008005 3300005458 Bacteria 10347
165 Ga0070681_10018607 3300005458 Bacteria 6946
166 Ga0070681_10022569 3300005458 Bacteria 6320
167 Ga0068867_100013615 3300005459 Bacteria 5760
168 Ga0068867_100052907 3300005459 Bacteria 2998
169 Ga0068867_100293730 3300005459 Bacteria 1337
170 Ga0068867_100578835 3300005459 Bacteria 976
171 Ga0068867_100676692 3300005459 Bacteria 908
172 Ga0070685_10043209 3300005466 Bacteria 2576
173 Ga0070685_10050484 3300005466 Bacteria 2403
174 Ga0070685_10236842 3300005466 Bacteria 1203
175 Ga0070685_10648318 3300005466 Bacteria 765
176 Ga0070685_10685326 3300005466 Bacteria 746
177 Ga0070706_100000616 3300005467 Bacteria 41104
178 Ga0070706_100003564 3300005467 Bacteria 15294
179 Ga0070706_100005484 3300005467 Bacteria 12081
180 Ga0070706_100017375 3300005467 Bacteria 6637
181 Ga0070706_100027728 3300005467 Bacteria 5209
182 Ga0070706_100041808 3300005467 Bacteria 4233
183 Ga0070706_100050912 3300005467 Bacteria 3822
184 Ga0070706_100106393 3300005467 Bacteria 2610
185 Ga0070706_100775803 3300005467 Unclassified 888
186 Ga0070707_100000369 3300005468 Bacteria 44505
187 Ga0070707_100028858 3300005468 Bacteria 5280
188 Ga0070707_100031840 3300005468 Bacteria 5024
189 Ga0070707_100118758 3300005468 Bacteria 2567
190 Ga0070707_100132575 3300005468 Bacteria 2423
191 Ga0070707_100166572 3300005468 Bacteria 2148
192 Ga0070707_100167719 3300005468 Bacteria 2140
193 Ga0070707_100195045 3300005468 Bacteria 1975
194 Ga0070707_100570179 3300005468 Bacteria 1094
195 Ga0070707_100693568 3300005468 Unclassified 981
196 Ga0070698_100000436 3300005471 Bacteria 44213
197 Ga0070698_100006378 3300005471 Bacteria 12808
198 Ga0070698_100037875 3300005471 Bacteria 4971
199 Ga0070698_100352446 3300005471 Bacteria 1403
200 Ga0070698_100401129 3300005471 Bacteria 1305
201 Ga0070698_100454955 3300005471 Bacteria 1216
202 Ga0070698_100476877 3300005471 Bacteria 1184
203 Ga0070699_100030512 3300005518 Bacteria 4654
204 Ga0070699_100057878 3300005518 Unclassified 3356
205 Ga0070699_100083146 3300005518 Bacteria 2792
206 Ga0070699_100173234 3300005518 Bacteria 1913
207 Ga0070679_100008884 3300005530 Bacteria 9483
208 Ga0070679_100018823 3300005530 Bacteria 6705
209 Ga0070679_100112613 3300005530 Bacteria 2707
210 Ga0070684_100437797 3300005535 Bacteria 1208
211 Ga0070684_100751954 3300005535 Bacteria 910
212 Ga0070697_100002610 3300005536 Bacteria 13870
213 Ga0070697_100005378 3300005536 Bacteria 9852
214 Ga0070697_100009481 3300005536 Bacteria 7608
215 Ga0070697_100014681 3300005536 Bacteria 6150
216 Ga0070697_100028510 3300005536 Bacteria 4471
217 Ga0070697_100061962 3300005536 Bacteria 3051
218 Ga0070697_100149322 3300005536 Unclassified 1969
219 Ga0070697_100310356 3300005536 Bacteria 1357
220 Ga0070697_100756483 3300005536 Bacteria 859
221 Ga0070697_100863184 3300005536 Unclassified 802
222 Ga0068853_100012328 3300005539 Bacteria 6954
223 Ga0068853_100021622 3300005539 Bacteria 5366
224 Ga0068853_100052934 3300005539 Bacteria 3496
225 Ga0068853_100240165 3300005539 Unclassified 1660
226 Ga0068853_100467850 3300005539 Bacteria 1187
227 Ga0068853_100620190 3300005539 Bacteria 1028
228 Ga0068853_101310101 3300005539 Bacteria 700
229 Ga0070672_100250044 3300005543 Bacteria 1493
230 Ga0070672_100359517 3300005543 Bacteria 1242
231 Ga0070672_100443700 3300005543 Bacteria 1117
232 Ga0070672_100501319 3300005543 Bacteria 1050
233 Ga0070686_100002438 3300005544 Bacteria 10251
234 Ga0070686_100012045 3300005544 Unclassified 4918
235 Ga0070686_100020799 3300005544 Bacteria 3889
236 Ga0070686_100029389 3300005544 Bacteria 3343
237 Ga0070686_100036476 3300005544 Bacteria 3044
238 Ga0070686_100284770 3300005544 Viruses 1220
239 Ga0070686_100443669 3300005544 Unclassified 996
240 Ga0070686_100518211 3300005544 Bacteria 928
241 Ga0070686_100780842 3300005544 Unclassified 768
242 Ga0070695_100037285 3300005545 Bacteria 3063
243 Ga0070695_100094837 3300005545 Bacteria 1999
244 Ga0070695_100133114 3300005545 Bacteria 1716
245 Ga0070695_100321934 3300005545 Bacteria 1150
246 Ga0070695_100385731 3300005545 Bacteria 1058
247 Ga0070695_100767422 3300005545 Bacteria 770
248 Ga0070696_100028804 3300005546 Bacteria 3790
249 Ga0070696_100044840 3300005546 Bacteria 3062
250 Ga0070696_100072312 3300005546 Bacteria 2429
251 Ga0070696_100106319 3300005546 Unclassified 2017
252 Ga0070696_100147083 3300005546 Bacteria 1727
253 Ga0070696_100164348 3300005546 Viruses 1637
254 Ga0070696_100206724 3300005546 Bacteria 1468
255 Ga0070696_100406323 3300005546 Unclassified 1066
256 Ga0070696_100407900 3300005546 Unclassified 1064
257 Ga0070696_101076287 3300005546 Unclassified 675
258 Ga0070693_100005819 3300005547 Bacteria 5955
259 Ga0070693_100229728 3300005547 Bacteria 1220
260 Ga0070693_100379264 3300005547 Bacteria 975
261 Ga0070693_100641565 3300005547 Unclassified 771
262 Ga0070704_100017584 3300005549 Bacteria 4550
263 Ga0070704_100043252 3300005549 Bacteria 3122
264 Ga0070704_100180565 3300005549 Bacteria 1687
265 Ga0070704_100251034 3300005549 Bacteria 1453
266 Ga0070704_100461238 3300005549 Unclassified 1096
267 Ga0070704_100833988 3300005549 Unclassified 826
268 Ga0070704_100869971 3300005549 Unclassified 809
269 Ga0068855_100021673 3300005563 Bacteria 7707
270 Ga0068855_101038839 3300005563 Bacteria 859
271 Ga0070664_100018563 3300005564 Bacteria 5716
272 Ga0070664_100024631 3300005564 Bacteria 4980
273 Ga0070664_100089587 3300005564 Bacteria 2662
274 Ga0070664_100794796 3300005564 Unclassified 884
275 Ga0068857_100013719 3300005577 Bacteria 7062
276 Ga0068857_100058228 3300005577 Bacteria 3430
277 Ga0068857_100082459 3300005577 Bacteria 2872
278 Ga0068857_100088537 3300005577 Bacteria 2770
279 Ga0068857_100119591 3300005577 Bacteria 2371
280 Ga0068854_100076538 3300005578 Bacteria 2459
281 Ga0068854_100171009 3300005578 Bacteria 1691
282 Ga0068854_100200050 3300005578 Unclassified 1570
283 Ga0068854_100286428 3300005578 Viruses 1328
284 Ga0068854_100340009 3300005578 Bacteria 1225
285 Ga0068854_100706027 3300005578 Unclassified 871
286 Ga0068854_100943693 3300005578 Bacteria 761
287 Ga0068854_101086304 3300005578 Unclassified 712
288 Ga0068856_100163553 3300005614 Bacteria 2237
289 Ga0070702_100019884 3300005615 Bacteria 3510
290 Ga0070702_100080257 3300005615 Bacteria 1952
291 Ga0070702_100091969 3300005615 Bacteria 1842
292 Ga0070702_100201819 3300005615 Bacteria 1317
293 Ga0070702_100634436 3300005615 Unclassified 806
294 Ga0068852_100021882 3300005616 Bacteria 5116
295 Ga0068852_100033414 3300005616 Bacteria 4270
296 Ga0068852_100078908 3300005616 Unclassified 2914
297 Ga0068852_100302886 3300005616 Bacteria 1547
298 Ga0068852_101151718 3300005616 Archaea 796
299 Ga0068852_101524079 3300005616 Unclassified 691
300 Ga0068859_100003936 3300005617 Bacteria 15167
301 Ga0068859_100016804 3300005617 Bacteria 7347
302 Ga0068859_100032278 3300005617 Bacteria 5260
303 Ga0068859_100033421 3300005617 Bacteria 5164
304 Ga0068859_100035396 3300005617 Bacteria 5010
305 Ga0068859_100036037 3300005617 Bacteria 4965
306 Ga0068859_100084756 3300005617 Bacteria 3214
307 Ga0068859_100113680 3300005617 Bacteria 2771
308 Ga0068859_100148654 3300005617 Bacteria 2418
309 Ga0068859_100176647 3300005617 Bacteria 2217
310 Ga0068859_100178152 3300005617 Unclassified 2208
311 Ga0068859_100239172 3300005617 Bacteria 1904
312 Ga0068859_100267802 3300005617 Bacteria 1800
313 Ga0068859_100273411 3300005617 Bacteria 1782
314 Ga0068859_100326067 3300005617 Bacteria 1629
315 Ga0068859_100427399 3300005617 Bacteria 1421
316 Ga0068859_100845230 3300005617 Bacteria 1001
317 Ga0068859_100965177 3300005617 Bacteria 935
318 Ga0068864_100027093 3300005618 Bacteria 4836
319 Ga0068864_100098518 3300005618 Bacteria 2589
320 Ga0068864_100098955 3300005618 Bacteria 2583
321 Ga0068864_100108597 3300005618 Bacteria 2469
322 Ga0068864_100238180 3300005618 Unclassified 1685
323 Ga0068864_100288296 3300005618 Bacteria 1534
324 Ga0068864_100457929 3300005618 Bacteria 1221
325 Ga0068864_100462266 3300005618 Unclassified 1215
326 Ga0068864_100592906 3300005618 Unclassified 1075
327 Ga0068864_100618043 3300005618 Bacteria 1053
328 Ga0068864_101288609 3300005618 Bacteria 731
329 Ga0068866_10003617 3300005718 Bacteria 6334
330 Ga0068866_10023562 3300005718 Bacteria 2866
331 Ga0068861_100004206 3300005719 Bacteria 9658
332 Ga0068861_100069961 3300005719 Bacteria 2716
333 Ga0068861_100124417 3300005719 Bacteria 2084
334 Ga0068861_100156818 3300005719 Bacteria 1874
335 Ga0068861_100267426 3300005719 Viruses 1467
336 Ga0068861_100631127 3300005719 Unclassified 987
337 Ga0068861_101480721 3300005719 Unclassified 665
338 Ga0068851_10079636 3300005834 Unclassified 1709
339 Ga0068870_10178679 3300005840 Bacteria 1272
340 Ga0068870_10633988 3300005840 Bacteria 730
341 Ga0068863_100015038 3300005841 Bacteria 7435
342 Ga0068863_100060130 3300005841 Bacteria 3593
343 Ga0068863_100100560 3300005841 Bacteria 2748
344 Ga0068863_100137253 3300005841 Bacteria 2337
345 Ga0068863_100195442 3300005841 Unclassified 1945
346 Ga0068863_100226574 3300005841 Unclassified 1802
347 Ga0068863_100812396 3300005841 Bacteria 933
348 Ga0068863_101120850 3300005841 Bacteria 792
349 Ga0068858_100000550 3300005842 Bacteria 39088
350 Ga0068858_100062360 3300005842 Bacteria 3447
351 Ga0068858_100065287 3300005842 Bacteria 3367
352 Ga0068858_100078155 3300005842 Bacteria 3075
353 Ga0068858_100085634 3300005842 Bacteria 2932
354 Ga0068858_100089587 3300005842 Unclassified 2863
355 Ga0068858_100164767 3300005842 Bacteria 2088
356 Ga0068858_100434737 3300005842 Bacteria 1263
357 Ga0068858_100761777 3300005842 Bacteria 943
358 Ga0068860_100018907 3300005843 Bacteria 6694
359 Ga0068860_100023710 3300005843 Bacteria 5932
360 Ga0068860_100025205 3300005843 Bacteria 5739
361 Ga0068860_100025329 3300005843 Bacteria 5725
362 Ga0068860_100065017 3300005843 Unclassified 3464
363 Ga0068860_100069839 3300005843 Bacteria 3339
364 Ga0068860_100391542 3300005843 Bacteria 1373
365 Ga0068862_100011189 3300005844 Bacteria 7410
366 Ga0068862_100023761 3300005844 Bacteria 5139
367 Ga0068862_100126074 3300005844 Bacteria 2260
368 Ga0068862_100225431 3300005844 Bacteria 1698
369 Ga0068862_100255547 3300005844 Bacteria 1598
370 Ga0068862_100459746 3300005844 Bacteria 1201
371 Ga0068862_100721092 3300005844 Bacteria 967
372 Ga0068862_100937126 3300005844 Unclassified 853
373 Ga0081455_10018342 3300005937 Bacteria 6670
374 Ga0081539_10000156 3300005985 Bacteria 158871
375 Ga0081539_10000407 3300005985 Bacteria 91696
376 Ga0081539_10000814 3300005985 Bacteria 60530
377 Ga0081539_10040320 3300005985 Bacteria 2742
378 Ga0081539_10066966 3300005985 Bacteria 1944
379 Ga0081539_10095621 3300005985 Bacteria 1526
380 Ga0070715_10000005 3300006163 Bacteria 298716
381 Ga0070716_100000009 3300006173 Bacteria 173295
382 Ga0070716_100153502 3300006173 Unclassified 1484
383 Ga0070716_100784350 3300006173 Unclassified 736
384 Ga0070712_100217623 3300006175 Bacteria 1510
385 Ga0097621_100006349 3300006237 Bacteria 8388
386 Ga0097621_100130817 3300006237 Unclassified 2136
387 Ga0097621_100896237 3300006237 Unclassified 826
388 Ga0068871_100005485 3300006358 Bacteria 8897
389 Ga0068871_100027051 3300006358 Bacteria 4482
390 Ga0068871_100027978 3300006358 Bacteria 4415
391 Ga0068871_100848575 3300006358 Unclassified 844
392 Ga0075428_100006095 3300006844 Bacteria 13408
393 Ga0075428_100085219 3300006844 Bacteria 3446
394 Ga0075428_100216879 3300006844 Bacteria 2067
395 Ga0075431_100069437 3300006847 Bacteria 3635
396 Ga0075431_100092692 3300006847 Bacteria 3118
397 Ga0075431_100141094 3300006847 Bacteria 2483
398 Ga0075431_100172741 3300006847 Bacteria 2220
399 Ga0075431_100525588 3300006847 Bacteria 1172
400 Ga0075433_10001603 3300006852 Bacteria 16763
401 Ga0075433_10034538 3300006852 Bacteria 4344
402 Ga0075433_10079937 3300006852 Bacteria 2881
403 Ga0075433_10115518 3300006852 Bacteria 2381
404 Ga0075433_10224191 3300006852 Unclassified 1669
405 Ga0075433_10232838 3300006852 Bacteria 1636
406 Ga0075433_10286903 3300006852 Bacteria 1458
407 Ga0075434_100033930 3300006871 Bacteria 5039
408 Ga0075434_100038061 3300006871 Bacteria 4764
409 Ga0075434_100071362 3300006871 Bacteria 3464
410 Ga0075434_100129929 3300006871 Bacteria 2537
411 Ga0075434_100484461 3300006871 Bacteria 1258
412 Ga0075434_100532346 3300006871 Bacteria 1195
413 Ga0075434_101497449 3300006871 Unclassified 684
414 Ga0075429_100102565 3300006880 Unclassified 2498
415 Ga0075429_100194350 3300006880 Bacteria 1777
416 Ga0068865_100328575 3300006881 Unclassified 1232
417 Ga0068865_100425941 3300006881 Unclassified 1092
418 Ga0068865_100573168 3300006881 Bacteria 951
419 Ga0068865_100926418 3300006881 Bacteria 759
420 Ga0075436_100000014 3300006914 Bacteria 175616
421 Ga0075436_100006651 3300006914 Bacteria 7918
422 Ga0075436_100288987 3300006914 Bacteria 1173
423 Ga0097620_100003936 3300006931 Bacteria 15167
424 Ga0097620_100016804 3300006931 Bacteria 7347
425 Ga0097620_100032279 3300006931 Bacteria 5260
426 Ga0097620_100033421 3300006931 Bacteria 5164
427 Ga0097620_100035396 3300006931 Bacteria 5010
428 Ga0097620_100036037 3300006931 Bacteria 4965
429 Ga0097620_100084762 3300006931 Bacteria 3214
430 Ga0097620_100113687 3300006931 Bacteria 2771
431 Ga0097620_100148645 3300006931 Bacteria 2418
432 Ga0097620_100176647 3300006931 Bacteria 2217
433 Ga0097620_100178149 3300006931 Unclassified 2208
434 Ga0097620_100239155 3300006931 Bacteria 1904
435 Ga0097620_100267809 3300006931 Bacteria 1800
436 Ga0097620_100273422 3300006931 Bacteria 1782
437 Ga0097620_100326078 3300006931 Bacteria 1629
438 Ga0097620_100363959 3300006931 Bacteria 1541
439 Ga0097620_100427441 3300006931 Bacteria 1421
440 Ga0097620_100845259 3300006931 Bacteria 1001
441 Ga0097620_100965198 3300006931 Bacteria 935
442 Ga0075435_100058947 3300007076 Unclassified 3111
443 Ga0075435_100066763 3300007076 Bacteria 2928
444 Ga0075435_100126441 3300007076 Bacteria 2137
445 Ga0075435_100140478 3300007076 Unclassified 2026
446 Ga0105250_10021457 3300009092 Unclassified 2606
447 Ga0105240_10039745 3300009093 Bacteria 6021
448 Ga0111539_10011415 3300009094 Bacteria 11150
449 Ga0111539_10016840 3300009094 Bacteria 9053
450 Ga0111539_10036774 3300009094 Bacteria 5916
451 Ga0111539_10147927 3300009094 Bacteria 2750
452 Ga0111539_11174376 3300009094 Bacteria 892
453 Ga0111539_11713605 3300009094 Unclassified 729
454 Ga0105245_10022955 3300009098 Bacteria 5474
455 Ga0105245_10206465 3300009098 Unclassified 1889
456 Ga0105245_10835476 3300009098 Bacteria 960
457 Ga0105245_11034047 3300009098 Bacteria 866
458 Ga0105245_11521695 3300009098 Unclassified 720
459 Ga0105245_11846908 3300009098 Unclassified 657
460 Ga0105247_10000552 3300009101 Bacteria 30429
461 Ga0105247_10012888 3300009101 Bacteria 5017
462 Ga0105247_10131798 3300009101 Bacteria 1630
463 Ga0114129_10014602 3300009147 Bacteria 11190
464 Ga0114129_10019404 3300009147 Bacteria 9683
465 Ga0114129_10031530 3300009147 Bacteria 7491
466 Ga0114129_10065817 3300009147 Bacteria 5057
467 Ga0114129_10094667 3300009147 Bacteria 4137
468 Ga0114129_10112398 3300009147 Bacteria 3756
469 Ga0114129_10165050 3300009147 Bacteria 3023
470 Ga0114129_10249606 3300009147 Bacteria 2383
471 Ga0114129_10378676 3300009147 Bacteria 1869
472 Ga0114129_10666885 3300009147 Unclassified 1340
473 Ga0114129_11819388 3300009147 Bacteria 740
474 Ga0105243_10000439 3300009148 Bacteria 43420
475 Ga0105243_10000652 3300009148 Bacteria 34357
476 Ga0105243_10011188 3300009148 Bacteria 6787
477 Ga0105243_10030507 3300009148 Bacteria 4151
478 Ga0105243_10085848 3300009148 Bacteria 2580
479 Ga0105243_10131049 3300009148 Unclassified 2127
480 Ga0105243_10447053 3300009148 Bacteria 1212
481 Ga0105243_10460094 3300009148 Bacteria 1196
482 Ga0105243_10544121 3300009148 Unclassified 1108
483 Ga0105241_10032278 3300009174 Bacteria 3925
484 Ga0105241_10056380 3300009174 Bacteria 3012
485 Ga0105241_10170754 3300009174 Bacteria 1796
486 Ga0105241_10967675 3300009174 Bacteria 794
487 Ga0105242_10000121 3300009176 Bacteria 57323
488 Ga0105242_10001024 3300009176 Bacteria 21984
489 Ga0105242_10002128 3300009176 Bacteria 15622
490 Ga0105242_10006525 3300009176 Bacteria 8978
491 Ga0105242_10015351 3300009176 Bacteria 5948
492 Ga0105242_10031170 3300009176 Bacteria 4255
493 Ga0105242_10095882 3300009176 Bacteria 2505
494 Ga0105242_10262007 3300009176 Bacteria 1562
495 Ga0105242_10425467 3300009176 Bacteria 1245
496 Ga0105242_10733529 3300009176 Bacteria 970
497 Ga0105248_10022758 3300009177 Bacteria 6954
498 Ga0105248_10092972 3300009177 Bacteria 3396
499 Ga0105248_10110231 3300009177 Bacteria 3103
500 Ga0105248_10129637 3300009177 Bacteria 2845
501 Ga0105248_10201614 3300009177 Bacteria 2242
502 Ga0105248_10207159 3300009177 Bacteria 2209
503 Ga0105248_10253052 3300009177 Bacteria 1982
504 Ga0105248_10283674 3300009177 Unclassified 1864
505 Ga0105248_10425763 3300009177 Bacteria 1495
506 Ga0105248_10459662 3300009177 Unclassified 1435
507 Ga0105248_10985482 3300009177 Bacteria 952
508 Ga0105237_10009532 3300009545 Bacteria 10397
509 Ga0105237_10029312 3300009545 Bacteria 5596
510 Ga0105238_10099060 3300009551 Bacteria 2898
511 Ga0105238_11741054 3300009551 Bacteria 655
512 Ga0105249_10000112 3300009553 Bacteria 108891
513 Ga0105249_10009689 3300009553 Bacteria 8441
514 Ga0105249_10025340 3300009553 Bacteria 5338
515 Ga0105249_10115176 3300009553 Bacteria 2546
516 Ga0105249_10169047 3300009553 Bacteria 2119
517 Ga0105249_10190186 3300009553 Bacteria 2003
518 Ga0105249_10251682 3300009553 Bacteria 1752
519 Ga0105249_10270437 3300009553 Bacteria 1693
520 Ga0105249_10314002 3300009553 Bacteria 1577
521 Ga0105249_11787431 3300009553 Bacteria 687
522 Ga0105239_10054463 3300010375 Bacteria 4388
523 Ga0105239_10652702 3300010375 Bacteria 1202
524 Ga0105239_11353832 3300010375 Bacteria 821
525 Ga0105246_10395030 3300011119 Bacteria 1147
526 Ga0105246_10535343 3300011119 Bacteria 1001
527 Ga0105246_10589836 3300011119 Bacteria 958
528 Ga0105246_10785144 3300011119 Unclassified 843
529 Ga0157373_10380906 3300013100 Bacteria 1009
530 Ga0157371_10099894 3300013102 Bacteria 2058
531 Ga0157371_10368779 3300013102 Bacteria 1047
532 Ga0157370_10137628 3300013104 Bacteria 2275
533 Ga0157369_10019613 3300013105 Bacteria 7567
534 Ga0157369_10028601 3300013105 Bacteria 6168
535 Ga0157374_10014469 3300013296 Bacteria 6904
536 Ga0157374_10079809 3300013296 Bacteria 3101
537 Ga0157374_10145556 3300013296 Bacteria 2301
538 Ga0157378_10000002 3300013297 Bacteria 222652
539 Ga0157378_10002032 3300013297 Bacteria 18119
540 Ga0157378_10002886 3300013297 Bacteria 15303
541 Ga0157378_10014879 3300013297 Bacteria 6808
542 Ga0157378_10021074 3300013297 Bacteria 5734
543 Ga0157378_10063645 3300013297 Bacteria 3296
544 Ga0157378_10074678 3300013297 Bacteria 3051
545 Ga0157378_10076538 3300013297 Bacteria 3015
546 Ga0157378_10091122 3300013297 Bacteria 2771
547 Ga0157378_10212944 3300013297 Bacteria 1833
548 Ga0157378_10306686 3300013297 Unclassified 1538
549 Ga0157378_10410939 3300013297 Bacteria 1336
550 Ga0157378_10949201 3300013297 Bacteria 893
551 Ga0157378_10964773 3300013297 Unclassified 886
552 Ga0163162_10000055 3300013306 Bacteria 109443
553 Ga0163162_10004296 3300013306 Bacteria 13710
554 Ga0163162_10020538 3300013306 Bacteria 6488
555 Ga0163162_10022268 3300013306 Bacteria 6246
556 Ga0163162_10025673 3300013306 Bacteria 5824
557 Ga0163162_10032007 3300013306 Bacteria 5220
558 Ga0163162_10051851 3300013306 Unclassified 4118
559 Ga0163162_10131366 3300013306 Bacteria 2613
560 Ga0163162_10133100 3300013306 Bacteria 2596
561 Ga0163162_10153220 3300013306 Bacteria 2423
562 Ga0163162_10269701 3300013306 Bacteria 1833
563 Ga0163162_10345028 3300013306 Bacteria 1621
564 Ga0163162_10430095 3300013306 Bacteria 1452
565 Ga0163162_10872795 3300013306 Unclassified 1014
566 Ga0157372_10021317 3300013307 Bacteria 7000
567 Ga0157372_10231045 3300013307 Unclassified 2144
568 Ga0157372_11375707 3300013307 Unclassified 814
569 Ga0157375_10004522 3300013308 Bacteria 12085
570 Ga0157375_10015339 3300013308 Bacteria 6856
571 Ga0157375_10048745 3300013308 Bacteria 4145
572 Ga0157375_10213273 3300013308 Bacteria 2088
573 Ga0157375_10223894 3300013308 Bacteria 2040
574 Ga0157375_10245088 3300013308 Bacteria 1952
575 Ga0157375_10288798 3300013308 Bacteria 1803
576 Ga0157375_10347941 3300013308 Bacteria 1648
577 Ga0157375_10491073 3300013308 Bacteria 1392
578 Ga0157375_10500035 3300013308 Bacteria 1380
579 Ga0157375_10515304 3300013308 Unclassified 1359
580 Ga0157375_10537387 3300013308 Bacteria 1331
581 Ga0157375_10600028 3300013308 Unclassified 1260
582 Ga0157375_10685230 3300013308 Bacteria 1179
583 Ga0157375_11043285 3300013308 Bacteria 955
584 Ga0157375_11484771 3300013308 Unclassified 800
585 Ga0157375_11784949 3300013308 Bacteria 729
586 Ga0163163_10000810 3300014325 Bacteria 26570
587 Ga0163163_10015453 3300014325 Bacteria 7059
588 Ga0163163_10039285 3300014325 Bacteria 4619
589 Ga0163163_10085112 3300014325 Bacteria 3169
590 Ga0163163_10176619 3300014325 Bacteria 2182
591 Ga0163163_10334967 3300014325 Bacteria 1568
592 Ga0163163_10370990 3300014325 Bacteria 1488
593 Ga0163163_10421986 3300014325 Bacteria 1393
594 Ga0163163_10529883 3300014325 Bacteria 1240
595 Ga0163163_10560548 3300014325 Bacteria 1205
596 Ga0157380_10000923 3300014326 Bacteria 18517
597 Ga0157380_10003564 3300014326 Bacteria 10701
598 Ga0157380_10023746 3300014326 Unclassified 4629
599 Ga0157380_10030693 3300014326 Bacteria 4118
600 Ga0157380_10057237 3300014326 Bacteria 3103
601 Ga0157380_10063114 3300014326 Bacteria 2970
602 Ga0157380_10103684 3300014326 Bacteria 2374
603 Ga0157380_10136741 3300014326 Unclassified 2099
604 Ga0157380_10142438 3300014326 Unclassified 2061
605 Ga0157380_10152811 3300014326 Bacteria 1998
606 Ga0157380_10393180 3300014326 Bacteria 1313
607 Ga0157380_10798518 3300014326 Bacteria 960
608 Ga0157380_10888298 3300014326 Bacteria 916
609 Ga0157380_11482376 3300014326 Unclassified 731
610 Ga0157377_10053572 3300014745 Bacteria 2281
611 Ga0157377_10083836 3300014745 Unclassified 1868
612 Ga0157377_10098546 3300014745 Bacteria 1737
613 Ga0157377_10152151 3300014745 Bacteria 1431
614 Ga0157377_10293858 3300014745 Bacteria 1070
615 Ga0157377_10985874 3300014745 Bacteria 637
616 Ga0157379_10061719 3300014968 Bacteria 3352
617 Ga0157379_10121127 3300014968 Unclassified 2353
618 Ga0157379_10938360 3300014968 Bacteria 822
619 Ga0157376_10019475 3300014969 Bacteria 5232
620 Ga0157376_10106216 3300014969 Bacteria 2463
621 Ga0157376_10273457 3300014969 Bacteria 1588
622 Ga0157376_11304065 3300014969 Bacteria 756
623 Ga0163161_10007020 3300017792 Bacteria 7791
624 Ga0163161_10008921 3300017792 Bacteria 6931
625 Ga0163161_10030117 3300017792 Bacteria 3860
626 Ga0163161_10039883 3300017792 Bacteria 3372
627 Ga0163161_10322977 3300017792 Unclassified 1221
628 Ga0213876_10000156 3300021384 Bacteria 71972
629 Ga0213876_10000219 3300021384 Bacteria 57264
630 Ga0213876_10055195 3300021384 Bacteria 2097
631 Ga0207672_1000510 3300025223 Bacteria 4817
632 Ga0209455_1018310 3300025272 Bacteria 1442
633 Ga0207697_10005034 3300025315 Bacteria 6197
634 Ga0207656_10131851 3300025321 Unclassified 1171
635 Ga0207656_10150954 3300025321 Bacteria 1100
636 Ga0207653_10000027 3300025885 Bacteria 113830
637 Ga0207653_10000128 3300025885 Bacteria 54083
638 Ga0207642_10009418 3300025899 Bacteria 3396
639 Ga0207710_10000001 3300025900 Bacteria 1797433
640 Ga0207710_10046532 3300025900 Bacteria 1937
641 Ga0207688_10079050 3300025901 Bacteria 1875
642 Ga0207688_10166601 3300025901 Bacteria 1309
643 Ga0207688_10208753 3300025901 Bacteria 1173
644 Ga0207680_10057550 3300025903 Bacteria 2352
645 Ga0207680_10116622 3300025903 Bacteria 1740
646 Ga0207680_10212025 3300025903 Unclassified 1324
647 Ga0207647_10156244 3300025904 Bacteria 1332
648 Ga0207647_10202521 3300025904 Bacteria 1148
649 Ga0207685_10000020 3300025905 Bacteria 138584
650 Ga0207699_10000002 3300025906 Bacteria 662194
651 Ga0207699_10299535 3300025906 Unclassified 1122
652 Ga0207645_10032087 3300025907 Bacteria 3377
653 Ga0207645_10131865 3300025907 Bacteria 1626
654 Ga0207645_10495844 3300025907 Unclassified 827
655 Ga0207645_10614670 3300025907 Unclassified 738
656 Ga0207643_10283854 3300025908 Bacteria 1027
657 Ga0207684_10000172 3300025910 Bacteria 106888
658 Ga0207684_10000278 3300025910 Bacteria 75068
659 Ga0207684_10014539 3300025910 Bacteria 6781
660 Ga0207684_10016664 3300025910 Bacteria 6310
661 Ga0207684_10061582 3300025910 Bacteria 3187
662 Ga0207684_10108764 3300025910 Bacteria 2372
663 Ga0207684_10275169 3300025910 Bacteria 1452
664 Ga0207654_10017901 3300025911 Bacteria 3712
665 Ga0207654_10341015 3300025911 Bacteria 1029
666 Ga0207707_10001199 3300025912 Bacteria 24407
667 Ga0207707_10032685 3300025912 Bacteria 4554
668 Ga0207707_10201316 3300025912 Bacteria 1736
669 Ga0207695_10460123 3300025913 Bacteria 1155
670 Ga0207671_10022023 3300025914 Bacteria 4825
671 Ga0207671_10454843 3300025914 Bacteria 1020
672 Ga0207671_10680088 3300025914 Bacteria 819
673 Ga0207663_10000378 3300025916 Bacteria 19435
674 Ga0207660_10039611 3300025917 Bacteria 3295
675 Ga0207660_10062716 3300025917 Bacteria 2678
676 Ga0207660_10081737 3300025917 Bacteria 2375
677 Ga0207660_10486569 3300025917 Bacteria 1000
678 Ga0207660_10566556 3300025917 Bacteria 924
679 Ga0207662_10038932 3300025918 Bacteria 2787
680 Ga0207662_10111707 3300025918 Unclassified 1705
681 Ga0207662_10226097 3300025918 Unclassified 1220
682 Ga0207662_10837205 3300025918 Unclassified 650
683 Ga0207657_10039767 3300025919 Bacteria 4175
684 Ga0207657_10153911 3300025919 Bacteria 1871
685 Ga0207649_10030401 3300025920 Bacteria 3198
686 Ga0207649_10136017 3300025920 Bacteria 1675
687 Ga0207652_10064351 3300025921 Bacteria 3173
688 Ga0207652_10080291 3300025921 Bacteria 2851
689 Ga0207652_10191538 3300025921 Bacteria 1839
690 Ga0207646_10000526 3300025922 Bacteria 51002
691 Ga0207646_10006822 3300025922 Bacteria 11743
692 Ga0207646_10100620 3300025922 Bacteria 2591
693 Ga0207646_10173093 3300025922 Bacteria 1949
694 Ga0207646_10201312 3300025922 Bacteria 1799
695 Ga0207646_10204459 3300025922 Bacteria 1784
696 Ga0207646_10209409 3300025922 Bacteria 1761
697 Ga0207646_10252178 3300025922 Unclassified 1594
698 Ga0207646_10258532 3300025922 Bacteria 1574
699 Ga0207646_10805982 3300025922 Unclassified 836
700 Ga0207681_10001298 3300025923 Bacteria 16120
701 Ga0207681_10024112 3300025923 Bacteria 3901
702 Ga0207681_10039019 3300025923 Bacteria 3150
703 Ga0207681_10049312 3300025923 Bacteria 2846
704 Ga0207681_10194576 3300025923 Bacteria 1554
705 Ga0207681_10530021 3300025923 Bacteria 967
706 Ga0207681_10541064 3300025923 Bacteria 958
707 Ga0207694_10013071 3300025924 Bacteria 6250
708 Ga0207650_10000022 3300025925 Bacteria 318878
709 Ga0207650_10021215 3300025925 Bacteria 4592
710 Ga0207650_10172447 3300025925 Bacteria 1720
711 Ga0207650_10216123 3300025925 Unclassified 1541
712 Ga0207650_10618080 3300025925 Bacteria 912
713 Ga0207659_10256660 3300025926 Bacteria 1420
714 Ga0207687_10016424 3300025927 Bacteria 4863
715 Ga0207687_10293202 3300025927 Unclassified 1308
716 Ga0207687_10778589 3300025927 Unclassified 815
717 Ga0207644_10000150 3300025931 Bacteria 50157
718 Ga0207644_10017838 3300025931 Bacteria 4800
719 Ga0207644_10038815 3300025931 Bacteria 3357
720 Ga0207644_10058474 3300025931 Bacteria 2787
721 Ga0207644_10092499 3300025931 Bacteria 2256
722 Ga0207644_10297028 3300025931 Bacteria 1301
723 Ga0207690_10089431 3300025932 Unclassified 2171
724 Ga0207690_10319239 3300025932 Bacteria 1220
725 Ga0207690_10381829 3300025932 Bacteria 1120
726 Ga0207706_10015714 3300025933 Bacteria 6841
727 Ga0207706_10080710 3300025933 Bacteria 2860
728 Ga0207706_10123295 3300025933 Bacteria 2280
729 Ga0207706_10318902 3300025933 Bacteria 1353
730 Ga0207686_10000017 3300025934 Bacteria 195143
731 Ga0207686_10000071 3300025934 Bacteria 93193
732 Ga0207686_10033243 3300025934 Bacteria 3077
733 Ga0207686_10430063 3300025934 Bacteria 1011
734 Ga0207709_10000024 3300025935 Bacteria 369177
735 Ga0207709_10000925 3300025935 Bacteria 22134
736 Ga0207709_10019745 3300025935 Bacteria 3794
737 Ga0207709_10025662 3300025935 Unclassified 3375
738 Ga0207709_10042089 3300025935 Bacteria 2745
739 Ga0207709_10502818 3300025935 Viruses 946
740 Ga0207709_10540755 3300025935 Bacteria 915
741 Ga0207670_10022836 3300025936 Bacteria 3884
742 Ga0207670_10091856 3300025936 Bacteria 2147
743 Ga0207670_10096009 3300025936 Bacteria 2107
744 Ga0207670_10173278 3300025936 Bacteria 1619
745 Ga0207670_10278548 3300025936 Bacteria 1303
746 Ga0207669_10049512 3300025937 Bacteria 2505
747 Ga0207669_10124614 3300025937 Bacteria 1757
748 Ga0207704_10204144 3300025938 Bacteria 1449
749 Ga0207704_10230087 3300025938 Bacteria 1378
750 Ga0207704_10567585 3300025938 Bacteria 924
751 Ga0207665_10000001 3300025939 Bacteria 279842
752 Ga0207665_10067057 3300025939 Bacteria 2443
753 Ga0207665_10640087 3300025939 Bacteria 833
754 Ga0207691_10001779 3300025940 Bacteria 21198
755 Ga0207691_10183034 3300025940 Unclassified 1830
756 Ga0207691_10217220 3300025940 Bacteria 1659
757 Ga0207691_10244131 3300025940 Bacteria 1552
758 Ga0207711_10006083 3300025941 Bacteria 10195
759 Ga0207711_10034278 3300025941 Bacteria 4300
760 Ga0207711_10038455 3300025941 Bacteria 4069
761 Ga0207711_10043627 3300025941 Bacteria 3826
762 Ga0207711_10047336 3300025941 Bacteria 3676
763 Ga0207711_10133801 3300025941 Bacteria 2225
764 Ga0207711_10274782 3300025941 Bacteria 1551
765 Ga0207711_10294142 3300025941 Bacteria 1497
766 Ga0207711_10321289 3300025941 Bacteria 1430
767 Ga0207689_10003180 3300025942 Bacteria 15062
768 Ga0207689_10025238 3300025942 Bacteria 4981
769 Ga0207689_10030489 3300025942 Bacteria 4495
770 Ga0207689_10066066 3300025942 Bacteria 2974
771 Ga0207689_10112548 3300025942 Bacteria 2237
772 Ga0207689_10151348 3300025942 Bacteria 1912
773 Ga0207689_10485960 3300025942 Bacteria 1034
774 Ga0207689_10670089 3300025942 Bacteria 874
775 Ga0207661_10450040 3300025944 Bacteria 1173
776 Ga0207661_10617026 3300025944 Bacteria 996
777 Ga0207661_10757276 3300025944 Bacteria 894
778 Ga0207679_10013498 3300025945 Bacteria 5356
779 Ga0207679_10016337 3300025945 Bacteria 4928
780 Ga0207679_10018072 3300025945 Bacteria 4715
781 Ga0207679_10020856 3300025945 Bacteria 4431
782 Ga0207679_10392902 3300025945 Unclassified 1218
783 Ga0207679_10542885 3300025945 Unclassified 1042
784 Ga0207667_10158569 3300025949 Bacteria 2328
785 Ga0207667_10651149 3300025949 Bacteria 1059
786 Ga0207651_10013023 3300025960 Bacteria 4739
787 Ga0207651_10042031 3300025960 Bacteria 3039
788 Ga0207651_10052702 3300025960 Bacteria 2776
789 Ga0207651_10059092 3300025960 Bacteria 2653
790 Ga0207651_10077321 3300025960 Bacteria 2382
791 Ga0207651_10323913 3300025960 Bacteria 1289
792 Ga0207651_10428490 3300025960 Bacteria 1131
793 Ga0207651_10486650 3300025960 Bacteria 1064
794 Ga0207712_10000369 3300025961 Bacteria 39804
795 Ga0207712_10008642 3300025961 Bacteria 6439
796 Ga0207712_10186495 3300025961 Bacteria 1634
797 Ga0207712_10189315 3300025961 Unclassified 1623
798 Ga0207712_10525190 3300025961 Bacteria 1015
799 Ga0207668_10206279 3300025972 Bacteria 1569
800 Ga0207640_10048209 3300025981 Bacteria 2752
801 Ga0207640_10210371 3300025981 Bacteria 1481
802 Ga0207640_10283465 3300025981 Unclassified 1302
803 Ga0207640_10332359 3300025981 Bacteria 1214
804 Ga0207640_10357739 3300025981 Bacteria 1175
805 Ga0207640_10610741 3300025981 Viruses 924
806 Ga0207640_10643427 3300025981 Unclassified 903
807 Ga0207640_10890504 3300025981 Bacteria 777
808 Ga0207640_11144743 3300025981 Bacteria 690
809 Ga0207658_10157754 3300025986 Bacteria 1856
810 Ga0207658_10639838 3300025986 Bacteria 958
811 Ga0207677_10005500 3300026023 Bacteria 6879
812 Ga0207677_10034636 3300026023 Bacteria 3271
813 Ga0207677_10504915 3300026023 Bacteria 1046
814 Ga0207677_11615843 3300026023 Bacteria 600
815 Ga0207703_10000347 3300026035 Bacteria 49743
816 Ga0207703_10005027 3300026035 Bacteria 10723
817 Ga0207703_10039748 3300026035 Bacteria 3761
818 Ga0207703_10044755 3300026035 Bacteria 3559
819 Ga0207703_10554206 3300026035 Bacteria 1084
820 Ga0207639_10033642 3300026041 Bacteria 3783
821 Ga0207639_10347162 3300026041 Unclassified 1324
822 Ga0207639_10560900 3300026041 Bacteria 1049
823 Ga0207639_11113618 3300026041 Bacteria 741
824 Ga0207678_10029321 3300026067 Bacteria 4802
825 Ga0207708_10057190 3300026075 Unclassified 2976
826 Ga0207708_10063570 3300026075 Bacteria 2820
827 Ga0207708_10069362 3300026075 Bacteria 2699
828 Ga0207708_10070579 3300026075 Bacteria 2674
829 Ga0207708_10074680 3300026075 Bacteria 2599
830 Ga0207708_10256114 3300026075 Bacteria 1411
831 Ga0207708_10340891 3300026075 Bacteria 1227
832 Ga0207702_10257092 3300026078 Bacteria 1643
833 Ga0207641_10010442 3300026088 Bacteria 7632
834 Ga0207641_10093688 3300026088 Bacteria 2633
835 Ga0207641_10172919 3300026088 Bacteria 1973
836 Ga0207641_10219968 3300026088 Bacteria 1761
837 Ga0207641_10344170 3300026088 Bacteria 1419
838 Ga0207648_10003569 3300026089 Bacteria 16272
839 Ga0207648_10089004 3300026089 Bacteria 2696
840 Ga0207648_10353099 3300026089 Unclassified 1326
841 Ga0207648_10398251 3300026089 Bacteria 1247
842 Ga0207648_10522741 3300026089 Bacteria 1087
843 Ga0207648_10918448 3300026089 Bacteria 818
844 Ga0207676_10003190 3300026095 Bacteria 11679
845 Ga0207676_10024012 3300026095 Bacteria 4507
846 Ga0207676_10032524 3300026095 Bacteria 3931
847 Ga0207676_10035981 3300026095 Bacteria 3763
848 Ga0207676_10178473 3300026095 Bacteria 1857
849 Ga0207676_10369944 3300026095 Bacteria 1331
850 Ga0207676_10392922 3300026095 Unclassified 1294
851 Ga0207676_10425327 3300026095 Unclassified 1246
852 Ga0207676_10568513 3300026095 Bacteria 1085
853 Ga0207674_10009973 3300026116 Bacteria 10809
854 Ga0207674_10042905 3300026116 Bacteria 4667
855 Ga0207674_10124110 3300026116 Bacteria 2548
856 Ga0207674_10257990 3300026116 Bacteria 1690
857 Ga0207674_10559993 3300026116 Unclassified 1104
858 Ga0207675_100002016 3300026118 Bacteria 20240
859 Ga0207675_100012755 3300026118 Bacteria 7852
860 Ga0207675_100084372 3300026118 Bacteria 2981
861 Ga0207675_100088793 3300026118 Bacteria 2904
862 Ga0207675_100112237 3300026118 Unclassified 2572
863 Ga0207675_100235032 3300026118 Bacteria 1769
864 Ga0207675_100244639 3300026118 Bacteria 1734
865 Ga0207675_100577671 3300026118 Unclassified 1125
866 Ga0207675_100602549 3300026118 Bacteria 1102
867 Ga0207683_10019864 3300026121 Bacteria 5741
868 Ga0207683_10123531 3300026121 Bacteria 2325
869 Ga0207698_10025090 3300026142 Bacteria 4193
870 Ga0207698_10040970 3300026142 Bacteria 3447
871 Ga0207698_10072718 3300026142 Unclassified 2734
872 Ga0207698_10077330 3300026142 Bacteria 2668
873 Ga0207698_10103043 3300026142 Bacteria 2371
874 Ga0207698_10983787 3300026142 Unclassified 854
875 Ga0209970_1030317 3300027614 Bacteria 938
876 Ga0209588_1027416 3300027671 Bacteria 1813
877 Ga0207428_10003511 3300027907 Bacteria 15179
878 Ga0207428_10020981 3300027907 Bacteria 5538
879 Ga0207428_10027745 3300027907 Bacteria 4711
880 Ga0268265_10027691 3300028380 Bacteria 4048
881 Ga0268265_10034426 3300028380 Bacteria 3692
882 Ga0268265_10110999 3300028380 Bacteria 2239
883 Ga0268265_10139224 3300028380 Bacteria 2029
884 Ga0268265_10148577 3300028380 Bacteria 1973
885 Ga0268265_10567282 3300028380 Bacteria 1080
886 Ga0268265_10748287 3300028380 Bacteria 948
887 Ga0268265_10756202 3300028380 Unclassified 944
888 Ga0268265_10954441 3300028380 Bacteria 845
889 Ga0268264_10011885 3300028381 Bacteria 7172
890 Ga0268264_10061070 3300028381 Bacteria 3160
891 Ga0268264_10109639 3300028381 Bacteria 2416
892 Ga0268264_10129705 3300028381 Unclassified 2233
893 Ga0268264_10151912 3300028381 Bacteria 2077
894 Ga0268264_10195902 3300028381 Bacteria 1845
895 Ga0268264_10394242 3300028381 Bacteria 1329
896 Ga0307515_10272813 3300028794 Bacteria 1410
897 Ga0307513_10002308 3300031456 Bacteria 26612
898 Ga0307509_10312526 3300031507 Unclassified 1313
899 Ga0307408_100000226 3300031548 Bacteria 60055
900 Ga0307408_100009344 3300031548 Bacteria 6463
901 Ga0307408_100025187 3300031548 Bacteria 4072
902 Ga0316576_10058793 3300031727 Bacteria 2813
903 Ga0307405_10089042 3300031731 Bacteria 2038
904 Ga0307405_10205406 3300031731 Bacteria 1434
905 Ga0307405_10240452 3300031731 Bacteria 1341
906 Ga0307413_10001757 3300031824 Bacteria 8481
907 Ga0307413_10042073 3300031824 Bacteria 2681
908 Ga0307413_10059817 3300031824 Bacteria 2342
909 Ga0307413_10929632 3300031824 Unclassified 741
910 Ga0307410_10005457 3300031852 Bacteria 6736
911 Ga0307410_10025234 3300031852 Bacteria 3725
912 Ga0307410_10052136 3300031852 Bacteria 2761
913 Ga0307410_10071324 3300031852 Bacteria 2409
914 Ga0307410_10311276 3300031852 Bacteria 1246
915 Ga0307410_11068165 3300031852 Bacteria 699
916 Ga0307406_10011266 3300031901 Bacteria 5072
917 Ga0307406_10029415 3300031901 Bacteria 3327
918 Ga0307406_10474722 3300031901 Bacteria 1009
919 Ga0307407_10000158 3300031903 Bacteria 20929
920 Ga0307407_10001823 3300031903 Bacteria 7998
921 Ga0307407_10007401 3300031903 Bacteria 4971
922 Ga0307407_10137275 3300031903 Bacteria 1573
923 Ga0307412_10002936 3300031911 Bacteria 9462
924 Ga0307412_10027824 3300031911 Bacteria 3531
925 Ga0307412_10039897 3300031911 Bacteria 3035
926 Ga0307412_10073175 3300031911 Bacteria 2344
927 Ga0307412_10381130 3300031911 Bacteria 1142
928 Ga0307409_100003461 3300031995 Bacteria 8572
929 Ga0307409_100047033 3300031995 Bacteria 3271
930 Ga0307409_100272383 3300031995 Bacteria 1560
931 Ga0307416_100019635 3300032002 Bacteria 4798
932 Ga0307416_100115357 3300032002 Bacteria 2378
933 Ga0307416_100302239 3300032002 Bacteria 1591
934 Ga0307416_100302376 3300032002 Bacteria 1591
935 Ga0307416_101092189 3300032002 Unclassified 902
936 Ga0307416_101493415 3300032002 Bacteria 781
937 Ga0307414_10031804 3300032004 Bacteria 3466
938 Ga0307414_10059423 3300032004 Unclassified 2699
939 Ga0307414_10059526 3300032004 Bacteria 2697
940 Ga0307414_10641210 3300032004 Bacteria 957
941 Ga0307414_10719524 3300032004 Bacteria 905
942 Ga0307414_10725764 3300032004 Unclassified 901
943 Ga0307411_10004219 3300032005 Bacteria 6837
944 Ga0307411_10008074 3300032005 Bacteria 5424
945 Ga0307411_10012138 3300032005 Bacteria 4684
946 Ga0307411_10120210 3300032005 Bacteria 1899
947 Ga0307411_10121380 3300032005 Bacteria 1892
948 Ga0307411_10547239 3300032005 Bacteria 987
949 Ga0307411_10594634 3300032005 Bacteria 950
950 Ga0307411_11548248 3300032005 Bacteria 610
951 Ga0307415_100026961 3300032126 Bacteria 3633
952 Ga0307415_100035137 3300032126 Bacteria 3271
953 Ga0307415_100061152 3300032126 Bacteria 2606
954 Ga0307415_100097125 3300032126 Bacteria 2149
955 Ga0307415_100288520 3300032126 Unclassified 1353
956 Ga0307415_100386400 3300032126 Bacteria 1190
957 Ga0307415_100472078 3300032126 Bacteria 1090
958 Ga0373931_0285546 3300035691 Bacteria 1015
959 Ga0395900_0187863 3300037418 Bacteria 2097
960 Ga0395900_0291097 3300037418 Bacteria 1622
961 Ga0395905_0004483 3300037471 Bacteria 14486
962 Ga0395905_0077903 3300037471 Bacteria 3106
963 Ga0395905_0592823 3300037471 Bacteria 1010
964 Ga0395905_0842468 3300037471 Bacteria 820
965 Ga0395901_0115625 3300038443 Bacteria 2818
966 Ga0395901_0484084 3300038443 Unclassified 1262
967 Ga0436365_0160602 3300039437 Bacteria 2104
968 Ga0436365_0227208 3300039437 Bacteria 70252
969 Ga0436365_0597228 3300039437 Bacteria 2149
970 Ga0436365_1695306 3300039437 Bacteria 69740
971 Ga0436363_0862232 3300039450 Unclassified 1972
972 Ga0436362_0661244 3300039453 Bacteria 1234
973 Ga0436362_1215482 3300039453 Bacteria 1208
974 Ga0439439_0101168 3300041406 Bacteria 793
975 Ga0439453_0046745 3300041408 Bacteria 864
976 Ga0451853_3419890 3300041512 Unclassified 738
977 Ga0439448_0007683 3300042005 Bacteria 3134
978 Ga0439457_036817 3300042014 Bacteria 1089
979 Ga0450892_003984 3300042130 Bacteria 1207
980 Ga0439446_0173275 3300042156 Unclassified 718
981 Ga0439458_0000902 3300042157 Bacteria 7669
982 Ga0439434_0008711 3300042435 Bacteria 2979
983 Ga0451577_0009471 3300042876 Bacteria 9378
984 Ga0451577_0402549 3300042876 Bacteria 1242
985 Ga0466957_0231009 3300044842 Bacteria 1225
986 Ga0451576_0009811 3300045051 Bacteria 11064
987 Ga0451576_0011416 3300045051 Bacteria 10093
988 Ga0451576_0186350 3300045051 Bacteria 2167
989 Ga0451576_0203316 3300045051 Bacteria 2069
990 Ga0451576_0221642 3300045051 Bacteria 1975
991 Ga0495662_0039589 3300046476 Bacteria 2277
992 Ga0495643_0018815 3300046522 Bacteria 4002
993 Ga0495663_0001543 3300046525 Bacteria 7221
994 Ga0495666_0421143 3300046526 Unclassified 599
995 Ga0495652_0774085 3300046529 Unclassified 641
996 Ga0495598_0000708 3300046537 Bacteria 6347
997 Ga0495598_0080244 3300046537 Unclassified 1045
998 Ga0495621_0001031 3300046539 Bacteria 7148
999 Ga0495621_0194890 3300046539 Unclassified 813
1000 Ga0495668_0542315 3300046616 Unclassified 642
1001 Ga0495634_0082741 3300046642 Bacteria 2097
1002 Ga0495635_0138070 3300046663 Bacteria 1661
1003 Ga0495669_0039629 3300046684 Unclassified 2086
1004 Ga0495670_0033048 3300046691 Bacteria 2574
1005 Ga0495600_0017139 3300046809 Bacteria 4606
1006 Ga0495581_0499315 3300047315 Unclassified 707
1007 Ga0495636_0182323 3300047318 Unclassified 953
1008 Ga0495636_0192205 3300047318 Unclassified 929
1009 Ga0495672_0048691 3300047320 Unclassified 2512
1010 Ga0495684_0130474 3300047471 Bacteria 1888
1011 Ga0495614_0231005 3300048089 Unclassified 843
1012 Ga0496100_0895164 3300048903 Bacteria 697
1013 Ga0496104_0273660 3300048907 Bacteria 1601
1014 Ga0496106_0004885 3300048909 Bacteria 9926
1015 Ga0496107_0113063 3300048910 Bacteria 1997
1016 Ga0496108_1060879 3300048911 Bacteria 690
1017 Ga0496109_0000074 3300048912 Bacteria 106163
1018 Ga0496109_0187060 3300048912 Bacteria 1946
1019 Ga0496111_0258834 3300048914 Bacteria 1291
1020 Ga0496112_0290594 3300048915 Bacteria 1581
1021 Ga0496113_0291423 3300048916 Bacteria 1306
1022 Ga0496114_0045617 3300048917 Bacteria 3642
1023 Ga0501041_0617794 3300049577 Bacteria 692
1024 Ga0501042_0328586 3300049578 Unclassified 1105
1025 Ga0501043_0124345 3300049579 Bacteria 2023
1026 Ga0501048_0353855 3300049582 Unclassified 1047
1027 Ga0501068_0198964 3300049584 Unclassified 1270
1028 Ga0501071_0120209 3300049587 Bacteria 1947
1029 Ga0501071_0153567 3300049587 Unclassified 1718
1030 Ga0501072_0013011 3300049588 Bacteria 6368
1031 Ga0501072_0191723 3300049588 Unclassified 1630
1032 Ga0501074_0075573 3300049590 Bacteria 2418
1033 Ga0501074_0481456 3300049590 Bacteria 880
1034 Ga0501074_0569401 3300049590 Bacteria 802
1035 Ga0501075_0033314 3300049591 Unclassified 3833
1036 Ga0501075_0738212 3300049591 Bacteria 750
1037 Ga0501077_0092539 3300049593 Bacteria 1916
1038 Ga0501077_0305414 3300049593 Bacteria 1014
1039 Ga0501209_016500 3300049656 Bacteria 1669
1040 Ga0501217_054313 3300049661 Unclassified 1055
1041 Ga0501235_025158 3300049669 Bacteria 1331
1042 Ga0501239_001186 3300049672 Bacteria 2200
1043 Ga0501258_003128 3300049687 Bacteria 1498
1044 Ga0501225_0029803 3300049705 Bacteria 1500
1045 Ga0501225_0085368 3300049705 Bacteria 910
1046 Ga0501245_005243 3300049708 Bacteria 1794
1047 Ga0501079_0055592 3300049741 Bacteria 3054
1048 Ga0501079_0363290 3300049741 Bacteria 1135
1049 Ga0501079_0851773 3300049741 Bacteria 718
1050 Ga0501081_0078482 3300049743 Bacteria 2308
1051 Ga0501241_000634 3300049758 Bacteria 7541
1052 Ga0501268_002452 3300049765 Bacteria 2446
1053 Ga0501273_029173 3300049770 Bacteria 779
1054 Ga0501045_0024194 3300049824 Bacteria 4359
1055 nmdc:mga05p37_110262_c1 3300050507 Bacteria 3385
1056 nmdc:mga05p37_119651_c1 3300050507 Bacteria 3236
1057 nmdc:mga05p37_140947_c1 3300050507 Bacteria 2954
1058 nmdc:mga05p37_25810_c1 3300050507 Bacteria 7144
1059 nmdc:mga05p37_283711_c1 3300050507 Bacteria 1974
1060 nmdc:mga05p37_284559_c1 3300050507 Bacteria 1970
1061 nmdc:mga05p37_454536_c1 3300050507 Bacteria 1481
1062 nmdc:mga05p37_54396_c1 3300050507 Bacteria 4925
1063 nmdc:mga05p37_624654_c1 3300050507 Bacteria 1212
1064 nmdc:mga09592_303364_c1 3300050508 Bacteria 1384
1065 nmdc:mga09592_96037_c1 3300050508 Bacteria 2535
1066 nmdc:mga06r32_123811_c1 3300050510 Bacteria 2552
1067 nmdc:mga06r32_13719_c1 3300050510 Bacteria 7348
1068 nmdc:mga06r32_170272_c1 3300050510 Bacteria 2162
1069 nmdc:mga06r32_37845_c1 3300050510 Bacteria 4565
1070 nmdc:mga06r32_385414_c1 3300050510 Unclassified 1384
1071 nmdc:mga06r32_547950_c1 3300050510 Bacteria 1131
1072 nmdc:mga08y16_175992_c1 3300050511 Bacteria 2222
1073 nmdc:mga08y16_24123_c1 3300050511 Bacteria 6423
1074 nmdc:mga08y16_293658_c1 3300050511 Bacteria 1676
1075 nmdc:mga08y16_5057_c1 3300050511 Bacteria 13780
1076 nmdc:mga08y16_60736_c1 3300050511 Unclassified 3948
1077 nmdc:mga0n895_1089738_c1 3300050512 Unclassified 776
1078 nmdc:mga0n895_1266176_c1 3300050512 Bacteria 709
1079 nmdc:mga0n895_192582_c1 3300050512 Bacteria 2070
1080 nmdc:mga0n895_216197_c1 3300050512 Bacteria 1946
1081 nmdc:mga0n895_253820_c1 3300050512 Bacteria 1785
1082 nmdc:mga0n895_333130_c1 3300050512 Unclassified 1538
1083 nmdc:mga0n895_472312_c1 3300050512 Bacteria 1265
1084 nmdc:mga0rr50_131639_c1 3300050513 Bacteria 2003
1085 nmdc:mga0rr50_53311_c1 3300050513 Bacteria 3008
1086 nmdc:mga0rr50_89679_c1 3300050513 Unclassified 2391
1087 nmdc:mga0rr50_936_c1 3300050513 Bacteria 15780
1088 nmdc:mga08x19_106872_c1 3300050514 Bacteria 1862
1089 nmdc:mga08x19_56_c1 3300050514 Bacteria 120839
1090 nmdc:mga08x19_79956_c1 3300050514 Bacteria 2145
1091 nmdc:mga0a205_108796_c1 3300050515 Bacteria 2670
1092 nmdc:mga0a205_24987_c1 3300050515 Bacteria 5688
1093 nmdc:mga0a205_369928_c1 3300050515 Bacteria 1299
1094 nmdc:mga0a205_383693_c1 3300050515 Bacteria 1270
1095 nmdc:mga0a205_393043_c1 3300050515 Unclassified 1251
1096 nmdc:mga0a205_46413_c1 3300050515 Bacteria 4190
1097 nmdc:mga0a205_94111_c1 3300050515 Bacteria 2894
1098 Ga0500555_003854 3300053103 Bacteria 4268
1099 Ga0500577_0003834 3300053142 Bacteria 3930
1100 Ga0501084_0046143 3300054114 Bacteria 3649
1101 Ga0501084_1185346 3300054114 Unclassified 641
1102 Ga0501084_1363858 3300054114 Unclassified 594
1103 Ga0587101_059941 3300059623 Bacteria 677
1104 Ga0501082_0110444 3300060353 Bacteria 2380
1105 Ga0501082_0277248 3300060353 Bacteria 1460
1106 Ga0501082_0705684 3300060353 Unclassified 883
1107 Ga0530510_0022853 3300061734 Bacteria 4457
1108 Ga0530510_0234204 3300061734 Unclassified 1366
1109 Ga0530510_0332146 3300061734 Bacteria 1140
1110 2511235088 2511231000 Bacteria 4488346
1111 2585159046 2582581281 Bacteria 4487904
1112 2585163367 2582581282 Bacteria 4495830
1113 2740033866 2739367866 Bacteria 4215900
1114 2740060289 2739367874 Bacteria 4872888
1115 2839989799 2839989709 Bacteria 3773432
1116 2890805939 2890804823 Bacteria 3717572
1117 2910249582 2910245624 Bacteria 6935613
1118 Ga0495655_0028173
1119 MBSR1b_contig_13888860
1120 MBSR1b_contig_7836939
1121 MBSR1b_contig_9885525
1122 JGI24034J14986_101222
1123 JGI24748J21848_1000059
1124 JGI24034J26672_10000030
1125 JGI24751J29686_10000094
1126 JGI25406J46586_10006607
1127 JGI25406J46586_10013396
1128 rootL2_10082721
1129 Ga0065704_10009690
1130 Ga0065704_10074449
1131 Ga0065704_10112333
1132 Ga0065704_10139794
1133 Ga0065704_10465483
1134 Ga0065712_10101532
1135 Ga0065712_10130378
1136 Ga0065715_10002145
1137 Ga0065715_10005331
1138 Ga0065715_10011053
1139 Ga0065715_10023037
1140 Ga0065715_10133615
1141 Ga0065715_10165915
1142 Ga0065715_10172243
1143 Ga0065715_10199667
1144 Ga0065707_10096902
1145 Ga0065707_10097201
1146 Ga0065707_10101801
1147 Ga0065707_10116895
1148 Ga0065707_10189441
1149 Ga0070676_10014792
1150 Ga0070676_10069640
1151 Ga0070683_100239140
1152 Ga0070683_100545983
1153 Ga0070690_100006398
1154 Ga0070690_100009295
1155 Ga0070690_100026546
1156 Ga0070690_100091763
1157 Ga0070690_100194711
1158 Ga0070690_100906204
1159 Ga0070670_100000266
1160 Ga0070670_100015660
1161 Ga0070670_100641021
1162 Ga0070670_100668399
1163 Ga0070670_100684556
1164 Ga0070677_10398845
1165 Ga0070677_10590430
1166 Ga0068869_100006571
1167 Ga0068869_100024548
1168 Ga0068869_100089018
1169 Ga0068869_100502677
1170 Ga0068869_100638346
1171 Ga0070666_10006766
1172 Ga0070666_10024479
1173 Ga0070666_10040447
1174 Ga0070680_100017772
1175 Ga0070680_100058398
1176 Ga0070680_100250231
1177 Ga0070680_100376428
1178 Ga0070680_100404011
1179 Ga0070682_100000196
1180 Ga0070682_100083692
1181 Ga0070682_100109824
1182 Ga0070682_100111307
1183 Ga0068868_100016973
1184 Ga0068868_100076941
1185 Ga0068868_100098626
1186 Ga0068868_100142306
1187 Ga0068868_100769604
1188 Ga0068868_100876580
1189 Ga0070660_100033881
1190 Ga0070660_100752707
1191 Ga0070689_100054301
1192 Ga0070689_100087182
1193 Ga0070689_100113315
1194 Ga0070687_100016815
1195 Ga0070687_100102327
1196 Ga0070687_100217413
1197 Ga0070661_100039974
1198 Ga0070661_100042505
1199 Ga0070661_100174201
1200 Ga0070661_100542158
1201 Ga0070692_10315098
1202 Ga0070692_10315740
1203 Ga0070692_10356044
1204 Ga0070668_100209418
1205 Ga0070669_100000464
1206 Ga0070669_100021933
1207 Ga0070669_100074347
1208 Ga0070669_100232806
1209 Ga0070669_100410620
1210 Ga0070669_100427108
1211 Ga0070675_100236786
1212 Ga0070675_100242593
1213 Ga0070675_100481069
1214 Ga0070675_100568140
1215 Ga0070675_100793265
1216 Ga0070675_101043219
1217 Ga0070675_101059397
1218 Ga0070671_100018380
1219 Ga0070671_100055064
1220 Ga0070671_100061586
1221 Ga0070671_100110364
1222 Ga0070671_100185395
1223 Ga0070671_100369288
1224 Ga0070671_100377635
1225 Ga0070671_100381549
1226 Ga0070674_100153833
1227 Ga0070674_100208205
1228 Ga0070673_100145442
1229 Ga0070673_100259499
1230 Ga0070673_100367778
1231 Ga0070673_100375132
1232 Ga0070673_100387522
1233 Ga0070673_100411349
1234 Ga0070673_100414265
1235 Ga0070673_100421136
1236 Ga0070659_100033428
1237 Ga0070659_100059680
1238 Ga0070659_100415701
1239 Ga0070667_100144360
1240 Ga0070667_100677177
1241 Ga0070703_10000162
1242 Ga0070703_10000306
1243 Ga0070709_10000033
1244 Ga0070701_10130721
1245 Ga0070701_10447508
1246 Ga0070701_10558890
1247 Ga0070711_100000074
1248 Ga0070705_100036474
1249 Ga0070705_100043051
1250 Ga0070705_100053116
1251 Ga0070705_100118388
1252 Ga0070705_100794932
1253 Ga0070700_100020041
1254 Ga0070700_100037401
1255 Ga0070700_100053848
1256 Ga0070700_100167144
1257 Ga0070700_100179874
1258 Ga0070700_100654817
1259 Ga0070700_101023452
1260 Ga0070694_100048440
1261 Ga0070694_100089749
1262 Ga0070694_100407549
1263 Ga0070694_100429967
1264 Ga0070694_100599636
1265 Ga0070694_100840341
1266 Ga0070708_100003084
1267 Ga0070708_100050439
1268 Ga0070708_100187481
1269 Ga0070708_100774445
1270 Ga0070708_100834475
1271 Ga0070708_101084326
1272 Ga0070678_100010464
1273 Ga0070678_101224901
1274 Ga0070678_101259911
1275 Ga0070662_100004210
1276 Ga0070662_100060995
1277 Ga0070662_100103442
1278 Ga0070662_100282071
1279 Ga0070662_100840831
1280 Ga0070681_10003215
1281 Ga0070681_10008005
1282 Ga0070681_10018607
1283 Ga0070681_10022569
1284 Ga0068867_100013615
1285 Ga0068867_100052907
1286 Ga0068867_100293730
1287 Ga0068867_100578835
1288 Ga0068867_100676692
1289 Ga0070685_10043209
1290 Ga0070685_10050484
1291 Ga0070685_10236842
1292 Ga0070685_10648318
1293 Ga0070685_10685326
1294 Ga0070706_100000616
1295 Ga0070706_100003564
1296 Ga0070706_100005484
1297 Ga0070706_100017375
1298 Ga0070706_100027728
1299 Ga0070706_100041808
1300 Ga0070706_100050912
1301 Ga0070706_100106393
1302 Ga0070706_100775803
1303 Ga0070707_100000369
1304 Ga0070707_100028858
1305 Ga0070707_100031840
1306 Ga0070707_100118758
1307 Ga0070707_100132575
1308 Ga0070707_100166572
1309 Ga0070707_100167719
1310 Ga0070707_100195045
1311 Ga0070707_100570179
1312 Ga0070707_100693568
1313 Ga0070698_100000436
1314 Ga0070698_100006378
1315 Ga0070698_100037875
1316 Ga0070698_100352446
1317 Ga0070698_100401129
1318 Ga0070698_100454955
1319 Ga0070698_100476877
1320 Ga0070699_100030512
1321 Ga0070699_100057878
1322 Ga0070699_100083146
1323 Ga0070699_100173234
1324 Ga0070679_100008884
1325 Ga0070679_100018823
1326 Ga0070679_100112613
1327 Ga0070684_100437797
1328 Ga0070684_100751954
1329 Ga0070697_100002610
1330 Ga0070697_100005378
1331 Ga0070697_100009481
1332 Ga0070697_100014681
1333 Ga0070697_100028510
1334 Ga0070697_100061962
1335 Ga0070697_100149322
1336 Ga0070697_100310356
1337 Ga0070697_100756483
1338 Ga0070697_100863184
1339 Ga0068853_100012328
1340 Ga0068853_100021622
1341 Ga0068853_100052934
1342 Ga0068853_100240165
1343 Ga0068853_100467850
1344 Ga0068853_100620190
1345 Ga0068853_101310101
1346 Ga0070672_100250044
1347 Ga0070672_100359517
1348 Ga0070672_100443700
1349 Ga0070672_100501319
1350 Ga0070686_100002438
1351 Ga0070686_100012045
1352 Ga0070686_100020799
1353 Ga0070686_100029389
1354 Ga0070686_100036476
1355 Ga0070686_100284770
1356 Ga0070686_100443669
1357 Ga0070686_100518211
1358 Ga0070686_100780842
1359 Ga0070695_100037285
1360 Ga0070695_100094837
1361 Ga0070695_100133114
1362 Ga0070695_100321934
1363 Ga0070695_100385731
1364 Ga0070695_100767422
1365 Ga0070696_100028804
1366 Ga0070696_100044840
1367 Ga0070696_100072312
1368 Ga0070696_100106319
1369 Ga0070696_100147083
1370 Ga0070696_100164348
1371 Ga0070696_100206724
1372 Ga0070696_100406323
1373 Ga0070696_100407900
1374 Ga0070696_101076287
1375 Ga0070693_100005819
1376 Ga0070693_100229728
1377 Ga0070693_100379264
1378 Ga0070693_100641565
1379 Ga0070704_100017584
1380 Ga0070704_100043252
1381 Ga0070704_100180565
1382 Ga0070704_100251034
1383 Ga0070704_100461238
1384 Ga0070704_100833988
1385 Ga0070704_100869971
1386 Ga0068855_100021673
1387 Ga0068855_101038839
1388 Ga0070664_100018563
1389 Ga0070664_100024631
1390 Ga0070664_100089587
1391 Ga0070664_100794796
1392 Ga0068857_100013719
1393 Ga0068857_100058228
1394 Ga0068857_100082459
1395 Ga0068857_100088537
1396 Ga0068857_100119591
1397 Ga0068854_100076538
1398 Ga0068854_100171009
1399 Ga0068854_100200050
1400 Ga0068854_100286428
1401 Ga0068854_100340009
1402 Ga0068854_100706027
1403 Ga0068854_100943693
1404 Ga0068854_101086304
1405 Ga0068856_100163553
1406 Ga0070702_100019884
1407 Ga0070702_100080257
1408 Ga0070702_100091969
1409 Ga0070702_100201819
1410 Ga0070702_100634436
1411 Ga0068852_100021882
1412 Ga0068852_100033414
1413 Ga0068852_100078908
1414 Ga0068852_100302886
1415 Ga0068852_101151718
1416 Ga0068852_101524079
1417 Ga0068859_100003936
1418 Ga0068859_100016804
1419 Ga0068859_100032278
1420 Ga0068859_100033421
1421 Ga0068859_100035396
1422 Ga0068859_100036037
1423 Ga0068859_100084756
1424 Ga0068859_100113680
1425 Ga0068859_100148654
1426 Ga0068859_100176647
1427 Ga0068859_100178152
1428 Ga0068859_100239172
1429 Ga0068859_100267802
1430 Ga0068859_100273411
1431 Ga0068859_100326067
1432 Ga0068859_100427399
1433 Ga0068859_100845230
1434 Ga0068859_100965177
1435 Ga0068864_100027093
1436 Ga0068864_100098518
1437 Ga0068864_100098955
1438 Ga0068864_100108597
1439 Ga0068864_100238180
1440 Ga0068864_100288296
1441 Ga0068864_100457929
1442 Ga0068864_100462266
1443 Ga0068864_100592906
1444 Ga0068864_100618043
1445 Ga0068864_101288609
1446 Ga0068866_10003617
1447 Ga0068866_10023562
1448 Ga0068861_100004206
1449 Ga0068861_100069961
1450 Ga0068861_100124417
1451 Ga0068861_100156818
1452 Ga0068861_100267426
1453 Ga0068861_100631127
1454 Ga0068861_101480721
1455 Ga0068851_10079636
1456 Ga0068870_10178679
1457 Ga0068870_10633988
1458 Ga0068863_100015038
1459 Ga0068863_100060130
1460 Ga0068863_100100560
1461 Ga0068863_100137253
1462 Ga0068863_100195442
1463 Ga0068863_100226574
1464 Ga0068863_100812396
1465 Ga0068863_101120850
1466 Ga0068858_100000550
1467 Ga0068858_100062360
1468 Ga0068858_100065287
1469 Ga0068858_100078155
1470 Ga0068858_100085634
1471 Ga0068858_100089587
1472 Ga0068858_100164767
1473 Ga0068858_100434737
1474 Ga0068858_100761777
1475 Ga0068860_100018907
1476 Ga0068860_100023710
1477 Ga0068860_100025205
1478 Ga0068860_100025329
1479 Ga0068860_100065017
1480 Ga0068860_100069839
1481 Ga0068860_100391542
1482 Ga0068862_100011189
1483 Ga0068862_100023761
1484 Ga0068862_100126074
1485 Ga0068862_100225431
1486 Ga0068862_100255547
1487 Ga0068862_100459746
1488 Ga0068862_100721092
1489 Ga0068862_100937126
1490 Ga0081455_10018342
1491 Ga0081539_10000156
1492 Ga0081539_10000407
1493 Ga0081539_10000814
1494 Ga0081539_10040320
1495 Ga0081539_10066966
1496 Ga0081539_10095621
1497 Ga0070715_10000005
1498 Ga0070716_100000009
1499 Ga0070716_100153502
1500 Ga0070716_100784350
1501 Ga0070712_100217623
1502 Ga0097621_100006349
1503 Ga0097621_100130817
1504 Ga0097621_100896237
1505 Ga0068871_100005485
1506 Ga0068871_100027051
1507 Ga0068871_100027978
1508 Ga0068871_100848575
1509 Ga0075428_100006095
1510 Ga0075428_100085219
1511 Ga0075428_100216879
1512 Ga0075431_100069437
1513 Ga0075431_100092692
1514 Ga0075431_100141094
1515 Ga0075431_100172741
1516 Ga0075431_100525588
1517 Ga0075433_10001603
1518 Ga0075433_10034538
1519 Ga0075433_10079937
1520 Ga0075433_10115518
1521 Ga0075433_10224191
1522 Ga0075433_10232838
1523 Ga0075433_10286903
1524 Ga0075434_100033930
1525 Ga0075434_100038061
1526 Ga0075434_100071362
1527 Ga0075434_100129929
1528 Ga0075434_100484461
1529 Ga0075434_100532346
1530 Ga0075434_101497449
1531 Ga0075429_100102565
1532 Ga0075429_100194350
1533 Ga0068865_100328575
1534 Ga0068865_100425941
1535 Ga0068865_100573168
1536 Ga0068865_100926418
1537 Ga0075436_100000014
1538 Ga0075436_100006651
1539 Ga0075436_100288987
1540 Ga0097620_100003936
1541 Ga0097620_100016804
1542 Ga0097620_100032279
1543 Ga0097620_100033421
1544 Ga0097620_100035396
1545 Ga0097620_100036037
1546 Ga0097620_100084762
1547 Ga0097620_100113687
1548 Ga0097620_100148645
1549 Ga0097620_100176647
1550 Ga0097620_100178149
1551 Ga0097620_100239155
1552 Ga0097620_100267809
1553 Ga0097620_100273422
1554 Ga0097620_100326078
1555 Ga0097620_100363959
1556 Ga0097620_100427441
1557 Ga0097620_100845259
1558 Ga0097620_100965198
1559 Ga0075435_100058947
1560 Ga0075435_100066763
1561 Ga0075435_100126441
1562 Ga0075435_100140478
1563 Ga0105250_10021457
1564 Ga0105240_10039745
1565 Ga0111539_10011415
1566 Ga0111539_10016840
1567 Ga0111539_10036774
1568 Ga0111539_10147927
1569 Ga0111539_11174376
1570 Ga0111539_11713605
1571 Ga0105245_10022955
1572 Ga0105245_10206465
1573 Ga0105245_10835476
1574 Ga0105245_11034047
1575 Ga0105245_11521695
1576 Ga0105245_11846908
1577 Ga0105247_10000552
1578 Ga0105247_10012888
1579 Ga0105247_10131798
1580 Ga0114129_10014602
1581 Ga0114129_10019404
1582 Ga0114129_10031530
1583 Ga0114129_10065817
1584 Ga0114129_10094667
1585 Ga0114129_10112398
1586 Ga0114129_10165050
1587 Ga0114129_10249606
1588 Ga0114129_10378676
1589 Ga0114129_10666885
1590 Ga0114129_11819388
1591 Ga0105243_10000439
1592 Ga0105243_10000652
1593 Ga0105243_10011188
1594 Ga0105243_10030507
1595 Ga0105243_10085848
1596 Ga0105243_10131049
1597 Ga0105243_10447053
1598 Ga0105243_10460094
1599 Ga0105243_10544121
1600 Ga0105241_10032278
1601 Ga0105241_10056380
1602 Ga0105241_10170754
1603 Ga0105241_10967675
1604 Ga0105242_10000121
1605 Ga0105242_10001024
1606 Ga0105242_10002128
1607 Ga0105242_10006525
1608 Ga0105242_10015351
1609 Ga0105242_10031170
1610 Ga0105242_10095882
1611 Ga0105242_10262007
1612 Ga0105242_10425467
1613 Ga0105242_10733529
1614 Ga0105248_10022758
1615 Ga0105248_10092972
1616 Ga0105248_10110231
1617 Ga0105248_10129637
1618 Ga0105248_10201614
1619 Ga0105248_10207159
1620 Ga0105248_10253052
1621 Ga0105248_10283674
1622 Ga0105248_10425763
1623 Ga0105248_10459662
1624 Ga0105248_10985482
1625 Ga0105237_10009532
1626 Ga0105237_10029312
1627 Ga0105238_10099060
1628 Ga0105238_11741054
1629 Ga0105249_10000112
1630 Ga0105249_10009689
1631 Ga0105249_10025340
1632 Ga0105249_10115176
1633 Ga0105249_10169047
1634 Ga0105249_10190186
1635 Ga0105249_10251682
1636 Ga0105249_10270437
1637 Ga0105249_10314002
1638 Ga0105249_11787431
1639 Ga0105239_10054463
1640 Ga0105239_10652702
1641 Ga0105239_11353832
1642 Ga0105246_10395030
1643 Ga0105246_10535343
1644 Ga0105246_10589836
1645 Ga0105246_10785144
1646 Ga0157373_10380906
1647 Ga0157371_10099894
1648 Ga0157371_10368779
1649 Ga0157370_10137628
1650 Ga0157369_10019613
1651 Ga0157369_10028601
1652 Ga0157374_10014469
1653 Ga0157374_10079809
1654 Ga0157374_10145556
1655 Ga0157378_10000002
1656 Ga0157378_10002032
1657 Ga0157378_10002886
1658 Ga0157378_10014879
1659 Ga0157378_10021074
1660 Ga0157378_10063645
1661 Ga0157378_10074678
1662 Ga0157378_10076538
1663 Ga0157378_10091122
1664 Ga0157378_10212944
1665 Ga0157378_10306686
1666 Ga0157378_10410939
1667 Ga0157378_10949201
1668 Ga0157378_10964773
1669 Ga0163162_10000055
1670 Ga0163162_10004296
1671 Ga0163162_10020538
1672 Ga0163162_10022268
1673 Ga0163162_10025673
1674 Ga0163162_10032007
1675 Ga0163162_10051851
1676 Ga0163162_10131366
1677 Ga0163162_10133100
1678 Ga0163162_10153220
1679 Ga0163162_10269701
1680 Ga0163162_10345028
1681 Ga0163162_10430095
1682 Ga0163162_10872795
1683 Ga0157372_10021317
1684 Ga0157372_10231045
1685 Ga0157372_11375707
1686 Ga0157375_10004522
1687 Ga0157375_10015339
1688 Ga0157375_10048745
1689 Ga0157375_10213273
1690 Ga0157375_10223894
1691 Ga0157375_10245088
1692 Ga0157375_10288798
1693 Ga0157375_10347941
1694 Ga0157375_10491073
1695 Ga0157375_10500035
1696 Ga0157375_10515304
1697 Ga0157375_10537387
1698 Ga0157375_10600028
1699 Ga0157375_10685230
1700 Ga0157375_11043285
1701 Ga0157375_11484771
1702 Ga0157375_11784949
1703 Ga0163163_10000810
1704 Ga0163163_10015453
1705 Ga0163163_10039285
1706 Ga0163163_10085112
1707 Ga0163163_10176619
1708 Ga0163163_10334967
1709 Ga0163163_10370990
1710 Ga0163163_10421986
1711 Ga0163163_10529883
1712 Ga0163163_10560548
1713 Ga0157380_10000923
1714 Ga0157380_10003564
1715 Ga0157380_10023746
1716 Ga0157380_10030693
1717 Ga0157380_10057237
1718 Ga0157380_10063114
1719 Ga0157380_10103684
1720 Ga0157380_10136741
1721 Ga0157380_10142438
1722 Ga0157380_10152811
1723 Ga0157380_10393180
1724 Ga0157380_10798518
1725 Ga0157380_10888298
1726 Ga0157380_11482376
1727 Ga0157377_10053572
1728 Ga0157377_10083836
1729 Ga0157377_10098546
1730 Ga0157377_10152151
1731 Ga0157377_10293858
1732 Ga0157377_10985874
1733 Ga0157379_10061719
1734 Ga0157379_10121127
1735 Ga0157379_10938360
1736 Ga0157376_10019475
1737 Ga0157376_10106216
1738 Ga0157376_10273457
1739 Ga0157376_11304065
1740 Ga0163161_10007020
1741 Ga0163161_10008921
1742 Ga0163161_10030117
1743 Ga0163161_10039883
1744 Ga0163161_10322977
1745 Ga0213876_10000156
1746 Ga0213876_10000219
1747 Ga0213876_10055195
1748 Ga0207672_1000510
1749 Ga0209455_1018310
1750 Ga0207697_10005034
1751 Ga0207656_10131851
1752 Ga0207656_10150954
1753 Ga0207653_10000027
1754 Ga0207653_10000128
1755 Ga0207642_10009418
1756 Ga0207710_10000001
1757 Ga0207710_10046532
1758 Ga0207688_10079050
1759 Ga0207688_10166601
1760 Ga0207688_10208753
1761 Ga0207680_10057550
1762 Ga0207680_10116622
1763 Ga0207680_10212025
1764 Ga0207647_10156244
1765 Ga0207647_10202521
1766 Ga0207685_10000020
1767 Ga0207699_10000002
1768 Ga0207699_10299535
1769 Ga0207645_10032087
1770 Ga0207645_10131865
1771 Ga0207645_10495844
1772 Ga0207645_10614670
1773 Ga0207643_10283854
1774 Ga0207684_10000172
1775 Ga0207684_10000278
1776 Ga0207684_10014539
1777 Ga0207684_10016664
1778 Ga0207684_10061582
1779 Ga0207684_10108764
1780 Ga0207684_10275169
1781 Ga0207654_10017901
1782 Ga0207654_10341015
1783 Ga0207707_10001199
1784 Ga0207707_10032685
1785 Ga0207707_10201316
1786 Ga0207695_10460123
1787 Ga0207671_10022023
1788 Ga0207671_10454843
1789 Ga0207671_10680088
1790 Ga0207663_10000378
1791 Ga0207660_10039611
1792 Ga0207660_10062716
1793 Ga0207660_10081737
1794 Ga0207660_10486569
1795 Ga0207660_10566556
1796 Ga0207662_10038932
1797 Ga0207662_10111707
1798 Ga0207662_10226097
1799 Ga0207662_10837205
1800 Ga0207657_10039767
1801 Ga0207657_10153911
1802 Ga0207649_10030401
1803 Ga0207649_10136017
1804 Ga0207652_10064351
1805 Ga0207652_10080291
1806 Ga0207652_10191538
1807 Ga0207646_10000526
1808 Ga0207646_10006822
1809 Ga0207646_10100620
1810 Ga0207646_10173093
1811 Ga0207646_10201312
1812 Ga0207646_10204459
1813 Ga0207646_10209409
1814 Ga0207646_10252178
1815 Ga0207646_10258532
1816 Ga0207646_10805982
1817 Ga0207681_10001298
1818 Ga0207681_10024112
1819 Ga0207681_10039019
1820 Ga0207681_10049312
1821 Ga0207681_10194576
1822 Ga0207681_10530021
1823 Ga0207681_10541064
1824 Ga0207694_10013071
1825 Ga0207650_10000022
1826 Ga0207650_10021215
1827 Ga0207650_10172447
1828 Ga0207650_10216123
1829 Ga0207650_10618080
1830 Ga0207659_10256660
1831 Ga0207687_10016424
1832 Ga0207687_10293202
1833 Ga0207687_10778589
1834 Ga0207644_10000150
1835 Ga0207644_10017838
1836 Ga0207644_10038815
1837 Ga0207644_10058474
1838 Ga0207644_10092499
1839 Ga0207644_10297028
1840 Ga0207690_10089431
1841 Ga0207690_10319239
1842 Ga0207690_10381829
1843 Ga0207706_10015714
1844 Ga0207706_10080710
1845 Ga0207706_10123295
1846 Ga0207706_10318902
1847 Ga0207686_10000017
1848 Ga0207686_10000071
1849 Ga0207686_10033243
1850 Ga0207686_10430063
1851 Ga0207709_10000024
1852 Ga0207709_10000925
1853 Ga0207709_10019745
1854 Ga0207709_10025662
1855 Ga0207709_10042089
1856 Ga0207709_10502818
1857 Ga0207709_10540755
1858 Ga0207670_10022836
1859 Ga0207670_10091856
1860 Ga0207670_10096009
1861 Ga0207670_10173278
1862 Ga0207670_10278548
1863 Ga0207669_10049512
1864 Ga0207669_10124614
1865 Ga0207704_10204144
1866 Ga0207704_10230087
1867 Ga0207704_10567585
1868 Ga0207665_10000001
1869 Ga0207665_10067057
1870 Ga0207665_10640087
1871 Ga0207691_10001779
1872 Ga0207691_10183034
1873 Ga0207691_10217220
1874 Ga0207691_10244131
1875 Ga0207711_10006083
1876 Ga0207711_10034278
1877 Ga0207711_10038455
1878 Ga0207711_10043627
1879 Ga0207711_10047336
1880 Ga0207711_10133801
1881 Ga0207711_10274782
1882 Ga0207711_10294142
1883 Ga0207711_10321289
1884 Ga0207689_10003180
1885 Ga0207689_10025238
1886 Ga0207689_10030489
1887 Ga0207689_10066066
1888 Ga0207689_10112548
1889 Ga0207689_10151348
1890 Ga0207689_10485960
1891 Ga0207689_10670089
1892 Ga0207661_10450040
1893 Ga0207661_10617026
1894 Ga0207661_10757276
1895 Ga0207679_10013498
1896 Ga0207679_10016337
1897 Ga0207679_10018072
1898 Ga0207679_10020856
1899 Ga0207679_10392902
1900 Ga0207679_10542885
1901 Ga0207667_10158569
1902 Ga0207667_10651149
1903 Ga0207651_10013023
1904 Ga0207651_10042031
1905 Ga0207651_10052702
1906 Ga0207651_10059092
1907 Ga0207651_10077321
1908 Ga0207651_10323913
1909 Ga0207651_10428490
1910 Ga0207651_10486650
1911 Ga0207712_10000369
1912 Ga0207712_10008642
1913 Ga0207712_10186495
1914 Ga0207712_10189315
1915 Ga0207712_10525190
1916 Ga0207668_10206279
1917 Ga0207640_10048209
1918 Ga0207640_10210371
1919 Ga0207640_10283465
1920 Ga0207640_10332359
1921 Ga0207640_10357739
1922 Ga0207640_10610741
1923 Ga0207640_10643427
1924 Ga0207640_10890504
1925 Ga0207640_11144743
1926 Ga0207658_10157754
1927 Ga0207658_10639838
1928 Ga0207677_10005500
1929 Ga0207677_10034636
1930 Ga0207677_10504915
1931 Ga0207677_11615843
1932 Ga0207703_10000347
1933 Ga0207703_10005027
1934 Ga0207703_10039748
1935 Ga0207703_10044755
1936 Ga0207703_10554206
1937 Ga0207639_10033642
1938 Ga0207639_10347162
1939 Ga0207639_10560900
1940 Ga0207639_11113618
1941 Ga0207678_10029321
1942 Ga0207708_10057190
1943 Ga0207708_10063570
1944 Ga0207708_10069362
1945 Ga0207708_10070579
1946 Ga0207708_10074680
1947 Ga0207708_10256114
1948 Ga0207708_10340891
1949 Ga0207702_10257092
1950 Ga0207641_10010442
1951 Ga0207641_10093688
1952 Ga0207641_10172919
1953 Ga0207641_10219968
1954 Ga0207641_10344170
1955 Ga0207648_10003569
1956 Ga0207648_10089004
1957 Ga0207648_10353099
1958 Ga0207648_10398251
1959 Ga0207648_10522741
1960 Ga0207648_10918448
1961 Ga0207676_10003190
1962 Ga0207676_10024012
1963 Ga0207676_10032524
1964 Ga0207676_10035981
1965 Ga0207676_10178473
1966 Ga0207676_10369944
1967 Ga0207676_10392922
1968 Ga0207676_10425327
1969 Ga0207676_10568513
1970 Ga0207674_10009973
1971 Ga0207674_10042905
1972 Ga0207674_10124110
1973 Ga0207674_10257990
1974 Ga0207674_10559993
1975 Ga0207675_100002016
1976 Ga0207675_100012755
1977 Ga0207675_100084372
1978 Ga0207675_100088793
1979 Ga0207675_100112237
1980 Ga0207675_100235032
1981 Ga0207675_100244639
1982 Ga0207675_100577671
1983 Ga0207675_100602549
1984 Ga0207683_10019864
1985 Ga0207683_10123531
1986 Ga0207698_10025090
1987 Ga0207698_10040970
1988 Ga0207698_10072718
1989 Ga0207698_10077330
1990 Ga0207698_10103043
1991 Ga0207698_10983787
1992 Ga0209970_1030317
1993 Ga0209588_1027416
1994 Ga0207428_10003511
1995 Ga0207428_10020981
1996 Ga0207428_10027745
1997 Ga0268265_10027691
1998 Ga0268265_10034426
1999 Ga0268265_10110999
2000 Ga0268265_10139224
2001 Ga0268265_10148577
2002 Ga0268265_10567282
2003 Ga0268265_10748287
2004 Ga0268265_10756202
2005 Ga0268265_10954441
2006 Ga0268264_10011885
2007 Ga0268264_10061070
2008 Ga0268264_10109639
2009 Ga0268264_10129705
2010 Ga0268264_10151912
2011 Ga0268264_10195902
2012 Ga0268264_10394242
2013 Ga0307515_10272813
2014 Ga0307513_10002308
2015 Ga0307509_10312526
2016 Ga0307408_100000226
2017 Ga0307408_100009344
2018 Ga0307408_100025187
2019 Ga0316576_10058793
2020 Ga0307405_10089042
2021 Ga0307405_10205406
2022 Ga0307405_10240452
2023 Ga0307413_10001757
2024 Ga0307413_10042073
2025 Ga0307413_10059817
2026 Ga0307413_10929632
2027 Ga0307410_10005457
2028 Ga0307410_10025234
2029 Ga0307410_10052136
2030 Ga0307410_10071324
2031 Ga0307410_10311276
2032 Ga0307410_11068165
2033 Ga0307406_10011266
2034 Ga0307406_10029415
2035 Ga0307406_10474722
2036 Ga0307407_10000158
2037 Ga0307407_10001823
2038 Ga0307407_10007401
2039 Ga0307407_10137275
2040 Ga0307412_10002936
2041 Ga0307412_10027824
2042 Ga0307412_10039897
2043 Ga0307412_10073175
2044 Ga0307412_10381130
2045 Ga0307409_100003461
2046 Ga0307409_100047033
2047 Ga0307409_100272383
2048 Ga0307416_100019635
2049 Ga0307416_100115357
2050 Ga0307416_100302239
2051 Ga0307416_100302376
2052 Ga0307416_101092189
2053 Ga0307416_101493415
2054 Ga0307414_10031804
2055 Ga0307414_10059423
2056 Ga0307414_10059526
2057 Ga0307414_10641210
2058 Ga0307414_10719524
2059 Ga0307414_10725764
2060 Ga0307411_10004219
2061 Ga0307411_10008074
2062 Ga0307411_10012138
2063 Ga0307411_10120210
2064 Ga0307411_10121380
2065 Ga0307411_10547239
2066 Ga0307411_10594634
2067 Ga0307411_11548248
2068 Ga0307415_100026961
2069 Ga0307415_100035137
2070 Ga0307415_100061152
2071 Ga0307415_100097125
2072 Ga0307415_100288520
2073 Ga0307415_100386400
2074 Ga0307415_100472078
2075 Ga0373931_0285546
2076 Ga0395900_0187863
2077 Ga0395900_0291097
2078 Ga0395905_0004483
2079 Ga0395905_0077903
2080 Ga0395905_0592823
2081 Ga0395905_0842468
2082 Ga0395901_0115625
2083 Ga0395901_0484084
2084 Ga0436365_0160602
2085 Ga0436365_0227208
2086 Ga0436365_0597228
2087 Ga0436365_1695306
2088 Ga0436363_0862232
2089 Ga0436362_0661244
2090 Ga0436362_1215482
2091 Ga0439439_0101168
2092 Ga0439453_0046745
2093 Ga0451853_3419890
2094 Ga0439448_0007683
2095 Ga0439457_036817
2096 Ga0450892_003984
2097 Ga0439446_0173275
2098 Ga0439458_0000902
2099 Ga0439434_0008711
2100 Ga0451577_0009471
2101 Ga0451577_0402549
2102 Ga0466957_0231009
2103 Ga0451576_0009811
2104 Ga0451576_0011416
2105 Ga0451576_0186350
2106 Ga0451576_0203316
2107 Ga0451576_0221642
2108 Ga0495662_0039589
2109 Ga0495643_0018815
2110 Ga0495663_0001543
2111 Ga0495666_0421143
2112 Ga0495652_0774085
2113 Ga0495598_0000708
2114 Ga0495598_0080244
2115 Ga0495621_0001031
2116 Ga0495621_0194890
2117 Ga0495668_0542315
2118 Ga0495634_0082741
2119 Ga0495635_0138070
2120 Ga0495669_0039629
2121 Ga0495670_0033048
2122 Ga0495600_0017139
2123 Ga0495581_0499315
2124 Ga0495636_0182323
2125 Ga0495636_0192205
2126 Ga0495672_0048691
2127 Ga0495684_0130474
2128 Ga0495614_0231005
2129 Ga0496100_0895164
2130 Ga0496104_0273660
2131 Ga0496106_0004885
2132 Ga0496107_0113063
2133 Ga0496108_1060879
2134 Ga0496109_0000074
2135 Ga0496109_0187060
2136 Ga0496111_0258834
2137 Ga0496112_0290594
2138 Ga0496113_0291423
2139 Ga0496114_0045617
2140 Ga0501041_0617794
2141 Ga0501042_0328586
2142 Ga0501043_0124345
2143 Ga0501048_0353855
2144 Ga0501068_0198964
2145 Ga0501071_0120209
2146 Ga0501071_0153567
2147 Ga0501072_0013011
2148 Ga0501072_0191723
2149 Ga0501074_0075573
2150 Ga0501074_0481456
2151 Ga0501074_0569401
2152 Ga0501075_0033314
2153 Ga0501075_0738212
2154 Ga0501077_0092539
2155 Ga0501077_0305414
2156 Ga0501209_016500
2157 Ga0501217_054313
2158 Ga0501235_025158
2159 Ga0501239_001186
2160 Ga0501258_003128
2161 Ga0501225_0029803
2162 Ga0501225_0085368
2163 Ga0501245_005243
2164 Ga0501079_0055592
2165 Ga0501079_0363290
2166 Ga0501079_0851773
2167 Ga0501081_0078482
2168 Ga0501241_000634
2169 Ga0501268_002452
2170 Ga0501273_029173
2171 Ga0501045_0024194
2172 nmdc:mga05p37_110262_c1
2173 nmdc:mga05p37_119651_c1
2174 nmdc:mga05p37_140947_c1
2175 nmdc:mga05p37_25810_c1
2176 nmdc:mga05p37_283711_c1
2177 nmdc:mga05p37_284559_c1
2178 nmdc:mga05p37_454536_c1
2179 nmdc:mga05p37_54396_c1
2180 nmdc:mga05p37_624654_c1
2181 nmdc:mga09592_303364_c1
2182 nmdc:mga09592_96037_c1
2183 nmdc:mga06r32_123811_c1
2184 nmdc:mga06r32_13719_c1
2185 nmdc:mga06r32_170272_c1
2186 nmdc:mga06r32_37845_c1
2187 nmdc:mga06r32_385414_c1
2188 nmdc:mga06r32_547950_c1
2189 nmdc:mga08y16_175992_c1
2190 nmdc:mga08y16_24123_c1
2191 nmdc:mga08y16_293658_c1
2192 nmdc:mga08y16_5057_c1
2193 nmdc:mga08y16_60736_c1
2194 nmdc:mga0n895_1089738_c1
2195 nmdc:mga0n895_1266176_c1
2196 nmdc:mga0n895_192582_c1
2197 nmdc:mga0n895_216197_c1
2198 nmdc:mga0n895_253820_c1
2199 nmdc:mga0n895_333130_c1
2200 nmdc:mga0n895_472312_c1
2201 nmdc:mga0rr50_131639_c1
2202 nmdc:mga0rr50_53311_c1
2203 nmdc:mga0rr50_89679_c1
2204 nmdc:mga0rr50_936_c1
2205 nmdc:mga08x19_106872_c1
2206 nmdc:mga08x19_56_c1
2207 nmdc:mga08x19_79956_c1
2208 nmdc:mga0a205_108796_c1
2209 nmdc:mga0a205_24987_c1
2210 nmdc:mga0a205_369928_c1
2211 nmdc:mga0a205_383693_c1
2212 nmdc:mga0a205_393043_c1
2213 nmdc:mga0a205_46413_c1
2214 nmdc:mga0a205_94111_c1
2215 Ga0500555_003854
2216 Ga0500577_0003834
2217 Ga0501084_0046143
2218 Ga0501084_1185346
2219 Ga0501084_1363858
2220 Ga0587101_059941
2221 Ga0501082_0110444
2222 Ga0501082_0277248
2223 Ga0501082_0705684
2224 Ga0530510_0022853
2225 Ga0530510_0234204
2226 Ga0530510_0332146
2227 2511235088
2228 2585159046
2229 2585163367
2230 2740033866
2231 2740060289
2232 2839989799
2233 2890805939
2234 2910249582

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01195

Pept_tRNA_hydro

Peptidyl-tRNA hydrolase

25

208

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ryb-assembly1.cif.gz_A crystal structure of the chloroplast group ii intron splicing factor crs2 0.9531 10 185
4yly-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from a gram-positive bacterium, staphylococcus aureus at 2.25 angstrom resolution 0.9448 11 194
3p2j-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from mycobacterium smegmatis at 2.2 a resolution 0.9413 9 194
7brd-assembly1.cif.gz_A crystal structure of peptidyl-trna hydrolase from klebsiella pneumoniae 0.9376 10 193
4yly-assembly2.cif.gz_B crystal structure of peptidyl-trna hydrolase from a gram-positive bacterium, staphylococcus aureus at 2.25 angstrom resolution 0.9373 11 194
ID Description Score Start End Superfamily
4ylyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9448 11 194 3.40.50.1470
af_Q54V95_265_452_3.40.50.1470 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9396 69 194 3.40.50.1470
1rynA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9312 10 192 3.40.50.1470
4q55B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9274 11 194 3.40.50.1470
3neaA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Peptidyl-tRNA hydrolase 0.9081 8 190 3.40.50.1470
ID Description Score Start End GO Terms
AF-Q01QR3-F1-model_v4 Peptidyl-tRNA hydrolase (Pth) (EC 3.1.1.29) 0.987 11 194 GO:0004045
GO:0005737
GO:0006412
AF-G2LJA4-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9865 11 194 GO:0004045
GO:0005737
GO:0006412
AF-A0A2V9BGU7-F1-model_v4 Aminoacyl-tRNA hydrolase 0.9841 95 194 GO:0004045
AF-A0A524LSD2-F1-model_v4 Peptidyl-tRNA hydrolase (PTH) (EC 3.1.1.29) 0.9752 11 194 GO:0004045
GO:0005737
GO:0006412
AF-A0A7C3I460-F1-model_v4 peptidyl-tRNA hydrolase (EC 3.1.1.29) 0.9748 101 194 GO:0004045

Map