F490337

General Info

Members Datasets Scaffolds Average Seq Length
1118 404 2236 197

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10936705|Ga0105241_109367051
Length 236
Sequence MNVVLVDAGGGTALDHPVVADADVEVVGVALQRAPERLVGLAAVLIDAGGANLGSVRYALERLGATVKLVRDAEGLAGAQRVILPGVGAAGPGMARLRELGLVELLRSLKQPVLGVCLGMQLLFDRSEEAGVDTLGLIPGVVRKLVPACGIRVPHMGWNLLSAKQAHPLLAGLGGDEQAYFVHSYAVPVGDWTLASSDYGEAFSAVIARDNYYGMQFHPERSAAVGAKLLKSFLEL

Samples

Sample ID Description Type Environment
1 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
10 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
11 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
12 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
13 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
14 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
17 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
18 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
19 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
20 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
21 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
22 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
23 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
24 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
25 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
26 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
27 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
28 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
29 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
30 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
31 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
32 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
33 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
34 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
35 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
36 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
37 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
38 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
39 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
40 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
41 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
42 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
43 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
44 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
45 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
46 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
47 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
48 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
49 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
50 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
51 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
52 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
53 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
54 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
55 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
56 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
57 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
58 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
59 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
60 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
61 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
62 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
65 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
83 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
84 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
85 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
92 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
120 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
121 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
122 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
123 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
124 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
127 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
130 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
131 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
133 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
134 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
135 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
138 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
139 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
140 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
144 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
147 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
149 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
207 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
208 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
209 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
210 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
211 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
212 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
213 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
214 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
215 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
216 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
217 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
218 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
219 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
220 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
221 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
222 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
223 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
224 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
225 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
226 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
227 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
228 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
229 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
230 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
231 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
232 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
233 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
234 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
235 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
236 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
237 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
238 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
239 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
240 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
241 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
242 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
243 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
244 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
245 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
246 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
247 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
248 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
249 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
250 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
251 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
252 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
253 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
254 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
255 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
256 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
257 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
258 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
259 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
260 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
261 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
262 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
263 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
264 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
265 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
266 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
267 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
268 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
269 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
270 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
271 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
272 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
273 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
274 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
275 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
276 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
277 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
278 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
279 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
280 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
281 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
282 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
283 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
284 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
285 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
286 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
287 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
288 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
289 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
290 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
291 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
292 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
293 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
294 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
295 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
296 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
297 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
298 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
299 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
300 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
301 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
302 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
303 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
304 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
305 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
306 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
307 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
308 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
309 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
310 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
311 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
312 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
313 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
314 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
315 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
316 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
317 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
318 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
319 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
320 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
321 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
334 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
335 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
336 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
337 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
338 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
339 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
340 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
341 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
342 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
343 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
345 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
346 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
347 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
348 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
349 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
350 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
351 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
352 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
353 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
354 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
355 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
356 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
357 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
358 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
359 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
360 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
361 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
362 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
363 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
364 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
365 2739367700 Dyella sp. YR388 Isolate Unclassified
366 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
367 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
368 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
369 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
370 2818991457 Xanthomonas translucens 569 Isolate Unclassified
371 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
372 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
373 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
374 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
375 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
376 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
377 2884411467 Dyella sp. AD56 Isolate Rhizosphere
378 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
379 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
380 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
381 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
382 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
383 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
384 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
385 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
386 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
387 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
388 2928963466 Dyella japonica 1073 Isolate Unclassified
389 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
390 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
391 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
392 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
393 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
394 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
395 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
396 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
397 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
398 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
399 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
400 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
401 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
402 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
403 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
404 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.53
Metatranscriptomes 0.36
Isolates 4.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.68
Nodule 0.09
Rhizoplane 3.13
Rhizosphere 76.3
Stem 0
Stem Tuber 0
Unclassified 0.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105241_10936705 3300009174 Bacteria 806
2 SwRhRL2b_contig_2191643 2162886007 Bacteria 1273
3 SwRhRL2b_contig_3936045 2162886007 Bacteria 1173
4 JGI24736J21556_1000339 3300001904 Bacteria 8765
5 JGI24739J22299_10000040 3300001989 Bacteria 35361
6 JGI24739J22299_10056009 3300001989 Bacteria 1259
7 JGI24737J22298_10002132 3300001990 Bacteria 7051
8 JGI24737J22298_10002784 3300001990 Bacteria 6194
9 JGI25156J39149_1010714 3300002705 Bacteria 2134
10 JGI25162J39368_1000395 3300002737 Bacteria 36803
11 JGI25162J39368_1000684 3300002737 Bacteria 23728
12 JGI25162J39368_1002286 3300002737 Bacteria 7726
13 JGI25157J39369_1000081 3300002741 Bacteria 85798
14 JGI25157J39369_1000547 3300002741 Bacteria 22506
15 JGI25163J39215_1000313 3300002771 Bacteria 16376
16 JGI25164J39214_1000028 3300002772 Bacteria 150310
17 JGI25164J39214_1000338 3300002772 Bacteria 29675
18 JGI25164J39214_1000416 3300002772 Bacteria 24162
19 JGI25152J39213_1001386 3300002773 Bacteria 10503
20 JGI25150J39212_1000817 3300002774 Bacteria 10499
21 JGI25151J46595_10001867 3300003187 Bacteria 13477
22 JGI25165J46597_1000108 3300003214 Bacteria 150310
23 JGI25165J46597_1000513 3300003214 Bacteria 36803
24 JGI25165J46597_1003664 3300003214 Bacteria 3673
25 JGI25153J46596_10000167 3300003215 Bacteria 66040
26 JGI25153J46596_10003689 3300003215 Bacteria 8469
27 rootH1_10048199 3300003316 Bacteria 3478
28 rootH2_10026728 3300003320 Bacteria 23571
29 rootH1_10048164 3300003323 Bacteria 1855
30 rootH1_10103103 3300003323 Bacteria 1709
31 rootH1_10162681 3300003323 Bacteria 3348
32 Ga0006562J51391_1011160 3300003578 Bacteria 7470
33 Ga0006562J51391_1011163 3300003578 Bacteria 2930
34 Ga0055539_1001625 3300003752 Bacteria 4033
35 Ga0055535_1000771 3300003761 Bacteria 23731
36 Ga0055542_1000772 3300003762 Bacteria 24080
37 Ga0055542_1000787 3300003762 Bacteria 23728
38 Ga0055529_1000078 3300003763 Bacteria 150310
39 Ga0055526_1000268 3300003771 Bacteria 43933
40 Ga0055537_1000348 3300003773 Bacteria 31460
41 Ga0055536_1001728 3300003781 Bacteria 12918
42 Ga0055536_1008641 3300003781 Bacteria 4339
43 Ga0055534_1000043 3300003784 Bacteria 99338
44 Ga0055528_1000065 3300003790 Bacteria 85294
45 Ga0055530_10001974 3300003791 Bacteria 13958
46 Ga0055530_10002320 3300003791 Bacteria 12437
47 Ga0055540_1037333 3300003792 Bacteria 1072
48 Ga0055531_10010116 3300003794 Bacteria 4734
49 Ga0055531_10011251 3300003794 Bacteria 4342
50 Ga0055531_10011262 3300003794 Bacteria 4339
51 Ga0058692_1000031 3300003856 Bacteria 188488
52 Ga0058692_1000060 3300003856 Bacteria 98866
53 Ga0065704_10070367 3300005289 Bacteria 29287
54 Ga0065704_10134021 3300005289 Bacteria 1593
55 Ga0070658_10097525 3300005327 Bacteria 2427
56 Ga0070658_10212515 3300005327 Bacteria 1634
57 Ga0070658_10343262 3300005327 Bacteria 1277
58 Ga0070658_10371877 3300005327 Bacteria 1225
59 Ga0070658_10473418 3300005327 Bacteria 1080
60 Ga0070676_10257509 3300005328 Bacteria 1167
61 Ga0070683_100048684 3300005329 Bacteria 3919
62 Ga0070683_100814161 3300005329 Bacteria 895
63 Ga0070690_100175666 3300005330 Bacteria 1477
64 Ga0070670_100007794 3300005331 Bacteria 9111
65 Ga0070666_10000388 3300005335 Bacteria 27657
66 Ga0070666_10058900 3300005335 Bacteria 2597
67 Ga0070666_10254484 3300005335 Bacteria 1244
68 Ga0070682_100023945 3300005337 Bacteria 3629
69 Ga0070682_100179353 3300005337 Bacteria 1478
70 Ga0070660_100019590 3300005339 Bacteria 4960
71 Ga0070660_100061965 3300005339 Bacteria 2905
72 Ga0070660_100156685 3300005339 Bacteria 1833
73 Ga0070660_100865117 3300005339 Bacteria 761
74 Ga0070660_101054913 3300005339 Bacteria 687
75 Ga0070689_100010930 3300005340 Bacteria 6487
76 Ga0070691_10112024 3300005341 Bacteria 1366
77 Ga0070691_10196097 3300005341 Bacteria 1059
78 Ga0070661_100037021 3300005344 Bacteria 3549
79 Ga0070661_100038689 3300005344 Bacteria 3474
80 Ga0070661_100084639 3300005344 Bacteria 2343
81 Ga0070661_100139852 3300005344 Bacteria 1824
82 Ga0070661_100257471 3300005344 Bacteria 1348
83 Ga0070661_100384145 3300005344 Bacteria 1107
84 Ga0070661_100459547 3300005344 Bacteria 1014
85 Ga0070692_10044215 3300005345 Bacteria 2293
86 Ga0070692_10215947 3300005345 Bacteria 1131
87 Ga0070668_100112328 3300005347 Bacteria 2170
88 Ga0070669_100020435 3300005353 Bacteria 4729
89 Ga0070669_100224637 3300005353 Bacteria 1486
90 Ga0070675_100119317 3300005354 Bacteria 2240
91 Ga0070671_100013860 3300005355 Bacteria 6504
92 Ga0070671_100306657 3300005355 Bacteria 1352
93 Ga0070674_100031562 3300005356 Bacteria 3511
94 Ga0070674_100133202 3300005356 Bacteria 1856
95 Ga0070674_100300121 3300005356 Bacteria 1280
96 Ga0070673_100096136 3300005364 Bacteria 2430
97 Ga0070673_100506750 3300005364 Bacteria 1092
98 Ga0070673_100669910 3300005364 Bacteria 951
99 Ga0070688_100136001 3300005365 Bacteria 1664
100 Ga0070659_100005797 3300005366 Bacteria 8894
101 Ga0070659_100034565 3300005366 Bacteria 3932
102 Ga0070659_100058107 3300005366 Bacteria 3051
103 Ga0070659_100133964 3300005366 Bacteria 2014
104 Ga0070659_100161313 3300005366 Bacteria 1833
105 Ga0070659_100267417 3300005366 Bacteria 1420
106 Ga0070659_100362442 3300005366 Bacteria 1218
107 Ga0070667_100156091 3300005367 Bacteria 2007
108 Ga0070714_100104775 3300005435 Bacteria 2496
109 Ga0070714_100116833 3300005435 Bacteria 2368
110 Ga0070714_100164743 3300005435 Bacteria 2008
111 Ga0070714_100241691 3300005435 Bacteria 1667
112 Ga0070714_100304389 3300005435 Bacteria 1487
113 Ga0070713_100006097 3300005436 Bacteria 8314
114 Ga0070713_100014588 3300005436 Bacteria 5843
115 Ga0070701_10145876 3300005438 Bacteria 1358
116 Ga0070663_100093093 3300005455 Bacteria 2236
117 Ga0070663_100186336 3300005455 Bacteria 1613
118 Ga0070663_100252768 3300005455 Bacteria 1395
119 Ga0070663_100306505 3300005455 Bacteria 1273
120 Ga0070663_100312998 3300005455 Bacteria 1260
121 Ga0070663_100428567 3300005455 Bacteria 1086
122 Ga0070663_100638384 3300005455 Bacteria 899
123 Ga0070678_100568995 3300005456 Bacteria 1008
124 Ga0070662_100012504 3300005457 Bacteria 5629
125 Ga0070662_100127321 3300005457 Bacteria 1959
126 Ga0070662_100208443 3300005457 Bacteria 1554
127 Ga0070662_100655373 3300005457 Bacteria 886
128 Ga0070662_100771357 3300005457 Bacteria 816
129 Ga0070679_100019902 3300005530 Bacteria 6535
130 Ga0070684_100000098 3300005535 Bacteria 56167
131 Ga0070684_100208421 3300005535 Bacteria 1781
132 Ga0068853_100007676 3300005539 Bacteria 8648
133 Ga0068853_100050236 3300005539 Bacteria 3587
134 Ga0068853_100161588 3300005539 Bacteria 2022
135 Ga0068853_100200769 3300005539 Bacteria 1815
136 Ga0068853_100360905 3300005539 Bacteria 1353
137 Ga0068853_100361954 3300005539 Bacteria 1351
138 Ga0070696_100005210 3300005546 Bacteria 8690
139 Ga0070696_100052356 3300005546 Bacteria 2840
140 Ga0070693_100051465 3300005547 Bacteria 2359
141 Ga0070693_100065349 3300005547 Bacteria 2126
142 Ga0070665_100003847 3300005548 Bacteria 15889
143 Ga0070665_100022951 3300005548 Bacteria 6283
144 Ga0070665_100499008 3300005548 Bacteria 1228
145 Ga0068855_100002059 3300005563 Bacteria 24913
146 Ga0068855_100005690 3300005563 Bacteria 15228
147 Ga0068855_100020597 3300005563 Bacteria 7909
148 Ga0068855_100080776 3300005563 Bacteria 3770
149 Ga0068855_100082253 3300005563 Bacteria 3732
150 Ga0068855_100092531 3300005563 Bacteria 3487
151 Ga0068855_100107211 3300005563 Bacteria 3210
152 Ga0068855_100399958 3300005563 Bacteria 1505
153 Ga0068855_100624049 3300005563 Bacteria 1160
154 Ga0070664_100091821 3300005564 Bacteria 2628
155 Ga0068857_100000511 3300005577 Bacteria 27856
156 Ga0068857_100004075 3300005577 Bacteria 12305
157 Ga0068857_100004673 3300005577 Bacteria 11601
158 Ga0068857_100042446 3300005577 Bacteria 4035
159 Ga0068857_100059143 3300005577 Bacteria 3404
160 Ga0068857_100380365 3300005577 Bacteria 1311
161 Ga0068854_100001254 3300005578 Bacteria 15235
162 Ga0068854_100009920 3300005578 Bacteria 6161
163 Ga0068854_100027013 3300005578 Bacteria 3951
164 Ga0068854_100036209 3300005578 Bacteria 3459
165 Ga0068854_100063684 3300005578 Bacteria 2677
166 Ga0068854_100148510 3300005578 Bacteria 1805
167 Ga0068854_100231495 3300005578 Bacteria 1467
168 Ga0068856_100001449 3300005614 Bacteria 24884
169 Ga0068856_100008083 3300005614 Bacteria 10271
170 Ga0068856_100020139 3300005614 Bacteria 6480
171 Ga0068856_100217728 3300005614 Bacteria 1925
172 Ga0068856_100923512 3300005614 Bacteria 891
173 Ga0068852_100003835 3300005616 Bacteria 10557
174 Ga0068852_100037468 3300005616 Bacteria 4066
175 Ga0068852_100105743 3300005616 Bacteria 2550
176 Ga0068852_100243143 3300005616 Bacteria 1721
177 Ga0068852_100357589 3300005616 Bacteria 1427
178 Ga0068852_100453352 3300005616 Bacteria 1270
179 Ga0068852_100488648 3300005616 Bacteria 1224
180 Ga0068852_100505328 3300005616 Bacteria 1204
181 Ga0068859_100419067 3300005617 Bacteria 1435
182 Ga0068864_100028252 3300005618 Bacteria 4739
183 Ga0068864_100067635 3300005618 Bacteria 3102
184 Ga0068866_10183996 3300005718 Bacteria 1236
185 Ga0068863_100000991 3300005841 Bacteria 28498
186 Ga0068863_100001728 3300005841 Bacteria 21634
187 Ga0068863_100156943 3300005841 Bacteria 2178
188 Ga0068863_101395398 3300005841 Bacteria 708
189 Ga0068858_100013472 3300005842 Bacteria 7715
190 Ga0068860_100017406 3300005843 Bacteria 7002
191 Ga0068860_100043436 3300005843 Bacteria 4288
192 Ga0068860_100061662 3300005843 Bacteria 3563
193 Ga0068860_100522419 3300005843 Bacteria 1187
194 Ga0068862_100055198 3300005844 Bacteria 3403
195 Ga0068862_100057171 3300005844 Bacteria 3344
196 Ga0081539_10029649 3300005985 Bacteria 3413
197 Ga0075364_10000075 3300006051 Bacteria 38780
198 Ga0075364_10017738 3300006051 Bacteria 4452
199 Ga0075364_10033599 3300006051 Bacteria 3304
200 Ga0075364_10045173 3300006051 Bacteria 2867
201 Ga0075362_10034213 3300006177 Bacteria 2214
202 Ga0075367_10107375 3300006178 Bacteria 1711
203 Ga0075369_10031861 3300006186 Bacteria 2228
204 Ga0075366_10183309 3300006195 Bacteria 1272
205 Ga0075366_10204202 3300006195 Bacteria 1202
206 Ga0097621_100107133 3300006237 Bacteria 2358
207 Ga0097621_100411855 3300006237 Bacteria 1212
208 Ga0068871_100027620 3300006358 Bacteria 4440
209 Ga0075428_100534850 3300006844 Bacteria 1253
210 Ga0075428_100836136 3300006844 Bacteria 978
211 Ga0068865_100491865 3300006881 Bacteria 1021
212 Ga0097620_100419059 3300006931 Bacteria 1435
213 Ga0099794_10049341 3300007265 Bacteria 2023
214 Ga0105251_10000684 3300009011 Bacteria 31292
215 Ga0105251_10010358 3300009011 Bacteria 5416
216 Ga0105240_10003424 3300009093 Bacteria 24649
217 Ga0105240_10009039 3300009093 Bacteria 14150
218 Ga0105240_10014865 3300009093 Bacteria 10609
219 Ga0105240_10020015 3300009093 Bacteria 8934
220 Ga0105240_10030261 3300009093 Bacteria 7037
221 Ga0105240_10031164 3300009093 Bacteria 6919
222 Ga0105240_10164754 3300009093 Bacteria 2630
223 Ga0105240_10172954 3300009093 Bacteria 2556
224 Ga0105240_10239123 3300009093 Bacteria 2106
225 Ga0105240_10414486 3300009093 Bacteria 1515
226 Ga0105240_10575495 3300009093 Bacteria 1243
227 Ga0105240_10977755 3300009093 Bacteria 906
228 Ga0111539_10409346 3300009094 Bacteria 1580
229 Ga0111539_11273889 3300009094 Bacteria 853
230 Ga0105245_10543037 3300009098 Bacteria 1184
231 Ga0105245_11213042 3300009098 Bacteria 802
232 Ga0114129_10815943 3300009147 Bacteria 1189
233 Ga0105243_10012752 3300009148 Bacteria 6349
234 Ga0105243_10096358 3300009148 Bacteria 2447
235 Ga0105241_10083769 3300009174 Bacteria 2502
236 Ga0105241_10098806 3300009174 Bacteria 2317
237 Ga0105241_10879278 3300009174 Bacteria 831
238 Ga0105248_10084810 3300009177 Bacteria 3564
239 Ga0105248_10183860 3300009177 Bacteria 2355
240 Ga0105248_10686207 3300009177 Bacteria 1155
241 Ga0105237_10000023 3300009545 Bacteria 226144
242 Ga0105237_10000595 3300009545 Bacteria 50470
243 Ga0105237_10282236 3300009545 Bacteria 1663
244 Ga0105237_10363183 3300009545 Bacteria 1452
245 Ga0105237_10420762 3300009545 Bacteria 1341
246 Ga0105238_10005372 3300009551 Bacteria 12662
247 Ga0105238_10005720 3300009551 Bacteria 12290
248 Ga0105238_10104398 3300009551 Bacteria 2815
249 Ga0105238_10113419 3300009551 Bacteria 2690
250 Ga0105238_10747423 3300009551 Bacteria 992
251 Ga0105238_11270837 3300009551 Bacteria 762
252 Ga0105249_10064480 3300009553 Bacteria 3368
253 Ga0105032_109395 3300009979 Bacteria 799
254 Ga0105239_10000022 3300010375 Bacteria 257744
255 Ga0105239_10039292 3300010375 Bacteria 5184
256 Ga0105239_10049113 3300010375 Bacteria 4627
257 Ga0105239_10074918 3300010375 Bacteria 3721
258 Ga0105239_10078397 3300010375 Bacteria 3635
259 Ga0105239_10451297 3300010375 Bacteria 1459
260 Ga0105239_10625658 3300010375 Bacteria 1228
261 Ga0105239_10636726 3300010375 Bacteria 1217
262 Ga0105246_10004902 3300011119 Bacteria 8154
263 Ga0105246_10023433 3300011119 Bacteria 3994
264 Ga0157314_1000105 3300012500 Bacteria 8981
265 Ga0157373_10027400 3300013100 Bacteria 4110
266 Ga0157373_10044297 3300013100 Bacteria 3177
267 Ga0157373_10075101 3300013100 Bacteria 2385
268 Ga0157373_10115399 3300013100 Bacteria 1888
269 Ga0157373_10462764 3300013100 Bacteria 914
270 Ga0157371_10002070 3300013102 Bacteria 19660
271 Ga0157371_10002097 3300013102 Bacteria 19462
272 Ga0157371_10005020 3300013102 Bacteria 11339
273 Ga0157371_10005924 3300013102 Bacteria 10208
274 Ga0157371_10021458 3300013102 Bacteria 4742
275 Ga0157371_10024187 3300013102 Bacteria 4437
276 Ga0157371_10036564 3300013102 Bacteria 3516
277 Ga0157371_10049262 3300013102 Bacteria 2993
278 Ga0157371_10165528 3300013102 Bacteria 1579
279 Ga0157371_10741917 3300013102 Unclassified 737
280 Ga0157370_10000707 3300013104 Bacteria 41767
281 Ga0157370_10001239 3300013104 Bacteria 31925
282 Ga0157370_10009476 3300013104 Bacteria 10395
283 Ga0157370_10025187 3300013104 Bacteria 5890
284 Ga0157370_10045181 3300013104 Bacteria 4227
285 Ga0157370_10082267 3300013104 Bacteria 3029
286 Ga0157370_10104116 3300013104 Bacteria 2656
287 Ga0157370_10177749 3300013104 Bacteria 1978
288 Ga0157370_10187919 3300013104 Bacteria 1918
289 Ga0157370_10289114 3300013104 Bacteria 1514
290 Ga0157370_10471752 3300013104 Bacteria 1153
291 Ga0157369_10000239 3300013105 Bacteria 76144
292 Ga0157369_10005861 3300013105 Bacteria 14272
293 Ga0157369_10011860 3300013105 Bacteria 9898
294 Ga0157369_10026692 3300013105 Bacteria 6404
295 Ga0157369_10076617 3300013105 Bacteria 3585
296 Ga0157369_10087931 3300013105 Bacteria 3317
297 Ga0157369_10095626 3300013105 Bacteria 3169
298 Ga0157369_10128439 3300013105 Bacteria 2687
299 Ga0157369_10164684 3300013105 Bacteria 2339
300 Ga0157369_10297926 3300013105 Bacteria 1678
301 Ga0157369_10337263 3300013105 Bacteria 1566
302 Ga0157369_10690381 3300013105 Bacteria 1051
303 Ga0157374_10010711 3300013296 Bacteria 7898
304 Ga0157378_10272408 3300013297 Bacteria 1628
305 Ga0157378_10673704 3300013297 Bacteria 1052
306 Ga0157372_10008488 3300013307 Bacteria 10902
307 Ga0157372_10126760 3300013307 Bacteria 2936
308 Ga0157372_10151239 3300013307 Bacteria 2679
309 Ga0157372_10382008 3300013307 Bacteria 1641
310 Ga0157372_10455589 3300013307 Bacteria 1491
311 Ga0157372_11018677 3300013307 Bacteria 959
312 Ga0157372_11312997 3300013307 Bacteria 835
313 Ga0157375_11021767 3300013308 Bacteria 966
314 Ga0157375_11987819 3300013308 Bacteria 691
315 Ga0163163_10000597 3300014325 Bacteria 31566
316 Ga0163163_10000788 3300014325 Bacteria 26861
317 Ga0163163_10007998 3300014325 Bacteria 9357
318 Ga0163163_10840434 3300014325 Bacteria 982
319 Ga0182008_10000032 3300014497 Bacteria 162985
320 Ga0182008_10053209 3300014497 Bacteria 2005
321 Ga0182008_10111837 3300014497 Bacteria 1353
322 Ga0157377_10170118 3300014745 Bacteria 1362
323 Ga0157379_10003251 3300014968 Bacteria 13770
324 Ga0157376_10840628 3300014969 Bacteria 933
325 Ga0182006_1027840 3300015261 Bacteria 2304
326 Ga0182006_1034584 3300015261 Bacteria 2020
327 Ga0182006_1055039 3300015261 Bacteria 1520
328 Ga0182006_1078117 3300015261 Bacteria 1213
329 Ga0182006_1092595 3300015261 Bacteria 1085
330 Ga0182006_1155977 3300015261 Bacteria 771
331 Ga0182007_10000067 3300015262 Bacteria 82879
332 Ga0182007_10013574 3300015262 Bacteria 3101
333 Ga0182007_10059055 3300015262 Bacteria 1258
334 Ga0182005_1000487 3300015265 Bacteria 20470
335 Ga0182005_1003544 3300015265 Bacteria 5268
336 Ga0183368_1004 3300015687 Bacteria 1211761
337 Ga0163161_10000314 3300017792 Bacteria 41729
338 Ga0163161_10020581 3300017792 Bacteria 4632
339 Ga0163161_10022836 3300017792 Bacteria 4407
340 Ga0163161_10130017 3300017792 Bacteria 1898
341 Ga0206356_10015297 3300020070 Bacteria 2268
342 Ga0206353_10295629 3300020082 Bacteria 1190
343 Ga0209760_100676 3300025207 Bacteria 5407
344 Ga0209784_100047 3300025224 Bacteria 199596
345 Ga0209674_100053 3300025226 Bacteria 323159
346 Ga0207427_100023 3300025231 Bacteria 439725
347 Ga0207427_100115 3300025231 Bacteria 104282
348 Ga0207427_100130 3300025231 Bacteria 94510
349 Ga0207427_101434 3300025231 Bacteria 8642
350 Ga0209437_100015 3300025233 Bacteria 713457
351 Ga0209437_100020 3300025233 Bacteria 656374
352 Ga0209437_100079 3300025233 Bacteria 275948
353 Ga0209437_100276 3300025233 Bacteria 76094
354 Ga0209258_100043 3300025242 Bacteria 380685
355 Ga0209258_101362 3300025242 Bacteria 8861
356 Ga0207425_1000097 3300025245 Bacteria 84719
357 Ga0209646_1001086 3300025246 Bacteria 8118
358 Ga0209646_1001409 3300025246 Bacteria 6528
359 Ga0209646_1005518 3300025246 Bacteria 2199
360 Ga0209026_1000047 3300025250 Bacteria 261867
361 Ga0209026_1000105 3300025250 Bacteria 150738
362 Ga0209026_1000162 3300025250 Bacteria 102867
363 Ga0209026_1004849 3300025250 Bacteria 3822
364 Ga0209677_107553 3300025253 Bacteria 2281
365 Ga0209148_1000002 3300025254 Bacteria 2399500
366 Ga0209148_1000010 3300025254 Bacteria 1265567
367 Ga0209759_1000318 3300025256 Bacteria 63865
368 Ga0209129_1000189 3300025258 Bacteria 84712
369 Ga0209129_1002006 3300025258 Bacteria 10556
370 Ga0209233_1000009 3300025261 Bacteria 1265567
371 Ga0209233_1000020 3300025261 Bacteria 798224
372 Ga0209233_1000121 3300025261 Bacteria 233309
373 Ga0209233_1004374 3300025261 Bacteria 4818
374 Ga0209565_1000063 3300025263 Bacteria 183711
375 Ga0209455_1000020 3300025272 Bacteria 702259
376 Ga0209455_1000560 3300025272 Bacteria 25084
377 Ga0209673_1000065 3300025273 Bacteria 252799
378 Ga0209130_1022608 3300025284 Bacteria 1399
379 Ga0209675_1000011 3300025291 Bacteria 520597
380 Ga0209676_1000011 3300025292 Bacteria 860463
381 Ga0209676_1000068 3300025292 Bacteria 314068
382 Ga0209676_1000804 3300025292 Bacteria 41314
383 Ga0209025_1000054 3300025294 Bacteria 317002
384 Ga0209564_1000433 3300025295 Bacteria 72594
385 Ga0209758_1000062 3300025297 Bacteria 317002
386 Ga0209758_1000959 3300025297 Bacteria 38968
387 Ga0209050_1000239 3300025298 Bacteria 119530
388 Ga0209050_1000599 3300025298 Bacteria 57405
389 Ga0209050_1012752 3300025298 Bacteria 3817
390 Ga0209050_1022399 3300025298 Bacteria 2264
391 Ga0209256_1010810 3300025299 Bacteria 3756
392 Ga0209051_1003250 3300025303 Bacteria 10799
393 Ga0209257_1000014 3300025304 Bacteria 946850
394 Ga0209257_1005372 3300025304 Bacteria 9045
395 Ga0209257_1006688 3300025304 Bacteria 7302
396 Ga0207656_10029913 3300025321 Bacteria 2246
397 Ga0207713_1000806 3300025735 Bacteria 29049
398 Ga0207713_1012433 3300025735 Bacteria 4550
399 Ga0207680_10000227 3300025903 Bacteria 27167
400 Ga0207647_10001844 3300025904 Bacteria 16266
401 Ga0207647_10007732 3300025904 Bacteria 7739
402 Ga0207647_10010023 3300025904 Bacteria 6709
403 Ga0207647_10012011 3300025904 Bacteria 6044
404 Ga0207647_10018195 3300025904 Bacteria 4761
405 Ga0207647_10021257 3300025904 Bacteria 4334
406 Ga0207647_10037022 3300025904 Bacteria 3096
407 Ga0207647_10059981 3300025904 Bacteria 2326
408 Ga0207647_10110117 3300025904 Bacteria 1628
409 Ga0207705_10000003 3300025909 Bacteria 709270
410 Ga0207705_10038222 3300025909 Bacteria 3436
411 Ga0207705_10040692 3300025909 Bacteria 3334
412 Ga0207705_10105804 3300025909 Bacteria 2074
413 Ga0207705_10183601 3300025909 Bacteria 1579
414 Ga0207654_10168043 3300025911 Bacteria 1422
415 Ga0207654_10181440 3300025911 Bacteria 1374
416 Ga0207654_10335523 3300025911 Bacteria 1037
417 Ga0207654_10526933 3300025911 Bacteria 837
418 Ga0207707_10011138 3300025912 Bacteria 7822
419 Ga0207707_10137111 3300025912 Bacteria 2139
420 Ga0207695_10000261 3300025913 Bacteria 133038
421 Ga0207695_10000654 3300025913 Bacteria 68735
422 Ga0207695_10000907 3300025913 Bacteria 53347
423 Ga0207695_10008059 3300025913 Bacteria 13262
424 Ga0207695_10010391 3300025913 Bacteria 11391
425 Ga0207695_10043582 3300025913 Bacteria 4782
426 Ga0207695_10046136 3300025913 Bacteria 4620
427 Ga0207695_10047480 3300025913 Bacteria 4544
428 Ga0207695_10048652 3300025913 Bacteria 4476
429 Ga0207695_10111216 3300025913 Bacteria 2718
430 Ga0207695_10266207 3300025913 Bacteria 1610
431 Ga0207695_10766180 3300025913 Bacteria 845
432 Ga0207671_10000020 3300025914 Bacteria 309636
433 Ga0207671_10000033 3300025914 Bacteria 245869
434 Ga0207671_10000726 3300025914 Bacteria 41902
435 Ga0207671_10010073 3300025914 Bacteria 7836
436 Ga0207662_10255148 3300025918 Bacteria 1152
437 Ga0207657_10031993 3300025919 Bacteria 4758
438 Ga0207657_10082222 3300025919 Bacteria 2703
439 Ga0207657_10207414 3300025919 Bacteria 1574
440 Ga0207657_10689750 3300025919 Bacteria 794
441 Ga0207649_10001485 3300025920 Bacteria 13767
442 Ga0207649_10017022 3300025920 Bacteria 4114
443 Ga0207649_10079824 3300025920 Bacteria 2115
444 Ga0207649_10124865 3300025920 Bacteria 1740
445 Ga0207649_10214274 3300025920 Bacteria 1368
446 Ga0207649_10354522 3300025920 Bacteria 1087
447 Ga0207649_10398768 3300025920 Bacteria 1029
448 Ga0207649_10610356 3300025920 Unclassified 840
449 Ga0207652_10166505 3300025921 Bacteria 1977
450 Ga0207681_10114151 3300025923 Bacteria 1970
451 Ga0207681_10239811 3300025923 Bacteria 1411
452 Ga0207694_10006130 3300025924 Bacteria 9187
453 Ga0207694_10017824 3300025924 Bacteria 5367
454 Ga0207694_10271084 3300025924 Bacteria 1392
455 Ga0207694_10362700 3300025924 Bacteria 1201
456 Ga0207650_10020651 3300025925 Bacteria 4647
457 Ga0207650_10352869 3300025925 Bacteria 1210
458 Ga0207700_10003865 3300025928 Bacteria 8752
459 Ga0207700_10024335 3300025928 Bacteria 4190
460 Ga0207664_10000419 3300025929 Bacteria 30364
461 Ga0207664_10022981 3300025929 Bacteria 4666
462 Ga0207664_10138967 3300025929 Bacteria 2052
463 Ga0207664_10822840 3300025929 Bacteria 835
464 Ga0207644_10000833 3300025931 Bacteria 19607
465 Ga0207644_10002832 3300025931 Bacteria 11181
466 Ga0207690_10000314 3300025932 Bacteria 32801
467 Ga0207690_10000797 3300025932 Bacteria 20327
468 Ga0207690_10008204 3300025932 Bacteria 6196
469 Ga0207690_10034749 3300025932 Bacteria 3250
470 Ga0207690_10043020 3300025932 Bacteria 2970
471 Ga0207690_10119941 3300025932 Bacteria 1909
472 Ga0207690_10155955 3300025932 Bacteria 1697
473 Ga0207690_10215986 3300025932 Bacteria 1465
474 Ga0207690_10255072 3300025932 Bacteria 1357
475 Ga0207690_10447939 3300025932 Bacteria 1037
476 Ga0207706_10006757 3300025933 Bacteria 10606
477 Ga0207706_10064116 3300025933 Bacteria 3235
478 Ga0207706_10083461 3300025933 Bacteria 2809
479 Ga0207706_10254836 3300025933 Bacteria 1532
480 Ga0207709_10001731 3300025935 Bacteria 14693
481 Ga0207709_10006989 3300025935 Bacteria 6307
482 Ga0207670_10006401 3300025936 Bacteria 6526
483 Ga0207669_10044209 3300025937 Bacteria 2615
484 Ga0207669_10678038 3300025937 Bacteria 845
485 Ga0207704_10128325 3300025938 Bacteria 1751
486 Ga0207711_10070123 3300025941 Bacteria 3039
487 Ga0207711_10135700 3300025941 Bacteria 2210
488 Ga0207711_10636030 3300025941 Bacteria 995
489 Ga0207689_10150058 3300025942 Bacteria 1921
490 Ga0207689_10513710 3300025942 Bacteria 1004
491 Ga0207661_10001403 3300025944 Bacteria 16228
492 Ga0207667_10000130 3300025949 Bacteria 115321
493 Ga0207667_10000169 3300025949 Bacteria 95977
494 Ga0207667_10006239 3300025949 Bacteria 14468
495 Ga0207667_10013015 3300025949 Bacteria 9550
496 Ga0207667_10015306 3300025949 Bacteria 8721
497 Ga0207667_10064596 3300025949 Bacteria 3820
498 Ga0207667_10131954 3300025949 Bacteria 2573
499 Ga0207667_10132801 3300025949 Bacteria 2564
500 Ga0207667_10264973 3300025949 Bacteria 1757
501 Ga0207667_10426315 3300025949 Bacteria 1349
502 Ga0207651_10287750 3300025960 Bacteria 1361
503 Ga0207651_10432056 3300025960 Bacteria 1126
504 Ga0207712_10123710 3300025961 Bacteria 1961
505 Ga0207668_10126656 3300025972 Bacteria 1943
506 Ga0207668_10612466 3300025972 Bacteria 950
507 Ga0207640_10000838 3300025981 Bacteria 17511
508 Ga0207640_10000908 3300025981 Bacteria 16632
509 Ga0207640_10001060 3300025981 Bacteria 15224
510 Ga0207640_10104123 3300025981 Bacteria 1997
511 Ga0207640_10237128 3300025981 Bacteria 1407
512 Ga0207677_10062497 3300026023 Bacteria 2583
513 Ga0207677_10354174 3300026023 Bacteria 1231
514 Ga0207677_10371122 3300026023 Bacteria 1205
515 Ga0207703_10076370 3300026035 Bacteria 2778
516 Ga0207639_10001886 3300026041 Bacteria 14081
517 Ga0207639_10033345 3300026041 Bacteria 3798
518 Ga0207639_10118496 3300026041 Bacteria 2171
519 Ga0207639_10306901 3300026041 Bacteria 1405
520 Ga0207639_10316142 3300026041 Bacteria 1385
521 Ga0207678_10004283 3300026067 Bacteria 12797
522 Ga0207678_10009382 3300026067 Bacteria 8612
523 Ga0207678_10012591 3300026067 Bacteria 7432
524 Ga0207678_10071671 3300026067 Bacteria 2971
525 Ga0207678_10077801 3300026067 Bacteria 2841
526 Ga0207678_10246941 3300026067 Bacteria 1528
527 Ga0207678_10250517 3300026067 Bacteria 1517
528 Ga0207678_10261620 3300026067 Bacteria 1483
529 Ga0207678_10467075 3300026067 Bacteria 1098
530 Ga0207678_10608017 3300026067 Bacteria 959
531 Ga0207702_10000456 3300026078 Bacteria 46149
532 Ga0207702_10001809 3300026078 Bacteria 21033
533 Ga0207702_10016985 3300026078 Bacteria 6022
534 Ga0207702_10043331 3300026078 Bacteria 3778
535 Ga0207702_10053697 3300026078 Bacteria 3412
536 Ga0207702_10548603 3300026078 Bacteria 1130
537 Ga0207641_10031254 3300026088 Bacteria 4416
538 Ga0207641_10057113 3300026088 Bacteria 3319
539 Ga0207641_10097631 3300026088 Bacteria 2582
540 Ga0207641_11154779 3300026088 Bacteria 774
541 Ga0207648_10407013 3300026089 Bacteria 1233
542 Ga0207648_11017111 3300026089 Bacteria 776
543 Ga0207676_10018047 3300026095 Bacteria 5122
544 Ga0207676_10747026 3300026095 Bacteria 951
545 Ga0207674_10000132 3300026116 Bacteria 87692
546 Ga0207674_10000971 3300026116 Bacteria 37506
547 Ga0207674_10021327 3300026116 Bacteria 6980
548 Ga0207674_10039041 3300026116 Bacteria 4924
549 Ga0207674_10047238 3300026116 Bacteria 4415
550 Ga0207674_10264604 3300026116 Bacteria 1667
551 Ga0207674_10605584 3300026116 Bacteria 1058
552 Ga0207683_10677450 3300026121 Bacteria 956
553 Ga0207698_10013331 3300026142 Bacteria 5418
554 Ga0207698_10015885 3300026142 Bacteria 5059
555 Ga0207698_10016173 3300026142 Bacteria 5020
556 Ga0207698_10045800 3300026142 Bacteria 3298
557 Ga0207698_10151618 3300026142 Bacteria 2013
558 Ga0207698_10556360 3300026142 Bacteria 1125
559 Ga0209973_1019921 3300027252 Bacteria 883
560 Ga0209371_1000004 3300027312 Bacteria 1098197
561 Ga0209371_1000139 3300027312 Bacteria 120350
562 Ga0209999_1008881 3300027543 Bacteria 1818
563 Ga0209970_1011151 3300027614 Bacteria 1476
564 Ga0209983_1005635 3300027665 Bacteria 2583
565 Ga0209974_10010051 3300027876 Bacteria 3198
566 Ga0268266_10000514 3300028379 Bacteria 54510
567 Ga0268266_10774463 3300028379 Bacteria 926
568 Ga0268265_10175325 3300028380 Bacteria 1837
569 Ga0268265_10271456 3300028380 Bacteria 1513
570 Ga0268265_11381258 3300028380 Bacteria 706
571 Ga0268264_10032658 3300028381 Bacteria 4271
572 Ga0268264_10046584 3300028381 Bacteria 3602
573 Ga0268264_10180457 3300028381 Bacteria 1917
574 Ga0268256_1000005 3300030500 Bacteria 1082342
575 Ga0268256_1000109 3300030500 Bacteria 120350
576 Ga0316176_1166069 3300030732 Bacteria 962
577 Ga0314311_1025340 3300030733 Bacteria 9144
578 Ga0316178_1066114 3300030735 Bacteria 1651
579 Ga0316183_1086976 3300030742 Bacteria 6685
580 Ga0316181_1180556 3300030744 Bacteria 2478
581 Ga0307408_100001207 3300031548 Bacteria 19481
582 Ga0307408_100056195 3300031548 Bacteria 2854
583 Ga0307408_100089274 3300031548 Bacteria 2323
584 Ga0307408_100136374 3300031548 Bacteria 1921
585 Ga0307408_100196370 3300031548 Bacteria 1630
586 Ga0316579_10040992 3300031691 Bacteria 2149
587 Ga0316576_10007734 3300031727 Bacteria 6783
588 Ga0316576_10010970 3300031727 Bacteria 5909
589 Ga0316576_10036293 3300031727 Bacteria 3524
590 Ga0316576_10708104 3300031727 Bacteria 729
591 Ga0316578_10006565 3300031728 Bacteria 5757
592 Ga0307516_10162244 3300031730 Bacteria 1984
593 Ga0307405_10009341 3300031731 Bacteria 5022
594 Ga0307405_10036573 3300031731 Bacteria 2943
595 Ga0307405_10224636 3300031731 Bacteria 1380
596 Ga0316577_10105319 3300031733 Bacteria 1582
597 Ga0307413_10026248 3300031824 Bacteria 3207
598 Ga0307413_10044844 3300031824 Bacteria 2616
599 Ga0307413_10177855 3300031824 Bacteria 1513
600 Ga0307413_10503860 3300031824 Bacteria 973
601 Ga0307413_10733133 3300031824 Bacteria 824
602 Ga0307410_10002549 3300031852 Bacteria 8824
603 Ga0307410_10010008 3300031852 Bacteria 5351
604 Ga0307410_10026571 3300031852 Bacteria 3646
605 Ga0307410_10944271 3300031852 Bacteria 741
606 Ga0307406_10016843 3300031901 Bacteria 4252
607 Ga0307406_10138571 3300031901 Bacteria 1719
608 Ga0307406_10390814 3300031901 Bacteria 1100
609 Ga0307406_10512447 3300031901 Bacteria 975
610 Ga0307406_10524310 3300031901 Bacteria 965
611 Ga0307407_10000195 3300031903 Bacteria 18328
612 Ga0307407_10159425 3300031903 Bacteria 1475
613 Ga0307412_10000548 3300031911 Bacteria 22392
614 Ga0307412_10005980 3300031911 Bacteria 6853
615 Ga0307412_10240330 3300031911 Bacteria 1400
616 Ga0307412_10240820 3300031911 Bacteria 1399
617 Ga0307412_10307364 3300031911 Bacteria 1256
618 Ga0307409_100003317 3300031995 Bacteria 8701
619 Ga0307409_100018175 3300031995 Bacteria 4714
620 Ga0307409_100066180 3300031995 Bacteria 2848
621 Ga0307409_100537009 3300031995 Bacteria 1145
622 Ga0307409_100560622 3300031995 Bacteria 1123
623 Ga0307416_100001750 3300032002 Bacteria 12019
624 Ga0307416_100177034 3300032002 Bacteria 1994
625 Ga0307414_10001053 3300032004 Bacteria 14103
626 Ga0307414_10003789 3300032004 Bacteria 8126
627 Ga0307414_10023949 3300032004 Bacteria 3883
628 Ga0307414_10074267 3300032004 Bacteria 2463
629 Ga0307414_10160897 3300032004 Bacteria 1783
630 Ga0307414_10296325 3300032004 Bacteria 1366
631 Ga0307414_10307317 3300032004 Bacteria 1344
632 Ga0307414_10562854 3300032004 Bacteria 1017
633 Ga0307414_10566378 3300032004 Bacteria 1014
634 Ga0307414_10602496 3300032004 Bacteria 985
635 Ga0307414_10978216 3300032004 Bacteria 778
636 Ga0307411_10000206 3300032005 Bacteria 18997
637 Ga0307411_10002634 3300032005 Bacteria 8032
638 Ga0307411_10014544 3300032005 Bacteria 4384
639 Ga0307411_10016389 3300032005 Bacteria 4193
640 Ga0307411_10094833 3300032005 Bacteria 2093
641 Ga0307411_10232904 3300032005 Bacteria 1437
642 Ga0307411_10264160 3300032005 Bacteria 1361
643 Ga0307411_10502491 3300032005 Bacteria 1025
644 Ga0307411_10609503 3300032005 Bacteria 940
645 Ga0307411_10702476 3300032005 Bacteria 881
646 Ga0307415_100171924 3300032126 Bacteria 1691
647 Ga0307415_100574187 3300032126 Bacteria 999
648 Ga0307507_10000880 3300033179 Bacteria 66789
649 Ga0373943_0410418 3300035170 Bacteria 783
650 Ga0316574_0006768 3300035398 Bacteria 6227
651 Ga0316574_0013668 3300035398 Bacteria 4672
652 Ga0316574_0035290 3300035398 Bacteria 3055
653 Ga0316574_0040143 3300035398 Bacteria 2880
654 Ga0316574_0087546 3300035398 Bacteria 1983
655 Ga0316574_0114224 3300035398 Bacteria 1732
656 Ga0316574_0170516 3300035398 Bacteria 1401
657 Ga0316574_0227671 3300035398 Bacteria 1193
658 Ga0316574_0266986 3300035398 Bacteria 1092
659 Ga0316574_0526489 3300035398 Bacteria 735
660 Ga0316582_0108618 3300036647 Bacteria 1844
661 Ga0316582_0130962 3300036647 Bacteria 1685
662 Ga0316584_0391071 3300036712 Bacteria 992
663 Ga0395899_0000184 3300037312 Bacteria 91815
664 Ga0395899_0026186 3300037312 Bacteria 4401
665 Ga0395899_0026471 3300037312 Bacteria 4377
666 Ga0395899_0030102 3300037312 Bacteria 4084
667 Ga0395899_0041528 3300037312 Bacteria 3437
668 Ga0395899_0053971 3300037312 Bacteria 2975
669 Ga0395899_0089521 3300037312 Bacteria 2232
670 Ga0395899_0104800 3300037312 Bacteria 2038
671 Ga0395899_0108198 3300037312 Bacteria 2000
672 Ga0395899_0193216 3300037312 Bacteria 1423
673 Ga0395899_0245317 3300037312 Bacteria 1231
674 Ga0395899_0402416 3300037312 Bacteria 905
675 Ga0395900_0000723 3300037418 Bacteria 43948
676 Ga0395900_0003562 3300037418 Bacteria 16749
677 Ga0395900_0015111 3300037418 Bacteria 7869
678 Ga0395900_0015235 3300037418 Bacteria 7840
679 Ga0395900_0015753 3300037418 Bacteria 7707
680 Ga0395900_0016216 3300037418 Bacteria 7590
681 Ga0395900_0018901 3300037418 Bacteria 7028
682 Ga0395900_0023262 3300037418 Bacteria 6342
683 Ga0395900_0023486 3300037418 Bacteria 6311
684 Ga0395900_0032996 3300037418 Bacteria 5328
685 Ga0395900_0034194 3300037418 Bacteria 5233
686 Ga0395900_0034975 3300037418 Bacteria 5174
687 Ga0395900_0048973 3300037418 Bacteria 4352
688 Ga0395900_0116238 3300037418 Bacteria 2745
689 Ga0395900_0152977 3300037418 Bacteria 2356
690 Ga0395900_0180553 3300037418 Bacteria 2145
691 Ga0395900_0195738 3300037418 Bacteria 2048
692 Ga0395900_0225941 3300037418 Bacteria 1885
693 Ga0395900_0283099 3300037418 Bacteria 1649
694 Ga0395900_0367667 3300037418 Bacteria 1408
695 Ga0395900_0371655 3300037418 Bacteria 1399
696 Ga0395900_0394087 3300037418 Bacteria 1350
697 Ga0395900_0426287 3300037418 Bacteria 1286
698 Ga0395900_0510831 3300037418 Bacteria 1151
699 Ga0395900_0673295 3300037418 Unclassified 970
700 Ga0395898_0000087 3300037466 Bacteria 239211
701 Ga0395898_0003277 3300037466 Bacteria 18196
702 Ga0395898_0004020 3300037466 Bacteria 16164
703 Ga0395898_0009646 3300037466 Bacteria 10135
704 Ga0395898_0021149 3300037466 Bacteria 6599
705 Ga0395898_0021259 3300037466 Bacteria 6581
706 Ga0395898_0073821 3300037466 Bacteria 3295
707 Ga0395898_0076450 3300037466 Bacteria 3233
708 Ga0395898_0105564 3300037466 Bacteria 2701
709 Ga0395898_0211881 3300037466 Bacteria 1848
710 Ga0395898_0305517 3300037466 Bacteria 1517
711 Ga0395898_0689979 3300037466 Bacteria 963
712 Ga0395898_0730900 3300037466 Bacteria 931
713 Ga0395905_0000005 3300037471 Bacteria 557808
714 Ga0395905_0002000 3300037471 Bacteria 23293
715 Ga0395905_0002910 3300037471 Bacteria 18678
716 Ga0395905_0005131 3300037471 Bacteria 13445
717 Ga0395905_0006920 3300037471 Bacteria 11334
718 Ga0395905_0014364 3300037471 Bacteria 7565
719 Ga0395905_0014911 3300037471 Bacteria 7414
720 Ga0395905_0017740 3300037471 Bacteria 6758
721 Ga0395905_0019323 3300037471 Bacteria 6460
722 Ga0395905_0020118 3300037471 Bacteria 6324
723 Ga0395905_0038867 3300037471 Bacteria 4464
724 Ga0395905_0048848 3300037471 Bacteria 3964
725 Ga0395905_0092920 3300037471 Bacteria 2829
726 Ga0395905_0112028 3300037471 Bacteria 2562
727 Ga0395905_0155998 3300037471 Bacteria 2147
728 Ga0395905_0156703 3300037471 Bacteria 2142
729 Ga0395905_0368606 3300037471 Bacteria 1329
730 Ga0395901_0000280 3300038443 Bacteria 63153
731 Ga0395901_0001808 3300038443 Bacteria 22093
732 Ga0395901_0004038 3300038443 Bacteria 14781
733 Ga0395901_0011865 3300038443 Bacteria 8835
734 Ga0395901_0013263 3300038443 Bacteria 8369
735 Ga0395901_0015235 3300038443 Bacteria 7823
736 Ga0395901_0024583 3300038443 Bacteria 6185
737 Ga0395901_0036907 3300038443 Bacteria 5053
738 Ga0395901_0039387 3300038443 Bacteria 4890
739 Ga0395901_0041573 3300038443 Bacteria 4765
740 Ga0395901_0047175 3300038443 Bacteria 4473
741 Ga0395901_0056242 3300038443 Bacteria 4092
742 Ga0395901_0062101 3300038443 Bacteria 3888
743 Ga0395901_0090198 3300038443 Bacteria 3208
744 Ga0395901_0135655 3300038443 Bacteria 2587
745 Ga0395901_0145796 3300038443 Bacteria 2488
746 Ga0395901_0219532 3300038443 Bacteria 1987
747 Ga0395901_0325934 3300038443 Bacteria 1589
748 Ga0395901_0428574 3300038443 Bacteria 1355
749 Ga0395901_0455686 3300038443 Bacteria 1307
750 Ga0395901_0628422 3300038443 Bacteria 1080
751 Ga0237819_00169 3300038705 Bacteria 24069
752 Ga0436365_0505056 3300039437 Bacteria 7152
753 Ga0436363_1707670 3300039450 Bacteria 2046
754 Ga0439439_0130190 3300041406 Bacteria 706
755 Ga0439465_0001563 3300041413 Bacteria 7448
756 Ga0439465_0205265 3300041413 Bacteria 719
757 Ga0451800_0005888 3300041459 Bacteria 2818
758 Ga0451806_032754 3300041462 Bacteria 2478
759 Ga0451837_0033562 3300041494 Bacteria 1395
760 Ga0451837_0344179 3300041494 Bacteria 1634
761 Ga0439437_018934 3300042000 Bacteria 825
762 Ga0439445_0000014 3300042004 Bacteria 23823
763 Ga0439448_0018099 3300042005 Bacteria 2156
764 Ga0439448_0063189 3300042005 Bacteria 1226
765 Ga0439432_028035 3300042006 Bacteria 1836
766 Ga0439432_167382 3300042006 Bacteria 642
767 Ga0439449_0000069 3300042007 Bacteria 32108
768 Ga0439449_0003704 3300042007 Bacteria 5933
769 Ga0450912_000246 3300042116 Bacteria 2368
770 Ga0450920_009978 3300042122 Bacteria 1756
771 Ga0439458_0000243 3300042157 Bacteria 13137
772 Ga0439458_0007783 3300042157 Bacteria 2386
773 Ga0439459_0002997 3300042438 Bacteria 2649
774 Ga0466969_0000310 3300044656 Bacteria 26790
775 Ga0466969_0055225 3300044656 Bacteria 1943
776 Ga0466972_0008198 3300044658 Bacteria 5239
777 Ga0466972_0036255 3300044658 Bacteria 2413
778 Ga0466982_0000020 3300044672 Bacteria 99164
779 Ga0466965_0077533 3300044683 Bacteria 1678
780 Ga0466965_0078668 3300044683 Bacteria 1665
781 Ga0466966_0000039 3300044684 Bacteria 97202
782 Ga0466966_0000802 3300044684 Bacteria 19991
783 Ga0466966_0001010 3300044684 Bacteria 17949
784 Ga0466966_0008999 3300044684 Bacteria 6617
785 Ga0466966_0039427 3300044684 Bacteria 3042
786 Ga0466966_0045857 3300044684 Bacteria 2793
787 Ga0466966_0050544 3300044684 Bacteria 2644
788 Ga0466966_0368928 3300044684 Bacteria 862
789 Ga0466961_0000332 3300044693 Bacteria 31109
790 Ga0466961_0024458 3300044693 Bacteria 3885
791 Ga0466961_0052657 3300044693 Bacteria 2598
792 Ga0466961_0053178 3300044693 Bacteria 2584
793 Ga0466961_0296031 3300044693 Bacteria 989
794 Ga0466963_0450303 3300044694 Bacteria 908
795 Ga0466964_0002553 3300044706 Bacteria 6491
796 Ga0466964_0006390 3300044706 Bacteria 4393
797 Ga0466971_0001750 3300044719 Bacteria 9205
798 Ga0466971_0006606 3300044719 Bacteria 5042
799 Ga0466971_0006892 3300044719 Bacteria 4938
800 Ga0466971_0039618 3300044719 Bacteria 2114
801 Ga0466971_0102646 3300044719 Bacteria 1315
802 Ga0466968_0000227 3300044735 Bacteria 17595
803 Ga0466968_0016306 3300044735 Bacteria 2956
804 Ga0466968_0363235 3300044735 Bacteria 705
805 Ga0466970_0000410 3300044765 Bacteria 20927
806 Ga0466970_0000836 3300044765 Bacteria 14806
807 Ga0466970_0019102 3300044765 Bacteria 3552
808 Ga0466970_0020879 3300044765 Bacteria 3407
809 Ga0466970_0024226 3300044765 Bacteria 3173
810 Ga0466970_0060892 3300044765 Unclassified 2022
811 Ga0466970_0522763 3300044765 Bacteria 684
812 Ga0466970_0581900 3300044765 Bacteria 648
813 Ga0466957_0006130 3300044842 Bacteria 6786
814 Ga0466957_0088901 3300044842 Bacteria 1933
815 Ga0466957_0233213 3300044842 Bacteria 1219
816 Ga0466960_0034356 3300044901 Bacteria 2362
817 Ga0466959_0000334 3300045049 Bacteria 27826
818 Ga0466959_0008432 3300045049 Bacteria 7288
819 Ga0466959_0039700 3300045049 Bacteria 3479
820 Ga0466959_0042264 3300045049 Bacteria 3361
821 Ga0466959_0099272 3300045049 Bacteria 2085
822 Ga0466959_0172748 3300045049 Unclassified 1515
823 Ga0466959_0178635 3300045049 Unclassified 1486
824 Ga0466959_0493413 3300045049 Bacteria 828
825 Ga0466958_0004354 3300045836 Bacteria 7468
826 Ga0466958_0011059 3300045836 Bacteria 5073
827 Ga0466958_0016632 3300045836 Bacteria 4239
828 Ga0466958_0019140 3300045836 Bacteria 3982
829 Ga0466958_0208934 3300045836 Bacteria 1243
830 Ga0466958_0316658 3300045836 Bacteria 1002
831 Ga0466967_0077687 3300045976 Bacteria 2989
832 Ga0466967_0271783 3300045976 Bacteria 1624
833 Ga0466967_0271814 3300045976 Bacteria 1624
834 Ga0466967_0281394 3300045976 Bacteria 1596
835 Ga0466967_0460225 3300045976 Bacteria 1244
836 Ga0466967_0563575 3300045976 Bacteria 1122
837 Ga0495627_017920 3300046453 Bacteria 2398
838 Ga0495638_0000049 3300046460 Bacteria 206725
839 Ga0495638_0000202 3300046460 Bacteria 84492
840 Ga0495638_0000916 3300046460 Bacteria 30114
841 Ga0495638_0027546 3300046460 Bacteria 3677
842 Ga0495650_0001214 3300046471 Bacteria 27066
843 Ga0495606_0001000 3300046507 Bacteria 41217
844 Ga0495610_0049600 3300046512 Bacteria 2054
845 Ga0495631_0034299 3300046518 Bacteria 2275
846 Ga0495632_0130654 3300046519 Bacteria 1169
847 Ga0495643_0000919 3300046522 Bacteria 30964
848 Ga0495663_0002339 3300046525 Bacteria 5734
849 Ga0495663_0006455 3300046525 Bacteria 3241
850 Ga0495663_0013907 3300046525 Bacteria 2251
851 Ga0495663_0044739 3300046525 Bacteria 1356
852 Ga0495621_0000983 3300046539 Bacteria 7289
853 Ga0495621_0020509 3300046539 Bacteria 2170
854 Ga0495621_0065359 3300046539 Bacteria 1329
855 Ga0495622_0023430 3300046557 Bacteria 2878
856 Ga0495633_0011833 3300046558 Bacteria 4678
857 Ga0495633_0046333 3300046558 Bacteria 2057
858 Ga0495633_0174398 3300046558 Bacteria 990
859 Ga0495633_0209316 3300046558 Bacteria 894
860 Ga0495656_0002149 3300046615 Bacteria 6516
861 Ga0495668_0084960 3300046616 Bacteria 1736
862 Ga0495625_0048020 3300046660 Bacteria 3075
863 Ga0495625_0120402 3300046660 Bacteria 1786
864 Ga0495625_0125600 3300046660 Bacteria 1742
865 Ga0495670_0011668 3300046691 Bacteria 4324
866 Ga0495649_0000823 3300046694 Bacteria 24933
867 Ga0495660_0106768 3300046810 Bacteria 1434
868 Ga0495636_0006533 3300047318 Bacteria 4585
869 Ga0495672_0000105 3300047320 Bacteria 133882
870 Ga0495672_0158322 3300047320 Bacteria 1167
871 Ga0495686_0008426 3300047472 Bacteria 7563
872 Ga0495686_0015670 3300047472 Bacteria 5167
873 Ga0496100_0167599 3300048903 Bacteria 1579
874 Ga0496100_0229956 3300048903 Bacteria 1364
875 Ga0496101_0048090 3300048904 Bacteria 3064
876 Ga0496101_0177997 3300048904 Bacteria 1637
877 Ga0496102_0034842 3300048905 Bacteria 4531
878 Ga0496102_0859362 3300048905 Bacteria 829
879 Ga0496103_0101135 3300048906 Bacteria 1824
880 Ga0496104_0055648 3300048907 Bacteria 3741
881 Ga0496104_0091848 3300048907 Bacteria 2902
882 Ga0496104_0268192 3300048907 Bacteria 1619
883 Ga0496104_0346063 3300048907 Bacteria 1399
884 Ga0496105_0001964 3300048908 Bacteria 14781
885 Ga0496105_0172208 3300048908 Bacteria 1774
886 Ga0496106_0046723 3300048909 Bacteria 3256
887 Ga0496107_0234325 3300048910 Bacteria 1366
888 Ga0496107_0361177 3300048910 Bacteria 1080
889 Ga0496107_0786771 3300048910 Bacteria 697
890 Ga0496108_0148092 3300048911 Bacteria 2025
891 Ga0496109_0136187 3300048912 Bacteria 2295
892 Ga0496109_0267515 3300048912 Bacteria 1610
893 Ga0496110_0188119 3300048913 Bacteria 1875
894 Ga0496110_1025254 3300048913 Bacteria 733
895 Ga0496111_0118009 3300048914 Bacteria 1958
896 Ga0496111_0213700 3300048914 Bacteria 1433
897 Ga0496113_0030099 3300048916 Bacteria 3927
898 Ga0496113_0115447 3300048916 Bacteria 2094
899 Ga0496114_0000594 3300048917 Bacteria 26726
900 Ga0496114_0937283 3300048917 Bacteria 748
901 Ga0496115_0000024 3300048918 Bacteria 154488
902 Ga0496115_0000103 3300048918 Bacteria 80518
903 Ga0496115_0002161 3300048918 Bacteria 14061
904 Ga0496115_0002922 3300048918 Bacteria 12322
905 Ga0496115_0011553 3300048918 Bacteria 6620
906 Ga0496116_0000218 3300048919 Bacteria 107445
907 Ga0496116_0013717 3300048919 Bacteria 6515
908 Ga0496116_0032122 3300048919 Bacteria 3746
909 Ga0496116_0076650 3300048919 Bacteria 2093
910 Ga0496116_0113902 3300048919 Bacteria 1581
911 Ga0496116_0213622 3300048919 Bacteria 997
912 Ga0496117_0000314 3300048920 Bacteria 84712
913 Ga0496117_0001191 3300048920 Bacteria 39121
914 Ga0496117_0003149 3300048920 Bacteria 19675
915 Ga0496117_0004544 3300048920 Bacteria 15213
916 Ga0496117_0009737 3300048920 Bacteria 8868
917 Ga0496117_0083137 3300048920 Bacteria 2094
918 Ga0496117_0086255 3300048920 Bacteria 2040
919 Ga0496117_0117784 3300048920 Bacteria 1638
920 Ga0496117_0276306 3300048920 Bacteria 902
921 Ga0496118_0000371 3300048921 Bacteria 75491
922 Ga0496118_0002136 3300048921 Bacteria 27584
923 Ga0496118_0002547 3300048921 Bacteria 24411
924 Ga0496118_0006150 3300048921 Bacteria 13317
925 Ga0496118_0006935 3300048921 Bacteria 12250
926 Ga0496118_0012624 3300048921 Bacteria 8083
927 Ga0496118_0021905 3300048921 Bacteria 5605
928 Ga0496118_0033714 3300048921 Bacteria 4194
929 Ga0496118_0117972 3300048921 Bacteria 1739
930 Ga0496118_0127254 3300048921 Bacteria 1644
931 Ga0496119_0000239 3300048922 Bacteria 77503
932 Ga0496119_0001743 3300048922 Bacteria 25359
933 Ga0496119_0002432 3300048922 Bacteria 20445
934 Ga0496119_0002973 3300048922 Bacteria 18010
935 Ga0496119_0054521 3300048922 Bacteria 2433
936 Ga0496120_0000167 3300048923 Bacteria 110734
937 Ga0496120_0000181 3300048923 Bacteria 107114
938 Ga0496120_0000676 3300048923 Bacteria 50058
939 Ga0496120_0000868 3300048923 Bacteria 42806
940 Ga0496121_0000532 3300048924 Bacteria 72417
941 Ga0496121_0004104 3300048924 Bacteria 19979
942 Ga0496121_0016876 3300048924 Bacteria 7508
943 Ga0496121_0028676 3300048924 Bacteria 5176
944 Ga0496121_0039123 3300048924 Bacteria 4186
945 Ga0496121_0042063 3300048924 Bacteria 3982
946 Ga0496121_0046716 3300048924 Bacteria 3702
947 Ga0496121_0175446 3300048924 Bacteria 1552
948 Ga0496121_0209945 3300048924 Bacteria 1380
949 Ga0496122_0000901 3300048925 Bacteria 54955
950 Ga0496122_0001122 3300048925 Bacteria 46123
951 Ga0496122_0012066 3300048925 Bacteria 8660
952 Ga0496122_0021920 3300048925 Bacteria 5696
953 Ga0496122_0102293 3300048925 Bacteria 1910
954 Ga0496122_0185702 3300048925 Bacteria 1233
955 Ga0496122_0262235 3300048925 Bacteria 958
956 Ga0496123_0000727 3300048926 Bacteria 53518
957 Ga0496123_0000920 3300048926 Bacteria 46126
958 Ga0496123_0002564 3300048926 Bacteria 22119
959 Ga0496123_0005759 3300048926 Bacteria 12328
960 Ga0496123_0010634 3300048926 Bacteria 8097
961 Ga0496123_0042551 3300048926 Bacteria 3133
962 Ga0496123_0046388 3300048926 Bacteria 2948
963 Ga0496123_0318995 3300048926 Bacteria 734
964 Ga0496124_0001061 3300048927 Bacteria 43394
965 Ga0496124_0001652 3300048927 Bacteria 31905
966 Ga0496124_0005126 3300048927 Bacteria 14915
967 Ga0496124_0006193 3300048927 Bacteria 13112
968 Ga0496124_0009321 3300048927 Bacteria 10115
969 Ga0496124_0019095 3300048927 Bacteria 6397
970 Ga0496124_0021047 3300048927 Bacteria 6015
971 Ga0496124_0058646 3300048927 Bacteria 3236
972 Ga0496124_0239956 3300048927 Bacteria 1348
973 Ga0496124_0335034 3300048927 Bacteria 1077
974 Ga0496125_0000320 3300048928 Bacteria 93682
975 Ga0496125_0000344 3300048928 Bacteria 88380
976 Ga0496125_0005964 3300048928 Bacteria 13336
977 Ga0496125_0025180 3300048928 Bacteria 5455
978 Ga0496125_0121582 3300048928 Bacteria 1861
979 Ga0496125_0131233 3300048928 Bacteria 1763
980 Ga0496125_0268578 3300048928 Bacteria 1064
981 Ga0496126_0000581 3300048929 Bacteria 69541
982 Ga0496126_0001014 3300048929 Bacteria 47842
983 Ga0496126_0007111 3300048929 Bacteria 12330
984 Ga0496126_0123760 3300048929 Bacteria 2240
985 Ga0496126_0191593 3300048929 Bacteria 1731
986 Ga0496126_0206619 3300048929 Bacteria 1655
987 Ga0496126_0588425 3300048929 Bacteria 878
988 Ga0495678_037387 3300049459 Bacteria 1973
989 Ga0495682_0017233 3300049460 Bacteria 2729
990 Ga0501031_0020584 3300049568 Bacteria 4301
991 Ga0501031_0107743 3300049568 Bacteria 1819
992 Ga0501031_0150963 3300049568 Bacteria 1518
993 Ga0501032_0014188 3300049569 Bacteria 5645
994 Ga0501032_0114080 3300049569 Bacteria 1787
995 Ga0501032_0178721 3300049569 Bacteria 1390
996 Ga0501033_0001868 3300049570 Bacteria 18315
997 Ga0501033_0002545 3300049570 Bacteria 15427
998 Ga0501033_0090785 3300049570 Bacteria 2234
999 Ga0501033_0199045 3300049570 Bacteria 1431
1000 Ga0501033_0523668 3300049570 Bacteria 819
1001 Ga0501034_0001977 3300049571 Bacteria 25973
1002 Ga0501034_0007048 3300049571 Bacteria 11989
1003 Ga0501034_0028239 3300049571 Bacteria 5708
1004 Ga0501034_0103298 3300049571 Bacteria 2843
1005 Ga0501034_0143066 3300049571 Bacteria 2370
1006 Ga0501034_0192995 3300049571 Bacteria 1998
1007 Ga0501034_0343555 3300049571 Bacteria 1422
1008 Ga0501034_0635658 3300049571 Bacteria 970
1009 Ga0501036_0095765 3300049572 Bacteria 2509
1010 Ga0501036_0111278 3300049572 Bacteria 2314
1011 Ga0501037_0015245 3300049573 Bacteria 5654
1012 Ga0501037_0041434 3300049573 Bacteria 3386
1013 Ga0501038_0066603 3300049574 Bacteria 3066
1014 Ga0501038_0119491 3300049574 Bacteria 2175
1015 Ga0501039_0362605 3300049575 Bacteria 1138
1016 Ga0501039_0605447 3300049575 Bacteria 859
1017 Ga0501043_0128950 3300049579 Bacteria 1982
1018 Ga0501043_0185757 3300049579 Bacteria 1618
1019 Ga0501043_0386785 3300049579 Bacteria 1058
1020 Ga0501046_0025262 3300049580 Bacteria 4862
1021 Ga0501046_0091874 3300049580 Bacteria 2334
1022 Ga0501046_0103124 3300049580 Bacteria 2187
1023 Ga0501047_0003603 3300049581 Bacteria 14602
1024 Ga0501047_0011089 3300049581 Bacteria 8529
1025 Ga0501047_0031361 3300049581 Bacteria 5126
1026 Ga0501047_0101772 3300049581 Bacteria 2752
1027 Ga0501048_0078848 3300049582 Bacteria 2324
1028 Ga0501069_0011564 3300049585 Bacteria 4678
1029 Ga0501069_0048655 3300049585 Bacteria 2355
1030 Ga0501070_0000587 3300049586 Bacteria 33165
1031 Ga0501070_0020482 3300049586 Bacteria 5547
1032 Ga0501070_0358320 3300049586 Bacteria 1183
1033 Ga0501073_0188926 3300049589 Bacteria 1425
1034 Ga0501077_0277500 3300049593 Bacteria 1066
1035 Ga0501216_011253 3300049660 Bacteria 1451
1036 Ga0501249_043326 3300049679 Bacteria 1024
1037 Ga0501259_027992 3300049688 Bacteria 1047
1038 Ga0501080_0038483 3300049742 Bacteria 4465
1039 Ga0501272_008281 3300049769 Bacteria 1139
1040 Ga0501275_000447 3300049772 Bacteria 4640
1041 Ga0501035_0005912 3300049822 Bacteria 11521
1042 Ga0501035_0017043 3300049822 Bacteria 6694
1043 Ga0501035_0023420 3300049822 Bacteria 5664
1044 Ga0501035_0070003 3300049822 Bacteria 3108
1045 Ga0501035_0097596 3300049822 Bacteria 2580
1046 Ga0501035_0499810 3300049822 Bacteria 1001
1047 Ga0501044_0020827 3300049823 Bacteria 6999
1048 Ga0501044_0025356 3300049823 Bacteria 6284
1049 Ga0501044_0042471 3300049823 Bacteria 4728
1050 Ga0501044_0213400 3300049823 Bacteria 1883
1051 Ga0501044_0345473 3300049823 Bacteria 1408
1052 Ga0501044_0601604 3300049823 Bacteria 993
1053 nmdc:mga00v17_20876_c1 3300050491 Bacteria 3758
1054 nmdc:mga00v17_729_c2 3300050491 Bacteria 11208
1055 nmdc:mga0yw44_137900_c1 3300050492 Bacteria 1583
1056 nmdc:mga06z11_426937_c1 3300050494 Bacteria 799
1057 nmdc:mga05p37_678987_c1 3300050507 Bacteria 1148
1058 nmdc:mga08y16_479171_c1 3300050511 Bacteria 1266
1059 nmdc:mga08y16_512095_c1 3300050511 Bacteria 1218
1060 nmdc:mga0n895_1019311_c1 3300050512 Bacteria 808
1061 Ga0500626_053803 3300053128 Bacteria 1808
1062 Ga0500658_0196854 3300053134 Bacteria 921
1063 Ga0500568_0004359 3300053139 Bacteria 7574
1064 Ga0500604_0000002 3300053151 Bacteria 165603
1065 Ga0500616_0000238 3300053153 Bacteria 86573
1066 Ga0500634_0000322 3300053161 Bacteria 15273
1067 Ga0500565_020439 3300053734 Bacteria 791
1068 Ga0466962_0000083 3300061719 Bacteria 38031
1069 Ga0466962_0003389 3300061719 Bacteria 7588
1070 Ga0466962_0004622 3300061719 Bacteria 6610
1071 Ga0466962_0066683 3300061719 Unclassified 1718
1072 Ga0466962_0131145 3300061719 Unclassified 1211
1073 2547502928 2547132130 Bacteria 4660562
1074 2578458532 2576861471 Bacteria 4648976
1075 2643830455 2643221562 Bacteria 4048635
1076 2643894229 2643221577 Bacteria 3710843
1077 2644476431 2643221685 Bacteria 3673288
1078 2687582890 2687453130 Bacteria 4227172
1079 2739730760 2739367700 Bacteria 4747630
1080 2747949454 2747842428 Bacteria 4689383
1081 2748019754 2747842501 Bacteria 5293829
1082 2765578859 2765235840 Bacteria 4663337
1083 2816516922 2816332141 Bacteria 4436036
1084 2819659690 2818991457 Bacteria 5323295
1085 2842393095 2842391507 Bacteria 4486072
1086 2842758283 2842757796 Bacteria 3981385
1087 2852650950 2852649853 Bacteria 4036942
1088 2852685497 2852684882 Bacteria 5463342
1089 2857443793 2857442823 Bacteria 4562550
1090 2874221498 2874220319 Bacteria 4594709
1091 2884414413 2884411467 Bacteria 5246714
1092 2894415468 2894414249 Bacteria 4405451
1093 2895398770 2895395659 Bacteria 3983269
1094 2895500779 2895498888 Bacteria 5283788
1095 2895516351 2895511927 Bacteria 6802080
1096 2895523730 2895522137 Bacteria 3284416
1097 2895526689 2895525241 Bacteria 3388457
1098 2919089833 2919089067 Bacteria 4560942
1099 2919131658 2919130084 Bacteria 5301837
1100 2919137845 2919134579 Bacteria 4480386
1101 2928496536 2928496128 Bacteria 4631123
1102 2928964166 2928963466 Bacteria 5165703
1103 2929197971 2929195423 Bacteria 5325372
1104 2931380878 2931380184 Bacteria 4455911
1105 2937612316 2937610967 Bacteria 4618818
1106 2939590876 2939589442 Bacteria 4214238
1107 2939612354 2939611941 Bacteria 3892017
1108 2939623133 2939622612 Bacteria 4698046
1109 2939630747 2939626828 Bacteria 4695272
1110 2941478202 2941475908 Bacteria 4145589
1111 2961048264 2961047084 Bacteria 4594415
1112 2961065262 2961064222 Bacteria 4749990
1113 2974309091 2974307012 Bacteria 4172388
1114 2977249811 2977247770 Bacteria 4160543
1115 2987606080 2987605356 Bacteria 4187822
1116 8021624276 8021622325 Bacteria 4844743
1117 8021629120 8021626552 Bacteria 4665214
1118 8021649111 8021648035 Bacteria 4772378
1119 Ga0105241_10936705
1120 SwRhRL2b_contig_2191643
1121 SwRhRL2b_contig_3936045
1122 JGI24736J21556_1000339
1123 JGI24739J22299_10000040
1124 JGI24739J22299_10056009
1125 JGI24737J22298_10002132
1126 JGI24737J22298_10002784
1127 JGI25156J39149_1010714
1128 JGI25162J39368_1000395
1129 JGI25162J39368_1000684
1130 JGI25162J39368_1002286
1131 JGI25157J39369_1000081
1132 JGI25157J39369_1000547
1133 JGI25163J39215_1000313
1134 JGI25164J39214_1000028
1135 JGI25164J39214_1000338
1136 JGI25164J39214_1000416
1137 JGI25152J39213_1001386
1138 JGI25150J39212_1000817
1139 JGI25151J46595_10001867
1140 JGI25165J46597_1000108
1141 JGI25165J46597_1000513
1142 JGI25165J46597_1003664
1143 JGI25153J46596_10000167
1144 JGI25153J46596_10003689
1145 rootH1_10048199
1146 rootH2_10026728
1147 rootH1_10048164
1148 rootH1_10103103
1149 rootH1_10162681
1150 Ga0006562J51391_1011160
1151 Ga0006562J51391_1011163
1152 Ga0055539_1001625
1153 Ga0055535_1000771
1154 Ga0055542_1000772
1155 Ga0055542_1000787
1156 Ga0055529_1000078
1157 Ga0055526_1000268
1158 Ga0055537_1000348
1159 Ga0055536_1001728
1160 Ga0055536_1008641
1161 Ga0055534_1000043
1162 Ga0055528_1000065
1163 Ga0055530_10001974
1164 Ga0055530_10002320
1165 Ga0055540_1037333
1166 Ga0055531_10010116
1167 Ga0055531_10011251
1168 Ga0055531_10011262
1169 Ga0058692_1000031
1170 Ga0058692_1000060
1171 Ga0065704_10070367
1172 Ga0065704_10134021
1173 Ga0070658_10097525
1174 Ga0070658_10212515
1175 Ga0070658_10343262
1176 Ga0070658_10371877
1177 Ga0070658_10473418
1178 Ga0070676_10257509
1179 Ga0070683_100048684
1180 Ga0070683_100814161
1181 Ga0070690_100175666
1182 Ga0070670_100007794
1183 Ga0070666_10000388
1184 Ga0070666_10058900
1185 Ga0070666_10254484
1186 Ga0070682_100023945
1187 Ga0070682_100179353
1188 Ga0070660_100019590
1189 Ga0070660_100061965
1190 Ga0070660_100156685
1191 Ga0070660_100865117
1192 Ga0070660_101054913
1193 Ga0070689_100010930
1194 Ga0070691_10112024
1195 Ga0070691_10196097
1196 Ga0070661_100037021
1197 Ga0070661_100038689
1198 Ga0070661_100084639
1199 Ga0070661_100139852
1200 Ga0070661_100257471
1201 Ga0070661_100384145
1202 Ga0070661_100459547
1203 Ga0070692_10044215
1204 Ga0070692_10215947
1205 Ga0070668_100112328
1206 Ga0070669_100020435
1207 Ga0070669_100224637
1208 Ga0070675_100119317
1209 Ga0070671_100013860
1210 Ga0070671_100306657
1211 Ga0070674_100031562
1212 Ga0070674_100133202
1213 Ga0070674_100300121
1214 Ga0070673_100096136
1215 Ga0070673_100506750
1216 Ga0070673_100669910
1217 Ga0070688_100136001
1218 Ga0070659_100005797
1219 Ga0070659_100034565
1220 Ga0070659_100058107
1221 Ga0070659_100133964
1222 Ga0070659_100161313
1223 Ga0070659_100267417
1224 Ga0070659_100362442
1225 Ga0070667_100156091
1226 Ga0070714_100104775
1227 Ga0070714_100116833
1228 Ga0070714_100164743
1229 Ga0070714_100241691
1230 Ga0070714_100304389
1231 Ga0070713_100006097
1232 Ga0070713_100014588
1233 Ga0070701_10145876
1234 Ga0070663_100093093
1235 Ga0070663_100186336
1236 Ga0070663_100252768
1237 Ga0070663_100306505
1238 Ga0070663_100312998
1239 Ga0070663_100428567
1240 Ga0070663_100638384
1241 Ga0070678_100568995
1242 Ga0070662_100012504
1243 Ga0070662_100127321
1244 Ga0070662_100208443
1245 Ga0070662_100655373
1246 Ga0070662_100771357
1247 Ga0070679_100019902
1248 Ga0070684_100000098
1249 Ga0070684_100208421
1250 Ga0068853_100007676
1251 Ga0068853_100050236
1252 Ga0068853_100161588
1253 Ga0068853_100200769
1254 Ga0068853_100360905
1255 Ga0068853_100361954
1256 Ga0070696_100005210
1257 Ga0070696_100052356
1258 Ga0070693_100051465
1259 Ga0070693_100065349
1260 Ga0070665_100003847
1261 Ga0070665_100022951
1262 Ga0070665_100499008
1263 Ga0068855_100002059
1264 Ga0068855_100005690
1265 Ga0068855_100020597
1266 Ga0068855_100080776
1267 Ga0068855_100082253
1268 Ga0068855_100092531
1269 Ga0068855_100107211
1270 Ga0068855_100399958
1271 Ga0068855_100624049
1272 Ga0070664_100091821
1273 Ga0068857_100000511
1274 Ga0068857_100004075
1275 Ga0068857_100004673
1276 Ga0068857_100042446
1277 Ga0068857_100059143
1278 Ga0068857_100380365
1279 Ga0068854_100001254
1280 Ga0068854_100009920
1281 Ga0068854_100027013
1282 Ga0068854_100036209
1283 Ga0068854_100063684
1284 Ga0068854_100148510
1285 Ga0068854_100231495
1286 Ga0068856_100001449
1287 Ga0068856_100008083
1288 Ga0068856_100020139
1289 Ga0068856_100217728
1290 Ga0068856_100923512
1291 Ga0068852_100003835
1292 Ga0068852_100037468
1293 Ga0068852_100105743
1294 Ga0068852_100243143
1295 Ga0068852_100357589
1296 Ga0068852_100453352
1297 Ga0068852_100488648
1298 Ga0068852_100505328
1299 Ga0068859_100419067
1300 Ga0068864_100028252
1301 Ga0068864_100067635
1302 Ga0068866_10183996
1303 Ga0068863_100000991
1304 Ga0068863_100001728
1305 Ga0068863_100156943
1306 Ga0068863_101395398
1307 Ga0068858_100013472
1308 Ga0068860_100017406
1309 Ga0068860_100043436
1310 Ga0068860_100061662
1311 Ga0068860_100522419
1312 Ga0068862_100055198
1313 Ga0068862_100057171
1314 Ga0081539_10029649
1315 Ga0075364_10000075
1316 Ga0075364_10017738
1317 Ga0075364_10033599
1318 Ga0075364_10045173
1319 Ga0075362_10034213
1320 Ga0075367_10107375
1321 Ga0075369_10031861
1322 Ga0075366_10183309
1323 Ga0075366_10204202
1324 Ga0097621_100107133
1325 Ga0097621_100411855
1326 Ga0068871_100027620
1327 Ga0075428_100534850
1328 Ga0075428_100836136
1329 Ga0068865_100491865
1330 Ga0097620_100419059
1331 Ga0099794_10049341
1332 Ga0105251_10000684
1333 Ga0105251_10010358
1334 Ga0105240_10003424
1335 Ga0105240_10009039
1336 Ga0105240_10014865
1337 Ga0105240_10020015
1338 Ga0105240_10030261
1339 Ga0105240_10031164
1340 Ga0105240_10164754
1341 Ga0105240_10172954
1342 Ga0105240_10239123
1343 Ga0105240_10414486
1344 Ga0105240_10575495
1345 Ga0105240_10977755
1346 Ga0111539_10409346
1347 Ga0111539_11273889
1348 Ga0105245_10543037
1349 Ga0105245_11213042
1350 Ga0114129_10815943
1351 Ga0105243_10012752
1352 Ga0105243_10096358
1353 Ga0105241_10083769
1354 Ga0105241_10098806
1355 Ga0105241_10879278
1356 Ga0105248_10084810
1357 Ga0105248_10183860
1358 Ga0105248_10686207
1359 Ga0105237_10000023
1360 Ga0105237_10000595
1361 Ga0105237_10282236
1362 Ga0105237_10363183
1363 Ga0105237_10420762
1364 Ga0105238_10005372
1365 Ga0105238_10005720
1366 Ga0105238_10104398
1367 Ga0105238_10113419
1368 Ga0105238_10747423
1369 Ga0105238_11270837
1370 Ga0105249_10064480
1371 Ga0105032_109395
1372 Ga0105239_10000022
1373 Ga0105239_10039292
1374 Ga0105239_10049113
1375 Ga0105239_10074918
1376 Ga0105239_10078397
1377 Ga0105239_10451297
1378 Ga0105239_10625658
1379 Ga0105239_10636726
1380 Ga0105246_10004902
1381 Ga0105246_10023433
1382 Ga0157314_1000105
1383 Ga0157373_10027400
1384 Ga0157373_10044297
1385 Ga0157373_10075101
1386 Ga0157373_10115399
1387 Ga0157373_10462764
1388 Ga0157371_10002070
1389 Ga0157371_10002097
1390 Ga0157371_10005020
1391 Ga0157371_10005924
1392 Ga0157371_10021458
1393 Ga0157371_10024187
1394 Ga0157371_10036564
1395 Ga0157371_10049262
1396 Ga0157371_10165528
1397 Ga0157371_10741917
1398 Ga0157370_10000707
1399 Ga0157370_10001239
1400 Ga0157370_10009476
1401 Ga0157370_10025187
1402 Ga0157370_10045181
1403 Ga0157370_10082267
1404 Ga0157370_10104116
1405 Ga0157370_10177749
1406 Ga0157370_10187919
1407 Ga0157370_10289114
1408 Ga0157370_10471752
1409 Ga0157369_10000239
1410 Ga0157369_10005861
1411 Ga0157369_10011860
1412 Ga0157369_10026692
1413 Ga0157369_10076617
1414 Ga0157369_10087931
1415 Ga0157369_10095626
1416 Ga0157369_10128439
1417 Ga0157369_10164684
1418 Ga0157369_10297926
1419 Ga0157369_10337263
1420 Ga0157369_10690381
1421 Ga0157374_10010711
1422 Ga0157378_10272408
1423 Ga0157378_10673704
1424 Ga0157372_10008488
1425 Ga0157372_10126760
1426 Ga0157372_10151239
1427 Ga0157372_10382008
1428 Ga0157372_10455589
1429 Ga0157372_11018677
1430 Ga0157372_11312997
1431 Ga0157375_11021767
1432 Ga0157375_11987819
1433 Ga0163163_10000597
1434 Ga0163163_10000788
1435 Ga0163163_10007998
1436 Ga0163163_10840434
1437 Ga0182008_10000032
1438 Ga0182008_10053209
1439 Ga0182008_10111837
1440 Ga0157377_10170118
1441 Ga0157379_10003251
1442 Ga0157376_10840628
1443 Ga0182006_1027840
1444 Ga0182006_1034584
1445 Ga0182006_1055039
1446 Ga0182006_1078117
1447 Ga0182006_1092595
1448 Ga0182006_1155977
1449 Ga0182007_10000067
1450 Ga0182007_10013574
1451 Ga0182007_10059055
1452 Ga0182005_1000487
1453 Ga0182005_1003544
1454 Ga0183368_1004
1455 Ga0163161_10000314
1456 Ga0163161_10020581
1457 Ga0163161_10022836
1458 Ga0163161_10130017
1459 Ga0206356_10015297
1460 Ga0206353_10295629
1461 Ga0209760_100676
1462 Ga0209784_100047
1463 Ga0209674_100053
1464 Ga0207427_100023
1465 Ga0207427_100115
1466 Ga0207427_100130
1467 Ga0207427_101434
1468 Ga0209437_100015
1469 Ga0209437_100020
1470 Ga0209437_100079
1471 Ga0209437_100276
1472 Ga0209258_100043
1473 Ga0209258_101362
1474 Ga0207425_1000097
1475 Ga0209646_1001086
1476 Ga0209646_1001409
1477 Ga0209646_1005518
1478 Ga0209026_1000047
1479 Ga0209026_1000105
1480 Ga0209026_1000162
1481 Ga0209026_1004849
1482 Ga0209677_107553
1483 Ga0209148_1000002
1484 Ga0209148_1000010
1485 Ga0209759_1000318
1486 Ga0209129_1000189
1487 Ga0209129_1002006
1488 Ga0209233_1000009
1489 Ga0209233_1000020
1490 Ga0209233_1000121
1491 Ga0209233_1004374
1492 Ga0209565_1000063
1493 Ga0209455_1000020
1494 Ga0209455_1000560
1495 Ga0209673_1000065
1496 Ga0209130_1022608
1497 Ga0209675_1000011
1498 Ga0209676_1000011
1499 Ga0209676_1000068
1500 Ga0209676_1000804
1501 Ga0209025_1000054
1502 Ga0209564_1000433
1503 Ga0209758_1000062
1504 Ga0209758_1000959
1505 Ga0209050_1000239
1506 Ga0209050_1000599
1507 Ga0209050_1012752
1508 Ga0209050_1022399
1509 Ga0209256_1010810
1510 Ga0209051_1003250
1511 Ga0209257_1000014
1512 Ga0209257_1005372
1513 Ga0209257_1006688
1514 Ga0207656_10029913
1515 Ga0207713_1000806
1516 Ga0207713_1012433
1517 Ga0207680_10000227
1518 Ga0207647_10001844
1519 Ga0207647_10007732
1520 Ga0207647_10010023
1521 Ga0207647_10012011
1522 Ga0207647_10018195
1523 Ga0207647_10021257
1524 Ga0207647_10037022
1525 Ga0207647_10059981
1526 Ga0207647_10110117
1527 Ga0207705_10000003
1528 Ga0207705_10038222
1529 Ga0207705_10040692
1530 Ga0207705_10105804
1531 Ga0207705_10183601
1532 Ga0207654_10168043
1533 Ga0207654_10181440
1534 Ga0207654_10335523
1535 Ga0207654_10526933
1536 Ga0207707_10011138
1537 Ga0207707_10137111
1538 Ga0207695_10000261
1539 Ga0207695_10000654
1540 Ga0207695_10000907
1541 Ga0207695_10008059
1542 Ga0207695_10010391
1543 Ga0207695_10043582
1544 Ga0207695_10046136
1545 Ga0207695_10047480
1546 Ga0207695_10048652
1547 Ga0207695_10111216
1548 Ga0207695_10266207
1549 Ga0207695_10766180
1550 Ga0207671_10000020
1551 Ga0207671_10000033
1552 Ga0207671_10000726
1553 Ga0207671_10010073
1554 Ga0207662_10255148
1555 Ga0207657_10031993
1556 Ga0207657_10082222
1557 Ga0207657_10207414
1558 Ga0207657_10689750
1559 Ga0207649_10001485
1560 Ga0207649_10017022
1561 Ga0207649_10079824
1562 Ga0207649_10124865
1563 Ga0207649_10214274
1564 Ga0207649_10354522
1565 Ga0207649_10398768
1566 Ga0207649_10610356
1567 Ga0207652_10166505
1568 Ga0207681_10114151
1569 Ga0207681_10239811
1570 Ga0207694_10006130
1571 Ga0207694_10017824
1572 Ga0207694_10271084
1573 Ga0207694_10362700
1574 Ga0207650_10020651
1575 Ga0207650_10352869
1576 Ga0207700_10003865
1577 Ga0207700_10024335
1578 Ga0207664_10000419
1579 Ga0207664_10022981
1580 Ga0207664_10138967
1581 Ga0207664_10822840
1582 Ga0207644_10000833
1583 Ga0207644_10002832
1584 Ga0207690_10000314
1585 Ga0207690_10000797
1586 Ga0207690_10008204
1587 Ga0207690_10034749
1588 Ga0207690_10043020
1589 Ga0207690_10119941
1590 Ga0207690_10155955
1591 Ga0207690_10215986
1592 Ga0207690_10255072
1593 Ga0207690_10447939
1594 Ga0207706_10006757
1595 Ga0207706_10064116
1596 Ga0207706_10083461
1597 Ga0207706_10254836
1598 Ga0207709_10001731
1599 Ga0207709_10006989
1600 Ga0207670_10006401
1601 Ga0207669_10044209
1602 Ga0207669_10678038
1603 Ga0207704_10128325
1604 Ga0207711_10070123
1605 Ga0207711_10135700
1606 Ga0207711_10636030
1607 Ga0207689_10150058
1608 Ga0207689_10513710
1609 Ga0207661_10001403
1610 Ga0207667_10000130
1611 Ga0207667_10000169
1612 Ga0207667_10006239
1613 Ga0207667_10013015
1614 Ga0207667_10015306
1615 Ga0207667_10064596
1616 Ga0207667_10131954
1617 Ga0207667_10132801
1618 Ga0207667_10264973
1619 Ga0207667_10426315
1620 Ga0207651_10287750
1621 Ga0207651_10432056
1622 Ga0207712_10123710
1623 Ga0207668_10126656
1624 Ga0207668_10612466
1625 Ga0207640_10000838
1626 Ga0207640_10000908
1627 Ga0207640_10001060
1628 Ga0207640_10104123
1629 Ga0207640_10237128
1630 Ga0207677_10062497
1631 Ga0207677_10354174
1632 Ga0207677_10371122
1633 Ga0207703_10076370
1634 Ga0207639_10001886
1635 Ga0207639_10033345
1636 Ga0207639_10118496
1637 Ga0207639_10306901
1638 Ga0207639_10316142
1639 Ga0207678_10004283
1640 Ga0207678_10009382
1641 Ga0207678_10012591
1642 Ga0207678_10071671
1643 Ga0207678_10077801
1644 Ga0207678_10246941
1645 Ga0207678_10250517
1646 Ga0207678_10261620
1647 Ga0207678_10467075
1648 Ga0207678_10608017
1649 Ga0207702_10000456
1650 Ga0207702_10001809
1651 Ga0207702_10016985
1652 Ga0207702_10043331
1653 Ga0207702_10053697
1654 Ga0207702_10548603
1655 Ga0207641_10031254
1656 Ga0207641_10057113
1657 Ga0207641_10097631
1658 Ga0207641_11154779
1659 Ga0207648_10407013
1660 Ga0207648_11017111
1661 Ga0207676_10018047
1662 Ga0207676_10747026
1663 Ga0207674_10000132
1664 Ga0207674_10000971
1665 Ga0207674_10021327
1666 Ga0207674_10039041
1667 Ga0207674_10047238
1668 Ga0207674_10264604
1669 Ga0207674_10605584
1670 Ga0207683_10677450
1671 Ga0207698_10013331
1672 Ga0207698_10015885
1673 Ga0207698_10016173
1674 Ga0207698_10045800
1675 Ga0207698_10151618
1676 Ga0207698_10556360
1677 Ga0209973_1019921
1678 Ga0209371_1000004
1679 Ga0209371_1000139
1680 Ga0209999_1008881
1681 Ga0209970_1011151
1682 Ga0209983_1005635
1683 Ga0209974_10010051
1684 Ga0268266_10000514
1685 Ga0268266_10774463
1686 Ga0268265_10175325
1687 Ga0268265_10271456
1688 Ga0268265_11381258
1689 Ga0268264_10032658
1690 Ga0268264_10046584
1691 Ga0268264_10180457
1692 Ga0268256_1000005
1693 Ga0268256_1000109
1694 Ga0316176_1166069
1695 Ga0314311_1025340
1696 Ga0316178_1066114
1697 Ga0316183_1086976
1698 Ga0316181_1180556
1699 Ga0307408_100001207
1700 Ga0307408_100056195
1701 Ga0307408_100089274
1702 Ga0307408_100136374
1703 Ga0307408_100196370
1704 Ga0316579_10040992
1705 Ga0316576_10007734
1706 Ga0316576_10010970
1707 Ga0316576_10036293
1708 Ga0316576_10708104
1709 Ga0316578_10006565
1710 Ga0307516_10162244
1711 Ga0307405_10009341
1712 Ga0307405_10036573
1713 Ga0307405_10224636
1714 Ga0316577_10105319
1715 Ga0307413_10026248
1716 Ga0307413_10044844
1717 Ga0307413_10177855
1718 Ga0307413_10503860
1719 Ga0307413_10733133
1720 Ga0307410_10002549
1721 Ga0307410_10010008
1722 Ga0307410_10026571
1723 Ga0307410_10944271
1724 Ga0307406_10016843
1725 Ga0307406_10138571
1726 Ga0307406_10390814
1727 Ga0307406_10512447
1728 Ga0307406_10524310
1729 Ga0307407_10000195
1730 Ga0307407_10159425
1731 Ga0307412_10000548
1732 Ga0307412_10005980
1733 Ga0307412_10240330
1734 Ga0307412_10240820
1735 Ga0307412_10307364
1736 Ga0307409_100003317
1737 Ga0307409_100018175
1738 Ga0307409_100066180
1739 Ga0307409_100537009
1740 Ga0307409_100560622
1741 Ga0307416_100001750
1742 Ga0307416_100177034
1743 Ga0307414_10001053
1744 Ga0307414_10003789
1745 Ga0307414_10023949
1746 Ga0307414_10074267
1747 Ga0307414_10160897
1748 Ga0307414_10296325
1749 Ga0307414_10307317
1750 Ga0307414_10562854
1751 Ga0307414_10566378
1752 Ga0307414_10602496
1753 Ga0307414_10978216
1754 Ga0307411_10000206
1755 Ga0307411_10002634
1756 Ga0307411_10014544
1757 Ga0307411_10016389
1758 Ga0307411_10094833
1759 Ga0307411_10232904
1760 Ga0307411_10264160
1761 Ga0307411_10502491
1762 Ga0307411_10609503
1763 Ga0307411_10702476
1764 Ga0307415_100171924
1765 Ga0307415_100574187
1766 Ga0307507_10000880
1767 Ga0373943_0410418
1768 Ga0316574_0006768
1769 Ga0316574_0013668
1770 Ga0316574_0035290
1771 Ga0316574_0040143
1772 Ga0316574_0087546
1773 Ga0316574_0114224
1774 Ga0316574_0170516
1775 Ga0316574_0227671
1776 Ga0316574_0266986
1777 Ga0316574_0526489
1778 Ga0316582_0108618
1779 Ga0316582_0130962
1780 Ga0316584_0391071
1781 Ga0395899_0000184
1782 Ga0395899_0026186
1783 Ga0395899_0026471
1784 Ga0395899_0030102
1785 Ga0395899_0041528
1786 Ga0395899_0053971
1787 Ga0395899_0089521
1788 Ga0395899_0104800
1789 Ga0395899_0108198
1790 Ga0395899_0193216
1791 Ga0395899_0245317
1792 Ga0395899_0402416
1793 Ga0395900_0000723
1794 Ga0395900_0003562
1795 Ga0395900_0015111
1796 Ga0395900_0015235
1797 Ga0395900_0015753
1798 Ga0395900_0016216
1799 Ga0395900_0018901
1800 Ga0395900_0023262
1801 Ga0395900_0023486
1802 Ga0395900_0032996
1803 Ga0395900_0034194
1804 Ga0395900_0034975
1805 Ga0395900_0048973
1806 Ga0395900_0116238
1807 Ga0395900_0152977
1808 Ga0395900_0180553
1809 Ga0395900_0195738
1810 Ga0395900_0225941
1811 Ga0395900_0283099
1812 Ga0395900_0367667
1813 Ga0395900_0371655
1814 Ga0395900_0394087
1815 Ga0395900_0426287
1816 Ga0395900_0510831
1817 Ga0395900_0673295
1818 Ga0395898_0000087
1819 Ga0395898_0003277
1820 Ga0395898_0004020
1821 Ga0395898_0009646
1822 Ga0395898_0021149
1823 Ga0395898_0021259
1824 Ga0395898_0073821
1825 Ga0395898_0076450
1826 Ga0395898_0105564
1827 Ga0395898_0211881
1828 Ga0395898_0305517
1829 Ga0395898_0689979
1830 Ga0395898_0730900
1831 Ga0395905_0000005
1832 Ga0395905_0002000
1833 Ga0395905_0002910
1834 Ga0395905_0005131
1835 Ga0395905_0006920
1836 Ga0395905_0014364
1837 Ga0395905_0014911
1838 Ga0395905_0017740
1839 Ga0395905_0019323
1840 Ga0395905_0020118
1841 Ga0395905_0038867
1842 Ga0395905_0048848
1843 Ga0395905_0092920
1844 Ga0395905_0112028
1845 Ga0395905_0155998
1846 Ga0395905_0156703
1847 Ga0395905_0368606
1848 Ga0395901_0000280
1849 Ga0395901_0001808
1850 Ga0395901_0004038
1851 Ga0395901_0011865
1852 Ga0395901_0013263
1853 Ga0395901_0015235
1854 Ga0395901_0024583
1855 Ga0395901_0036907
1856 Ga0395901_0039387
1857 Ga0395901_0041573
1858 Ga0395901_0047175
1859 Ga0395901_0056242
1860 Ga0395901_0062101
1861 Ga0395901_0090198
1862 Ga0395901_0135655
1863 Ga0395901_0145796
1864 Ga0395901_0219532
1865 Ga0395901_0325934
1866 Ga0395901_0428574
1867 Ga0395901_0455686
1868 Ga0395901_0628422
1869 Ga0237819_00169
1870 Ga0436365_0505056
1871 Ga0436363_1707670
1872 Ga0439439_0130190
1873 Ga0439465_0001563
1874 Ga0439465_0205265
1875 Ga0451800_0005888
1876 Ga0451806_032754
1877 Ga0451837_0033562
1878 Ga0451837_0344179
1879 Ga0439437_018934
1880 Ga0439445_0000014
1881 Ga0439448_0018099
1882 Ga0439448_0063189
1883 Ga0439432_028035
1884 Ga0439432_167382
1885 Ga0439449_0000069
1886 Ga0439449_0003704
1887 Ga0450912_000246
1888 Ga0450920_009978
1889 Ga0439458_0000243
1890 Ga0439458_0007783
1891 Ga0439459_0002997
1892 Ga0466969_0000310
1893 Ga0466969_0055225
1894 Ga0466972_0008198
1895 Ga0466972_0036255
1896 Ga0466982_0000020
1897 Ga0466965_0077533
1898 Ga0466965_0078668
1899 Ga0466966_0000039
1900 Ga0466966_0000802
1901 Ga0466966_0001010
1902 Ga0466966_0008999
1903 Ga0466966_0039427
1904 Ga0466966_0045857
1905 Ga0466966_0050544
1906 Ga0466966_0368928
1907 Ga0466961_0000332
1908 Ga0466961_0024458
1909 Ga0466961_0052657
1910 Ga0466961_0053178
1911 Ga0466961_0296031
1912 Ga0466963_0450303
1913 Ga0466964_0002553
1914 Ga0466964_0006390
1915 Ga0466971_0001750
1916 Ga0466971_0006606
1917 Ga0466971_0006892
1918 Ga0466971_0039618
1919 Ga0466971_0102646
1920 Ga0466968_0000227
1921 Ga0466968_0016306
1922 Ga0466968_0363235
1923 Ga0466970_0000410
1924 Ga0466970_0000836
1925 Ga0466970_0019102
1926 Ga0466970_0020879
1927 Ga0466970_0024226
1928 Ga0466970_0060892
1929 Ga0466970_0522763
1930 Ga0466970_0581900
1931 Ga0466957_0006130
1932 Ga0466957_0088901
1933 Ga0466957_0233213
1934 Ga0466960_0034356
1935 Ga0466959_0000334
1936 Ga0466959_0008432
1937 Ga0466959_0039700
1938 Ga0466959_0042264
1939 Ga0466959_0099272
1940 Ga0466959_0172748
1941 Ga0466959_0178635
1942 Ga0466959_0493413
1943 Ga0466958_0004354
1944 Ga0466958_0011059
1945 Ga0466958_0016632
1946 Ga0466958_0019140
1947 Ga0466958_0208934
1948 Ga0466958_0316658
1949 Ga0466967_0077687
1950 Ga0466967_0271783
1951 Ga0466967_0271814
1952 Ga0466967_0281394
1953 Ga0466967_0460225
1954 Ga0466967_0563575
1955 Ga0495627_017920
1956 Ga0495638_0000049
1957 Ga0495638_0000202
1958 Ga0495638_0000916
1959 Ga0495638_0027546
1960 Ga0495650_0001214
1961 Ga0495606_0001000
1962 Ga0495610_0049600
1963 Ga0495631_0034299
1964 Ga0495632_0130654
1965 Ga0495643_0000919
1966 Ga0495663_0002339
1967 Ga0495663_0006455
1968 Ga0495663_0013907
1969 Ga0495663_0044739
1970 Ga0495621_0000983
1971 Ga0495621_0020509
1972 Ga0495621_0065359
1973 Ga0495622_0023430
1974 Ga0495633_0011833
1975 Ga0495633_0046333
1976 Ga0495633_0174398
1977 Ga0495633_0209316
1978 Ga0495656_0002149
1979 Ga0495668_0084960
1980 Ga0495625_0048020
1981 Ga0495625_0120402
1982 Ga0495625_0125600
1983 Ga0495670_0011668
1984 Ga0495649_0000823
1985 Ga0495660_0106768
1986 Ga0495636_0006533
1987 Ga0495672_0000105
1988 Ga0495672_0158322
1989 Ga0495686_0008426
1990 Ga0495686_0015670
1991 Ga0496100_0167599
1992 Ga0496100_0229956
1993 Ga0496101_0048090
1994 Ga0496101_0177997
1995 Ga0496102_0034842
1996 Ga0496102_0859362
1997 Ga0496103_0101135
1998 Ga0496104_0055648
1999 Ga0496104_0091848
2000 Ga0496104_0268192
2001 Ga0496104_0346063
2002 Ga0496105_0001964
2003 Ga0496105_0172208
2004 Ga0496106_0046723
2005 Ga0496107_0234325
2006 Ga0496107_0361177
2007 Ga0496107_0786771
2008 Ga0496108_0148092
2009 Ga0496109_0136187
2010 Ga0496109_0267515
2011 Ga0496110_0188119
2012 Ga0496110_1025254
2013 Ga0496111_0118009
2014 Ga0496111_0213700
2015 Ga0496113_0030099
2016 Ga0496113_0115447
2017 Ga0496114_0000594
2018 Ga0496114_0937283
2019 Ga0496115_0000024
2020 Ga0496115_0000103
2021 Ga0496115_0002161
2022 Ga0496115_0002922
2023 Ga0496115_0011553
2024 Ga0496116_0000218
2025 Ga0496116_0013717
2026 Ga0496116_0032122
2027 Ga0496116_0076650
2028 Ga0496116_0113902
2029 Ga0496116_0213622
2030 Ga0496117_0000314
2031 Ga0496117_0001191
2032 Ga0496117_0003149
2033 Ga0496117_0004544
2034 Ga0496117_0009737
2035 Ga0496117_0083137
2036 Ga0496117_0086255
2037 Ga0496117_0117784
2038 Ga0496117_0276306
2039 Ga0496118_0000371
2040 Ga0496118_0002136
2041 Ga0496118_0002547
2042 Ga0496118_0006150
2043 Ga0496118_0006935
2044 Ga0496118_0012624
2045 Ga0496118_0021905
2046 Ga0496118_0033714
2047 Ga0496118_0117972
2048 Ga0496118_0127254
2049 Ga0496119_0000239
2050 Ga0496119_0001743
2051 Ga0496119_0002432
2052 Ga0496119_0002973
2053 Ga0496119_0054521
2054 Ga0496120_0000167
2055 Ga0496120_0000181
2056 Ga0496120_0000676
2057 Ga0496120_0000868
2058 Ga0496121_0000532
2059 Ga0496121_0004104
2060 Ga0496121_0016876
2061 Ga0496121_0028676
2062 Ga0496121_0039123
2063 Ga0496121_0042063
2064 Ga0496121_0046716
2065 Ga0496121_0175446
2066 Ga0496121_0209945
2067 Ga0496122_0000901
2068 Ga0496122_0001122
2069 Ga0496122_0012066
2070 Ga0496122_0021920
2071 Ga0496122_0102293
2072 Ga0496122_0185702
2073 Ga0496122_0262235
2074 Ga0496123_0000727
2075 Ga0496123_0000920
2076 Ga0496123_0002564
2077 Ga0496123_0005759
2078 Ga0496123_0010634
2079 Ga0496123_0042551
2080 Ga0496123_0046388
2081 Ga0496123_0318995
2082 Ga0496124_0001061
2083 Ga0496124_0001652
2084 Ga0496124_0005126
2085 Ga0496124_0006193
2086 Ga0496124_0009321
2087 Ga0496124_0019095
2088 Ga0496124_0021047
2089 Ga0496124_0058646
2090 Ga0496124_0239956
2091 Ga0496124_0335034
2092 Ga0496125_0000320
2093 Ga0496125_0000344
2094 Ga0496125_0005964
2095 Ga0496125_0025180
2096 Ga0496125_0121582
2097 Ga0496125_0131233
2098 Ga0496125_0268578
2099 Ga0496126_0000581
2100 Ga0496126_0001014
2101 Ga0496126_0007111
2102 Ga0496126_0123760
2103 Ga0496126_0191593
2104 Ga0496126_0206619
2105 Ga0496126_0588425
2106 Ga0495678_037387
2107 Ga0495682_0017233
2108 Ga0501031_0020584
2109 Ga0501031_0107743
2110 Ga0501031_0150963
2111 Ga0501032_0014188
2112 Ga0501032_0114080
2113 Ga0501032_0178721
2114 Ga0501033_0001868
2115 Ga0501033_0002545
2116 Ga0501033_0090785
2117 Ga0501033_0199045
2118 Ga0501033_0523668
2119 Ga0501034_0001977
2120 Ga0501034_0007048
2121 Ga0501034_0028239
2122 Ga0501034_0103298
2123 Ga0501034_0143066
2124 Ga0501034_0192995
2125 Ga0501034_0343555
2126 Ga0501034_0635658
2127 Ga0501036_0095765
2128 Ga0501036_0111278
2129 Ga0501037_0015245
2130 Ga0501037_0041434
2131 Ga0501038_0066603
2132 Ga0501038_0119491
2133 Ga0501039_0362605
2134 Ga0501039_0605447
2135 Ga0501043_0128950
2136 Ga0501043_0185757
2137 Ga0501043_0386785
2138 Ga0501046_0025262
2139 Ga0501046_0091874
2140 Ga0501046_0103124
2141 Ga0501047_0003603
2142 Ga0501047_0011089
2143 Ga0501047_0031361
2144 Ga0501047_0101772
2145 Ga0501048_0078848
2146 Ga0501069_0011564
2147 Ga0501069_0048655
2148 Ga0501070_0000587
2149 Ga0501070_0020482
2150 Ga0501070_0358320
2151 Ga0501073_0188926
2152 Ga0501077_0277500
2153 Ga0501216_011253
2154 Ga0501249_043326
2155 Ga0501259_027992
2156 Ga0501080_0038483
2157 Ga0501272_008281
2158 Ga0501275_000447
2159 Ga0501035_0005912
2160 Ga0501035_0017043
2161 Ga0501035_0023420
2162 Ga0501035_0070003
2163 Ga0501035_0097596
2164 Ga0501035_0499810
2165 Ga0501044_0020827
2166 Ga0501044_0025356
2167 Ga0501044_0042471
2168 Ga0501044_0213400
2169 Ga0501044_0345473
2170 Ga0501044_0601604
2171 nmdc:mga00v17_20876_c1
2172 nmdc:mga00v17_729_c2
2173 nmdc:mga0yw44_137900_c1
2174 nmdc:mga06z11_426937_c1
2175 nmdc:mga05p37_678987_c1
2176 nmdc:mga08y16_479171_c1
2177 nmdc:mga08y16_512095_c1
2178 nmdc:mga0n895_1019311_c1
2179 Ga0500626_053803
2180 Ga0500658_0196854
2181 Ga0500568_0004359
2182 Ga0500604_0000002
2183 Ga0500616_0000238
2184 Ga0500634_0000322
2185 Ga0500565_020439
2186 Ga0466962_0000083
2187 Ga0466962_0003389
2188 Ga0466962_0004622
2189 Ga0466962_0066683
2190 Ga0466962_0131145
2191 2547502928
2192 2578458532
2193 2643830455
2194 2643894229
2195 2644476431
2196 2687582890
2197 2739730760
2198 2747949454
2199 2748019754
2200 2765578859
2201 2816516922
2202 2819659690
2203 2842393095
2204 2842758283
2205 2852650950
2206 2852685497
2207 2857443793
2208 2874221498
2209 2884414413
2210 2894415468
2211 2895398770
2212 2895500779
2213 2895516351
2214 2895523730
2215 2895526689
2216 2919089833
2217 2919131658
2218 2919137845
2219 2928496536
2220 2928964166
2221 2929197971
2222 2931380878
2223 2937612316
2224 2939590876
2225 2939612354
2226 2939623133
2227 2939630747
2228 2941478202
2229 2961048264
2230 2961065262
2231 2974309091
2232 2977249811
2233 2987606080
2234 8021624276
2235 8021629120
2236 8021649111

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00117

GATase

Glutamine amidotransferase class-I

44

236

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4gud-assembly1.cif.gz_A crystal structure of amidotransferase hish from vibrio cholerae 0.958 4 196
4gud-assembly2.cif.gz_B crystal structure of amidotransferase hish from vibrio cholerae 0.9552 1 196
4gud-assembly1.cif.gz_A crystal structure of amidotransferase hish from vibrio cholerae 0.9344 4 196
4gud-assembly2.cif.gz_B crystal structure of amidotransferase hish from vibrio cholerae 0.932 1 196
1ka9-assembly1.cif.gz_H imidazole glycerol phosphate synthase 0.9167 3 197
ID Description Score Start End Superfamily
4gudA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9519 4 196 3.40.50.880
af_P9WMM1_1_205_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9407 1 197 3.40.50.880
af_Q2FUU1_1_190_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9357 4 200 3.40.50.880
af_Q57929_1_195_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9332 4 196 3.40.50.880
4gudA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9328 4 196 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A357NIC5-F1-model_v4 deleted 0.9957 116 180
AF-A0A7C9LXU4-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) 0.9921 2 196 GO:0000105
GO:0000107
GO:0004359
GO:0005737
GO:0006541
GO:0016829
AF-A0A1G0QUI8-F1-model_v4 Imidazole glycerol phosphate synthase, glutamine amidotransferase subunit 0.9918 113 196 GO:0000105
GO:0000107
GO:0004359
GO:0016829
AF-A0A848QA24-F1-model_v4 deleted 0.9892 44 196
AF-A0A3C0X9Q2-F1-model_v4 deleted 0.9883 1 121

Map