F490344
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1118 | 398 | 1117 | 292 |
Family's Representative Sequence
| Representative Sequence | 3300032004|Ga0307414_10000608|Ga0307414_100006088 |
| Length | 359 |
| Sequence | MLLCTVGVGVLRWLAISIHCPLSFESFTKPIRYLGLVRKLNQYQIQELGLGLANRKSIFVSNSSKRSIVANKTVKVGLVQLSCSPDVAENMTKTIAGVREAAAKGAQVVVLQELFRSLYFCDVEDYENFKLAESIPGPSTETLGDLAKELGVVIVASLFEKRAEGLYHNTTAVLDADGTYLGKYRKMHIPDDPGYYEKFYFTPGDLGYKVFTTKFGNIGVLICWDQWYPEAARITALKGADFLVYPTAIGWHKDQAPDVNDEQYGAWQTIQRSHAVANGIPVVSVNRCGHEGDMKFWGGSFVANPFGRIIFKASHDEEQIHVEELDFAKSDQYRTHWPFLRDRRIDSYQPITKRFLDEE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 3 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 7 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 8 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 9 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 10 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 11 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 12 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 13 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 14 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 15 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 16 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 17 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 18 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 21 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 22 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 25 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 31 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 35 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 57 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 62 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 68 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 70 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 71 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 72 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 74 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 75 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 76 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 77 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 78 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 79 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 80 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 81 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 82 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 83 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 84 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 86 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 88 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 89 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 90 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 91 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 92 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 120 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 124 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 125 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 126 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 127 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 129 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 135 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 136 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 203 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 207 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 208 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 209 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 210 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 211 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 212 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 213 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 214 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 215 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 216 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 217 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 218 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 219 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 220 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 221 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 222 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 223 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 224 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 225 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 226 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 227 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 228 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 229 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 230 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 231 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 232 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 233 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 234 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 235 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 236 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 237 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 238 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 239 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 240 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 241 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 242 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 243 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 244 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 245 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 246 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 247 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 249 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 250 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 251 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 252 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 253 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 254 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 255 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 256 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 257 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 258 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 259 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 260 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 261 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 262 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 263 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 264 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 265 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 266 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 267 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 268 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 269 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 270 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 271 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 272 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 273 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 274 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 275 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 276 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 277 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 324 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 325 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 326 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 327 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 328 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 329 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 330 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 331 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 332 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 333 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 334 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 335 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 336 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 337 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 338 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 356 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 357 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 358 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 359 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 360 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 361 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 362 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 364 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 365 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 366 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 369 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 370 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 371 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 378 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 379 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 380 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 381 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 382 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 383 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 384 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 385 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 386 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 387 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 388 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 389 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 390 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 391 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 392 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 393 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 394 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 395 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 396 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 397 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 398 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.82 |
| Metatranscriptomes | 0.09 |
| Isolates | 0.09 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.89 |
| Nodule | 0 |
| Rhizoplane | 0.98 |
| Rhizosphere | 88.1 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.03 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1599521 | 2162886007 | Bacteria | 4540 |
| 2 | SwRhRL2b_contig_3865623 | 2162886007 | Bacteria | 4805 |
| 3 | JGI24736J21556_1001800 | 3300001904 | Bacteria | 3847 |
| 4 | JGI24737J22298_10001003 | 3300001990 | Bacteria | 9991 |
| 5 | JGI24737J22298_10022757 | 3300001990 | Bacteria | 1991 |
| 6 | JGI24735J21928_10000038 | 3300002067 | Bacteria | 64134 |
| 7 | JGI24744J21845_10001880 | 3300002077 | Bacteria | 4219 |
| 8 | JGI25162J39368_1000716 | 3300002737 | Bacteria | 22967 |
| 9 | JGI25164J39214_1000601 | 3300002772 | Bacteria | 15724 |
| 10 | JGI25150J39212_1000015 | 3300002774 | Bacteria | 170613 |
| 11 | JGI25151J46595_10000043 | 3300003187 | Bacteria | 170613 |
| 12 | JGI25165J46597_1000157 | 3300003214 | Bacteria | 108987 |
| 13 | JGI25153J46596_10000009 | 3300003215 | Bacteria | 340925 |
| 14 | rootH2_10002560 | 3300003320 | Bacteria | 75599 |
| 15 | rootL2_10001385 | 3300003322 | Bacteria | 8933 |
| 16 | rootL2_10071161 | 3300003322 | Bacteria | 1288 |
| 17 | rootH1_10005851 | 3300003323 | Bacteria | 85811 |
| 18 | rootH1_10007902 | 3300003323 | Bacteria | 8629 |
| 19 | rootH1_10008582 | 3300003323 | Bacteria | 172664 |
| 20 | rootH1_10025209 | 3300003323 | Bacteria | 3648 |
| 21 | rootH1_10025210 | 3300003323 | Bacteria | 12643 |
| 22 | rootH1_10061615 | 3300003323 | Bacteria | 2792 |
| 23 | JGI25160J50197_1010888 | 3300003354 | Bacteria | 3260 |
| 24 | Ga0055536_1000019 | 3300003781 | Bacteria | 203087 |
| 25 | Ga0055530_10003660 | 3300003791 | Bacteria | 8598 |
| 26 | Ga0055531_10000144 | 3300003794 | Bacteria | 82231 |
| 27 | Ga0055531_10000559 | 3300003794 | Bacteria | 32705 |
| 28 | Ga0058863_11478938 | 3300004799 | Bacteria | 2876 |
| 29 | Ga0065165_1000470 | 3300005262 | Bacteria | 62866 |
| 30 | Ga0065714_10006118 | 3300005288 | Bacteria | 5189 |
| 31 | Ga0065714_10113088 | 3300005288 | Bacteria | 1446 |
| 32 | Ga0065704_10002638 | 3300005289 | Bacteria | 8395 |
| 33 | Ga0065704_10070962 | 3300005289 | Bacteria | 14215 |
| 34 | Ga0065712_10082930 | 3300005290 | Bacteria | 2874 |
| 35 | Ga0065712_10092198 | 3300005290 | Bacteria | 2340 |
| 36 | Ga0065712_10143882 | 3300005290 | Bacteria | 1423 |
| 37 | Ga0065712_10221579 | 3300005290 | Bacteria | 1039 |
| 38 | Ga0065715_10218605 | 3300005293 | Bacteria | 1282 |
| 39 | Ga0070658_10000014 | 3300005327 | Bacteria | 244978 |
| 40 | Ga0070658_10033640 | 3300005327 | Bacteria | 4124 |
| 41 | Ga0070658_10106653 | 3300005327 | Bacteria | 2318 |
| 42 | Ga0070676_10000269 | 3300005328 | Bacteria | 22806 |
| 43 | Ga0070676_10002554 | 3300005328 | Bacteria | 9358 |
| 44 | Ga0070676_10022315 | 3300005328 | Bacteria | 3549 |
| 45 | Ga0070683_100002314 | 3300005329 | Bacteria | 15105 |
| 46 | Ga0070683_100016654 | 3300005329 | Bacteria | 6486 |
| 47 | Ga0070683_100049155 | 3300005329 | Bacteria | 3900 |
| 48 | Ga0070683_100050964 | 3300005329 | Bacteria | 3834 |
| 49 | Ga0070683_100179132 | 3300005329 | Bacteria | 2012 |
| 50 | Ga0070670_100027148 | 3300005331 | Bacteria | 4925 |
| 51 | Ga0070670_100066317 | 3300005331 | Bacteria | 3097 |
| 52 | Ga0070670_100120637 | 3300005331 | Bacteria | 2262 |
| 53 | Ga0070670_100141292 | 3300005331 | Bacteria | 2082 |
| 54 | Ga0068869_100018905 | 3300005334 | Bacteria | 4697 |
| 55 | Ga0068869_100036830 | 3300005334 | Bacteria | 3475 |
| 56 | Ga0068869_100046930 | 3300005334 | Bacteria | 3117 |
| 57 | Ga0070666_10000135 | 3300005335 | Bacteria | 51126 |
| 58 | Ga0070666_10002025 | 3300005335 | Bacteria | 12324 |
| 59 | Ga0070666_10002566 | 3300005335 | Bacteria | 10980 |
| 60 | Ga0070666_10282195 | 3300005335 | Bacteria | 1181 |
| 61 | Ga0070680_100011377 | 3300005336 | Bacteria | 6882 |
| 62 | Ga0070680_100019405 | 3300005336 | Bacteria | 5387 |
| 63 | Ga0070680_100420565 | 3300005336 | Bacteria | 1140 |
| 64 | Ga0070682_100019480 | 3300005337 | Bacteria | 3981 |
| 65 | Ga0068868_100000346 | 3300005338 | Bacteria | 31447 |
| 66 | Ga0068868_100023630 | 3300005338 | Bacteria | 4654 |
| 67 | Ga0068868_100023876 | 3300005338 | Bacteria | 4633 |
| 68 | Ga0068868_100074081 | 3300005338 | Bacteria | 2718 |
| 69 | Ga0068868_100123383 | 3300005338 | Bacteria | 2114 |
| 70 | Ga0070660_100033752 | 3300005339 | Bacteria | 3860 |
| 71 | Ga0070689_100045450 | 3300005340 | Bacteria | 3382 |
| 72 | Ga0070689_100063312 | 3300005340 | Bacteria | 2878 |
| 73 | Ga0070689_100096685 | 3300005340 | Bacteria | 2335 |
| 74 | Ga0070689_100153373 | 3300005340 | Bacteria | 1859 |
| 75 | Ga0070691_10002703 | 3300005341 | Bacteria | 7902 |
| 76 | Ga0070691_10013653 | 3300005341 | Bacteria | 3723 |
| 77 | Ga0070691_10102297 | 3300005341 | Bacteria | 1424 |
| 78 | Ga0070687_100029219 | 3300005343 | Bacteria | 2682 |
| 79 | Ga0070661_100000309 | 3300005344 | Bacteria | 39394 |
| 80 | Ga0070668_100001621 | 3300005347 | Bacteria | 16276 |
| 81 | Ga0070668_100118657 | 3300005347 | Bacteria | 2112 |
| 82 | Ga0070668_100309168 | 3300005347 | Bacteria | 1328 |
| 83 | Ga0070669_100001811 | 3300005353 | Bacteria | 15389 |
| 84 | Ga0070669_100026569 | 3300005353 | Bacteria | 4165 |
| 85 | Ga0070669_100273468 | 3300005353 | Bacteria | 1351 |
| 86 | Ga0070669_100332853 | 3300005353 | Bacteria | 1229 |
| 87 | Ga0070675_100025703 | 3300005354 | Bacteria | 4721 |
| 88 | Ga0070675_100029719 | 3300005354 | Bacteria | 4409 |
| 89 | Ga0070675_100045543 | 3300005354 | Bacteria | 3590 |
| 90 | Ga0070675_100058628 | 3300005354 | Bacteria | 3176 |
| 91 | Ga0070675_100103555 | 3300005354 | Bacteria | 2400 |
| 92 | Ga0070675_100134598 | 3300005354 | Bacteria | 2108 |
| 93 | Ga0070675_100185362 | 3300005354 | Bacteria | 1801 |
| 94 | Ga0070671_100008005 | 3300005355 | Bacteria | 8461 |
| 95 | Ga0070671_100014610 | 3300005355 | Bacteria | 6349 |
| 96 | Ga0070671_100044961 | 3300005355 | Bacteria | 3669 |
| 97 | Ga0070671_100080801 | 3300005355 | Bacteria | 2718 |
| 98 | Ga0070671_100190925 | 3300005355 | Bacteria | 1736 |
| 99 | Ga0070671_100304743 | 3300005355 | Bacteria | 1356 |
| 100 | Ga0070674_100001154 | 3300005356 | Bacteria | 13918 |
| 101 | Ga0070674_100075747 | 3300005356 | Bacteria | 2391 |
| 102 | Ga0070673_100003206 | 3300005364 | Bacteria | 10139 |
| 103 | Ga0070673_100012228 | 3300005364 | Bacteria | 5887 |
| 104 | Ga0070673_100033392 | 3300005364 | Bacteria | 3885 |
| 105 | Ga0070673_100035168 | 3300005364 | Bacteria | 3796 |
| 106 | Ga0070673_100085144 | 3300005364 | Bacteria | 2572 |
| 107 | Ga0070688_100000797 | 3300005365 | Bacteria | 15547 |
| 108 | Ga0070688_100010642 | 3300005365 | Bacteria | 5080 |
| 109 | Ga0070688_100093239 | 3300005365 | Bacteria | 1972 |
| 110 | Ga0070688_100112317 | 3300005365 | Bacteria | 1814 |
| 111 | Ga0070688_100115543 | 3300005365 | Bacteria | 1791 |
| 112 | Ga0070688_100152736 | 3300005365 | Bacteria | 1580 |
| 113 | Ga0070659_100000107 | 3300005366 | Bacteria | 61453 |
| 114 | Ga0070659_100027777 | 3300005366 | Bacteria | 4363 |
| 115 | Ga0070667_100001883 | 3300005367 | Bacteria | 18625 |
| 116 | Ga0070667_100022393 | 3300005367 | Bacteria | 5241 |
| 117 | Ga0070667_100038061 | 3300005367 | Bacteria | 4033 |
| 118 | Ga0070713_100125449 | 3300005436 | Bacteria | 2257 |
| 119 | Ga0070705_100000614 | 3300005440 | Bacteria | 20625 |
| 120 | Ga0070700_100274053 | 3300005441 | Bacteria | 1220 |
| 121 | Ga0070663_100109107 | 3300005455 | Bacteria | 2077 |
| 122 | Ga0070678_100068655 | 3300005456 | Bacteria | 2643 |
| 123 | Ga0070678_100267669 | 3300005456 | Bacteria | 1440 |
| 124 | Ga0070662_100000192 | 3300005457 | Bacteria | 35614 |
| 125 | Ga0070662_100040400 | 3300005457 | Bacteria | 3321 |
| 126 | Ga0070662_100131336 | 3300005457 | Bacteria | 1931 |
| 127 | Ga0070662_100231604 | 3300005457 | Bacteria | 1478 |
| 128 | Ga0070681_10022138 | 3300005458 | Bacteria | 6378 |
| 129 | Ga0070681_10037085 | 3300005458 | Bacteria | 4893 |
| 130 | Ga0070681_10587577 | 3300005458 | Bacteria | 1028 |
| 131 | Ga0068867_100004996 | 3300005459 | Bacteria | 9349 |
| 132 | Ga0068867_100006330 | 3300005459 | Bacteria | 8375 |
| 133 | Ga0068867_100014723 | 3300005459 | Bacteria | 5543 |
| 134 | Ga0068867_100058992 | 3300005459 | Bacteria | 2844 |
| 135 | Ga0068867_100082126 | 3300005459 | Bacteria | 2430 |
| 136 | Ga0068867_100085784 | 3300005459 | Bacteria | 2381 |
| 137 | Ga0068867_100093402 | 3300005459 | Bacteria | 2286 |
| 138 | Ga0070685_10004778 | 3300005466 | Bacteria | 6862 |
| 139 | Ga0070685_10032145 | 3300005466 | Bacteria | 2938 |
| 140 | Ga0070685_10131185 | 3300005466 | Bacteria | 1567 |
| 141 | Ga0070698_100002401 | 3300005471 | Bacteria | 20622 |
| 142 | Ga0070698_100004441 | 3300005471 | Bacteria | 15416 |
| 143 | Ga0070698_100188834 | 3300005471 | Bacteria | 1998 |
| 144 | Ga0070698_100337335 | 3300005471 | Bacteria | 1439 |
| 145 | Ga0070679_100022452 | 3300005530 | Bacteria | 6166 |
| 146 | Ga0070679_100033714 | 3300005530 | Bacteria | 5070 |
| 147 | Ga0070679_100036558 | 3300005530 | Bacteria | 4873 |
| 148 | Ga0070684_100000823 | 3300005535 | Bacteria | 21717 |
| 149 | Ga0070684_100001699 | 3300005535 | Bacteria | 16028 |
| 150 | Ga0070684_100024327 | 3300005535 | Bacteria | 5079 |
| 151 | Ga0070684_100074493 | 3300005535 | Bacteria | 2992 |
| 152 | Ga0070684_100363490 | 3300005535 | Bacteria | 1332 |
| 153 | Ga0068853_100004185 | 3300005539 | Bacteria | 11126 |
| 154 | Ga0068853_100009749 | 3300005539 | Bacteria | 7747 |
| 155 | Ga0068853_100014984 | 3300005539 | Bacteria | 6369 |
| 156 | Ga0068853_100021323 | 3300005539 | Bacteria | 5401 |
| 157 | Ga0068853_100026820 | 3300005539 | Bacteria | 4840 |
| 158 | Ga0068853_100075071 | 3300005539 | Bacteria | 2950 |
| 159 | Ga0068853_100081876 | 3300005539 | Bacteria | 2827 |
| 160 | Ga0068853_100086863 | 3300005539 | Bacteria | 2743 |
| 161 | Ga0070672_100000840 | 3300005543 | Bacteria | 18390 |
| 162 | Ga0070672_100031360 | 3300005543 | Bacteria | 3999 |
| 163 | Ga0070686_100029354 | 3300005544 | Bacteria | 3345 |
| 164 | Ga0070696_100008024 | 3300005546 | Bacteria | 7053 |
| 165 | Ga0070665_100000001 | 3300005548 | Bacteria | 1083363 |
| 166 | Ga0070665_100001766 | 3300005548 | Bacteria | 24650 |
| 167 | Ga0070704_100020577 | 3300005549 | Bacteria | 4257 |
| 168 | Ga0068855_100000089 | 3300005563 | Bacteria | 110845 |
| 169 | Ga0068855_100003029 | 3300005563 | Bacteria | 20562 |
| 170 | Ga0068855_100005857 | 3300005563 | Bacteria | 15001 |
| 171 | Ga0068855_100007823 | 3300005563 | Bacteria | 12912 |
| 172 | Ga0068855_100009170 | 3300005563 | Bacteria | 11950 |
| 173 | Ga0068855_100081580 | 3300005563 | Bacteria | 3749 |
| 174 | Ga0068855_100213189 | 3300005563 | Bacteria | 2169 |
| 175 | Ga0068855_100226227 | 3300005563 | Bacteria | 2096 |
| 176 | Ga0070664_100013649 | 3300005564 | Bacteria | 6620 |
| 177 | Ga0070664_100014161 | 3300005564 | Bacteria | 6505 |
| 178 | Ga0070664_100020475 | 3300005564 | Bacteria | 5447 |
| 179 | Ga0070664_100136174 | 3300005564 | Bacteria | 2160 |
| 180 | Ga0070664_100140932 | 3300005564 | Bacteria | 2123 |
| 181 | Ga0070664_100294277 | 3300005564 | Bacteria | 1466 |
| 182 | Ga0068857_100002744 | 3300005577 | Bacteria | 14466 |
| 183 | Ga0068857_100018587 | 3300005577 | Bacteria | 6098 |
| 184 | Ga0068857_100023085 | 3300005577 | Bacteria | 5472 |
| 185 | Ga0068854_100022883 | 3300005578 | Bacteria | 4263 |
| 186 | Ga0068854_100032235 | 3300005578 | Bacteria | 3644 |
| 187 | Ga0068854_100036834 | 3300005578 | Bacteria | 3431 |
| 188 | Ga0068854_100090956 | 3300005578 | Bacteria | 2270 |
| 189 | Ga0068856_100000104 | 3300005614 | Bacteria | 81872 |
| 190 | Ga0068856_100019556 | 3300005614 | Bacteria | 6574 |
| 191 | Ga0068856_100100991 | 3300005614 | Bacteria | 2878 |
| 192 | Ga0070702_100019598 | 3300005615 | Bacteria | 3532 |
| 193 | Ga0070702_100031741 | 3300005615 | Bacteria | 2893 |
| 194 | Ga0070702_100060720 | 3300005615 | Bacteria | 2199 |
| 195 | Ga0068852_100002279 | 3300005616 | Bacteria | 13188 |
| 196 | Ga0068852_100065071 | 3300005616 | Bacteria | 3180 |
| 197 | Ga0068852_100251633 | 3300005616 | Bacteria | 1693 |
| 198 | Ga0068852_100267830 | 3300005616 | Bacteria | 1643 |
| 199 | Ga0068859_100000127 | 3300005617 | Bacteria | 72136 |
| 200 | Ga0068859_100008901 | 3300005617 | Bacteria | 10134 |
| 201 | Ga0068859_100020688 | 3300005617 | Bacteria | 6603 |
| 202 | Ga0068859_100074856 | 3300005617 | Bacteria | 3425 |
| 203 | Ga0068859_100460630 | 3300005617 | Bacteria | 1367 |
| 204 | Ga0068859_100650379 | 3300005617 | Bacteria | 1146 |
| 205 | Ga0068864_100003469 | 3300005618 | Bacteria | 13020 |
| 206 | Ga0068864_100009571 | 3300005618 | Bacteria | 7990 |
| 207 | Ga0068864_100029379 | 3300005618 | Bacteria | 4655 |
| 208 | Ga0068864_100057779 | 3300005618 | Bacteria | 3352 |
| 209 | Ga0068864_100071253 | 3300005618 | Bacteria | 3026 |
| 210 | Ga0068864_100137455 | 3300005618 | Bacteria | 2202 |
| 211 | Ga0068864_100348222 | 3300005618 | Bacteria | 1397 |
| 212 | Ga0068864_100447387 | 3300005618 | Bacteria | 1235 |
| 213 | Ga0068866_10000672 | 3300005718 | Bacteria | 15505 |
| 214 | Ga0068866_10013596 | 3300005718 | Bacteria | 3576 |
| 215 | Ga0068866_10110441 | 3300005718 | Bacteria | 1533 |
| 216 | Ga0068861_100013626 | 3300005719 | Bacteria | 5692 |
| 217 | Ga0068861_100016204 | 3300005719 | Bacteria | 5269 |
| 218 | Ga0068861_100019242 | 3300005719 | Bacteria | 4878 |
| 219 | Ga0068861_100033474 | 3300005719 | Bacteria | 3791 |
| 220 | Ga0068861_100505641 | 3300005719 | Bacteria | 1093 |
| 221 | Ga0068851_10000010 | 3300005834 | Bacteria | 202121 |
| 222 | Ga0068851_10000863 | 3300005834 | Bacteria | 13044 |
| 223 | Ga0068851_10121257 | 3300005834 | Bacteria | 1405 |
| 224 | Ga0068863_100000546 | 3300005841 | Bacteria | 38297 |
| 225 | Ga0068863_100001425 | 3300005841 | Bacteria | 23686 |
| 226 | Ga0068863_100023248 | 3300005841 | Bacteria | 5924 |
| 227 | Ga0068863_100111487 | 3300005841 | Bacteria | 2606 |
| 228 | Ga0068863_100665499 | 3300005841 | Bacteria | 1033 |
| 229 | Ga0068858_100000505 | 3300005842 | Bacteria | 40920 |
| 230 | Ga0068858_100014075 | 3300005842 | Bacteria | 7544 |
| 231 | Ga0068858_100031927 | 3300005842 | Bacteria | 4892 |
| 232 | Ga0068858_100128362 | 3300005842 | Bacteria | 2376 |
| 233 | Ga0068860_100000111 | 3300005843 | Bacteria | 131004 |
| 234 | Ga0068860_100002119 | 3300005843 | Bacteria | 20918 |
| 235 | Ga0068860_100005385 | 3300005843 | Bacteria | 12986 |
| 236 | Ga0068860_100014120 | 3300005843 | Bacteria | 7833 |
| 237 | Ga0068860_100018651 | 3300005843 | Bacteria | 6747 |
| 238 | Ga0068860_100023982 | 3300005843 | Bacteria | 5897 |
| 239 | Ga0068860_100036960 | 3300005843 | Bacteria | 4676 |
| 240 | Ga0068862_100012975 | 3300005844 | Bacteria | 6891 |
| 241 | Ga0081539_10033663 | 3300005985 | Bacteria | 3115 |
| 242 | Ga0070715_10049955 | 3300006163 | Bacteria | 1794 |
| 243 | Ga0075366_10004074 | 3300006195 | Bacteria | 7812 |
| 244 | Ga0075366_10006278 | 3300006195 | Bacteria | 6501 |
| 245 | Ga0075366_10011952 | 3300006195 | Bacteria | 4916 |
| 246 | Ga0075366_10079830 | 3300006195 | Bacteria | 1954 |
| 247 | Ga0097621_100000579 | 3300006237 | Bacteria | 25795 |
| 248 | Ga0097621_100000586 | 3300006237 | Bacteria | 25626 |
| 249 | Ga0097621_100002660 | 3300006237 | Bacteria | 12228 |
| 250 | Ga0097621_100005487 | 3300006237 | Bacteria | 8933 |
| 251 | Ga0097621_100039231 | 3300006237 | Bacteria | 3803 |
| 252 | Ga0097621_100055070 | 3300006237 | Bacteria | 3247 |
| 253 | Ga0097621_100311840 | 3300006237 | Bacteria | 1392 |
| 254 | Ga0075370_10168223 | 3300006353 | Bacteria | 1288 |
| 255 | Ga0068871_100000212 | 3300006358 | Bacteria | 40531 |
| 256 | Ga0068871_100001377 | 3300006358 | Bacteria | 16266 |
| 257 | Ga0068871_100001603 | 3300006358 | Bacteria | 15221 |
| 258 | Ga0068871_100068598 | 3300006358 | Bacteria | 2912 |
| 259 | Ga0075428_100011915 | 3300006844 | Bacteria | 9673 |
| 260 | Ga0075428_100025699 | 3300006844 | Bacteria | 6520 |
| 261 | Ga0075428_100180137 | 3300006844 | Bacteria | 2288 |
| 262 | Ga0075431_100262683 | 3300006847 | Bacteria | 1751 |
| 263 | Ga0075429_100001604 | 3300006880 | Bacteria | 18651 |
| 264 | Ga0075429_100019706 | 3300006880 | Bacteria | 5848 |
| 265 | Ga0068865_100000264 | 3300006881 | Bacteria | 28723 |
| 266 | Ga0068865_100003908 | 3300006881 | Bacteria | 8938 |
| 267 | Ga0068865_100012416 | 3300006881 | Bacteria | 5361 |
| 268 | Ga0097620_100000127 | 3300006931 | Bacteria | 72136 |
| 269 | Ga0097620_100008901 | 3300006931 | Bacteria | 10134 |
| 270 | Ga0097620_100020689 | 3300006931 | Bacteria | 6603 |
| 271 | Ga0097620_100074860 | 3300006931 | Bacteria | 3425 |
| 272 | Ga0097620_100460665 | 3300006931 | Bacteria | 1367 |
| 273 | Ga0097620_100650420 | 3300006931 | Bacteria | 1146 |
| 274 | Ga0105240_10000074 | 3300009093 | Bacteria | 199611 |
| 275 | Ga0105240_10000104 | 3300009093 | Bacteria | 172082 |
| 276 | Ga0105240_10001630 | 3300009093 | Bacteria | 38080 |
| 277 | Ga0105240_10003016 | 3300009093 | Bacteria | 26478 |
| 278 | Ga0105240_10003457 | 3300009093 | Bacteria | 24509 |
| 279 | Ga0105240_10013866 | 3300009093 | Bacteria | 11038 |
| 280 | Ga0105240_10036376 | 3300009093 | Bacteria | 6335 |
| 281 | Ga0105240_10063866 | 3300009093 | Bacteria | 4578 |
| 282 | Ga0105240_10070596 | 3300009093 | Bacteria | 4321 |
| 283 | Ga0105240_10094488 | 3300009093 | Bacteria | 3647 |
| 284 | Ga0105240_10248840 | 3300009093 | Bacteria | 2057 |
| 285 | Ga0105240_10270843 | 3300009093 | Bacteria | 1955 |
| 286 | Ga0105240_10281100 | 3300009093 | Bacteria | 1912 |
| 287 | Ga0105240_10296427 | 3300009093 | Bacteria | 1851 |
| 288 | Ga0105240_10505637 | 3300009093 | Bacteria | 1343 |
| 289 | Ga0111539_10001795 | 3300009094 | Bacteria | 28548 |
| 290 | Ga0111539_10002481 | 3300009094 | Bacteria | 24471 |
| 291 | Ga0111539_10096181 | 3300009094 | Bacteria | 3478 |
| 292 | Ga0111539_10158671 | 3300009094 | Bacteria | 2646 |
| 293 | Ga0111539_10295000 | 3300009094 | Bacteria | 1887 |
| 294 | Ga0111539_10658699 | 3300009094 | Bacteria | 1219 |
| 295 | Ga0105245_10137472 | 3300009098 | Bacteria | 2298 |
| 296 | Ga0105245_10230596 | 3300009098 | Bacteria | 1791 |
| 297 | Ga0105245_10679797 | 3300009098 | Bacteria | 1061 |
| 298 | Ga0105247_10004365 | 3300009101 | Bacteria | 9034 |
| 299 | Ga0105247_10032589 | 3300009101 | Bacteria | 3166 |
| 300 | Ga0114129_10161864 | 3300009147 | Bacteria | 3056 |
| 301 | Ga0114129_10164802 | 3300009147 | Bacteria | 3026 |
| 302 | Ga0114129_10187296 | 3300009147 | Bacteria | 2812 |
| 303 | Ga0105243_10000025 | 3300009148 | Bacteria | 193732 |
| 304 | Ga0105243_10002943 | 3300009148 | Bacteria | 14082 |
| 305 | Ga0105243_10024433 | 3300009148 | Bacteria | 4609 |
| 306 | Ga0105243_10352515 | 3300009148 | Bacteria | 1352 |
| 307 | Ga0105241_10000609 | 3300009174 | Bacteria | 26925 |
| 308 | Ga0105241_10001018 | 3300009174 | Bacteria | 21338 |
| 309 | Ga0105241_10001544 | 3300009174 | Bacteria | 17662 |
| 310 | Ga0105241_10009620 | 3300009174 | Bacteria | 7102 |
| 311 | Ga0105241_10012092 | 3300009174 | Bacteria | 6339 |
| 312 | Ga0105241_10030901 | 3300009174 | Bacteria | 4006 |
| 313 | Ga0105241_10114973 | 3300009174 | Bacteria | 2159 |
| 314 | Ga0105241_10166860 | 3300009174 | Bacteria | 1815 |
| 315 | Ga0105241_10251360 | 3300009174 | Bacteria | 1499 |
| 316 | Ga0105241_10267191 | 3300009174 | Bacteria | 1456 |
| 317 | Ga0105242_10025247 | 3300009176 | Bacteria | 4701 |
| 318 | Ga0105242_10027904 | 3300009176 | Bacteria | 4488 |
| 319 | Ga0105242_10039161 | 3300009176 | Bacteria | 3814 |
| 320 | Ga0105242_10059231 | 3300009176 | Bacteria | 3141 |
| 321 | Ga0105242_10307197 | 3300009176 | Bacteria | 1450 |
| 322 | Ga0105248_10016149 | 3300009177 | Bacteria | 8216 |
| 323 | Ga0105248_10185760 | 3300009177 | Bacteria | 2342 |
| 324 | Ga0105237_10001427 | 3300009545 | Bacteria | 31582 |
| 325 | Ga0105237_10001607 | 3300009545 | Bacteria | 29352 |
| 326 | Ga0105237_10002980 | 3300009545 | Bacteria | 20473 |
| 327 | Ga0105237_10003047 | 3300009545 | Bacteria | 20209 |
| 328 | Ga0105237_10007044 | 3300009545 | Bacteria | 12367 |
| 329 | Ga0105237_10011278 | 3300009545 | Bacteria | 9456 |
| 330 | Ga0105237_10013498 | 3300009545 | Bacteria | 8560 |
| 331 | Ga0105237_10116470 | 3300009545 | Bacteria | 2665 |
| 332 | Ga0105237_10172316 | 3300009545 | Bacteria | 2164 |
| 333 | Ga0105237_10186160 | 3300009545 | Bacteria | 2076 |
| 334 | Ga0105238_10001119 | 3300009551 | Bacteria | 27090 |
| 335 | Ga0105238_10045942 | 3300009551 | Bacteria | 4410 |
| 336 | Ga0105238_10058908 | 3300009551 | Bacteria | 3849 |
| 337 | Ga0105238_10154232 | 3300009551 | Bacteria | 2271 |
| 338 | Ga0105249_10002959 | 3300009553 | Bacteria | 14658 |
| 339 | Ga0105249_10008693 | 3300009553 | Bacteria | 8851 |
| 340 | Ga0105249_10012344 | 3300009553 | Bacteria | 7527 |
| 341 | Ga0105249_10021579 | 3300009553 | Bacteria | 5765 |
| 342 | Ga0105249_10032963 | 3300009553 | Bacteria | 4688 |
| 343 | Ga0105249_10037774 | 3300009553 | Bacteria | 4382 |
| 344 | Ga0105249_10044140 | 3300009553 | Bacteria | 4054 |
| 345 | Ga0105249_10071328 | 3300009553 | Bacteria | 3209 |
| 346 | Ga0105249_10119889 | 3300009553 | Bacteria | 2499 |
| 347 | Ga0105249_10430901 | 3300009553 | Bacteria | 1354 |
| 348 | Ga0105239_10000007 | 3300010375 | Bacteria | 385297 |
| 349 | Ga0105239_10000015 | 3300010375 | Bacteria | 319892 |
| 350 | Ga0105239_10000048 | 3300010375 | Bacteria | 177855 |
| 351 | Ga0105239_10000314 | 3300010375 | Bacteria | 71313 |
| 352 | Ga0105239_10000853 | 3300010375 | Bacteria | 43358 |
| 353 | Ga0105239_10000864 | 3300010375 | Bacteria | 43048 |
| 354 | Ga0105239_10007377 | 3300010375 | Bacteria | 12632 |
| 355 | Ga0105239_10024795 | 3300010375 | Bacteria | 6607 |
| 356 | Ga0105239_10030338 | 3300010375 | Bacteria | 5944 |
| 357 | Ga0105239_10044414 | 3300010375 | Bacteria | 4872 |
| 358 | Ga0105239_10050569 | 3300010375 | Bacteria | 4558 |
| 359 | Ga0105239_10059237 | 3300010375 | Bacteria | 4203 |
| 360 | Ga0105239_10062112 | 3300010375 | Bacteria | 4101 |
| 361 | Ga0105239_10069962 | 3300010375 | Bacteria | 3854 |
| 362 | Ga0105239_10097637 | 3300010375 | Bacteria | 3247 |
| 363 | Ga0105239_10108921 | 3300010375 | Bacteria | 3069 |
| 364 | Ga0105239_10171663 | 3300010375 | Bacteria | 2425 |
| 365 | Ga0105239_10335541 | 3300010375 | Bacteria | 1706 |
| 366 | Ga0105246_10010437 | 3300011119 | Bacteria | 5748 |
| 367 | Ga0105246_10087613 | 3300011119 | Bacteria | 2235 |
| 368 | Ga0157373_10001240 | 3300013100 | Bacteria | 19499 |
| 369 | Ga0157373_10002086 | 3300013100 | Bacteria | 15140 |
| 370 | Ga0157373_10008399 | 3300013100 | Bacteria | 7669 |
| 371 | Ga0157373_10043290 | 3300013100 | Bacteria | 3216 |
| 372 | Ga0157373_10046828 | 3300013100 | Bacteria | 3085 |
| 373 | Ga0157373_10073914 | 3300013100 | Bacteria | 2405 |
| 374 | Ga0157373_10191475 | 3300013100 | Bacteria | 1441 |
| 375 | Ga0157371_10000037 | 3300013102 | Bacteria | 214866 |
| 376 | Ga0157371_10000220 | 3300013102 | Bacteria | 83813 |
| 377 | Ga0157371_10002087 | 3300013102 | Bacteria | 19526 |
| 378 | Ga0157371_10002091 | 3300013102 | Bacteria | 19502 |
| 379 | Ga0157371_10002507 | 3300013102 | Bacteria | 17449 |
| 380 | Ga0157371_10003338 | 3300013102 | Bacteria | 14645 |
| 381 | Ga0157371_10007834 | 3300013102 | Bacteria | 8575 |
| 382 | Ga0157371_10021914 | 3300013102 | Bacteria | 4689 |
| 383 | Ga0157371_10035971 | 3300013102 | Bacteria | 3546 |
| 384 | Ga0157371_10054408 | 3300013102 | Bacteria | 2843 |
| 385 | Ga0157371_10118318 | 3300013102 | Bacteria | 1884 |
| 386 | Ga0157371_10134964 | 3300013102 | Bacteria | 1757 |
| 387 | Ga0157370_10001415 | 3300013104 | Bacteria | 29777 |
| 388 | Ga0157370_10001827 | 3300013104 | Bacteria | 26213 |
| 389 | Ga0157370_10002234 | 3300013104 | Bacteria | 23553 |
| 390 | Ga0157370_10003187 | 3300013104 | Bacteria | 19402 |
| 391 | Ga0157370_10006395 | 3300013104 | Bacteria | 12998 |
| 392 | Ga0157370_10010736 | 3300013104 | Bacteria | 9630 |
| 393 | Ga0157370_10010796 | 3300013104 | Bacteria | 9601 |
| 394 | Ga0157370_10012309 | 3300013104 | Bacteria | 8879 |
| 395 | Ga0157370_10012412 | 3300013104 | Bacteria | 8835 |
| 396 | Ga0157370_10016537 | 3300013104 | Bacteria | 7463 |
| 397 | Ga0157370_10019635 | 3300013104 | Bacteria | 6769 |
| 398 | Ga0157370_10035920 | 3300013104 | Bacteria | 4812 |
| 399 | Ga0157370_10041237 | 3300013104 | Bacteria | 4455 |
| 400 | Ga0157370_10064921 | 3300013104 | Bacteria | 3454 |
| 401 | Ga0157370_10065890 | 3300013104 | Bacteria | 3426 |
| 402 | Ga0157370_10178285 | 3300013104 | Bacteria | 1975 |
| 403 | Ga0157370_10468509 | 3300013104 | Bacteria | 1158 |
| 404 | Ga0157369_10000031 | 3300013105 | Bacteria | 203214 |
| 405 | Ga0157369_10000566 | 3300013105 | Bacteria | 48674 |
| 406 | Ga0157369_10071400 | 3300013105 | Bacteria | 3727 |
| 407 | Ga0157369_10104435 | 3300013105 | Bacteria | 3017 |
| 408 | Ga0157369_10139013 | 3300013105 | Bacteria | 2571 |
| 409 | Ga0157374_10000001 | 3300013296 | Bacteria | 1077351 |
| 410 | Ga0157374_10001177 | 3300013296 | Bacteria | 22312 |
| 411 | Ga0157374_10006147 | 3300013296 | Bacteria | 10174 |
| 412 | Ga0157374_10024365 | 3300013296 | Bacteria | 5426 |
| 413 | Ga0157374_10042435 | 3300013296 | Bacteria | 4196 |
| 414 | Ga0157374_10047739 | 3300013296 | Bacteria | 3971 |
| 415 | Ga0157374_10067364 | 3300013296 | Bacteria | 3366 |
| 416 | Ga0157374_10076000 | 3300013296 | Bacteria | 3175 |
| 417 | Ga0157374_10097407 | 3300013296 | Bacteria | 2815 |
| 418 | Ga0157378_10001918 | 3300013297 | Bacteria | 18667 |
| 419 | Ga0157378_10005877 | 3300013297 | Bacteria | 10749 |
| 420 | Ga0157378_10007196 | 3300013297 | Bacteria | 9719 |
| 421 | Ga0157378_10014455 | 3300013297 | Bacteria | 6910 |
| 422 | Ga0157378_10021276 | 3300013297 | Bacteria | 5703 |
| 423 | Ga0157378_10036254 | 3300013297 | Bacteria | 4365 |
| 424 | Ga0157378_10077422 | 3300013297 | Bacteria | 2998 |
| 425 | Ga0157378_10239054 | 3300013297 | Bacteria | 1734 |
| 426 | Ga0163162_10000101 | 3300013306 | Bacteria | 77114 |
| 427 | Ga0163162_10000227 | 3300013306 | Bacteria | 51464 |
| 428 | Ga0163162_10000871 | 3300013306 | Bacteria | 28126 |
| 429 | Ga0163162_10001177 | 3300013306 | Bacteria | 24418 |
| 430 | Ga0163162_10002080 | 3300013306 | Bacteria | 18806 |
| 431 | Ga0163162_10003406 | 3300013306 | Bacteria | 15182 |
| 432 | Ga0163162_10003892 | 3300013306 | Bacteria | 14333 |
| 433 | Ga0163162_10006263 | 3300013306 | Bacteria | 11529 |
| 434 | Ga0163162_10009506 | 3300013306 | Bacteria | 9455 |
| 435 | Ga0163162_10012052 | 3300013306 | Bacteria | 8432 |
| 436 | Ga0163162_10014268 | 3300013306 | Bacteria | 7761 |
| 437 | Ga0163162_10015601 | 3300013306 | Bacteria | 7425 |
| 438 | Ga0163162_10025293 | 3300013306 | Bacteria | 5866 |
| 439 | Ga0163162_10030170 | 3300013306 | Bacteria | 5372 |
| 440 | Ga0163162_10180929 | 3300013306 | Bacteria | 2234 |
| 441 | Ga0163162_10498991 | 3300013306 | Bacteria | 1347 |
| 442 | Ga0163162_10679652 | 3300013306 | Bacteria | 1152 |
| 443 | Ga0157372_10000020 | 3300013307 | Bacteria | 208056 |
| 444 | Ga0157372_10000804 | 3300013307 | Bacteria | 34050 |
| 445 | Ga0157372_10001414 | 3300013307 | Bacteria | 25877 |
| 446 | Ga0157372_10005311 | 3300013307 | Bacteria | 13682 |
| 447 | Ga0157372_10027413 | 3300013307 | Bacteria | 6203 |
| 448 | Ga0157372_10031343 | 3300013307 | Bacteria | 5822 |
| 449 | Ga0157372_10099370 | 3300013307 | Bacteria | 3319 |
| 450 | Ga0157372_10113115 | 3300013307 | Bacteria | 3111 |
| 451 | Ga0157372_10137839 | 3300013307 | Bacteria | 2811 |
| 452 | Ga0157372_10318581 | 3300013307 | Bacteria | 1810 |
| 453 | Ga0157372_10394649 | 3300013307 | Bacteria | 1612 |
| 454 | Ga0157372_10704924 | 3300013307 | Bacteria | 1174 |
| 455 | Ga0157375_10000118 | 3300013308 | Bacteria | 77255 |
| 456 | Ga0157375_10001625 | 3300013308 | Bacteria | 19340 |
| 457 | Ga0157375_10004861 | 3300013308 | Bacteria | 11676 |
| 458 | Ga0157375_10007692 | 3300013308 | Bacteria | 9429 |
| 459 | Ga0157375_10015273 | 3300013308 | Bacteria | 6871 |
| 460 | Ga0157375_10038711 | 3300013308 | Bacteria | 4580 |
| 461 | Ga0157375_10104315 | 3300013308 | Bacteria | 2924 |
| 462 | Ga0157375_10114211 | 3300013308 | Bacteria | 2802 |
| 463 | Ga0157375_10131057 | 3300013308 | Bacteria | 2626 |
| 464 | Ga0157375_10173309 | 3300013308 | Bacteria | 2306 |
| 465 | Ga0157375_10190621 | 3300013308 | Bacteria | 2205 |
| 466 | Ga0157375_10250248 | 3300013308 | Bacteria | 1933 |
| 467 | Ga0157375_10273768 | 3300013308 | Bacteria | 1850 |
| 468 | Ga0157375_10557583 | 3300013308 | Bacteria | 1307 |
| 469 | Ga0157375_10758572 | 3300013308 | Bacteria | 1121 |
| 470 | Ga0163163_10000636 | 3300014325 | Bacteria | 30223 |
| 471 | Ga0163163_10001351 | 3300014325 | Bacteria | 20695 |
| 472 | Ga0163163_10002778 | 3300014325 | Bacteria | 14786 |
| 473 | Ga0163163_10084057 | 3300014325 | Bacteria | 3189 |
| 474 | Ga0157380_10001070 | 3300014326 | Bacteria | 17569 |
| 475 | Ga0157380_10001555 | 3300014326 | Bacteria | 15095 |
| 476 | Ga0157380_10086738 | 3300014326 | Bacteria | 2573 |
| 477 | Ga0182008_10000048 | 3300014497 | Bacteria | 105176 |
| 478 | Ga0182008_10000572 | 3300014497 | Bacteria | 27252 |
| 479 | Ga0182008_10090120 | 3300014497 | Bacteria | 1512 |
| 480 | Ga0157377_10004058 | 3300014745 | Bacteria | 6682 |
| 481 | Ga0157377_10005239 | 3300014745 | Bacteria | 6072 |
| 482 | Ga0157377_10030501 | 3300014745 | Bacteria | 2921 |
| 483 | Ga0157379_10000536 | 3300014968 | Bacteria | 30631 |
| 484 | Ga0157379_10037300 | 3300014968 | Bacteria | 4334 |
| 485 | Ga0157379_10045049 | 3300014968 | Bacteria | 3938 |
| 486 | Ga0157379_10193488 | 3300014968 | Bacteria | 1838 |
| 487 | Ga0157379_10259554 | 3300014968 | Bacteria | 1578 |
| 488 | Ga0157376_10000378 | 3300014969 | Bacteria | 29031 |
| 489 | Ga0157376_10000697 | 3300014969 | Bacteria | 21724 |
| 490 | Ga0157376_10000873 | 3300014969 | Bacteria | 19768 |
| 491 | Ga0157376_10001271 | 3300014969 | Bacteria | 16567 |
| 492 | Ga0157376_10004501 | 3300014969 | Bacteria | 9711 |
| 493 | Ga0157376_10077611 | 3300014969 | Bacteria | 2841 |
| 494 | Ga0157376_10120246 | 3300014969 | Bacteria | 2326 |
| 495 | Ga0157376_10165142 | 3300014969 | Bacteria | 2011 |
| 496 | Ga0157376_10286253 | 3300014969 | Bacteria | 1554 |
| 497 | Ga0157376_10486400 | 3300014969 | Bacteria | 1210 |
| 498 | Ga0182006_1000103 | 3300015261 | Bacteria | 93638 |
| 499 | Ga0182006_1000159 | 3300015261 | Bacteria | 72265 |
| 500 | Ga0182006_1000237 | 3300015261 | Bacteria | 52084 |
| 501 | Ga0182006_1002314 | 3300015261 | Bacteria | 10497 |
| 502 | Ga0182006_1006283 | 3300015261 | Bacteria | 5535 |
| 503 | Ga0182007_10000002 | 3300015262 | Bacteria | 564661 |
| 504 | Ga0182007_10029805 | 3300015262 | Bacteria | 1867 |
| 505 | Ga0182005_1000091 | 3300015265 | Bacteria | 67859 |
| 506 | Ga0183373_1004 | 3300015682 | Bacteria | 537398 |
| 507 | Ga0163161_10000672 | 3300017792 | Bacteria | 27295 |
| 508 | Ga0163161_10002407 | 3300017792 | Bacteria | 13412 |
| 509 | Ga0163161_10002660 | 3300017792 | Bacteria | 12700 |
| 510 | Ga0163161_10006842 | 3300017792 | Bacteria | 7890 |
| 511 | Ga0163161_10008268 | 3300017792 | Bacteria | 7199 |
| 512 | Ga0163161_10020027 | 3300017792 | Bacteria | 4693 |
| 513 | Ga0163161_10022509 | 3300017792 | Bacteria | 4439 |
| 514 | Ga0163161_10039109 | 3300017792 | Bacteria | 3404 |
| 515 | Ga0163161_10040002 | 3300017792 | Bacteria | 3367 |
| 516 | Ga0163161_10047518 | 3300017792 | Bacteria | 3099 |
| 517 | Ga0163161_10073639 | 3300017792 | Bacteria | 2503 |
| 518 | Ga0163161_10108403 | 3300017792 | Bacteria | 2074 |
| 519 | Ga0163161_10132659 | 3300017792 | Bacteria | 1880 |
| 520 | Ga0213876_10001490 | 3300021384 | Bacteria | 14554 |
| 521 | Ga0213876_10022436 | 3300021384 | Bacteria | 3337 |
| 522 | Ga0209563_103255 | 3300025230 | Bacteria | 3404 |
| 523 | Ga0207427_100025 | 3300025231 | Bacteria | 433726 |
| 524 | Ga0209437_100010 | 3300025233 | Bacteria | 838447 |
| 525 | Ga0209258_100081 | 3300025242 | Bacteria | 254564 |
| 526 | Ga0207425_1000023 | 3300025245 | Bacteria | 341339 |
| 527 | Ga0209646_1001126 | 3300025246 | Bacteria | 7867 |
| 528 | Ga0209026_1000225 | 3300025250 | Bacteria | 77234 |
| 529 | Ga0209148_1000202 | 3300025254 | Bacteria | 106106 |
| 530 | Ga0209129_1000032 | 3300025258 | Bacteria | 341150 |
| 531 | Ga0209233_1000017 | 3300025261 | Bacteria | 898076 |
| 532 | Ga0209233_1000655 | 3300025261 | Bacteria | 16841 |
| 533 | Ga0209455_1000758 | 3300025272 | Bacteria | 18261 |
| 534 | Ga0209676_1000009 | 3300025292 | Bacteria | 981719 |
| 535 | Ga0209025_1000047 | 3300025294 | Bacteria | 341150 |
| 536 | Ga0209758_1000144 | 3300025297 | Bacteria | 170724 |
| 537 | Ga0209050_1000094 | 3300025298 | Bacteria | 242893 |
| 538 | Ga0207426_1000093 | 3300025302 | Bacteria | 277663 |
| 539 | Ga0209257_1000007 | 3300025304 | Bacteria | 1564415 |
| 540 | Ga0209257_1000064 | 3300025304 | Bacteria | 356803 |
| 541 | Ga0207656_10000239 | 3300025321 | Bacteria | 19231 |
| 542 | Ga0207653_10034997 | 3300025885 | Bacteria | 1632 |
| 543 | Ga0207682_10008876 | 3300025893 | Bacteria | 3975 |
| 544 | Ga0207710_10006884 | 3300025900 | Bacteria | 4838 |
| 545 | Ga0207680_10000057 | 3300025903 | Bacteria | 50978 |
| 546 | Ga0207680_10003557 | 3300025903 | Bacteria | 7335 |
| 547 | Ga0207680_10115000 | 3300025903 | Bacteria | 1751 |
| 548 | Ga0207647_10000169 | 3300025904 | Bacteria | 52146 |
| 549 | Ga0207647_10000206 | 3300025904 | Bacteria | 48374 |
| 550 | Ga0207647_10006207 | 3300025904 | Bacteria | 8710 |
| 551 | Ga0207645_10000536 | 3300025907 | Bacteria | 31571 |
| 552 | Ga0207645_10000672 | 3300025907 | Bacteria | 28332 |
| 553 | Ga0207645_10005567 | 3300025907 | Bacteria | 9116 |
| 554 | Ga0207645_10084467 | 3300025907 | Bacteria | 2037 |
| 555 | Ga0207645_10218207 | 3300025907 | Bacteria | 1257 |
| 556 | Ga0207643_10266106 | 3300025908 | Bacteria | 1060 |
| 557 | Ga0207705_10002909 | 3300025909 | Bacteria | 13096 |
| 558 | Ga0207705_10077238 | 3300025909 | Bacteria | 2422 |
| 559 | Ga0207654_10000940 | 3300025911 | Bacteria | 16008 |
| 560 | Ga0207654_10002291 | 3300025911 | Bacteria | 9812 |
| 561 | Ga0207654_10008022 | 3300025911 | Bacteria | 5323 |
| 562 | Ga0207654_10040476 | 3300025911 | Bacteria | 2626 |
| 563 | Ga0207654_10217055 | 3300025911 | Bacteria | 1266 |
| 564 | Ga0207707_10000889 | 3300025912 | Bacteria | 29199 |
| 565 | Ga0207707_10007990 | 3300025912 | Bacteria | 9188 |
| 566 | Ga0207707_10496807 | 3300025912 | Bacteria | 1041 |
| 567 | Ga0207695_10000048 | 3300025913 | Bacteria | 421800 |
| 568 | Ga0207695_10000071 | 3300025913 | Bacteria | 315568 |
| 569 | Ga0207695_10000323 | 3300025913 | Bacteria | 114265 |
| 570 | Ga0207695_10008731 | 3300025913 | Bacteria | 12637 |
| 571 | Ga0207695_10016782 | 3300025913 | Bacteria | 8549 |
| 572 | Ga0207695_10058385 | 3300025913 | Bacteria | 4005 |
| 573 | Ga0207695_10202776 | 3300025913 | Bacteria | 1897 |
| 574 | Ga0207695_10235724 | 3300025913 | Bacteria | 1733 |
| 575 | Ga0207695_10283985 | 3300025913 | Bacteria | 1548 |
| 576 | Ga0207695_10351824 | 3300025913 | Bacteria | 1360 |
| 577 | Ga0207695_10523926 | 3300025913 | Bacteria | 1067 |
| 578 | Ga0207671_10003914 | 3300025914 | Bacteria | 14516 |
| 579 | Ga0207671_10005064 | 3300025914 | Bacteria | 12309 |
| 580 | Ga0207671_10006304 | 3300025914 | Bacteria | 10594 |
| 581 | Ga0207671_10008774 | 3300025914 | Bacteria | 8516 |
| 582 | Ga0207671_10016225 | 3300025914 | Bacteria | 5798 |
| 583 | Ga0207671_10033095 | 3300025914 | Bacteria | 3847 |
| 584 | Ga0207671_10330170 | 3300025914 | Bacteria | 1208 |
| 585 | Ga0207660_10006223 | 3300025917 | Bacteria | 7753 |
| 586 | Ga0207660_10018017 | 3300025917 | Bacteria | 4703 |
| 587 | Ga0207662_10062713 | 3300025918 | Bacteria | 2234 |
| 588 | Ga0207657_10042545 | 3300025919 | Bacteria | 4007 |
| 589 | Ga0207649_10025237 | 3300025920 | Bacteria | 3463 |
| 590 | Ga0207652_10011595 | 3300025921 | Bacteria | 7110 |
| 591 | Ga0207652_10013482 | 3300025921 | Bacteria | 6613 |
| 592 | Ga0207652_10066470 | 3300025921 | Bacteria | 3125 |
| 593 | Ga0207681_10024366 | 3300025923 | Bacteria | 3883 |
| 594 | Ga0207681_10046476 | 3300025923 | Bacteria | 2920 |
| 595 | Ga0207681_10070425 | 3300025923 | Bacteria | 2435 |
| 596 | Ga0207681_10127668 | 3300025923 | Bacteria | 1875 |
| 597 | Ga0207694_10017591 | 3300025924 | Bacteria | 5403 |
| 598 | Ga0207694_10127546 | 3300025924 | Bacteria | 2037 |
| 599 | Ga0207694_10156064 | 3300025924 | Bacteria | 1841 |
| 600 | Ga0207650_10053098 | 3300025925 | Bacteria | 3003 |
| 601 | Ga0207650_10122441 | 3300025925 | Bacteria | 2027 |
| 602 | Ga0207650_10162935 | 3300025925 | Bacteria | 1768 |
| 603 | Ga0207650_10182155 | 3300025925 | Bacteria | 1674 |
| 604 | Ga0207659_10026032 | 3300025926 | Bacteria | 3942 |
| 605 | Ga0207659_10080515 | 3300025926 | Bacteria | 2406 |
| 606 | Ga0207659_10157167 | 3300025926 | Bacteria | 1781 |
| 607 | Ga0207659_10179472 | 3300025926 | Bacteria | 1676 |
| 608 | Ga0207687_10227262 | 3300025927 | Bacteria | 1472 |
| 609 | Ga0207644_10004906 | 3300025931 | Bacteria | 8720 |
| 610 | Ga0207644_10008932 | 3300025931 | Bacteria | 6565 |
| 611 | Ga0207644_10214632 | 3300025931 | Bacteria | 1523 |
| 612 | Ga0207644_10256232 | 3300025931 | Bacteria | 1397 |
| 613 | Ga0207690_10000147 | 3300025932 | Bacteria | 56329 |
| 614 | Ga0207690_10008110 | 3300025932 | Bacteria | 6231 |
| 615 | Ga0207690_10014393 | 3300025932 | Bacteria | 4778 |
| 616 | Ga0207706_10000038 | 3300025933 | Bacteria | 132725 |
| 617 | Ga0207706_10000167 | 3300025933 | Bacteria | 72622 |
| 618 | Ga0207706_10003140 | 3300025933 | Bacteria | 15873 |
| 619 | Ga0207706_10007966 | 3300025933 | Bacteria | 9781 |
| 620 | Ga0207706_10137890 | 3300025933 | Bacteria | 2146 |
| 621 | Ga0207686_10000481 | 3300025934 | Bacteria | 26333 |
| 622 | Ga0207686_10002939 | 3300025934 | Bacteria | 9182 |
| 623 | Ga0207686_10024483 | 3300025934 | Bacteria | 3499 |
| 624 | Ga0207686_10360981 | 3300025934 | Bacteria | 1096 |
| 625 | Ga0207686_10380838 | 3300025934 | Bacteria | 1070 |
| 626 | Ga0207686_10462970 | 3300025934 | Bacteria | 977 |
| 627 | Ga0207709_10000003 | 3300025935 | Bacteria | 1050072 |
| 628 | Ga0207709_10015358 | 3300025935 | Bacteria | 4245 |
| 629 | Ga0207709_10023674 | 3300025935 | Bacteria | 3497 |
| 630 | Ga0207709_10430942 | 3300025935 | Bacteria | 1015 |
| 631 | Ga0207670_10012693 | 3300025936 | Bacteria | 4937 |
| 632 | Ga0207670_10079985 | 3300025936 | Bacteria | 2283 |
| 633 | Ga0207670_10122717 | 3300025936 | Bacteria | 1891 |
| 634 | Ga0207669_10001204 | 3300025937 | Bacteria | 10996 |
| 635 | Ga0207704_10000042 | 3300025938 | Bacteria | 89683 |
| 636 | Ga0207704_10018404 | 3300025938 | Bacteria | 3645 |
| 637 | Ga0207704_10030610 | 3300025938 | Bacteria | 3020 |
| 638 | Ga0207704_10032633 | 3300025938 | Bacteria | 2949 |
| 639 | Ga0207704_10296384 | 3300025938 | Bacteria | 1237 |
| 640 | Ga0207704_10360541 | 3300025938 | Bacteria | 1135 |
| 641 | Ga0207665_10120474 | 3300025939 | Bacteria | 1853 |
| 642 | Ga0207691_10000228 | 3300025940 | Bacteria | 54500 |
| 643 | Ga0207691_10045382 | 3300025940 | Bacteria | 4040 |
| 644 | Ga0207691_10050071 | 3300025940 | Bacteria | 3825 |
| 645 | Ga0207691_10065740 | 3300025940 | Bacteria | 3281 |
| 646 | Ga0207691_10095297 | 3300025940 | Bacteria | 2662 |
| 647 | Ga0207691_10136167 | 3300025940 | Bacteria | 2166 |
| 648 | Ga0207691_10154222 | 3300025940 | Bacteria | 2018 |
| 649 | Ga0207691_10214535 | 3300025940 | Bacteria | 1671 |
| 650 | Ga0207711_10028398 | 3300025941 | Bacteria | 4707 |
| 651 | Ga0207711_10029091 | 3300025941 | Bacteria | 4657 |
| 652 | Ga0207689_10000482 | 3300025942 | Bacteria | 37605 |
| 653 | Ga0207689_10000945 | 3300025942 | Bacteria | 27917 |
| 654 | Ga0207689_10005168 | 3300025942 | Bacteria | 11724 |
| 655 | Ga0207689_10017098 | 3300025942 | Bacteria | 6138 |
| 656 | Ga0207661_10021969 | 3300025944 | Bacteria | 4793 |
| 657 | Ga0207661_10035166 | 3300025944 | Bacteria | 3901 |
| 658 | Ga0207661_10092105 | 3300025944 | Bacteria | 2526 |
| 659 | Ga0207661_10109608 | 3300025944 | Bacteria | 2332 |
| 660 | Ga0207679_10001675 | 3300025945 | Bacteria | 13804 |
| 661 | Ga0207679_10004011 | 3300025945 | Bacteria | 9141 |
| 662 | Ga0207679_10053294 | 3300025945 | Bacteria | 2972 |
| 663 | Ga0207679_10256138 | 3300025945 | Bacteria | 1490 |
| 664 | Ga0207667_10000135 | 3300025949 | Bacteria | 111565 |
| 665 | Ga0207667_10000177 | 3300025949 | Bacteria | 92852 |
| 666 | Ga0207667_10013458 | 3300025949 | Bacteria | 9363 |
| 667 | Ga0207667_10030139 | 3300025949 | Bacteria | 5871 |
| 668 | Ga0207667_10073752 | 3300025949 | Bacteria | 3546 |
| 669 | Ga0207667_10094059 | 3300025949 | Bacteria | 3095 |
| 670 | Ga0207667_10357613 | 3300025949 | Bacteria | 1489 |
| 671 | Ga0207667_10466872 | 3300025949 | Bacteria | 1282 |
| 672 | Ga0207651_10015395 | 3300025960 | Bacteria | 4443 |
| 673 | Ga0207651_10018322 | 3300025960 | Bacteria | 4162 |
| 674 | Ga0207651_10266004 | 3300025960 | Bacteria | 1410 |
| 675 | Ga0207651_10331379 | 3300025960 | Bacteria | 1276 |
| 676 | Ga0207712_10016682 | 3300025961 | Bacteria | 4759 |
| 677 | Ga0207712_10024884 | 3300025961 | Bacteria | 3972 |
| 678 | Ga0207712_10026045 | 3300025961 | Bacteria | 3893 |
| 679 | Ga0207712_10043054 | 3300025961 | Bacteria | 3112 |
| 680 | Ga0207712_10102072 | 3300025961 | Bacteria | 2135 |
| 681 | Ga0207712_10123402 | 3300025961 | Bacteria | 1963 |
| 682 | Ga0207712_10176024 | 3300025961 | Bacteria | 1676 |
| 683 | Ga0207668_10065915 | 3300025972 | Bacteria | 2565 |
| 684 | Ga0207668_10111514 | 3300025972 | Bacteria | 2053 |
| 685 | Ga0207668_10453301 | 3300025972 | Bacteria | 1095 |
| 686 | Ga0207640_10018940 | 3300025981 | Bacteria | 4055 |
| 687 | Ga0207640_10024008 | 3300025981 | Bacteria | 3672 |
| 688 | Ga0207658_10008941 | 3300025986 | Bacteria | 6793 |
| 689 | Ga0207658_10019785 | 3300025986 | Bacteria | 4658 |
| 690 | Ga0207658_10037585 | 3300025986 | Bacteria | 3480 |
| 691 | Ga0207658_10085379 | 3300025986 | Bacteria | 2431 |
| 692 | Ga0207658_10180636 | 3300025986 | Bacteria | 1746 |
| 693 | Ga0207658_10313622 | 3300025986 | Bacteria | 1355 |
| 694 | Ga0207658_10373683 | 3300025986 | Bacteria | 1247 |
| 695 | Ga0207677_10005483 | 3300026023 | Bacteria | 6888 |
| 696 | Ga0207677_10060696 | 3300026023 | Bacteria | 2615 |
| 697 | Ga0207677_10078074 | 3300026023 | Bacteria | 2363 |
| 698 | Ga0207677_10323758 | 3300026023 | Bacteria | 1282 |
| 699 | Ga0207703_10000924 | 3300026035 | Bacteria | 28603 |
| 700 | Ga0207703_10011638 | 3300026035 | Bacteria | 6841 |
| 701 | Ga0207703_10045798 | 3300026035 | Bacteria | 3519 |
| 702 | Ga0207703_10372715 | 3300026035 | Bacteria | 1319 |
| 703 | Ga0207703_10619095 | 3300026035 | Bacteria | 1025 |
| 704 | Ga0207639_10013846 | 3300026041 | Bacteria | 5656 |
| 705 | Ga0207639_10018848 | 3300026041 | Bacteria | 4911 |
| 706 | Ga0207639_10047774 | 3300026041 | Bacteria | 3236 |
| 707 | Ga0207639_10057307 | 3300026041 | Bacteria | 2991 |
| 708 | Ga0207639_10061204 | 3300026041 | Bacteria | 2906 |
| 709 | Ga0207639_10089840 | 3300026041 | Bacteria | 2455 |
| 710 | Ga0207639_10093652 | 3300026041 | Bacteria | 2410 |
| 711 | Ga0207639_10096563 | 3300026041 | Bacteria | 2378 |
| 712 | Ga0207639_10246622 | 3300026041 | Bacteria | 1556 |
| 713 | Ga0207639_10348741 | 3300026041 | Bacteria | 1321 |
| 714 | Ga0207678_10077492 | 3300026067 | Bacteria | 2847 |
| 715 | Ga0207708_10073643 | 3300026075 | Bacteria | 2618 |
| 716 | Ga0207702_10000119 | 3300026078 | Bacteria | 92653 |
| 717 | Ga0207702_10008334 | 3300026078 | Bacteria | 8751 |
| 718 | Ga0207702_10047091 | 3300026078 | Bacteria | 3632 |
| 719 | Ga0207702_10158637 | 3300026078 | Bacteria | 2064 |
| 720 | Ga0207641_10000229 | 3300026088 | Bacteria | 72315 |
| 721 | Ga0207641_10000539 | 3300026088 | Bacteria | 42499 |
| 722 | Ga0207641_10013808 | 3300026088 | Bacteria | 6622 |
| 723 | Ga0207641_10107505 | 3300026088 | Bacteria | 2468 |
| 724 | Ga0207641_10126665 | 3300026088 | Bacteria | 2287 |
| 725 | Ga0207641_10147673 | 3300026088 | Bacteria | 2127 |
| 726 | Ga0207648_10000036 | 3300026089 | Bacteria | 122209 |
| 727 | Ga0207648_10003557 | 3300026089 | Bacteria | 16296 |
| 728 | Ga0207648_10040383 | 3300026089 | Bacteria | 4100 |
| 729 | Ga0207648_10053860 | 3300026089 | Bacteria | 3515 |
| 730 | Ga0207648_10075182 | 3300026089 | Bacteria | 2945 |
| 731 | Ga0207648_10085784 | 3300026089 | Bacteria | 2746 |
| 732 | Ga0207648_10170550 | 3300026089 | Bacteria | 1923 |
| 733 | Ga0207648_10487736 | 3300026089 | Bacteria | 1126 |
| 734 | Ga0207676_10001997 | 3300026095 | Bacteria | 14856 |
| 735 | Ga0207676_10003168 | 3300026095 | Bacteria | 11734 |
| 736 | Ga0207676_10024749 | 3300026095 | Bacteria | 4446 |
| 737 | Ga0207676_10119837 | 3300026095 | Bacteria | 2217 |
| 738 | Ga0207676_10142717 | 3300026095 | Bacteria | 2052 |
| 739 | Ga0207676_10184824 | 3300026095 | Bacteria | 1828 |
| 740 | Ga0207676_10386236 | 3300026095 | Bacteria | 1305 |
| 741 | Ga0207676_10651554 | 3300026095 | Bacteria | 1016 |
| 742 | Ga0207674_10016309 | 3300026116 | Bacteria | 8137 |
| 743 | Ga0207674_10025163 | 3300026116 | Bacteria | 6351 |
| 744 | Ga0207674_10035928 | 3300026116 | Bacteria | 5168 |
| 745 | Ga0207674_10543312 | 3300026116 | Bacteria | 1123 |
| 746 | Ga0207675_100000938 | 3300026118 | Bacteria | 29125 |
| 747 | Ga0207675_100029699 | 3300026118 | Bacteria | 5091 |
| 748 | Ga0207675_100050955 | 3300026118 | Bacteria | 3863 |
| 749 | Ga0207675_100071059 | 3300026118 | Bacteria | 3254 |
| 750 | Ga0207675_100191812 | 3300026118 | Bacteria | 1960 |
| 751 | Ga0207683_10026994 | 3300026121 | Bacteria | 4962 |
| 752 | Ga0207683_10028296 | 3300026121 | Bacteria | 4846 |
| 753 | Ga0207683_10040552 | 3300026121 | Bacteria | 4064 |
| 754 | Ga0207683_10315809 | 3300026121 | Bacteria | 1431 |
| 755 | Ga0207683_10461876 | 3300026121 | Bacteria | 1171 |
| 756 | Ga0207698_10001222 | 3300026142 | Bacteria | 15005 |
| 757 | Ga0207698_10014331 | 3300026142 | Bacteria | 5267 |
| 758 | Ga0207698_10093884 | 3300026142 | Bacteria | 2465 |
| 759 | Ga0207698_10438985 | 3300026142 | Bacteria | 1257 |
| 760 | Ga0207698_10483855 | 3300026142 | Bacteria | 1201 |
| 761 | Ga0207428_10158752 | 3300027907 | Bacteria | 1718 |
| 762 | Ga0268266_10000030 | 3300028379 | Bacteria | 417120 |
| 763 | Ga0268266_10000049 | 3300028379 | Bacteria | 307763 |
| 764 | Ga0268266_10005598 | 3300028379 | Bacteria | 11664 |
| 765 | Ga0268266_10034011 | 3300028379 | Bacteria | 4333 |
| 766 | Ga0268266_10145262 | 3300028379 | Bacteria | 2132 |
| 767 | Ga0268265_10504682 | 3300028380 | Bacteria | 1140 |
| 768 | Ga0268264_10003106 | 3300028381 | Bacteria | 14382 |
| 769 | Ga0268264_10003271 | 3300028381 | Bacteria | 14012 |
| 770 | Ga0268264_10007090 | 3300028381 | Bacteria | 9391 |
| 771 | Ga0268264_10013186 | 3300028381 | Bacteria | 6801 |
| 772 | Ga0268264_10020419 | 3300028381 | Bacteria | 5414 |
| 773 | Ga0265337_1005714 | 3300028556 | Bacteria | 4889 |
| 774 | Ga0265326_10005999 | 3300028558 | Bacteria | 3801 |
| 775 | Ga0265319_1000171 | 3300028563 | Bacteria | 49323 |
| 776 | Ga0265334_10000220 | 3300028573 | Bacteria | 33009 |
| 777 | Ga0265318_10002220 | 3300028577 | Bacteria | 10479 |
| 778 | Ga0265322_10034893 | 3300028654 | Bacteria | 1433 |
| 779 | Ga0307517_10003658 | 3300028786 | Bacteria | 23904 |
| 780 | Ga0307517_10011388 | 3300028786 | Bacteria | 12327 |
| 781 | Ga0307515_10000009 | 3300028794 | Bacteria | 653206 |
| 782 | Ga0307515_10000507 | 3300028794 | Bacteria | 93166 |
| 783 | Ga0265338_10000448 | 3300028800 | Bacteria | 73538 |
| 784 | Ga0265338_10001633 | 3300028800 | Bacteria | 35870 |
| 785 | Ga0265338_10015047 | 3300028800 | Bacteria | 8539 |
| 786 | Ga0265324_10014609 | 3300029957 | Bacteria | 2902 |
| 787 | Ga0307511_10000276 | 3300030521 | Bacteria | 53817 |
| 788 | Ga0265328_10078783 | 3300031239 | Bacteria | 1214 |
| 789 | Ga0265320_10006371 | 3300031240 | Bacteria | 7443 |
| 790 | Ga0265325_10039951 | 3300031241 | Bacteria | 2466 |
| 791 | Ga0265329_10042288 | 3300031242 | Bacteria | 1460 |
| 792 | Ga0265327_10000148 | 3300031251 | Bacteria | 151952 |
| 793 | Ga0265327_10008831 | 3300031251 | Bacteria | 7420 |
| 794 | Ga0265327_10091547 | 3300031251 | Bacteria | 1482 |
| 795 | Ga0265327_10133319 | 3300031251 | Bacteria | 1167 |
| 796 | Ga0307513_10061705 | 3300031456 | Bacteria | 3967 |
| 797 | Ga0307513_10149923 | 3300031456 | Bacteria | 2243 |
| 798 | Ga0307509_10043782 | 3300031507 | Bacteria | 4841 |
| 799 | Ga0307509_10055932 | 3300031507 | Bacteria | 4190 |
| 800 | Ga0307509_10063261 | 3300031507 | Bacteria | 3896 |
| 801 | Ga0307509_10089274 | 3300031507 | Bacteria | 3161 |
| 802 | Ga0307408_100000578 | 3300031548 | Bacteria | 31539 |
| 803 | Ga0307408_100001086 | 3300031548 | Bacteria | 20801 |
| 804 | Ga0307408_100001939 | 3300031548 | Bacteria | 14992 |
| 805 | Ga0265313_10003787 | 3300031595 | Bacteria | 11994 |
| 806 | Ga0265313_10028202 | 3300031595 | Bacteria | 2923 |
| 807 | Ga0265313_10041092 | 3300031595 | Bacteria | 2281 |
| 808 | Ga0307508_10003266 | 3300031616 | Bacteria | 16542 |
| 809 | Ga0307514_10061041 | 3300031649 | Bacteria | 2873 |
| 810 | Ga0265314_10048233 | 3300031711 | Bacteria | 2990 |
| 811 | Ga0265342_10018127 | 3300031712 | Bacteria | 4566 |
| 812 | Ga0307516_10001231 | 3300031730 | Bacteria | 35640 |
| 813 | Ga0307516_10007511 | 3300031730 | Bacteria | 12531 |
| 814 | Ga0307516_10420721 | 3300031730 | Bacteria | 994 |
| 815 | Ga0307405_10000015 | 3300031731 | Bacteria | 206299 |
| 816 | Ga0307413_10345611 | 3300031824 | Bacteria | 1146 |
| 817 | Ga0307407_10000031 | 3300031903 | Bacteria | 87995 |
| 818 | Ga0307412_10000049 | 3300031911 | Bacteria | 151588 |
| 819 | Ga0307409_100013894 | 3300031995 | Bacteria | 5208 |
| 820 | Ga0307409_100059433 | 3300031995 | Bacteria | 2975 |
| 821 | Ga0307416_100000002 | 3300032002 | Bacteria | 509907 |
| 822 | Ga0307416_100851260 | 3300032002 | Bacteria | 1010 |
| 823 | Ga0307414_10000608 | 3300032004 | Bacteria | 18392 |
| 824 | Ga0307414_10052185 | 3300032004 | Bacteria | 2844 |
| 825 | Ga0307414_10061057 | 3300032004 | Bacteria | 2669 |
| 826 | Ga0307414_10411462 | 3300032004 | Bacteria | 1177 |
| 827 | Ga0307414_10447515 | 3300032004 | Bacteria | 1132 |
| 828 | Ga0307411_10212129 | 3300032005 | Bacteria | 1496 |
| 829 | Ga0307510_10000147 | 3300033180 | Bacteria | 58704 |
| 830 | Ga0373934_0092268 | 3300035086 | Bacteria | 1221 |
| 831 | Ga0373941_0084057 | 3300035115 | Bacteria | 1080 |
| 832 | Ga0373945_0124358 | 3300035116 | Bacteria | 1028 |
| 833 | Ga0373935_0091379 | 3300035692 | Bacteria | 1994 |
| 834 | Ga0373927_0207455 | 3300035695 | Bacteria | 1287 |
| 835 | Ga0373933_0042199 | 3300035724 | Bacteria | 2696 |
| 836 | Ga0373947_0050857 | 3300035725 | Bacteria | 2492 |
| 837 | Ga0373937_0096850 | 3300036401 | Bacteria | 2736 |
| 838 | Ga0373937_0321850 | 3300036401 | Bacteria | 1463 |
| 839 | Ga0395899_0000002 | 3300037312 | Bacteria | 1324310 |
| 840 | Ga0395899_0000286 | 3300037312 | Bacteria | 65138 |
| 841 | Ga0395900_0000115 | 3300037418 | Bacteria | 138474 |
| 842 | Ga0395900_0004784 | 3300037418 | Bacteria | 14268 |
| 843 | Ga0395900_0140357 | 3300037418 | Bacteria | 2475 |
| 844 | Ga0395898_0010131 | 3300037466 | Bacteria | 9865 |
| 845 | Ga0395905_0000045 | 3300037471 | Bacteria | 241370 |
| 846 | Ga0395905_0001113 | 3300037471 | Bacteria | 33725 |
| 847 | Ga0395905_0394886 | 3300037471 | Bacteria | 1278 |
| 848 | Ga0395901_0000254 | 3300038443 | Bacteria | 66508 |
| 849 | Ga0395901_0006539 | 3300038443 | Bacteria | 11789 |
| 850 | Ga0395901_0116658 | 3300038443 | Bacteria | 2805 |
| 851 | Ga0436365_0763276 | 3300039437 | Bacteria | 3365 |
| 852 | Ga0436365_1121511 | 3300039437 | Bacteria | 10842 |
| 853 | Ga0436365_1214063 | 3300039437 | Bacteria | 13888 |
| 854 | Ga0436365_1871487 | 3300039437 | Bacteria | 2813 |
| 855 | Ga0439436_0025603 | 3300041404 | Bacteria | 1732 |
| 856 | Ga0439439_0012722 | 3300041406 | Bacteria | 2037 |
| 857 | Ga0439439_0019014 | 3300041406 | Bacteria | 1702 |
| 858 | Ga0439465_0006087 | 3300041413 | Bacteria | 3835 |
| 859 | Ga0451853_1789420 | 3300041512 | Bacteria | 2164 |
| 860 | Ga0439442_014100 | 3300042002 | Bacteria | 1645 |
| 861 | Ga0439445_0063498 | 3300042004 | Bacteria | 1013 |
| 862 | Ga0439449_0016294 | 3300042007 | Bacteria | 2794 |
| 863 | Ga0439449_0044809 | 3300042007 | Bacteria | 1640 |
| 864 | Ga0439449_0066030 | 3300042007 | Bacteria | 1334 |
| 865 | Ga0439457_002393 | 3300042014 | Bacteria | 5364 |
| 866 | Ga0439462_0007027 | 3300042015 | Bacteria | 2813 |
| 867 | Ga0439446_0096903 | 3300042156 | Bacteria | 929 |
| 868 | Ga0439434_0002629 | 3300042435 | Bacteria | 5233 |
| 869 | Ga0451577_0020546 | 3300042876 | Bacteria | 6057 |
| 870 | Ga0451577_0032953 | 3300042876 | Bacteria | 4670 |
| 871 | Ga0451577_0351037 | 3300042876 | Bacteria | 1338 |
| 872 | Ga0466969_0000921 | 3300044656 | Bacteria | 15847 |
| 873 | Ga0466969_0041570 | 3300044656 | Bacteria | 2299 |
| 874 | Ga0466972_0000038 | 3300044658 | Bacteria | 135937 |
| 875 | Ga0466972_0000055 | 3300044658 | Bacteria | 111338 |
| 876 | Ga0466972_0062541 | 3300044658 | Bacteria | 1783 |
| 877 | Ga0453683_0093085 | 3300044673 | Bacteria | 1890 |
| 878 | Ga0466966_0010092 | 3300044684 | Bacteria | 6263 |
| 879 | Ga0466964_0011227 | 3300044706 | Bacteria | 3383 |
| 880 | Ga0466964_0013406 | 3300044706 | Bacteria | 3111 |
| 881 | Ga0453684_0064450 | 3300044712 | Bacteria | 4681 |
| 882 | Ga0453684_0093866 | 3300044712 | Bacteria | 3694 |
| 883 | Ga0453684_0231041 | 3300044712 | Bacteria | 2135 |
| 884 | Ga0453684_0262477 | 3300044712 | Bacteria | 1977 |
| 885 | Ga0453684_0413196 | 3300044712 | Bacteria | 1509 |
| 886 | Ga0453684_0774816 | 3300044712 | Bacteria | 1036 |
| 887 | Ga0466968_0011055 | 3300044735 | Bacteria | 3512 |
| 888 | Ga0466968_0063728 | 3300044735 | Bacteria | 1593 |
| 889 | Ga0466970_0000722 | 3300044765 | Bacteria | 16167 |
| 890 | Ga0466957_0000186 | 3300044842 | Bacteria | 28257 |
| 891 | Ga0466957_0002253 | 3300044842 | Bacteria | 10334 |
| 892 | Ga0466959_0000157 | 3300045049 | Bacteria | 44458 |
| 893 | Ga0466959_0006469 | 3300045049 | Bacteria | 8116 |
| 894 | Ga0451576_0001626 | 3300045051 | Bacteria | 37654 |
| 895 | Ga0451576_0048038 | 3300045051 | Bacteria | 4485 |
| 896 | Ga0451576_0117261 | 3300045051 | Bacteria | 2771 |
| 897 | Ga0451576_0219922 | 3300045051 | Bacteria | 1983 |
| 898 | Ga0451576_0336454 | 3300045051 | Bacteria | 1580 |
| 899 | Ga0495627_001652 | 3300046453 | Bacteria | 12384 |
| 900 | Ga0495627_005399 | 3300046453 | Bacteria | 5158 |
| 901 | Ga0495590_0015436 | 3300046457 | Bacteria | 2772 |
| 902 | Ga0495629_0087417 | 3300046459 | Bacteria | 2175 |
| 903 | Ga0495629_0100797 | 3300046459 | Bacteria | 2015 |
| 904 | Ga0495638_0095177 | 3300046460 | Bacteria | 1789 |
| 905 | Ga0495638_0135022 | 3300046460 | Bacteria | 1446 |
| 906 | Ga0495638_0251708 | 3300046460 | Bacteria | 973 |
| 907 | Ga0495651_0267440 | 3300046462 | Bacteria | 1161 |
| 908 | Ga0495650_0000198 | 3300046471 | Bacteria | 130455 |
| 909 | Ga0495650_0071548 | 3300046471 | Bacteria | 1360 |
| 910 | Ga0495650_0134930 | 3300046471 | Bacteria | 897 |
| 911 | Ga0495585_0002633 | 3300046492 | Bacteria | 12644 |
| 912 | Ga0495585_0006258 | 3300046492 | Bacteria | 7410 |
| 913 | Ga0495594_0055291 | 3300046499 | Bacteria | 2188 |
| 914 | Ga0495596_0016929 | 3300046500 | Bacteria | 3024 |
| 915 | Ga0495607_0055009 | 3300046501 | Bacteria | 2291 |
| 916 | Ga0495583_0037848 | 3300046506 | Bacteria | 2284 |
| 917 | Ga0495606_0000003 | 3300046507 | Bacteria | 449402 |
| 918 | Ga0495606_0010339 | 3300046507 | Bacteria | 7760 |
| 919 | Ga0495606_0012375 | 3300046507 | Bacteria | 6848 |
| 920 | Ga0495606_0014704 | 3300046507 | Bacteria | 6085 |
| 921 | Ga0495606_0026073 | 3300046507 | Bacteria | 4170 |
| 922 | Ga0495606_0032782 | 3300046507 | Bacteria | 3594 |
| 923 | Ga0495606_0054176 | 3300046507 | Bacteria | 2598 |
| 924 | Ga0495606_0068194 | 3300046507 | Bacteria | 2251 |
| 925 | Ga0495606_0111876 | 3300046507 | Bacteria | 1646 |
| 926 | Ga0495610_0001576 | 3300046512 | Bacteria | 20073 |
| 927 | Ga0495610_0002315 | 3300046512 | Bacteria | 16104 |
| 928 | Ga0495610_0015317 | 3300046512 | Bacteria | 4461 |
| 929 | Ga0495610_0122677 | 3300046512 | Bacteria | 1137 |
| 930 | Ga0495616_0052238 | 3300046513 | Bacteria | 2035 |
| 931 | Ga0495628_0105232 | 3300046516 | Bacteria | 2174 |
| 932 | Ga0495630_0007001 | 3300046517 | Bacteria | 8038 |
| 933 | Ga0495637_0046036 | 3300046520 | Bacteria | 1847 |
| 934 | Ga0495643_0000719 | 3300046522 | Bacteria | 37837 |
| 935 | Ga0495643_0014997 | 3300046522 | Bacteria | 4594 |
| 936 | Ga0495648_0003102 | 3300046524 | Bacteria | 14832 |
| 937 | Ga0495648_0022342 | 3300046524 | Bacteria | 4359 |
| 938 | Ga0495652_0137274 | 3300046529 | Bacteria | 1928 |
| 939 | Ga0495652_0311750 | 3300046529 | Bacteria | 1140 |
| 940 | Ga0495587_0070088 | 3300046536 | Bacteria | 2041 |
| 941 | Ga0495587_0238841 | 3300046536 | Bacteria | 1023 |
| 942 | Ga0495609_0000063 | 3300046538 | Bacteria | 135584 |
| 943 | Ga0495633_0000123 | 3300046558 | Bacteria | 104682 |
| 944 | Ga0495633_0000267 | 3300046558 | Bacteria | 61184 |
| 945 | Ga0495667_0076052 | 3300046559 | Bacteria | 2184 |
| 946 | Ga0495668_0000010 | 3300046616 | Bacteria | 487308 |
| 947 | Ga0495668_0241400 | 3300046616 | Bacteria | 989 |
| 948 | Ga0495634_0166336 | 3300046642 | Bacteria | 1388 |
| 949 | Ga0495611_0010000 | 3300046648 | Bacteria | 4013 |
| 950 | Ga0495625_0000456 | 3300046660 | Bacteria | 61289 |
| 951 | Ga0495625_0000524 | 3300046660 | Bacteria | 56526 |
| 952 | Ga0495625_0003704 | 3300046660 | Bacteria | 14924 |
| 953 | Ga0495625_0043481 | 3300046660 | Bacteria | 3257 |
| 954 | Ga0495625_0077607 | 3300046660 | Bacteria | 2320 |
| 955 | Ga0495625_0124116 | 3300046660 | Bacteria | 1754 |
| 956 | Ga0495625_0207130 | 3300046660 | Bacteria | 1291 |
| 957 | Ga0495635_0253598 | 3300046663 | Bacteria | 1186 |
| 958 | Ga0495661_0000924 | 3300046665 | Bacteria | 26810 |
| 959 | Ga0495661_0015466 | 3300046665 | Bacteria | 5094 |
| 960 | Ga0495661_0017815 | 3300046665 | Bacteria | 4681 |
| 961 | Ga0495623_0206754 | 3300046679 | Bacteria | 1126 |
| 962 | Ga0495646_0088268 | 3300046680 | Bacteria | 1796 |
| 963 | Ga0495658_0008440 | 3300046683 | Bacteria | 5105 |
| 964 | Ga0495670_0025883 | 3300046691 | Bacteria | 2904 |
| 965 | Ga0495649_0000168 | 3300046694 | Bacteria | 57053 |
| 966 | Ga0495660_0007737 | 3300046810 | Bacteria | 6314 |
| 967 | Ga0495581_0218718 | 3300047315 | Bacteria | 1114 |
| 968 | Ga0495604_0105816 | 3300047317 | Bacteria | 2059 |
| 969 | Ga0495636_0109904 | 3300047318 | Bacteria | 1212 |
| 970 | Ga0495674_0034534 | 3300047319 | Bacteria | 4573 |
| 971 | Ga0495674_0126667 | 3300047319 | Bacteria | 2154 |
| 972 | Ga0495672_0030543 | 3300047320 | Bacteria | 3378 |
| 973 | Ga0495672_0075161 | 3300047320 | Bacteria | 1901 |
| 974 | Ga0495672_0089092 | 3300047320 | Bacteria | 1699 |
| 975 | Ga0495687_000001 | 3300047443 | Bacteria | 1215582 |
| 976 | Ga0495687_001225 | 3300047443 | Bacteria | 24525 |
| 977 | Ga0495687_017007 | 3300047443 | Bacteria | 3642 |
| 978 | Ga0495675_0274464 | 3300047444 | Bacteria | 1007 |
| 979 | Ga0495679_024124 | 3300047446 | Bacteria | 2054 |
| 980 | Ga0495673_0025798 | 3300047469 | Bacteria | 2817 |
| 981 | Ga0495686_0000004 | 3300047472 | Bacteria | 869019 |
| 982 | Ga0495686_0000845 | 3300047472 | Bacteria | 39321 |
| 983 | Ga0495686_0000974 | 3300047472 | Bacteria | 35181 |
| 984 | Ga0495686_0041318 | 3300047472 | Bacteria | 2937 |
| 985 | Ga0495686_0052463 | 3300047472 | Bacteria | 2557 |
| 986 | Ga0496100_0049855 | 3300048903 | Bacteria | 2710 |
| 987 | Ga0496104_0279048 | 3300048907 | Bacteria | 1584 |
| 988 | Ga0496104_0501552 | 3300048907 | Bacteria | 1125 |
| 989 | Ga0496106_0027781 | 3300048909 | Bacteria | 4214 |
| 990 | Ga0496109_0044543 | 3300048912 | Bacteria | 4025 |
| 991 | Ga0496110_0018044 | 3300048913 | Bacteria | 5911 |
| 992 | Ga0496114_0016464 | 3300048917 | Bacteria | 5959 |
| 993 | Ga0496114_0079330 | 3300048917 | Bacteria | 2771 |
| 994 | Ga0496114_0081057 | 3300048917 | Bacteria | 2741 |
| 995 | Ga0496115_0035249 | 3300048918 | Bacteria | 3958 |
| 996 | Ga0496115_0142278 | 3300048918 | Bacteria | 1979 |
| 997 | Ga0496116_0004898 | 3300048919 | Bacteria | 12621 |
| 998 | Ga0496118_0045690 | 3300048921 | Bacteria | 3415 |
| 999 | Ga0496121_0000011 | 3300048924 | Bacteria | 792193 |
| 1000 | Ga0496122_0002605 | 3300048925 | Bacteria | 25277 |
| 1001 | Ga0496122_0005789 | 3300048925 | Bacteria | 14547 |
| 1002 | Ga0496123_0010356 | 3300048926 | Bacteria | 8254 |
| 1003 | Ga0496124_0138676 | 3300048927 | Bacteria | 1922 |
| 1004 | Ga0496125_0000185 | 3300048928 | Bacteria | 135607 |
| 1005 | Ga0496126_0177067 | 3300048929 | Bacteria | 1814 |
| 1006 | Ga0496126_0347944 | 3300048929 | Bacteria | 1213 |
| 1007 | Ga0495678_038134 | 3300049459 | Bacteria | 1947 |
| 1008 | Ga0495682_0050695 | 3300049460 | Bacteria | 1510 |
| 1009 | Ga0501031_0014259 | 3300049568 | Bacteria | 5170 |
| 1010 | Ga0501033_0102622 | 3300049570 | Bacteria | 2086 |
| 1011 | Ga0501034_0012015 | 3300049571 | Bacteria | 8949 |
| 1012 | Ga0501034_0058093 | 3300049571 | Bacteria | 3888 |
| 1013 | Ga0501034_0061631 | 3300049571 | Bacteria | 3766 |
| 1014 | Ga0501034_0219801 | 3300049571 | Bacteria | 1853 |
| 1015 | Ga0501034_0291915 | 3300049571 | Bacteria | 1568 |
| 1016 | Ga0501034_0368685 | 3300049571 | Bacteria | 1362 |
| 1017 | Ga0501036_0008645 | 3300049572 | Bacteria | 8353 |
| 1018 | Ga0501036_0156326 | 3300049572 | Bacteria | 1923 |
| 1019 | Ga0501037_0007731 | 3300049573 | Bacteria | 7868 |
| 1020 | Ga0501037_0084518 | 3300049573 | Bacteria | 2298 |
| 1021 | Ga0501037_0198426 | 3300049573 | Bacteria | 1419 |
| 1022 | Ga0501038_0022825 | 3300049574 | Bacteria | 5601 |
| 1023 | Ga0501038_0064235 | 3300049574 | Bacteria | 3131 |
| 1024 | Ga0501039_0119026 | 3300049575 | Bacteria | 2069 |
| 1025 | Ga0501039_0490305 | 3300049575 | Bacteria | 965 |
| 1026 | Ga0501040_0149266 | 3300049576 | Bacteria | 1648 |
| 1027 | Ga0501043_0005210 | 3300049579 | Bacteria | 10520 |
| 1028 | Ga0501043_0027182 | 3300049579 | Bacteria | 4492 |
| 1029 | Ga0501046_0006810 | 3300049580 | Bacteria | 10086 |
| 1030 | Ga0501047_0006182 | 3300049581 | Bacteria | 11259 |
| 1031 | Ga0501047_0019192 | 3300049581 | Bacteria | 6558 |
| 1032 | Ga0501047_0043311 | 3300049581 | Bacteria | 4348 |
| 1033 | Ga0501047_0062647 | 3300049581 | Bacteria | 3587 |
| 1034 | Ga0501047_0154980 | 3300049581 | Bacteria | 2165 |
| 1035 | Ga0501047_0249186 | 3300049581 | Bacteria | 1625 |
| 1036 | Ga0501068_0035118 | 3300049584 | Bacteria | 2992 |
| 1037 | Ga0501072_0145354 | 3300049588 | Bacteria | 1891 |
| 1038 | Ga0501073_0001866 | 3300049589 | Bacteria | 15697 |
| 1039 | Ga0501073_0105669 | 3300049589 | Bacteria | 1954 |
| 1040 | Ga0501073_0259380 | 3300049589 | Bacteria | 1199 |
| 1041 | Ga0501074_0004312 | 3300049590 | Bacteria | 10161 |
| 1042 | Ga0501207_004862 | 3300049654 | Bacteria | 1843 |
| 1043 | Ga0501238_002917 | 3300049671 | Bacteria | 2077 |
| 1044 | Ga0501243_006992 | 3300049675 | Bacteria | 1719 |
| 1045 | Ga0501247_001231 | 3300049677 | Bacteria | 2402 |
| 1046 | Ga0501253_004504 | 3300049683 | Bacteria | 1764 |
| 1047 | Ga0501219_000052 | 3300049703 | Bacteria | 18661 |
| 1048 | Ga0501225_0000277 | 3300049705 | Bacteria | 16169 |
| 1049 | Ga0501080_0044471 | 3300049742 | Bacteria | 4134 |
| 1050 | Ga0501080_0056933 | 3300049742 | Bacteria | 3640 |
| 1051 | Ga0501080_0359626 | 3300049742 | Bacteria | 1313 |
| 1052 | Ga0501241_003222 | 3300049758 | Bacteria | 3097 |
| 1053 | Ga0501264_000212 | 3300049761 | Bacteria | 9457 |
| 1054 | Ga0501279_002719 | 3300049775 | Bacteria | 2309 |
| 1055 | Ga0501035_0039835 | 3300049822 | Bacteria | 4250 |
| 1056 | Ga0501035_0113305 | 3300049822 | Bacteria | 2376 |
| 1057 | Ga0501035_0296139 | 3300049822 | Bacteria | 1364 |
| 1058 | Ga0501044_0003551 | 3300049823 | Bacteria | 17548 |
| 1059 | Ga0501044_0012622 | 3300049823 | Bacteria | 9148 |
| 1060 | Ga0501044_0198740 | 3300049823 | Bacteria | 1964 |
| 1061 | Ga0501284_00029 | 3300050005 | Bacteria | 74818 |
| 1062 | nmdc:mga0k408_13677_c2 | 3300050493 | Bacteria | 3480 |
| 1063 | nmdc:mga0k408_156_c1 | 3300050493 | Bacteria | 20011 |
| 1064 | nmdc:mga0k408_227705_c1 | 3300050493 | Bacteria | 1113 |
| 1065 | nmdc:mga0k408_2627_c1 | 3300050493 | Bacteria | 2039 |
| 1066 | nmdc:mga0k408_6061_c1 | 3300050493 | Bacteria | 6444 |
| 1067 | nmdc:mga0k408_93952_c1 | 3300050493 | Bacteria | 1763 |
| 1068 | nmdc:mga07m45_225701_c1 | 3300050496 | Bacteria | 1090 |
| 1069 | nmdc:mga05p37_18450_c2 | 3300050507 | Bacteria | 3051 |
| 1070 | nmdc:mga05p37_188731_c1 | 3300050507 | Bacteria | 2504 |
| 1071 | nmdc:mga09592_166862_c1 | 3300050508 | Bacteria | 1903 |
| 1072 | nmdc:mga09592_47012_c1 | 3300050508 | Bacteria | 3636 |
| 1073 | nmdc:mga0qj67_148647_c1 | 3300050509 | Bacteria | 1900 |
| 1074 | nmdc:mga06r32_303292_c1 | 3300050510 | Bacteria | 1583 |
| 1075 | nmdc:mga08y16_141552_c1 | 3300050511 | Bacteria | 2500 |
| 1076 | nmdc:mga08y16_31053_c1 | 3300050511 | Bacteria | 5619 |
| 1077 | nmdc:mga08y16_34280_c1 | 3300050511 | Bacteria | 5333 |
| 1078 | nmdc:mga08y16_548386_c1 | 3300050511 | Bacteria | 1170 |
| 1079 | nmdc:mga08y16_650243_c1 | 3300050511 | Bacteria | 1058 |
| 1080 | Ga0495619_0105116 | 3300053085 | Bacteria | 1925 |
| 1081 | Ga0495619_0105762 | 3300053085 | Bacteria | 1919 |
| 1082 | Ga0500578_0000009 | 3300053086 | Bacteria | 219807 |
| 1083 | Ga0500578_0132429 | 3300053086 | Bacteria | 1563 |
| 1084 | Ga0500644_0000035 | 3300053088 | Bacteria | 82815 |
| 1085 | Ga0500644_0021498 | 3300053088 | Bacteria | 1934 |
| 1086 | Ga0500646_0011119 | 3300053090 | Bacteria | 2312 |
| 1087 | Ga0500646_0024757 | 3300053090 | Bacteria | 1617 |
| 1088 | Ga0500646_0038939 | 3300053090 | Bacteria | 1332 |
| 1089 | Ga0500583_0000147 | 3300053092 | Bacteria | 29930 |
| 1090 | Ga0500583_0006066 | 3300053092 | Bacteria | 4116 |
| 1091 | Ga0500651_0003850 | 3300053093 | Bacteria | 8299 |
| 1092 | Ga0500651_0014342 | 3300053093 | Bacteria | 4848 |
| 1093 | Ga0500641_0000081 | 3300053096 | Bacteria | 38801 |
| 1094 | Ga0500562_000161 | 3300053108 | Bacteria | 19289 |
| 1095 | Ga0500562_040953 | 3300053108 | Bacteria | 1231 |
| 1096 | Ga0500569_000486 | 3300053109 | Bacteria | 6576 |
| 1097 | Ga0500608_009264 | 3300053122 | Bacteria | 4173 |
| 1098 | Ga0500608_074613 | 3300053122 | Bacteria | 1609 |
| 1099 | Ga0500618_000038 | 3300053125 | Bacteria | 116036 |
| 1100 | Ga0500642_0019775 | 3300053130 | Bacteria | 2634 |
| 1101 | Ga0500655_008823 | 3300053133 | Bacteria | 1814 |
| 1102 | Ga0500658_0014621 | 3300053134 | Bacteria | 2907 |
| 1103 | Ga0500561_0004593 | 3300053137 | Bacteria | 2504 |
| 1104 | Ga0500573_0101342 | 3300053140 | Bacteria | 1620 |
| 1105 | Ga0500577_0000507 | 3300053142 | Bacteria | 10012 |
| 1106 | Ga0500616_0000015 | 3300053153 | Bacteria | 633259 |
| 1107 | Ga0500616_0052247 | 3300053153 | Bacteria | 2150 |
| 1108 | Ga0500616_0064751 | 3300053153 | Bacteria | 1881 |
| 1109 | Ga0500622_0000203 | 3300053156 | Bacteria | 63042 |
| 1110 | Ga0500622_0011602 | 3300053156 | Bacteria | 4793 |
| 1111 | Ga0500622_0027095 | 3300053156 | Bacteria | 3022 |
| 1112 | Ga0500622_0027852 | 3300053156 | Bacteria | 2977 |
| 1113 | Ga0500622_0033407 | 3300053156 | Bacteria | 2697 |
| 1114 | Ga0500624_000278 | 3300053157 | Bacteria | 17649 |
| 1115 | Ga0500633_0069739 | 3300053160 | Bacteria | 1253 |
| 1116 | Ga0500611_000006 | 3300053727 | Bacteria | 226069 |
| 1117 | Ga0500645_005960 | 3300053730 | Bacteria | 4411 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035725 | Ga0373947_0050857 | Ga0373947_0050857_824_1828 | 279 |
| 2 | 3300006844 | Ga0075428_100011915 | Ga0075428_1000119154 | 286 |
| 3 | 3300031824 | Ga0307413_10345611 | Ga0307413_103456111 | 286 |
| 4 | 3300032005 | Ga0307411_10212129 | Ga0307411_102121291 | 286 |
| 5 | 3300049576 | Ga0501040_0149266 | Ga0501040_0149266_217_1086 | 286 |
| 6 | 3300050508 | nmdc:mga09592_166862_c1 | nmdc:mga09592_166862_c1_234_1106 | 286 |
| 7 | 3300005455 | Ga0070663_100109107 | Ga0070663_1001091073 | 287 |
| 8 | 3300006844 | Ga0075428_100180137 | Ga0075428_1001801372 | 287 |
| 9 | 3300013102 | Ga0157371_10035971 | Ga0157371_100359711 | 287 |
| 10 | 3300013105 | Ga0157369_10000566 | Ga0157369_1000056656 | 287 |
| 11 | 3300013307 | Ga0157372_10000020 | Ga0157372_1000002052 | 287 |
| 12 | 3300028556 | Ga0265337_1005714 | Ga0265337_10057144 | 287 |
| 13 | 3300028800 | Ga0265338_10015047 | Ga0265338_100150472 | 287 |
| 14 | 3300031241 | Ga0265325_10039951 | Ga0265325_100399512 | 287 |
| 15 | 3300031595 | Ga0265313_10041092 | Ga0265313_100410922 | 287 |
| 16 | 3300042876 | Ga0451577_0351037 | Ga0451577_0351037_269_1210 | 287 |
| 17 | 3300044712 | Ga0453684_0064450 | Ga0453684_0064450_2188_3129 | 287 |
| 18 | 3300045051 | Ga0451576_0001626 | Ga0451576_0001626_1450_2382 | 287 |
| 19 | 3300050509 | nmdc:mga0qj67_148647_c1 | nmdc:mga0qj67_148647_c1_152_1024 | 287 |
| 20 | 3300005327 | Ga0070658_10000014 | Ga0070658_1000001429 | 288 |
| 21 | 3300005329 | Ga0070683_100016654 | Ga0070683_1000166545 | 288 |
| 22 | 3300005539 | Ga0068853_100081876 | Ga0068853_1000818762 | 288 |
| 23 | 3300005563 | Ga0068855_100226227 | Ga0068855_1002262272 | 288 |
| 24 | 3300013307 | Ga0157372_10005311 | Ga0157372_1000531113 | 288 |
| 25 | 3300025944 | Ga0207661_10035166 | Ga0207661_100351664 | 288 |
| 26 | 3300029957 | Ga0265324_10014609 | Ga0265324_100146092 | 288 |
| 27 | 3300044673 | Ga0453683_0093085 | Ga0453683_0093085_316_1188 | 288 |
| 28 | 3300044712 | Ga0453684_0774816 | Ga0453684_0774816_90_959 | 288 |
| 29 | 3300045051 | Ga0451576_0219922 | Ga0451576_0219922_453_1325 | 288 |
| 30 | 3300001904 | JGI24736J21556_1001800 | JGI24736J21556_10018002 | 289 |
| 31 | 3300001990 | JGI24737J22298_10001003 | JGI24737J22298_1000100313 | 289 |
| 32 | 3300001990 | JGI24737J22298_10022757 | JGI24737J22298_100227572 | 289 |
| 33 | 3300002067 | JGI24735J21928_10000038 | JGI24735J21928_1000003823 | 289 |
| 34 | 3300002077 | JGI24744J21845_10001880 | JGI24744J21845_100018803 | 289 |
| 35 | 3300002737 | JGI25162J39368_1000716 | JGI25162J39368_100071624 | 289 |
| 36 | 3300002772 | JGI25164J39214_1000601 | JGI25164J39214_10006015 | 289 |
| 37 | 3300003214 | JGI25165J46597_1000157 | JGI25165J46597_100015713 | 289 |
| 38 | 3300003320 | rootH2_10002560 | rootH2_1000256024 | 289 |
| 39 | 3300003323 | rootH1_10005851 | rootH1_1000585177 | 289 |
| 40 | 3300003323 | rootH1_10007902 | rootH1_100079026 | 289 |
| 41 | 3300003323 | rootH1_10025209 | rootH1_100252092 | 289 |
| 42 | 3300003323 | rootH1_10061615 | rootH1_100616151 | 289 |
| 43 | 3300004799 | Ga0058863_11478938 | Ga0058863_114789382 | 289 |
| 44 | 3300005262 | Ga0065165_1000470 | Ga0065165_100047029 | 289 |
| 45 | 3300005288 | Ga0065714_10006118 | Ga0065714_100061182 | 289 |
| 46 | 3300005288 | Ga0065714_10113088 | Ga0065714_101130882 | 289 |
| 47 | 3300005293 | Ga0065715_10218605 | Ga0065715_102186052 | 289 |
| 48 | 3300005327 | Ga0070658_10106653 | Ga0070658_101066532 | 289 |
| 49 | 3300005328 | Ga0070676_10000269 | Ga0070676_1000026910 | 289 |
| 50 | 3300005328 | Ga0070676_10022315 | Ga0070676_100223154 | 289 |
| 51 | 3300005336 | Ga0070680_100011377 | Ga0070680_1000113776 | 289 |
| 52 | 3300005339 | Ga0070660_100033752 | Ga0070660_1000337523 | 289 |
| 53 | 3300005340 | Ga0070689_100063312 | Ga0070689_1000633122 | 289 |
| 54 | 3300005341 | Ga0070691_10102297 | Ga0070691_101022972 | 289 |
| 55 | 3300005343 | Ga0070687_100029219 | Ga0070687_1000292191 | 289 |
| 56 | 3300005353 | Ga0070669_100332853 | Ga0070669_1003328531 | 289 |
| 57 | 3300005354 | Ga0070675_100185362 | Ga0070675_1001853621 | 289 |
| 58 | 3300005355 | Ga0070671_100008005 | Ga0070671_1000080053 | 289 |
| 59 | 3300005355 | Ga0070671_100014610 | Ga0070671_1000146102 | 289 |
| 60 | 3300005355 | Ga0070671_100080801 | Ga0070671_1000808014 | 289 |
| 61 | 3300005364 | Ga0070673_100003206 | Ga0070673_1000032065 | 289 |
| 62 | 3300005364 | Ga0070673_100033392 | Ga0070673_1000333924 | 289 |
| 63 | 3300005365 | Ga0070688_100112317 | Ga0070688_1001123173 | 289 |
| 64 | 3300005366 | Ga0070659_100000107 | Ga0070659_10000010748 | 289 |
| 65 | 3300005441 | Ga0070700_100274053 | Ga0070700_1002740531 | 289 |
| 66 | 3300005456 | Ga0070678_100267669 | Ga0070678_1002676692 | 289 |
| 67 | 3300005457 | Ga0070662_100000192 | Ga0070662_10000019214 | 289 |
| 68 | 3300005457 | Ga0070662_100131336 | Ga0070662_1001313362 | 289 |
| 69 | 3300005457 | Ga0070662_100231604 | Ga0070662_1002316041 | 289 |
| 70 | 3300005458 | Ga0070681_10022138 | Ga0070681_1002213810 | 289 |
| 71 | 3300005459 | Ga0068867_100006330 | Ga0068867_1000063301 | 289 |
| 72 | 3300005459 | Ga0068867_100085784 | Ga0068867_1000857842 | 289 |
| 73 | 3300005530 | Ga0070679_100033714 | Ga0070679_1000337143 | 289 |
| 74 | 3300005530 | Ga0070679_100036558 | Ga0070679_1000365587 | 289 |
| 75 | 3300005539 | Ga0068853_100009749 | Ga0068853_1000097498 | 289 |
| 76 | 3300005539 | Ga0068853_100075071 | Ga0068853_1000750713 | 289 |
| 77 | 3300005543 | Ga0070672_100031360 | Ga0070672_1000313602 | 289 |
| 78 | 3300005544 | Ga0070686_100029354 | Ga0070686_1000293542 | 289 |
| 79 | 3300005563 | Ga0068855_100009170 | Ga0068855_1000091703 | 289 |
| 80 | 3300005563 | Ga0068855_100081580 | Ga0068855_1000815803 | 289 |
| 81 | 3300005564 | Ga0070664_100020475 | Ga0070664_1000204756 | 289 |
| 82 | 3300005577 | Ga0068857_100023085 | Ga0068857_1000230852 | 289 |
| 83 | 3300005578 | Ga0068854_100036834 | Ga0068854_1000368342 | 289 |
| 84 | 3300005614 | Ga0068856_100000104 | Ga0068856_10000010457 | 289 |
| 85 | 3300005615 | Ga0070702_100019598 | Ga0070702_1000195984 | 289 |
| 86 | 3300005616 | Ga0068852_100002279 | Ga0068852_1000022798 | 289 |
| 87 | 3300005834 | Ga0068851_10121257 | Ga0068851_101212572 | 289 |
| 88 | 3300005841 | Ga0068863_100023248 | Ga0068863_1000232482 | 289 |
| 89 | 3300006195 | Ga0075366_10004074 | Ga0075366_100040746 | 289 |
| 90 | 3300006195 | Ga0075366_10006278 | Ga0075366_100062782 | 289 |
| 91 | 3300006237 | Ga0097621_100000579 | Ga0097621_1000005798 | 289 |
| 92 | 3300006237 | Ga0097621_100000586 | Ga0097621_10000058616 | 289 |
| 93 | 3300006237 | Ga0097621_100039231 | Ga0097621_1000392312 | 289 |
| 94 | 3300006353 | Ga0075370_10168223 | Ga0075370_101682232 | 289 |
| 95 | 3300006358 | Ga0068871_100000212 | Ga0068871_10000021231 | 289 |
| 96 | 3300006358 | Ga0068871_100001603 | Ga0068871_1000016032 | 289 |
| 97 | 3300006881 | Ga0068865_100003908 | Ga0068865_1000039085 | 289 |
| 98 | 3300009093 | Ga0105240_10000104 | Ga0105240_1000010471 | 289 |
| 99 | 3300009093 | Ga0105240_10063866 | Ga0105240_100638665 | 289 |
| 100 | 3300009093 | Ga0105240_10070596 | Ga0105240_100705963 | 289 |
| 101 | 3300009093 | Ga0105240_10094488 | Ga0105240_100944885 | 289 |
| 102 | 3300009093 | Ga0105240_10505637 | Ga0105240_105056372 | 289 |
| 103 | 3300009098 | Ga0105245_10230596 | Ga0105245_102305963 | 289 |
| 104 | 3300009098 | Ga0105245_10679797 | Ga0105245_106797971 | 289 |
| 105 | 3300009148 | Ga0105243_10024433 | Ga0105243_100244333 | 289 |
| 106 | 3300009174 | Ga0105241_10000609 | Ga0105241_100006095 | 289 |
| 107 | 3300009174 | Ga0105241_10009620 | Ga0105241_100096207 | 289 |
| 108 | 3300009174 | Ga0105241_10030901 | Ga0105241_100309013 | 289 |
| 109 | 3300009176 | Ga0105242_10039161 | Ga0105242_100391613 | 289 |
| 110 | 3300009545 | Ga0105237_10001427 | Ga0105237_1000142726 | 289 |
| 111 | 3300009545 | Ga0105237_10002980 | Ga0105237_1000298024 | 289 |
| 112 | 3300009545 | Ga0105237_10003047 | Ga0105237_1000304717 | 289 |
| 113 | 3300009545 | Ga0105237_10011278 | Ga0105237_100112788 | 289 |
| 114 | 3300009545 | Ga0105237_10172316 | Ga0105237_101723162 | 289 |
| 115 | 3300009545 | Ga0105237_10186160 | Ga0105237_101861602 | 289 |
| 116 | 3300009551 | Ga0105238_10058908 | Ga0105238_100589082 | 289 |
| 117 | 3300009553 | Ga0105249_10008693 | Ga0105249_100086932 | 289 |
| 118 | 3300009553 | Ga0105249_10044140 | Ga0105249_100441403 | 289 |
| 119 | 3300010375 | Ga0105239_10000007 | Ga0105239_10000007145 | 289 |
| 120 | 3300010375 | Ga0105239_10000015 | Ga0105239_10000015221 | 289 |
| 121 | 3300010375 | Ga0105239_10000864 | Ga0105239_1000086440 | 289 |
| 122 | 3300010375 | Ga0105239_10030338 | Ga0105239_100303385 | 289 |
| 123 | 3300010375 | Ga0105239_10069962 | Ga0105239_100699622 | 289 |
| 124 | 3300010375 | Ga0105239_10097637 | Ga0105239_100976372 | 289 |
| 125 | 3300010375 | Ga0105239_10335541 | Ga0105239_103355412 | 289 |
| 126 | 3300013100 | Ga0157373_10001240 | Ga0157373_1000124011 | 289 |
| 127 | 3300013100 | Ga0157373_10002086 | Ga0157373_1000208614 | 289 |
| 128 | 3300013102 | Ga0157371_10002507 | Ga0157371_1000250711 | 289 |
| 129 | 3300013102 | Ga0157371_10003338 | Ga0157371_100033388 | 289 |
| 130 | 3300013102 | Ga0157371_10021914 | Ga0157371_100219141 | 289 |
| 131 | 3300013104 | Ga0157370_10003187 | Ga0157370_1000318713 | 289 |
| 132 | 3300013104 | Ga0157370_10012309 | Ga0157370_1001230912 | 289 |
| 133 | 3300013104 | Ga0157370_10019635 | Ga0157370_100196352 | 289 |
| 134 | 3300013104 | Ga0157370_10064921 | Ga0157370_100649214 | 289 |
| 135 | 3300013104 | Ga0157370_10178285 | Ga0157370_101782852 | 289 |
| 136 | 3300013105 | Ga0157369_10104435 | Ga0157369_101044351 | 289 |
| 137 | 3300013105 | Ga0157369_10139013 | Ga0157369_101390133 | 289 |
| 138 | 3300013296 | Ga0157374_10001177 | Ga0157374_100011773 | 289 |
| 139 | 3300013296 | Ga0157374_10006147 | Ga0157374_100061474 | 289 |
| 140 | 3300013296 | Ga0157374_10047739 | Ga0157374_100477394 | 289 |
| 141 | 3300013297 | Ga0157378_10001918 | Ga0157378_1000191814 | 289 |
| 142 | 3300013297 | Ga0157378_10014455 | Ga0157378_100144554 | 289 |
| 143 | 3300013297 | Ga0157378_10021276 | Ga0157378_100212762 | 289 |
| 144 | 3300013297 | Ga0157378_10077422 | Ga0157378_100774222 | 289 |
| 145 | 3300013306 | Ga0163162_10000871 | Ga0163162_100008712 | 289 |
| 146 | 3300013306 | Ga0163162_10002080 | Ga0163162_100020809 | 289 |
| 147 | 3300013306 | Ga0163162_10003406 | Ga0163162_1000340613 | 289 |
| 148 | 3300013306 | Ga0163162_10025293 | Ga0163162_100252932 | 289 |
| 149 | 3300013306 | Ga0163162_10180929 | Ga0163162_101809292 | 289 |
| 150 | 3300013307 | Ga0157372_10001414 | Ga0157372_1000141420 | 289 |
| 151 | 3300013307 | Ga0157372_10027413 | Ga0157372_100274135 | 289 |
| 152 | 3300013307 | Ga0157372_10031343 | Ga0157372_100313433 | 289 |
| 153 | 3300013307 | Ga0157372_10113115 | Ga0157372_101131153 | 289 |
| 154 | 3300013307 | Ga0157372_10137839 | Ga0157372_101378392 | 289 |
| 155 | 3300013308 | Ga0157375_10000118 | Ga0157375_1000011845 | 289 |
| 156 | 3300013308 | Ga0157375_10001625 | Ga0157375_100016252 | 289 |
| 157 | 3300013308 | Ga0157375_10131057 | Ga0157375_101310573 | 289 |
| 158 | 3300013308 | Ga0157375_10190621 | Ga0157375_101906213 | 289 |
| 159 | 3300013308 | Ga0157375_10250248 | Ga0157375_102502482 | 289 |
| 160 | 3300013308 | Ga0157375_10273768 | Ga0157375_102737682 | 289 |
| 161 | 3300013308 | Ga0157375_10758572 | Ga0157375_107585721 | 289 |
| 162 | 3300014325 | Ga0163163_10000636 | Ga0163163_1000063620 | 289 |
| 163 | 3300014497 | Ga0182008_10000048 | Ga0182008_1000004845 | 289 |
| 164 | 3300014497 | Ga0182008_10090120 | Ga0182008_100901201 | 289 |
| 165 | 3300014745 | Ga0157377_10030501 | Ga0157377_100305012 | 289 |
| 166 | 3300014968 | Ga0157379_10037300 | Ga0157379_100373006 | 289 |
| 167 | 3300014969 | Ga0157376_10000378 | Ga0157376_1000037813 | 289 |
| 168 | 3300014969 | Ga0157376_10165142 | Ga0157376_101651422 | 289 |
| 169 | 3300015261 | Ga0182006_1000103 | Ga0182006_100010321 | 289 |
| 170 | 3300015261 | Ga0182006_1006283 | Ga0182006_10062834 | 289 |
| 171 | 3300015262 | Ga0182007_10029805 | Ga0182007_100298051 | 289 |
| 172 | 3300017792 | Ga0163161_10000672 | Ga0163161_1000067219 | 289 |
| 173 | 3300017792 | Ga0163161_10022509 | Ga0163161_100225093 | 289 |
| 174 | 3300017792 | Ga0163161_10040002 | Ga0163161_100400023 | 289 |
| 175 | 3300017792 | Ga0163161_10073639 | Ga0163161_100736393 | 289 |
| 176 | 3300017792 | Ga0163161_10132659 | Ga0163161_101326592 | 289 |
| 177 | 3300025230 | Ga0209563_103255 | Ga0209563_1032553 | 289 |
| 178 | 3300025231 | Ga0207427_100025 | Ga0207427_100025129 | 289 |
| 179 | 3300025233 | Ga0209437_100010 | Ga0209437_100010391 | 289 |
| 180 | 3300025250 | Ga0209026_1000225 | Ga0209026_100022543 | 289 |
| 181 | 3300025261 | Ga0209233_1000017 | Ga0209233_1000017404 | 289 |
| 182 | 3300025261 | Ga0209233_1000655 | Ga0209233_100065514 | 289 |
| 183 | 3300025272 | Ga0209455_1000758 | Ga0209455_100075811 | 289 |
| 184 | 3300025885 | Ga0207653_10034997 | Ga0207653_100349971 | 289 |
| 185 | 3300025904 | Ga0207647_10000169 | Ga0207647_1000016928 | 289 |
| 186 | 3300025904 | Ga0207647_10000206 | Ga0207647_1000020629 | 289 |
| 187 | 3300025907 | Ga0207645_10000672 | Ga0207645_100006724 | 289 |
| 188 | 3300025907 | Ga0207645_10218207 | Ga0207645_102182072 | 289 |
| 189 | 3300025908 | Ga0207643_10266106 | Ga0207643_102661061 | 289 |
| 190 | 3300025911 | Ga0207654_10000940 | Ga0207654_1000094013 | 289 |
| 191 | 3300025911 | Ga0207654_10002291 | Ga0207654_100022914 | 289 |
| 192 | 3300025912 | Ga0207707_10007990 | Ga0207707_100079906 | 289 |
| 193 | 3300025913 | Ga0207695_10000048 | Ga0207695_1000004889 | 289 |
| 194 | 3300025913 | Ga0207695_10008731 | Ga0207695_1000873114 | 289 |
| 195 | 3300025913 | Ga0207695_10058385 | Ga0207695_100583852 | 289 |
| 196 | 3300025913 | Ga0207695_10283985 | Ga0207695_102839851 | 289 |
| 197 | 3300025913 | Ga0207695_10351824 | Ga0207695_103518242 | 289 |
| 198 | 3300025913 | Ga0207695_10523926 | Ga0207695_105239261 | 289 |
| 199 | 3300025914 | Ga0207671_10005064 | Ga0207671_100050642 | 289 |
| 200 | 3300025914 | Ga0207671_10006304 | Ga0207671_1000630410 | 289 |
| 201 | 3300025914 | Ga0207671_10008774 | Ga0207671_100087744 | 289 |
| 202 | 3300025914 | Ga0207671_10016225 | Ga0207671_100162255 | 289 |
| 203 | 3300025914 | Ga0207671_10330170 | Ga0207671_103301701 | 289 |
| 204 | 3300025917 | Ga0207660_10018017 | Ga0207660_100180173 | 289 |
| 205 | 3300025919 | Ga0207657_10042545 | Ga0207657_100425453 | 289 |
| 206 | 3300025921 | Ga0207652_10011595 | Ga0207652_100115958 | 289 |
| 207 | 3300025921 | Ga0207652_10066470 | Ga0207652_100664703 | 289 |
| 208 | 3300025924 | Ga0207694_10017591 | Ga0207694_100175913 | 289 |
| 209 | 3300025927 | Ga0207687_10227262 | Ga0207687_102272622 | 289 |
| 210 | 3300025931 | Ga0207644_10004906 | Ga0207644_100049064 | 289 |
| 211 | 3300025931 | Ga0207644_10008932 | Ga0207644_100089322 | 289 |
| 212 | 3300025931 | Ga0207644_10256232 | Ga0207644_102562322 | 289 |
| 213 | 3300025932 | Ga0207690_10000147 | Ga0207690_1000014719 | 289 |
| 214 | 3300025932 | Ga0207690_10014393 | Ga0207690_100143932 | 289 |
| 215 | 3300025933 | Ga0207706_10000167 | Ga0207706_1000016743 | 289 |
| 216 | 3300025934 | Ga0207686_10380838 | Ga0207686_103808381 | 289 |
| 217 | 3300025934 | Ga0207686_10462970 | Ga0207686_104629701 | 289 |
| 218 | 3300025935 | Ga0207709_10023674 | Ga0207709_100236743 | 289 |
| 219 | 3300025936 | Ga0207670_10079985 | Ga0207670_100799853 | 289 |
| 220 | 3300025938 | Ga0207704_10000042 | Ga0207704_1000004244 | 289 |
| 221 | 3300025938 | Ga0207704_10296384 | Ga0207704_102963842 | 289 |
| 222 | 3300025940 | Ga0207691_10154222 | Ga0207691_101542222 | 289 |
| 223 | 3300025941 | Ga0207711_10028398 | Ga0207711_100283982 | 289 |
| 224 | 3300025945 | Ga0207679_10256138 | Ga0207679_102561381 | 289 |
| 225 | 3300025949 | Ga0207667_10073752 | Ga0207667_100737523 | 289 |
| 226 | 3300025949 | Ga0207667_10094059 | Ga0207667_100940592 | 289 |
| 227 | 3300025960 | Ga0207651_10018322 | Ga0207651_100183222 | 289 |
| 228 | 3300025961 | Ga0207712_10024884 | Ga0207712_100248842 | 289 |
| 229 | 3300025961 | Ga0207712_10026045 | Ga0207712_100260454 | 289 |
| 230 | 3300025981 | Ga0207640_10018940 | Ga0207640_100189403 | 289 |
| 231 | 3300025986 | Ga0207658_10313622 | Ga0207658_103136222 | 289 |
| 232 | 3300026023 | Ga0207677_10060696 | Ga0207677_100606963 | 289 |
| 233 | 3300026041 | Ga0207639_10057307 | Ga0207639_100573073 | 289 |
| 234 | 3300026041 | Ga0207639_10089840 | Ga0207639_100898402 | 289 |
| 235 | 3300026041 | Ga0207639_10093652 | Ga0207639_100936523 | 289 |
| 236 | 3300026075 | Ga0207708_10073643 | Ga0207708_100736432 | 289 |
| 237 | 3300026078 | Ga0207702_10000119 | Ga0207702_100001199 | 289 |
| 238 | 3300026078 | Ga0207702_10047091 | Ga0207702_100470914 | 289 |
| 239 | 3300026088 | Ga0207641_10147673 | Ga0207641_101476732 | 289 |
| 240 | 3300026089 | Ga0207648_10003557 | Ga0207648_100035579 | 289 |
| 241 | 3300026089 | Ga0207648_10085784 | Ga0207648_100857843 | 289 |
| 242 | 3300026095 | Ga0207676_10386236 | Ga0207676_103862361 | 289 |
| 243 | 3300026121 | Ga0207683_10040552 | Ga0207683_100405523 | 289 |
| 244 | 3300026121 | Ga0207683_10315809 | Ga0207683_103158092 | 289 |
| 245 | 3300026121 | Ga0207683_10461876 | Ga0207683_104618761 | 289 |
| 246 | 3300026142 | Ga0207698_10001222 | Ga0207698_100012223 | 289 |
| 247 | 3300028379 | Ga0268266_10000030 | Ga0268266_10000030284 | 289 |
| 248 | 3300028380 | Ga0268265_10504682 | Ga0268265_105046821 | 289 |
| 249 | 3300028558 | Ga0265326_10005999 | Ga0265326_100059995 | 289 |
| 250 | 3300028563 | Ga0265319_1000171 | Ga0265319_10001717 | 289 |
| 251 | 3300028573 | Ga0265334_10000220 | Ga0265334_100002204 | 289 |
| 252 | 3300028577 | Ga0265318_10002220 | Ga0265318_100022203 | 289 |
| 253 | 3300028654 | Ga0265322_10034893 | Ga0265322_100348932 | 289 |
| 254 | 3300028786 | Ga0307517_10011388 | Ga0307517_100113883 | 289 |
| 255 | 3300028794 | Ga0307515_10000507 | Ga0307515_1000050730 | 289 |
| 256 | 3300028800 | Ga0265338_10000448 | Ga0265338_1000044819 | 289 |
| 257 | 3300028800 | Ga0265338_10001633 | Ga0265338_1000163317 | 289 |
| 258 | 3300031239 | Ga0265328_10078783 | Ga0265328_100787832 | 289 |
| 259 | 3300031240 | Ga0265320_10006371 | Ga0265320_100063713 | 289 |
| 260 | 3300031242 | Ga0265329_10042288 | Ga0265329_100422882 | 289 |
| 261 | 3300031507 | Ga0307509_10089274 | Ga0307509_100892743 | 289 |
| 262 | 3300031548 | Ga0307408_100000578 | Ga0307408_1000005782 | 289 |
| 263 | 3300031548 | Ga0307408_100001086 | Ga0307408_10000108616 | 289 |
| 264 | 3300031548 | Ga0307408_100001939 | Ga0307408_1000019399 | 289 |
| 265 | 3300031595 | Ga0265313_10003787 | Ga0265313_100037873 | 289 |
| 266 | 3300031711 | Ga0265314_10048233 | Ga0265314_100482333 | 289 |
| 267 | 3300031712 | Ga0265342_10018127 | Ga0265342_100181274 | 289 |
| 268 | 3300031730 | Ga0307516_10420721 | Ga0307516_104207211 | 289 |
| 269 | 3300032004 | Ga0307414_10000608 | Ga0307414_100006088 | 289 |
| 270 | 3300032004 | Ga0307414_10052185 | Ga0307414_100521852 | 289 |
| 271 | 3300032004 | Ga0307414_10447515 | Ga0307414_104475151 | 289 |
| 272 | 3300033180 | Ga0307510_10000147 | Ga0307510_1000014741 | 289 |
| 273 | 3300035115 | Ga0373941_0084057 | Ga0373941_0084057_62_931 | 289 |
| 274 | 3300037312 | Ga0395899_0000002 | Ga0395899_0000002_312292_313161 | 289 |
| 275 | 3300037312 | Ga0395899_0000286 | Ga0395899_0000286_50548_51420 | 289 |
| 276 | 3300037418 | Ga0395900_0000115 | Ga0395900_0000115_112820_113692 | 289 |
| 277 | 3300037418 | Ga0395900_0004784 | Ga0395900_0004784_12051_12920 | 289 |
| 278 | 3300037418 | Ga0395900_0140357 | Ga0395900_0140357_101_970 | 289 |
| 279 | 3300037466 | Ga0395898_0010131 | Ga0395898_0010131_8688_9560 | 289 |
| 280 | 3300037471 | Ga0395905_0000045 | Ga0395905_0000045_112626_113498 | 289 |
| 281 | 3300037471 | Ga0395905_0001113 | Ga0395905_0001113_23536_24405 | 289 |
| 282 | 3300037471 | Ga0395905_0394886 | Ga0395905_0394886_268_1137 | 289 |
| 283 | 3300038443 | Ga0395901_0000254 | Ga0395901_0000254_62439_63311 | 289 |
| 284 | 3300038443 | Ga0395901_0006539 | Ga0395901_0006539_10841_11710 | 289 |
| 285 | 3300038443 | Ga0395901_0116658 | Ga0395901_0116658_1488_2357 | 289 |
| 286 | 3300045051 | Ga0451576_0117261 | Ga0451576_0117261_516_1406 | 289 |
| 287 | 3300046459 | Ga0495629_0100797 | Ga0495629_0100797_243_1112 | 289 |
| 288 | 3300046460 | Ga0495638_0135022 | Ga0495638_0135022_309_1178 | 289 |
| 289 | 3300046462 | Ga0495651_0267440 | Ga0495651_0267440_243_1112 | 289 |
| 290 | 3300046471 | Ga0495650_0000198 | Ga0495650_0000198_31355_32224 | 289 |
| 291 | 3300046471 | Ga0495650_0071548 | Ga0495650_0071548_377_1246 | 289 |
| 292 | 3300046492 | Ga0495585_0002633 | Ga0495585_0002633_8988_9857 | 289 |
| 293 | 3300046492 | Ga0495585_0006258 | Ga0495585_0006258_1136_2005 | 289 |
| 294 | 3300046499 | Ga0495594_0055291 | Ga0495594_0055291_1171_2061 | 289 |
| 295 | 3300046500 | Ga0495596_0016929 | Ga0495596_0016929_923_1792 | 289 |
| 296 | 3300046506 | Ga0495583_0037848 | Ga0495583_0037848_1334_2203 | 289 |
| 297 | 3300046507 | Ga0495606_0000003 | Ga0495606_0000003_9854_10723 | 289 |
| 298 | 3300046507 | Ga0495606_0012375 | Ga0495606_0012375_3750_4619 | 289 |
| 299 | 3300046507 | Ga0495606_0014704 | Ga0495606_0014704_3896_4765 | 289 |
| 300 | 3300046507 | Ga0495606_0054176 | Ga0495606_0054176_564_1433 | 289 |
| 301 | 3300046507 | Ga0495606_0111876 | Ga0495606_0111876_697_1566 | 289 |
| 302 | 3300046512 | Ga0495610_0015317 | Ga0495610_0015317_2462_3331 | 289 |
| 303 | 3300046512 | Ga0495610_0122677 | Ga0495610_0122677_258_1127 | 289 |
| 304 | 3300046513 | Ga0495616_0052238 | Ga0495616_0052238_1102_1971 | 289 |
| 305 | 3300046524 | Ga0495648_0003102 | Ga0495648_0003102_11950_12819 | 289 |
| 306 | 3300046524 | Ga0495648_0022342 | Ga0495648_0022342_3367_4236 | 289 |
| 307 | 3300046529 | Ga0495652_0311750 | Ga0495652_0311750_13_882 | 289 |
| 308 | 3300046558 | Ga0495633_0000267 | Ga0495633_0000267_23169_24038 | 289 |
| 309 | 3300046616 | Ga0495668_0000010 | Ga0495668_0000010_460117_460986 | 289 |
| 310 | 3300046660 | Ga0495625_0000456 | Ga0495625_0000456_6885_7754 | 289 |
| 311 | 3300046660 | Ga0495625_0000524 | Ga0495625_0000524_27807_28676 | 289 |
| 312 | 3300046660 | Ga0495625_0003704 | Ga0495625_0003704_10008_10877 | 289 |
| 313 | 3300046660 | Ga0495625_0043481 | Ga0495625_0043481_1168_2037 | 289 |
| 314 | 3300046660 | Ga0495625_0077607 | Ga0495625_0077607_683_1552 | 289 |
| 315 | 3300046660 | Ga0495625_0124116 | Ga0495625_0124116_809_1678 | 289 |
| 316 | 3300046660 | Ga0495625_0207130 | Ga0495625_0207130_156_1025 | 289 |
| 317 | 3300046665 | Ga0495661_0000924 | Ga0495661_0000924_2812_3681 | 289 |
| 318 | 3300046665 | Ga0495661_0015466 | Ga0495661_0015466_3385_4254 | 289 |
| 319 | 3300046665 | Ga0495661_0017815 | Ga0495661_0017815_21_890 | 289 |
| 320 | 3300046694 | Ga0495649_0000168 | Ga0495649_0000168_28334_29203 | 289 |
| 321 | 3300046810 | Ga0495660_0007737 | Ga0495660_0007737_5332_6201 | 289 |
| 322 | 3300047443 | Ga0495687_001225 | Ga0495687_001225_20615_21484 | 289 |
| 323 | 3300047443 | Ga0495687_017007 | Ga0495687_017007_2025_2897 | 289 |
| 324 | 3300047446 | Ga0495679_024124 | Ga0495679_024124_185_1054 | 289 |
| 325 | 3300047469 | Ga0495673_0025798 | Ga0495673_0025798_553_1422 | 289 |
| 326 | 3300047472 | Ga0495686_0000845 | Ga0495686_0000845_20753_21622 | 289 |
| 327 | 3300047472 | Ga0495686_0000974 | Ga0495686_0000974_18443_19312 | 289 |
| 328 | 3300047472 | Ga0495686_0041318 | Ga0495686_0041318_473_1342 | 289 |
| 329 | 3300048917 | Ga0496114_0081057 | Ga0496114_0081057_1188_2057 | 289 |
| 330 | 3300048925 | Ga0496122_0005789 | Ga0496122_0005789_5229_6104 | 289 |
| 331 | 3300049459 | Ga0495678_038134 | Ga0495678_038134_159_1028 | 289 |
| 332 | 3300049460 | Ga0495682_0050695 | Ga0495682_0050695_623_1492 | 289 |
| 333 | 3300049572 | Ga0501036_0156326 | Ga0501036_0156326_785_1654 | 289 |
| 334 | 3300049573 | Ga0501037_0007731 | Ga0501037_0007731_5805_6674 | 289 |
| 335 | 3300049574 | Ga0501038_0064235 | Ga0501038_0064235_314_1183 | 289 |
| 336 | 3300049575 | Ga0501039_0490305 | Ga0501039_0490305_11_880 | 289 |
| 337 | 3300049581 | Ga0501047_0062647 | Ga0501047_0062647_1721_2590 | 289 |
| 338 | 3300049675 | Ga0501243_006992 | Ga0501243_006992_208_1083 | 289 |
| 339 | 3300049822 | Ga0501035_0296139 | Ga0501035_0296139_455_1324 | 289 |
| 340 | 3300049823 | Ga0501044_0012622 | Ga0501044_0012622_3515_4384 | 289 |
| 341 | 3300050493 | nmdc:mga0k408_156_c1 | nmdc:mga0k408_156_c1_17435_18304 | 289 |
| 342 | 3300050493 | nmdc:mga0k408_6061_c1 | nmdc:mga0k408_6061_c1_189_1058 | 289 |
| 343 | 3300050493 | nmdc:mga0k408_93952_c1 | nmdc:mga0k408_93952_c1_317_1186 | 289 |
| 344 | 3300050496 | nmdc:mga07m45_225701_c1 | nmdc:mga07m45_225701_c1_80_949 | 289 |
| 345 | 3300053122 | Ga0500608_009264 | Ga0500608_009264_519_1388 | 289 |
| 346 | 3300053122 | Ga0500608_074613 | Ga0500608_074613_71_991 | 289 |
| 347 | 3300053125 | Ga0500618_000038 | Ga0500618_000038_3371_4240 | 289 |
| 348 | 3300053130 | Ga0500642_0019775 | Ga0500642_0019775_920_1789 | 289 |
| 349 | 3300053140 | Ga0500573_0101342 | Ga0500573_0101342_154_1029 | 289 |
| 350 | 3300053156 | Ga0500622_0011602 | Ga0500622_0011602_2787_3656 | 289 |
| 351 | 3300053157 | Ga0500624_000278 | Ga0500624_000278_3327_4250 | 289 |
| 352 | iso_pu_bacteria | 2932082852 | 2932086400 | 289 |
| 353 | 3300005334 | Ga0068869_100018905 | Ga0068869_1000189051 | 290 |
| 354 | 3300005334 | Ga0068869_100046930 | Ga0068869_1000469301 | 290 |
| 355 | 3300005338 | Ga0068868_100074081 | Ga0068868_1000740812 | 290 |
| 356 | 3300005355 | Ga0070671_100190925 | Ga0070671_1001909251 | 290 |
| 357 | 3300005356 | Ga0070674_100001154 | Ga0070674_1000011544 | 290 |
| 358 | 3300005440 | Ga0070705_100000614 | Ga0070705_10000061412 | 290 |
| 359 | 3300005459 | Ga0068867_100004996 | Ga0068867_1000049964 | 290 |
| 360 | 3300005459 | Ga0068867_100058992 | Ga0068867_1000589921 | 290 |
| 361 | 3300005459 | Ga0068867_100093402 | Ga0068867_1000934021 | 290 |
| 362 | 3300005471 | Ga0070698_100002401 | Ga0070698_1000024019 | 290 |
| 363 | 3300005539 | Ga0068853_100086863 | Ga0068853_1000868632 | 290 |
| 364 | 3300005546 | Ga0070696_100008024 | Ga0070696_1000080244 | 290 |
| 365 | 3300005549 | Ga0070704_100020577 | Ga0070704_1000205772 | 290 |
| 366 | 3300005578 | Ga0068854_100032235 | Ga0068854_1000322353 | 290 |
| 367 | 3300005615 | Ga0070702_100060720 | Ga0070702_1000607202 | 290 |
| 368 | 3300005616 | Ga0068852_100267830 | Ga0068852_1002678302 | 290 |
| 369 | 3300005617 | Ga0068859_100020688 | Ga0068859_1000206883 | 290 |
| 370 | 3300005718 | Ga0068866_10000672 | Ga0068866_100006722 | 290 |
| 371 | 3300005719 | Ga0068861_100016204 | Ga0068861_1000162045 | 290 |
| 372 | 3300005719 | Ga0068861_100033474 | Ga0068861_1000334743 | 290 |
| 373 | 3300005843 | Ga0068860_100023982 | Ga0068860_1000239822 | 290 |
| 374 | 3300005843 | Ga0068860_100036960 | Ga0068860_1000369603 | 290 |
| 375 | 3300006237 | Ga0097621_100055070 | Ga0097621_1000550702 | 290 |
| 376 | 3300006847 | Ga0075431_100262683 | Ga0075431_1002626832 | 290 |
| 377 | 3300006881 | Ga0068865_100000264 | Ga0068865_10000026413 | 290 |
| 378 | 3300006931 | Ga0097620_100020689 | Ga0097620_1000206895 | 290 |
| 379 | 3300009148 | Ga0105243_10002943 | Ga0105243_100029431 | 290 |
| 380 | 3300009174 | Ga0105241_10267191 | Ga0105241_102671912 | 290 |
| 381 | 3300009176 | Ga0105242_10027904 | Ga0105242_100279042 | 290 |
| 382 | 3300009176 | Ga0105242_10059231 | Ga0105242_100592313 | 290 |
| 383 | 3300009177 | Ga0105248_10185760 | Ga0105248_101857601 | 290 |
| 384 | 3300010375 | Ga0105239_10059237 | Ga0105239_100592372 | 290 |
| 385 | 3300011119 | Ga0105246_10010437 | Ga0105246_100104374 | 290 |
| 386 | 3300013102 | Ga0157371_10054408 | Ga0157371_100544083 | 290 |
| 387 | 3300013102 | Ga0157371_10118318 | Ga0157371_101183181 | 290 |
| 388 | 3300013102 | Ga0157371_10134964 | Ga0157371_101349642 | 290 |
| 389 | 3300013297 | Ga0157378_10005877 | Ga0157378_100058774 | 290 |
| 390 | 3300013306 | Ga0163162_10003892 | Ga0163162_1000389211 | 290 |
| 391 | 3300013308 | Ga0157375_10173309 | Ga0157375_101733092 | 290 |
| 392 | 3300013308 | Ga0157375_10557583 | Ga0157375_105575832 | 290 |
| 393 | 3300014326 | Ga0157380_10001070 | Ga0157380_1000107012 | 290 |
| 394 | 3300014326 | Ga0157380_10086738 | Ga0157380_100867382 | 290 |
| 395 | 3300025907 | Ga0207645_10000536 | Ga0207645_1000053621 | 290 |
| 396 | 3300025913 | Ga0207695_10202776 | Ga0207695_102027762 | 290 |
| 397 | 3300025923 | Ga0207681_10024366 | Ga0207681_100243662 | 290 |
| 398 | 3300025931 | Ga0207644_10214632 | Ga0207644_102146322 | 290 |
| 399 | 3300025933 | Ga0207706_10000038 | Ga0207706_1000003836 | 290 |
| 400 | 3300025934 | Ga0207686_10000481 | Ga0207686_1000048111 | 290 |
| 401 | 3300025934 | Ga0207686_10360981 | Ga0207686_103609811 | 290 |
| 402 | 3300025935 | Ga0207709_10015358 | Ga0207709_100153582 | 290 |
| 403 | 3300025937 | Ga0207669_10001204 | Ga0207669_100012047 | 290 |
| 404 | 3300025938 | Ga0207704_10018404 | Ga0207704_100184042 | 290 |
| 405 | 3300025938 | Ga0207704_10360541 | Ga0207704_103605411 | 290 |
| 406 | 3300025940 | Ga0207691_10095297 | Ga0207691_100952973 | 290 |
| 407 | 3300025941 | Ga0207711_10029091 | Ga0207711_100290912 | 290 |
| 408 | 3300025942 | Ga0207689_10000945 | Ga0207689_100009453 | 290 |
| 409 | 3300025961 | Ga0207712_10102072 | Ga0207712_101020723 | 290 |
| 410 | 3300025981 | Ga0207640_10024008 | Ga0207640_100240081 | 290 |
| 411 | 3300025986 | Ga0207658_10373683 | Ga0207658_103736831 | 290 |
| 412 | 3300026023 | Ga0207677_10323758 | Ga0207677_103237582 | 290 |
| 413 | 3300026041 | Ga0207639_10047774 | Ga0207639_100477742 | 290 |
| 414 | 3300026089 | Ga0207648_10000036 | Ga0207648_1000003637 | 290 |
| 415 | 3300026089 | Ga0207648_10075182 | Ga0207648_100751821 | 290 |
| 416 | 3300026116 | Ga0207674_10543312 | Ga0207674_105433122 | 290 |
| 417 | 3300026118 | Ga0207675_100029699 | Ga0207675_1000296995 | 290 |
| 418 | 3300026118 | Ga0207675_100050955 | Ga0207675_1000509553 | 290 |
| 419 | 3300026118 | Ga0207675_100191812 | Ga0207675_1001918122 | 290 |
| 420 | 3300028381 | Ga0268264_10003271 | Ga0268264_1000327111 | 290 |
| 421 | 3300028381 | Ga0268264_10013186 | Ga0268264_100131862 | 290 |
| 422 | 3300042876 | Ga0451577_0020546 | Ga0451577_0020546_3420_4292 | 290 |
| 423 | 3300042876 | Ga0451577_0032953 | Ga0451577_0032953_3117_4040 | 290 |
| 424 | 3300044712 | Ga0453684_0231041 | Ga0453684_0231041_500_1423 | 290 |
| 425 | 3300045051 | Ga0451576_0048038 | Ga0451576_0048038_1522_2445 | 290 |
| 426 | 3300047318 | Ga0495636_0109904 | Ga0495636_0109904_170_1063 | 290 |
| 427 | 3300047320 | Ga0495672_0089092 | Ga0495672_0089092_419_1291 | 290 |
| 428 | 3300048903 | Ga0496100_0049855 | Ga0496100_0049855_153_1046 | 290 |
| 429 | 3300048909 | Ga0496106_0027781 | Ga0496106_0027781_979_1872 | 290 |
| 430 | 3300048917 | Ga0496114_0016464 | Ga0496114_0016464_3430_4323 | 290 |
| 431 | 2162886007 | SwRhRL2b_contig_1599521 | SwRhRL2b_0027.00007310 | 291 |
| 432 | 2162886007 | SwRhRL2b_contig_3865623 | SwRhRL2b_0963.00005680 | 291 |
| 433 | 3300002774 | JGI25150J39212_1000015 | JGI25150J39212_10000152 | 291 |
| 434 | 3300003187 | JGI25151J46595_10000043 | JGI25151J46595_10000043132 | 291 |
| 435 | 3300003215 | JGI25153J46596_10000009 | JGI25153J46596_10000009145 | 291 |
| 436 | 3300003322 | rootL2_10001385 | rootL2_100013855 | 291 |
| 437 | 3300003322 | rootL2_10071161 | rootL2_100711611 | 291 |
| 438 | 3300003323 | rootH1_10008582 | rootH1_10008582145 | 291 |
| 439 | 3300003323 | rootH1_10025210 | rootH1_100252106 | 291 |
| 440 | 3300003354 | JGI25160J50197_1010888 | JGI25160J50197_10108882 | 291 |
| 441 | 3300003781 | Ga0055536_1000019 | Ga0055536_100001926 | 291 |
| 442 | 3300003791 | Ga0055530_10003660 | Ga0055530_100036605 | 291 |
| 443 | 3300003794 | Ga0055531_10000144 | Ga0055531_1000014456 | 291 |
| 444 | 3300003794 | Ga0055531_10000559 | Ga0055531_1000055928 | 291 |
| 445 | 3300005289 | Ga0065704_10002638 | Ga0065704_100026384 | 291 |
| 446 | 3300005289 | Ga0065704_10070962 | Ga0065704_100709624 | 291 |
| 447 | 3300005290 | Ga0065712_10082930 | Ga0065712_100829302 | 291 |
| 448 | 3300005290 | Ga0065712_10092198 | Ga0065712_100921981 | 291 |
| 449 | 3300005290 | Ga0065712_10143882 | Ga0065712_101438822 | 291 |
| 450 | 3300005290 | Ga0065712_10221579 | Ga0065712_102215791 | 291 |
| 451 | 3300005327 | Ga0070658_10033640 | Ga0070658_100336403 | 291 |
| 452 | 3300005328 | Ga0070676_10002554 | Ga0070676_100025545 | 291 |
| 453 | 3300005329 | Ga0070683_100002314 | Ga0070683_1000023143 | 291 |
| 454 | 3300005329 | Ga0070683_100049155 | Ga0070683_1000491552 | 291 |
| 455 | 3300005329 | Ga0070683_100050964 | Ga0070683_1000509642 | 291 |
| 456 | 3300005329 | Ga0070683_100179132 | Ga0070683_1001791322 | 291 |
| 457 | 3300005331 | Ga0070670_100027148 | Ga0070670_1000271486 | 291 |
| 458 | 3300005331 | Ga0070670_100066317 | Ga0070670_1000663172 | 291 |
| 459 | 3300005331 | Ga0070670_100120637 | Ga0070670_1001206372 | 291 |
| 460 | 3300005331 | Ga0070670_100141292 | Ga0070670_1001412922 | 291 |
| 461 | 3300005334 | Ga0068869_100036830 | Ga0068869_1000368302 | 291 |
| 462 | 3300005335 | Ga0070666_10000135 | Ga0070666_100001358 | 291 |
| 463 | 3300005335 | Ga0070666_10002025 | Ga0070666_100020254 | 291 |
| 464 | 3300005335 | Ga0070666_10002566 | Ga0070666_100025662 | 291 |
| 465 | 3300005335 | Ga0070666_10282195 | Ga0070666_102821952 | 291 |
| 466 | 3300005336 | Ga0070680_100019405 | Ga0070680_1000194054 | 291 |
| 467 | 3300005336 | Ga0070680_100420565 | Ga0070680_1004205652 | 291 |
| 468 | 3300005337 | Ga0070682_100019480 | Ga0070682_1000194803 | 291 |
| 469 | 3300005338 | Ga0068868_100000346 | Ga0068868_10000034617 | 291 |
| 470 | 3300005338 | Ga0068868_100023630 | Ga0068868_1000236303 | 291 |
| 471 | 3300005338 | Ga0068868_100023876 | Ga0068868_1000238762 | 291 |
| 472 | 3300005338 | Ga0068868_100123383 | Ga0068868_1001233832 | 291 |
| 473 | 3300005340 | Ga0070689_100045450 | Ga0070689_1000454502 | 291 |
| 474 | 3300005340 | Ga0070689_100096685 | Ga0070689_1000966851 | 291 |
| 475 | 3300005340 | Ga0070689_100153373 | Ga0070689_1001533731 | 291 |
| 476 | 3300005341 | Ga0070691_10002703 | Ga0070691_100027034 | 291 |
| 477 | 3300005341 | Ga0070691_10013653 | Ga0070691_100136533 | 291 |
| 478 | 3300005344 | Ga0070661_100000309 | Ga0070661_10000030935 | 291 |
| 479 | 3300005347 | Ga0070668_100001621 | Ga0070668_1000016217 | 291 |
| 480 | 3300005347 | Ga0070668_100118657 | Ga0070668_1001186572 | 291 |
| 481 | 3300005347 | Ga0070668_100309168 | Ga0070668_1003091682 | 291 |
| 482 | 3300005353 | Ga0070669_100001811 | Ga0070669_1000018113 | 291 |
| 483 | 3300005353 | Ga0070669_100026569 | Ga0070669_1000265691 | 291 |
| 484 | 3300005353 | Ga0070669_100273468 | Ga0070669_1002734682 | 291 |
| 485 | 3300005354 | Ga0070675_100025703 | Ga0070675_1000257034 | 291 |
| 486 | 3300005354 | Ga0070675_100029719 | Ga0070675_1000297193 | 291 |
| 487 | 3300005354 | Ga0070675_100045543 | Ga0070675_1000455433 | 291 |
| 488 | 3300005354 | Ga0070675_100058628 | Ga0070675_1000586283 | 291 |
| 489 | 3300005354 | Ga0070675_100103555 | Ga0070675_1001035552 | 291 |
| 490 | 3300005354 | Ga0070675_100134598 | Ga0070675_1001345984 | 291 |
| 491 | 3300005355 | Ga0070671_100044961 | Ga0070671_1000449612 | 291 |
| 492 | 3300005355 | Ga0070671_100304743 | Ga0070671_1003047431 | 291 |
| 493 | 3300005356 | Ga0070674_100075747 | Ga0070674_1000757473 | 291 |
| 494 | 3300005364 | Ga0070673_100012228 | Ga0070673_1000122285 | 291 |
| 495 | 3300005364 | Ga0070673_100035168 | Ga0070673_1000351681 | 291 |
| 496 | 3300005364 | Ga0070673_100085144 | Ga0070673_1000851441 | 291 |
| 497 | 3300005365 | Ga0070688_100000797 | Ga0070688_10000079710 | 291 |
| 498 | 3300005365 | Ga0070688_100010642 | Ga0070688_1000106424 | 291 |
| 499 | 3300005365 | Ga0070688_100093239 | Ga0070688_1000932392 | 291 |
| 500 | 3300005365 | Ga0070688_100115543 | Ga0070688_1001155433 | 291 |
| 501 | 3300005365 | Ga0070688_100152736 | Ga0070688_1001527362 | 291 |
| 502 | 3300005366 | Ga0070659_100027777 | Ga0070659_1000277772 | 291 |
| 503 | 3300005367 | Ga0070667_100001883 | Ga0070667_1000018837 | 291 |
| 504 | 3300005367 | Ga0070667_100022393 | Ga0070667_1000223932 | 291 |
| 505 | 3300005367 | Ga0070667_100038061 | Ga0070667_1000380613 | 291 |
| 506 | 3300005436 | Ga0070713_100125449 | Ga0070713_1001254492 | 291 |
| 507 | 3300005456 | Ga0070678_100068655 | Ga0070678_1000686553 | 291 |
| 508 | 3300005457 | Ga0070662_100040400 | Ga0070662_1000404003 | 291 |
| 509 | 3300005458 | Ga0070681_10037085 | Ga0070681_100370855 | 291 |
| 510 | 3300005458 | Ga0070681_10587577 | Ga0070681_105875771 | 291 |
| 511 | 3300005459 | Ga0068867_100014723 | Ga0068867_1000147236 | 291 |
| 512 | 3300005459 | Ga0068867_100082126 | Ga0068867_1000821262 | 291 |
| 513 | 3300005466 | Ga0070685_10004778 | Ga0070685_100047784 | 291 |
| 514 | 3300005466 | Ga0070685_10032145 | Ga0070685_100321452 | 291 |
| 515 | 3300005466 | Ga0070685_10131185 | Ga0070685_101311851 | 291 |
| 516 | 3300005471 | Ga0070698_100004441 | Ga0070698_1000044417 | 291 |
| 517 | 3300005471 | Ga0070698_100188834 | Ga0070698_1001888342 | 291 |
| 518 | 3300005471 | Ga0070698_100337335 | Ga0070698_1003373352 | 291 |
| 519 | 3300005530 | Ga0070679_100022452 | Ga0070679_1000224525 | 291 |
| 520 | 3300005535 | Ga0070684_100000823 | Ga0070684_10000082314 | 291 |
| 521 | 3300005535 | Ga0070684_100001699 | Ga0070684_1000016992 | 291 |
| 522 | 3300005535 | Ga0070684_100024327 | Ga0070684_1000243274 | 291 |
| 523 | 3300005535 | Ga0070684_100074493 | Ga0070684_1000744933 | 291 |
| 524 | 3300005535 | Ga0070684_100363490 | Ga0070684_1003634902 | 291 |
| 525 | 3300005539 | Ga0068853_100004185 | Ga0068853_1000041854 | 291 |
| 526 | 3300005539 | Ga0068853_100014984 | Ga0068853_1000149842 | 291 |
| 527 | 3300005539 | Ga0068853_100021323 | Ga0068853_1000213233 | 291 |
| 528 | 3300005539 | Ga0068853_100026820 | Ga0068853_1000268203 | 291 |
| 529 | 3300005543 | Ga0070672_100000840 | Ga0070672_1000008404 | 291 |
| 530 | 3300005548 | Ga0070665_100000001 | Ga0070665_100000001646 | 291 |
| 531 | 3300005548 | Ga0070665_100001766 | Ga0070665_1000017668 | 291 |
| 532 | 3300005563 | Ga0068855_100000089 | Ga0068855_10000008953 | 291 |
| 533 | 3300005563 | Ga0068855_100003029 | Ga0068855_1000030299 | 291 |
| 534 | 3300005563 | Ga0068855_100005857 | Ga0068855_10000585711 | 291 |
| 535 | 3300005563 | Ga0068855_100007823 | Ga0068855_1000078238 | 291 |
| 536 | 3300005563 | Ga0068855_100213189 | Ga0068855_1002131892 | 291 |
| 537 | 3300005564 | Ga0070664_100013649 | Ga0070664_1000136495 | 291 |
| 538 | 3300005564 | Ga0070664_100014161 | Ga0070664_1000141612 | 291 |
| 539 | 3300005564 | Ga0070664_100136174 | Ga0070664_1001361742 | 291 |
| 540 | 3300005564 | Ga0070664_100140932 | Ga0070664_1001409322 | 291 |
| 541 | 3300005564 | Ga0070664_100294277 | Ga0070664_1002942772 | 291 |
| 542 | 3300005577 | Ga0068857_100002744 | Ga0068857_1000027449 | 291 |
| 543 | 3300005577 | Ga0068857_100018587 | Ga0068857_1000185875 | 291 |
| 544 | 3300005578 | Ga0068854_100022883 | Ga0068854_1000228834 | 291 |
| 545 | 3300005578 | Ga0068854_100090956 | Ga0068854_1000909562 | 291 |
| 546 | 3300005614 | Ga0068856_100019556 | Ga0068856_1000195562 | 291 |
| 547 | 3300005614 | Ga0068856_100100991 | Ga0068856_1001009912 | 291 |
| 548 | 3300005615 | Ga0070702_100031741 | Ga0070702_1000317413 | 291 |
| 549 | 3300005616 | Ga0068852_100065071 | Ga0068852_1000650713 | 291 |
| 550 | 3300005616 | Ga0068852_100251633 | Ga0068852_1002516332 | 291 |
| 551 | 3300005617 | Ga0068859_100000127 | Ga0068859_10000012745 | 291 |
| 552 | 3300005617 | Ga0068859_100008901 | Ga0068859_1000089015 | 291 |
| 553 | 3300005617 | Ga0068859_100074856 | Ga0068859_1000748563 | 291 |
| 554 | 3300005617 | Ga0068859_100460630 | Ga0068859_1004606302 | 291 |
| 555 | 3300005617 | Ga0068859_100650379 | Ga0068859_1006503792 | 291 |
| 556 | 3300005618 | Ga0068864_100003469 | Ga0068864_1000034698 | 291 |
| 557 | 3300005618 | Ga0068864_100009571 | Ga0068864_1000095719 | 291 |
| 558 | 3300005618 | Ga0068864_100029379 | Ga0068864_1000293793 | 291 |
| 559 | 3300005618 | Ga0068864_100057779 | Ga0068864_1000577793 | 291 |
| 560 | 3300005618 | Ga0068864_100071253 | Ga0068864_1000712533 | 291 |
| 561 | 3300005618 | Ga0068864_100137455 | Ga0068864_1001374552 | 291 |
| 562 | 3300005618 | Ga0068864_100348222 | Ga0068864_1003482222 | 291 |
| 563 | 3300005618 | Ga0068864_100447387 | Ga0068864_1004473872 | 291 |
| 564 | 3300005718 | Ga0068866_10013596 | Ga0068866_100135963 | 291 |
| 565 | 3300005718 | Ga0068866_10110441 | Ga0068866_101104412 | 291 |
| 566 | 3300005719 | Ga0068861_100013626 | Ga0068861_1000136262 | 291 |
| 567 | 3300005719 | Ga0068861_100019242 | Ga0068861_1000192422 | 291 |
| 568 | 3300005719 | Ga0068861_100505641 | Ga0068861_1005056411 | 291 |
| 569 | 3300005834 | Ga0068851_10000010 | Ga0068851_100000109 | 291 |
| 570 | 3300005834 | Ga0068851_10000863 | Ga0068851_100008633 | 291 |
| 571 | 3300005841 | Ga0068863_100000546 | Ga0068863_1000005467 | 291 |
| 572 | 3300005841 | Ga0068863_100001425 | Ga0068863_1000014252 | 291 |
| 573 | 3300005841 | Ga0068863_100111487 | Ga0068863_1001114872 | 291 |
| 574 | 3300005841 | Ga0068863_100665499 | Ga0068863_1006654991 | 291 |
| 575 | 3300005842 | Ga0068858_100000505 | Ga0068858_10000050518 | 291 |
| 576 | 3300005842 | Ga0068858_100014075 | Ga0068858_1000140758 | 291 |
| 577 | 3300005842 | Ga0068858_100031927 | Ga0068858_1000319276 | 291 |
| 578 | 3300005842 | Ga0068858_100128362 | Ga0068858_1001283622 | 291 |
| 579 | 3300005843 | Ga0068860_100000111 | Ga0068860_10000011153 | 291 |
| 580 | 3300005843 | Ga0068860_100002119 | Ga0068860_10000211917 | 291 |
| 581 | 3300005843 | Ga0068860_100005385 | Ga0068860_1000053857 | 291 |
| 582 | 3300005843 | Ga0068860_100014120 | Ga0068860_1000141203 | 291 |
| 583 | 3300005843 | Ga0068860_100018651 | Ga0068860_1000186514 | 291 |
| 584 | 3300005844 | Ga0068862_100012975 | Ga0068862_1000129752 | 291 |
| 585 | 3300005985 | Ga0081539_10033663 | Ga0081539_100336633 | 291 |
| 586 | 3300006163 | Ga0070715_10049955 | Ga0070715_100499552 | 291 |
| 587 | 3300006195 | Ga0075366_10011952 | Ga0075366_100119522 | 291 |
| 588 | 3300006195 | Ga0075366_10079830 | Ga0075366_100798302 | 291 |
| 589 | 3300006237 | Ga0097621_100002660 | Ga0097621_1000026608 | 291 |
| 590 | 3300006237 | Ga0097621_100005487 | Ga0097621_1000054877 | 291 |
| 591 | 3300006237 | Ga0097621_100311840 | Ga0097621_1003118402 | 291 |
| 592 | 3300006358 | Ga0068871_100001377 | Ga0068871_1000013774 | 291 |
| 593 | 3300006358 | Ga0068871_100068598 | Ga0068871_1000685984 | 291 |
| 594 | 3300006844 | Ga0075428_100025699 | Ga0075428_1000256994 | 291 |
| 595 | 3300006880 | Ga0075429_100001604 | Ga0075429_1000016049 | 291 |
| 596 | 3300006880 | Ga0075429_100019706 | Ga0075429_1000197063 | 291 |
| 597 | 3300006881 | Ga0068865_100012416 | Ga0068865_1000124164 | 291 |
| 598 | 3300006931 | Ga0097620_100000127 | Ga0097620_10000012726 | 291 |
| 599 | 3300006931 | Ga0097620_100008901 | Ga0097620_1000089015 | 291 |
| 600 | 3300006931 | Ga0097620_100074860 | Ga0097620_1000748603 | 291 |
| 601 | 3300006931 | Ga0097620_100460665 | Ga0097620_1004606652 | 291 |
| 602 | 3300006931 | Ga0097620_100650420 | Ga0097620_1006504201 | 291 |
| 603 | 3300009093 | Ga0105240_10000074 | Ga0105240_1000007465 | 291 |
| 604 | 3300009093 | Ga0105240_10001630 | Ga0105240_1000163011 | 291 |
| 605 | 3300009093 | Ga0105240_10003016 | Ga0105240_1000301622 | 291 |
| 606 | 3300009093 | Ga0105240_10003457 | Ga0105240_1000345722 | 291 |
| 607 | 3300009093 | Ga0105240_10013866 | Ga0105240_100138668 | 291 |
| 608 | 3300009093 | Ga0105240_10036376 | Ga0105240_100363766 | 291 |
| 609 | 3300009093 | Ga0105240_10248840 | Ga0105240_102488402 | 291 |
| 610 | 3300009093 | Ga0105240_10270843 | Ga0105240_102708432 | 291 |
| 611 | 3300009093 | Ga0105240_10281100 | Ga0105240_102811002 | 291 |
| 612 | 3300009093 | Ga0105240_10296427 | Ga0105240_102964272 | 291 |
| 613 | 3300009094 | Ga0111539_10001795 | Ga0111539_1000179527 | 291 |
| 614 | 3300009094 | Ga0111539_10002481 | Ga0111539_100024812 | 291 |
| 615 | 3300009094 | Ga0111539_10096181 | Ga0111539_100961812 | 291 |
| 616 | 3300009094 | Ga0111539_10158671 | Ga0111539_101586711 | 291 |
| 617 | 3300009094 | Ga0111539_10295000 | Ga0111539_102950001 | 291 |
| 618 | 3300009094 | Ga0111539_10658699 | Ga0111539_106586992 | 291 |
| 619 | 3300009098 | Ga0105245_10137472 | Ga0105245_101374723 | 291 |
| 620 | 3300009101 | Ga0105247_10004365 | Ga0105247_100043656 | 291 |
| 621 | 3300009101 | Ga0105247_10032589 | Ga0105247_100325891 | 291 |
| 622 | 3300009147 | Ga0114129_10161864 | Ga0114129_101618643 | 291 |
| 623 | 3300009147 | Ga0114129_10164802 | Ga0114129_101648023 | 291 |
| 624 | 3300009147 | Ga0114129_10187296 | Ga0114129_101872963 | 291 |
| 625 | 3300009148 | Ga0105243_10000025 | Ga0105243_10000025107 | 291 |
| 626 | 3300009148 | Ga0105243_10352515 | Ga0105243_103525152 | 291 |
| 627 | 3300009174 | Ga0105241_10001018 | Ga0105241_100010184 | 291 |
| 628 | 3300009174 | Ga0105241_10001544 | Ga0105241_100015447 | 291 |
| 629 | 3300009174 | Ga0105241_10012092 | Ga0105241_100120927 | 291 |
| 630 | 3300009174 | Ga0105241_10114973 | Ga0105241_101149732 | 291 |
| 631 | 3300009174 | Ga0105241_10166860 | Ga0105241_101668602 | 291 |
| 632 | 3300009174 | Ga0105241_10251360 | Ga0105241_102513602 | 291 |
| 633 | 3300009176 | Ga0105242_10025247 | Ga0105242_100252474 | 291 |
| 634 | 3300009176 | Ga0105242_10307197 | Ga0105242_103071971 | 291 |
| 635 | 3300009177 | Ga0105248_10016149 | Ga0105248_100161492 | 291 |
| 636 | 3300009545 | Ga0105237_10001607 | Ga0105237_100016071 | 291 |
| 637 | 3300009545 | Ga0105237_10007044 | Ga0105237_100070442 | 291 |
| 638 | 3300009545 | Ga0105237_10013498 | Ga0105237_100134983 | 291 |
| 639 | 3300009545 | Ga0105237_10116470 | Ga0105237_101164702 | 291 |
| 640 | 3300009551 | Ga0105238_10001119 | Ga0105238_1000111912 | 291 |
| 641 | 3300009551 | Ga0105238_10045942 | Ga0105238_100459422 | 291 |
| 642 | 3300009551 | Ga0105238_10154232 | Ga0105238_101542322 | 291 |
| 643 | 3300009553 | Ga0105249_10002959 | Ga0105249_100029598 | 291 |
| 644 | 3300009553 | Ga0105249_10012344 | Ga0105249_100123444 | 291 |
| 645 | 3300009553 | Ga0105249_10021579 | Ga0105249_100215795 | 291 |
| 646 | 3300009553 | Ga0105249_10032963 | Ga0105249_100329632 | 291 |
| 647 | 3300009553 | Ga0105249_10037774 | Ga0105249_100377745 | 291 |
| 648 | 3300009553 | Ga0105249_10071328 | Ga0105249_100713282 | 291 |
| 649 | 3300009553 | Ga0105249_10119889 | Ga0105249_101198893 | 291 |
| 650 | 3300009553 | Ga0105249_10430901 | Ga0105249_104309012 | 291 |
| 651 | 3300010375 | Ga0105239_10000048 | Ga0105239_1000004819 | 291 |
| 652 | 3300010375 | Ga0105239_10000314 | Ga0105239_1000031424 | 291 |
| 653 | 3300010375 | Ga0105239_10000853 | Ga0105239_1000085322 | 291 |
| 654 | 3300010375 | Ga0105239_10007377 | Ga0105239_100073773 | 291 |
| 655 | 3300010375 | Ga0105239_10024795 | Ga0105239_100247955 | 291 |
| 656 | 3300010375 | Ga0105239_10044414 | Ga0105239_100444142 | 291 |
| 657 | 3300010375 | Ga0105239_10050569 | Ga0105239_100505694 | 291 |
| 658 | 3300010375 | Ga0105239_10062112 | Ga0105239_100621122 | 291 |
| 659 | 3300010375 | Ga0105239_10108921 | Ga0105239_101089212 | 291 |
| 660 | 3300010375 | Ga0105239_10171663 | Ga0105239_101716631 | 291 |
| 661 | 3300011119 | Ga0105246_10087613 | Ga0105246_100876131 | 291 |
| 662 | 3300013100 | Ga0157373_10008399 | Ga0157373_100083994 | 291 |
| 663 | 3300013100 | Ga0157373_10043290 | Ga0157373_100432901 | 291 |
| 664 | 3300013100 | Ga0157373_10046828 | Ga0157373_100468283 | 291 |
| 665 | 3300013100 | Ga0157373_10073914 | Ga0157373_100739142 | 291 |
| 666 | 3300013100 | Ga0157373_10191475 | Ga0157373_101914752 | 291 |
| 667 | 3300013102 | Ga0157371_10000037 | Ga0157371_10000037189 | 291 |
| 668 | 3300013102 | Ga0157371_10000220 | Ga0157371_1000022060 | 291 |
| 669 | 3300013102 | Ga0157371_10002087 | Ga0157371_100020879 | 291 |
| 670 | 3300013102 | Ga0157371_10002091 | Ga0157371_100020914 | 291 |
| 671 | 3300013102 | Ga0157371_10007834 | Ga0157371_100078344 | 291 |
| 672 | 3300013104 | Ga0157370_10001415 | Ga0157370_100014153 | 291 |
| 673 | 3300013104 | Ga0157370_10001827 | Ga0157370_1000182723 | 291 |
| 674 | 3300013104 | Ga0157370_10002234 | Ga0157370_100022349 | 291 |
| 675 | 3300013104 | Ga0157370_10006395 | Ga0157370_100063954 | 291 |
| 676 | 3300013104 | Ga0157370_10010736 | Ga0157370_100107363 | 291 |
| 677 | 3300013104 | Ga0157370_10010796 | Ga0157370_100107963 | 291 |
| 678 | 3300013104 | Ga0157370_10012412 | Ga0157370_100124124 | 291 |
| 679 | 3300013104 | Ga0157370_10016537 | Ga0157370_100165376 | 291 |
| 680 | 3300013104 | Ga0157370_10035920 | Ga0157370_100359203 | 291 |
| 681 | 3300013104 | Ga0157370_10041237 | Ga0157370_100412372 | 291 |
| 682 | 3300013104 | Ga0157370_10065890 | Ga0157370_100658903 | 291 |
| 683 | 3300013104 | Ga0157370_10468509 | Ga0157370_104685091 | 291 |
| 684 | 3300013105 | Ga0157369_10000031 | Ga0157369_10000031122 | 291 |
| 685 | 3300013105 | Ga0157369_10071400 | Ga0157369_100714004 | 291 |
| 686 | 3300013296 | Ga0157374_10000001 | Ga0157374_10000001282 | 291 |
| 687 | 3300013296 | Ga0157374_10024365 | Ga0157374_100243652 | 291 |
| 688 | 3300013296 | Ga0157374_10042435 | Ga0157374_100424351 | 291 |
| 689 | 3300013296 | Ga0157374_10067364 | Ga0157374_100673642 | 291 |
| 690 | 3300013296 | Ga0157374_10076000 | Ga0157374_100760003 | 291 |
| 691 | 3300013296 | Ga0157374_10097407 | Ga0157374_100974072 | 291 |
| 692 | 3300013297 | Ga0157378_10007196 | Ga0157378_100071968 | 291 |
| 693 | 3300013297 | Ga0157378_10036254 | Ga0157378_100362543 | 291 |
| 694 | 3300013297 | Ga0157378_10239054 | Ga0157378_102390542 | 291 |
| 695 | 3300013306 | Ga0163162_10000101 | Ga0163162_1000010114 | 291 |
| 696 | 3300013306 | Ga0163162_10000227 | Ga0163162_100002273 | 291 |
| 697 | 3300013306 | Ga0163162_10001177 | Ga0163162_100011775 | 291 |
| 698 | 3300013306 | Ga0163162_10006263 | Ga0163162_100062639 | 291 |
| 699 | 3300013306 | Ga0163162_10009506 | Ga0163162_100095067 | 291 |
| 700 | 3300013306 | Ga0163162_10012052 | Ga0163162_100120522 | 291 |
| 701 | 3300013306 | Ga0163162_10014268 | Ga0163162_100142688 | 291 |
| 702 | 3300013306 | Ga0163162_10015601 | Ga0163162_100156019 | 291 |
| 703 | 3300013306 | Ga0163162_10030170 | Ga0163162_100301703 | 291 |
| 704 | 3300013306 | Ga0163162_10498991 | Ga0163162_104989911 | 291 |
| 705 | 3300013306 | Ga0163162_10679652 | Ga0163162_106796522 | 291 |
| 706 | 3300013307 | Ga0157372_10000804 | Ga0157372_1000080422 | 291 |
| 707 | 3300013307 | Ga0157372_10099370 | Ga0157372_100993702 | 291 |
| 708 | 3300013307 | Ga0157372_10318581 | Ga0157372_103185812 | 291 |
| 709 | 3300013307 | Ga0157372_10394649 | Ga0157372_103946491 | 291 |
| 710 | 3300013307 | Ga0157372_10704924 | Ga0157372_107049241 | 291 |
| 711 | 3300013308 | Ga0157375_10004861 | Ga0157375_100048619 | 291 |
| 712 | 3300013308 | Ga0157375_10007692 | Ga0157375_100076924 | 291 |
| 713 | 3300013308 | Ga0157375_10015273 | Ga0157375_100152737 | 291 |
| 714 | 3300013308 | Ga0157375_10038711 | Ga0157375_100387112 | 291 |
| 715 | 3300013308 | Ga0157375_10104315 | Ga0157375_101043153 | 291 |
| 716 | 3300013308 | Ga0157375_10114211 | Ga0157375_101142113 | 291 |
| 717 | 3300014325 | Ga0163163_10001351 | Ga0163163_1000135120 | 291 |
| 718 | 3300014325 | Ga0163163_10002778 | Ga0163163_100027783 | 291 |
| 719 | 3300014325 | Ga0163163_10084057 | Ga0163163_100840571 | 291 |
| 720 | 3300014326 | Ga0157380_10001555 | Ga0157380_100015553 | 291 |
| 721 | 3300014497 | Ga0182008_10000572 | Ga0182008_1000057220 | 291 |
| 722 | 3300014745 | Ga0157377_10004058 | Ga0157377_100040585 | 291 |
| 723 | 3300014745 | Ga0157377_10005239 | Ga0157377_100052392 | 291 |
| 724 | 3300014968 | Ga0157379_10000536 | Ga0157379_100005368 | 291 |
| 725 | 3300014968 | Ga0157379_10045049 | Ga0157379_100450491 | 291 |
| 726 | 3300014968 | Ga0157379_10193488 | Ga0157379_101934882 | 291 |
| 727 | 3300014968 | Ga0157379_10259554 | Ga0157379_102595541 | 291 |
| 728 | 3300014969 | Ga0157376_10000697 | Ga0157376_100006978 | 291 |
| 729 | 3300014969 | Ga0157376_10000873 | Ga0157376_1000087312 | 291 |
| 730 | 3300014969 | Ga0157376_10001271 | Ga0157376_100012717 | 291 |
| 731 | 3300014969 | Ga0157376_10004501 | Ga0157376_100045014 | 291 |
| 732 | 3300014969 | Ga0157376_10077611 | Ga0157376_100776112 | 291 |
| 733 | 3300014969 | Ga0157376_10120246 | Ga0157376_101202462 | 291 |
| 734 | 3300014969 | Ga0157376_10286253 | Ga0157376_102862531 | 291 |
| 735 | 3300014969 | Ga0157376_10486400 | Ga0157376_104864001 | 291 |
| 736 | 3300015261 | Ga0182006_1000159 | Ga0182006_10001596 | 291 |
| 737 | 3300015261 | Ga0182006_1000237 | Ga0182006_100023716 | 291 |
| 738 | 3300015261 | Ga0182006_1002314 | Ga0182006_10023143 | 291 |
| 739 | 3300015262 | Ga0182007_10000002 | Ga0182007_10000002152 | 291 |
| 740 | 3300015265 | Ga0182005_1000091 | Ga0182005_100009123 | 291 |
| 741 | 3300015682 | Ga0183373_1004 | Ga0183373_1004325 | 291 |
| 742 | 3300017792 | Ga0163161_10002407 | Ga0163161_100024074 | 291 |
| 743 | 3300017792 | Ga0163161_10002660 | Ga0163161_100026606 | 291 |
| 744 | 3300017792 | Ga0163161_10006842 | Ga0163161_100068423 | 291 |
| 745 | 3300017792 | Ga0163161_10008268 | Ga0163161_100082682 | 291 |
| 746 | 3300017792 | Ga0163161_10020027 | Ga0163161_100200272 | 291 |
| 747 | 3300017792 | Ga0163161_10039109 | Ga0163161_100391094 | 291 |
| 748 | 3300017792 | Ga0163161_10047518 | Ga0163161_100475182 | 291 |
| 749 | 3300017792 | Ga0163161_10108403 | Ga0163161_101084032 | 291 |
| 750 | 3300021384 | Ga0213876_10001490 | Ga0213876_100014902 | 291 |
| 751 | 3300021384 | Ga0213876_10022436 | Ga0213876_100224362 | 291 |
| 752 | 3300025242 | Ga0209258_100081 | Ga0209258_100081149 | 291 |
| 753 | 3300025245 | Ga0207425_1000023 | Ga0207425_1000023144 | 291 |
| 754 | 3300025246 | Ga0209646_1001126 | Ga0209646_10011268 | 291 |
| 755 | 3300025254 | Ga0209148_1000202 | Ga0209148_100020287 | 291 |
| 756 | 3300025258 | Ga0209129_1000032 | Ga0209129_1000032129 | 291 |
| 757 | 3300025292 | Ga0209676_1000009 | Ga0209676_1000009154 | 291 |
| 758 | 3300025294 | Ga0209025_1000047 | Ga0209025_1000047129 | 291 |
| 759 | 3300025297 | Ga0209758_1000144 | Ga0209758_10001442 | 291 |
| 760 | 3300025298 | Ga0209050_1000094 | Ga0209050_1000094154 | 291 |
| 761 | 3300025302 | Ga0207426_1000093 | Ga0207426_100009354 | 291 |
| 762 | 3300025304 | Ga0209257_1000007 | Ga0209257_1000007509 | 291 |
| 763 | 3300025304 | Ga0209257_1000064 | Ga0209257_1000064184 | 291 |
| 764 | 3300025321 | Ga0207656_10000239 | Ga0207656_100002399 | 291 |
| 765 | 3300025893 | Ga0207682_10008876 | Ga0207682_100088762 | 291 |
| 766 | 3300025900 | Ga0207710_10006884 | Ga0207710_100068843 | 291 |
| 767 | 3300025903 | Ga0207680_10000057 | Ga0207680_100000576 | 291 |
| 768 | 3300025903 | Ga0207680_10003557 | Ga0207680_100035574 | 291 |
| 769 | 3300025903 | Ga0207680_10115000 | Ga0207680_101150002 | 291 |
| 770 | 3300025904 | Ga0207647_10006207 | Ga0207647_100062078 | 291 |
| 771 | 3300025907 | Ga0207645_10005567 | Ga0207645_100055672 | 291 |
| 772 | 3300025907 | Ga0207645_10084467 | Ga0207645_100844672 | 291 |
| 773 | 3300025909 | Ga0207705_10002909 | Ga0207705_100029094 | 291 |
| 774 | 3300025909 | Ga0207705_10077238 | Ga0207705_100772382 | 291 |
| 775 | 3300025911 | Ga0207654_10008022 | Ga0207654_100080222 | 291 |
| 776 | 3300025911 | Ga0207654_10040476 | Ga0207654_100404762 | 291 |
| 777 | 3300025911 | Ga0207654_10217055 | Ga0207654_102170551 | 291 |
| 778 | 3300025912 | Ga0207707_10000889 | Ga0207707_1000088924 | 291 |
| 779 | 3300025912 | Ga0207707_10496807 | Ga0207707_104968071 | 291 |
| 780 | 3300025913 | Ga0207695_10000071 | Ga0207695_10000071185 | 291 |
| 781 | 3300025913 | Ga0207695_10000323 | Ga0207695_100003234 | 291 |
| 782 | 3300025913 | Ga0207695_10016782 | Ga0207695_100167828 | 291 |
| 783 | 3300025913 | Ga0207695_10235724 | Ga0207695_102357242 | 291 |
| 784 | 3300025914 | Ga0207671_10003914 | Ga0207671_100039141 | 291 |
| 785 | 3300025914 | Ga0207671_10033095 | Ga0207671_100330952 | 291 |
| 786 | 3300025917 | Ga0207660_10006223 | Ga0207660_100062232 | 291 |
| 787 | 3300025918 | Ga0207662_10062713 | Ga0207662_100627132 | 291 |
| 788 | 3300025920 | Ga0207649_10025237 | Ga0207649_100252374 | 291 |
| 789 | 3300025921 | Ga0207652_10013482 | Ga0207652_100134827 | 291 |
| 790 | 3300025923 | Ga0207681_10046476 | Ga0207681_100464762 | 291 |
| 791 | 3300025923 | Ga0207681_10070425 | Ga0207681_100704251 | 291 |
| 792 | 3300025923 | Ga0207681_10127668 | Ga0207681_101276682 | 291 |
| 793 | 3300025924 | Ga0207694_10127546 | Ga0207694_101275462 | 291 |
| 794 | 3300025924 | Ga0207694_10156064 | Ga0207694_101560642 | 291 |
| 795 | 3300025925 | Ga0207650_10053098 | Ga0207650_100530983 | 291 |
| 796 | 3300025925 | Ga0207650_10122441 | Ga0207650_101224412 | 291 |
| 797 | 3300025925 | Ga0207650_10162935 | Ga0207650_101629352 | 291 |
| 798 | 3300025925 | Ga0207650_10182155 | Ga0207650_101821552 | 291 |
| 799 | 3300025926 | Ga0207659_10026032 | Ga0207659_100260322 | 291 |
| 800 | 3300025926 | Ga0207659_10080515 | Ga0207659_100805152 | 291 |
| 801 | 3300025926 | Ga0207659_10157167 | Ga0207659_101571674 | 291 |
| 802 | 3300025926 | Ga0207659_10179472 | Ga0207659_101794722 | 291 |
| 803 | 3300025932 | Ga0207690_10008110 | Ga0207690_100081104 | 291 |
| 804 | 3300025933 | Ga0207706_10003140 | Ga0207706_100031402 | 291 |
| 805 | 3300025933 | Ga0207706_10007966 | Ga0207706_100079668 | 291 |
| 806 | 3300025933 | Ga0207706_10137890 | Ga0207706_101378901 | 291 |
| 807 | 3300025934 | Ga0207686_10002939 | Ga0207686_100029397 | 291 |
| 808 | 3300025934 | Ga0207686_10024483 | Ga0207686_100244832 | 291 |
| 809 | 3300025935 | Ga0207709_10000003 | Ga0207709_10000003818 | 291 |
| 810 | 3300025935 | Ga0207709_10430942 | Ga0207709_104309421 | 291 |
| 811 | 3300025936 | Ga0207670_10012693 | Ga0207670_100126935 | 291 |
| 812 | 3300025936 | Ga0207670_10122717 | Ga0207670_101227172 | 291 |
| 813 | 3300025938 | Ga0207704_10030610 | Ga0207704_100306103 | 291 |
| 814 | 3300025938 | Ga0207704_10032633 | Ga0207704_100326333 | 291 |
| 815 | 3300025939 | Ga0207665_10120474 | Ga0207665_101204742 | 291 |
| 816 | 3300025940 | Ga0207691_10000228 | Ga0207691_1000022833 | 291 |
| 817 | 3300025940 | Ga0207691_10045382 | Ga0207691_100453823 | 291 |
| 818 | 3300025940 | Ga0207691_10050071 | Ga0207691_100500713 | 291 |
| 819 | 3300025940 | Ga0207691_10065740 | Ga0207691_100657402 | 291 |
| 820 | 3300025940 | Ga0207691_10136167 | Ga0207691_101361672 | 291 |
| 821 | 3300025940 | Ga0207691_10214535 | Ga0207691_102145351 | 291 |
| 822 | 3300025942 | Ga0207689_10000482 | Ga0207689_1000048211 | 291 |
| 823 | 3300025942 | Ga0207689_10005168 | Ga0207689_100051684 | 291 |
| 824 | 3300025942 | Ga0207689_10017098 | Ga0207689_100170984 | 291 |
| 825 | 3300025944 | Ga0207661_10021969 | Ga0207661_100219693 | 291 |
| 826 | 3300025944 | Ga0207661_10092105 | Ga0207661_100921052 | 291 |
| 827 | 3300025944 | Ga0207661_10109608 | Ga0207661_101096082 | 291 |
| 828 | 3300025945 | Ga0207679_10001675 | Ga0207679_100016752 | 291 |
| 829 | 3300025945 | Ga0207679_10004011 | Ga0207679_100040116 | 291 |
| 830 | 3300025945 | Ga0207679_10053294 | Ga0207679_100532942 | 291 |
| 831 | 3300025949 | Ga0207667_10000135 | Ga0207667_1000013560 | 291 |
| 832 | 3300025949 | Ga0207667_10000177 | Ga0207667_1000017768 | 291 |
| 833 | 3300025949 | Ga0207667_10013458 | Ga0207667_100134585 | 291 |
| 834 | 3300025949 | Ga0207667_10030139 | Ga0207667_100301394 | 291 |
| 835 | 3300025949 | Ga0207667_10357613 | Ga0207667_103576132 | 291 |
| 836 | 3300025949 | Ga0207667_10466872 | Ga0207667_104668722 | 291 |
| 837 | 3300025960 | Ga0207651_10015395 | Ga0207651_100153953 | 291 |
| 838 | 3300025960 | Ga0207651_10266004 | Ga0207651_102660041 | 291 |
| 839 | 3300025960 | Ga0207651_10331379 | Ga0207651_103313792 | 291 |
| 840 | 3300025961 | Ga0207712_10016682 | Ga0207712_100166824 | 291 |
| 841 | 3300025961 | Ga0207712_10043054 | Ga0207712_100430542 | 291 |
| 842 | 3300025961 | Ga0207712_10123402 | Ga0207712_101234022 | 291 |
| 843 | 3300025961 | Ga0207712_10176024 | Ga0207712_101760241 | 291 |
| 844 | 3300025972 | Ga0207668_10065915 | Ga0207668_100659151 | 291 |
| 845 | 3300025972 | Ga0207668_10111514 | Ga0207668_101115142 | 291 |
| 846 | 3300025972 | Ga0207668_10453301 | Ga0207668_104533012 | 291 |
| 847 | 3300025986 | Ga0207658_10008941 | Ga0207658_100089413 | 291 |
| 848 | 3300025986 | Ga0207658_10019785 | Ga0207658_100197852 | 291 |
| 849 | 3300025986 | Ga0207658_10037585 | Ga0207658_100375853 | 291 |
| 850 | 3300025986 | Ga0207658_10085379 | Ga0207658_100853792 | 291 |
| 851 | 3300025986 | Ga0207658_10180636 | Ga0207658_101806362 | 291 |
| 852 | 3300026023 | Ga0207677_10005483 | Ga0207677_100054838 | 291 |
| 853 | 3300026023 | Ga0207677_10078074 | Ga0207677_100780741 | 291 |
| 854 | 3300026035 | Ga0207703_10000924 | Ga0207703_100009248 | 291 |
| 855 | 3300026035 | Ga0207703_10011638 | Ga0207703_100116386 | 291 |
| 856 | 3300026035 | Ga0207703_10045798 | Ga0207703_100457982 | 291 |
| 857 | 3300026035 | Ga0207703_10372715 | Ga0207703_103727151 | 291 |
| 858 | 3300026035 | Ga0207703_10619095 | Ga0207703_106190952 | 291 |
| 859 | 3300026041 | Ga0207639_10013846 | Ga0207639_100138464 | 291 |
| 860 | 3300026041 | Ga0207639_10018848 | Ga0207639_100188483 | 291 |
| 861 | 3300026041 | Ga0207639_10061204 | Ga0207639_100612043 | 291 |
| 862 | 3300026041 | Ga0207639_10096563 | Ga0207639_100965633 | 291 |
| 863 | 3300026041 | Ga0207639_10246622 | Ga0207639_102466222 | 291 |
| 864 | 3300026041 | Ga0207639_10348741 | Ga0207639_103487412 | 291 |
| 865 | 3300026067 | Ga0207678_10077492 | Ga0207678_100774923 | 291 |
| 866 | 3300026078 | Ga0207702_10008334 | Ga0207702_100083343 | 291 |
| 867 | 3300026078 | Ga0207702_10158637 | Ga0207702_101586372 | 291 |
| 868 | 3300026088 | Ga0207641_10000229 | Ga0207641_1000022945 | 291 |
| 869 | 3300026088 | Ga0207641_10000539 | Ga0207641_100005398 | 291 |
| 870 | 3300026088 | Ga0207641_10013808 | Ga0207641_100138084 | 291 |
| 871 | 3300026088 | Ga0207641_10107505 | Ga0207641_101075053 | 291 |
| 872 | 3300026088 | Ga0207641_10126665 | Ga0207641_101266652 | 291 |
| 873 | 3300026089 | Ga0207648_10040383 | Ga0207648_100403835 | 291 |
| 874 | 3300026089 | Ga0207648_10053860 | Ga0207648_100538602 | 291 |
| 875 | 3300026089 | Ga0207648_10170550 | Ga0207648_101705502 | 291 |
| 876 | 3300026089 | Ga0207648_10487736 | Ga0207648_104877361 | 291 |
| 877 | 3300026095 | Ga0207676_10001997 | Ga0207676_100019976 | 291 |
| 878 | 3300026095 | Ga0207676_10003168 | Ga0207676_100031684 | 291 |
| 879 | 3300026095 | Ga0207676_10024749 | Ga0207676_100247493 | 291 |
| 880 | 3300026095 | Ga0207676_10119837 | Ga0207676_101198372 | 291 |
| 881 | 3300026095 | Ga0207676_10142717 | Ga0207676_101427172 | 291 |
| 882 | 3300026095 | Ga0207676_10184824 | Ga0207676_101848241 | 291 |
| 883 | 3300026095 | Ga0207676_10651554 | Ga0207676_106515541 | 291 |
| 884 | 3300026116 | Ga0207674_10016309 | Ga0207674_1001630910 | 291 |
| 885 | 3300026116 | Ga0207674_10025163 | Ga0207674_100251633 | 291 |
| 886 | 3300026116 | Ga0207674_10035928 | Ga0207674_100359281 | 291 |
| 887 | 3300026118 | Ga0207675_100000938 | Ga0207675_10000093818 | 291 |
| 888 | 3300026118 | Ga0207675_100071059 | Ga0207675_1000710592 | 291 |
| 889 | 3300026121 | Ga0207683_10026994 | Ga0207683_100269941 | 291 |
| 890 | 3300026121 | Ga0207683_10028296 | Ga0207683_100282963 | 291 |
| 891 | 3300026142 | Ga0207698_10014331 | Ga0207698_100143314 | 291 |
| 892 | 3300026142 | Ga0207698_10093884 | Ga0207698_100938842 | 291 |
| 893 | 3300026142 | Ga0207698_10438985 | Ga0207698_104389851 | 291 |
| 894 | 3300026142 | Ga0207698_10483855 | Ga0207698_104838551 | 291 |
| 895 | 3300027907 | Ga0207428_10158752 | Ga0207428_101587521 | 291 |
| 896 | 3300028379 | Ga0268266_10000049 | Ga0268266_100000497 | 291 |
| 897 | 3300028379 | Ga0268266_10005598 | Ga0268266_100055988 | 291 |
| 898 | 3300028379 | Ga0268266_10034011 | Ga0268266_100340113 | 291 |
| 899 | 3300028379 | Ga0268266_10145262 | Ga0268266_101452622 | 291 |
| 900 | 3300028381 | Ga0268264_10003106 | Ga0268264_100031064 | 291 |
| 901 | 3300028381 | Ga0268264_10007090 | Ga0268264_100070905 | 291 |
| 902 | 3300028381 | Ga0268264_10020419 | Ga0268264_100204194 | 291 |
| 903 | 3300028786 | Ga0307517_10003658 | Ga0307517_100036588 | 291 |
| 904 | 3300028794 | Ga0307515_10000009 | Ga0307515_10000009187 | 291 |
| 905 | 3300030521 | Ga0307511_10000276 | Ga0307511_1000027626 | 291 |
| 906 | 3300031251 | Ga0265327_10000148 | Ga0265327_10000148125 | 291 |
| 907 | 3300031251 | Ga0265327_10008831 | Ga0265327_100088313 | 291 |
| 908 | 3300031251 | Ga0265327_10091547 | Ga0265327_100915472 | 291 |
| 909 | 3300031251 | Ga0265327_10133319 | Ga0265327_101333192 | 291 |
| 910 | 3300031456 | Ga0307513_10061705 | Ga0307513_100617054 | 291 |
| 911 | 3300031456 | Ga0307513_10149923 | Ga0307513_101499231 | 291 |
| 912 | 3300031507 | Ga0307509_10043782 | Ga0307509_100437823 | 291 |
| 913 | 3300031507 | Ga0307509_10055932 | Ga0307509_100559323 | 291 |
| 914 | 3300031507 | Ga0307509_10063261 | Ga0307509_100632612 | 291 |
| 915 | 3300031595 | Ga0265313_10028202 | Ga0265313_100282022 | 291 |
| 916 | 3300031616 | Ga0307508_10003266 | Ga0307508_100032669 | 291 |
| 917 | 3300031649 | Ga0307514_10061041 | Ga0307514_100610412 | 291 |
| 918 | 3300031730 | Ga0307516_10001231 | Ga0307516_1000123130 | 291 |
| 919 | 3300031730 | Ga0307516_10007511 | Ga0307516_100075116 | 291 |
| 920 | 3300031731 | Ga0307405_10000015 | Ga0307405_1000001519 | 291 |
| 921 | 3300031903 | Ga0307407_10000031 | Ga0307407_1000003115 | 291 |
| 922 | 3300031911 | Ga0307412_10000049 | Ga0307412_1000004949 | 291 |
| 923 | 3300031995 | Ga0307409_100013894 | Ga0307409_1000138942 | 291 |
| 924 | 3300031995 | Ga0307409_100059433 | Ga0307409_1000594333 | 291 |
| 925 | 3300032002 | Ga0307416_100000002 | Ga0307416_100000002135 | 291 |
| 926 | 3300032002 | Ga0307416_100851260 | Ga0307416_1008512601 | 291 |
| 927 | 3300032004 | Ga0307414_10061057 | Ga0307414_100610573 | 291 |
| 928 | 3300032004 | Ga0307414_10411462 | Ga0307414_104114622 | 291 |
| 929 | 3300035086 | Ga0373934_0092268 | Ga0373934_0092268_274_1158 | 291 |
| 930 | 3300035116 | Ga0373945_0124358 | Ga0373945_0124358_36_914 | 291 |
| 931 | 3300035692 | Ga0373935_0091379 | Ga0373935_0091379_624_1508 | 291 |
| 932 | 3300035695 | Ga0373927_0207455 | Ga0373927_0207455_389_1267 | 291 |
| 933 | 3300035724 | Ga0373933_0042199 | Ga0373933_0042199_865_1749 | 291 |
| 934 | 3300036401 | Ga0373937_0096850 | Ga0373937_0096850_917_1801 | 291 |
| 935 | 3300036401 | Ga0373937_0321850 | Ga0373937_0321850_486_1361 | 291 |
| 936 | 3300039437 | Ga0436365_0763276 | Ga0436365_0763276_1535_2410 | 291 |
| 937 | 3300039437 | Ga0436365_1121511 | Ga0436365_1121511_8647_9522 | 291 |
| 938 | 3300039437 | Ga0436365_1214063 | Ga0436365_1214063_302_1177 | 291 |
| 939 | 3300039437 | Ga0436365_1871487 | Ga0436365_1871487_1031_1909 | 291 |
| 940 | 3300041404 | Ga0439436_0025603 | Ga0439436_0025603_141_1016 | 291 |
| 941 | 3300041406 | Ga0439439_0012722 | Ga0439439_0012722_581_1456 | 291 |
| 942 | 3300041406 | Ga0439439_0019014 | Ga0439439_0019014_710_1591 | 291 |
| 943 | 3300041413 | Ga0439465_0006087 | Ga0439465_0006087_201_1076 | 291 |
| 944 | 3300041512 | Ga0451853_1789420 | Ga0451853_1789420_1069_1944 | 291 |
| 945 | 3300042002 | Ga0439442_014100 | Ga0439442_014100_397_1278 | 291 |
| 946 | 3300042004 | Ga0439445_0063498 | Ga0439445_0063498_118_1002 | 291 |
| 947 | 3300042007 | Ga0439449_0016294 | Ga0439449_0016294_1009_1884 | 291 |
| 948 | 3300042007 | Ga0439449_0044809 | Ga0439449_0044809_607_1482 | 291 |
| 949 | 3300042007 | Ga0439449_0066030 | Ga0439449_0066030_72_947 | 291 |
| 950 | 3300042014 | Ga0439457_002393 | Ga0439457_002393_3231_4106 | 291 |
| 951 | 3300042015 | Ga0439462_0007027 | Ga0439462_0007027_719_1594 | 291 |
| 952 | 3300042156 | Ga0439446_0096903 | Ga0439446_0096903_33_917 | 291 |
| 953 | 3300042435 | Ga0439434_0002629 | Ga0439434_0002629_65_949 | 291 |
| 954 | 3300044656 | Ga0466969_0000921 | Ga0466969_0000921_695_1573 | 291 |
| 955 | 3300044656 | Ga0466969_0041570 | Ga0466969_0041570_1015_1893 | 291 |
| 956 | 3300044658 | Ga0466972_0000038 | Ga0466972_0000038_97217_98092 | 291 |
| 957 | 3300044658 | Ga0466972_0000055 | Ga0466972_0000055_13116_13991 | 291 |
| 958 | 3300044658 | Ga0466972_0062541 | Ga0466972_0062541_233_1159 | 291 |
| 959 | 3300044684 | Ga0466966_0010092 | Ga0466966_0010092_855_1733 | 291 |
| 960 | 3300044706 | Ga0466964_0011227 | Ga0466964_0011227_1598_2476 | 291 |
| 961 | 3300044706 | Ga0466964_0013406 | Ga0466964_0013406_787_1665 | 291 |
| 962 | 3300044712 | Ga0453684_0093866 | Ga0453684_0093866_2424_3299 | 291 |
| 963 | 3300044712 | Ga0453684_0262477 | Ga0453684_0262477_872_1747 | 291 |
| 964 | 3300044712 | Ga0453684_0413196 | Ga0453684_0413196_101_988 | 291 |
| 965 | 3300044735 | Ga0466968_0011055 | Ga0466968_0011055_2549_3427 | 291 |
| 966 | 3300044735 | Ga0466968_0063728 | Ga0466968_0063728_538_1413 | 291 |
| 967 | 3300044765 | Ga0466970_0000722 | Ga0466970_0000722_6677_7552 | 291 |
| 968 | 3300044842 | Ga0466957_0000186 | Ga0466957_0000186_5161_6126 | 291 |
| 969 | 3300044842 | Ga0466957_0002253 | Ga0466957_0002253_1684_2562 | 291 |
| 970 | 3300045049 | Ga0466959_0000157 | Ga0466959_0000157_11676_12554 | 291 |
| 971 | 3300045049 | Ga0466959_0006469 | Ga0466959_0006469_6328_7209 | 291 |
| 972 | 3300045051 | Ga0451576_0336454 | Ga0451576_0336454_37_918 | 291 |
| 973 | 3300046453 | Ga0495627_001652 | Ga0495627_001652_840_1715 | 291 |
| 974 | 3300046453 | Ga0495627_005399 | Ga0495627_005399_4225_5100 | 291 |
| 975 | 3300046457 | Ga0495590_0015436 | Ga0495590_0015436_508_1383 | 291 |
| 976 | 3300046459 | Ga0495629_0087417 | Ga0495629_0087417_707_1582 | 291 |
| 977 | 3300046460 | Ga0495638_0095177 | Ga0495638_0095177_851_1726 | 291 |
| 978 | 3300046460 | Ga0495638_0251708 | Ga0495638_0251708_40_915 | 291 |
| 979 | 3300046471 | Ga0495650_0134930 | Ga0495650_0134930_10_885 | 291 |
| 980 | 3300046501 | Ga0495607_0055009 | Ga0495607_0055009_610_1485 | 291 |
| 981 | 3300046507 | Ga0495606_0010339 | Ga0495606_0010339_738_1613 | 291 |
| 982 | 3300046507 | Ga0495606_0026073 | Ga0495606_0026073_2344_3219 | 291 |
| 983 | 3300046507 | Ga0495606_0032782 | Ga0495606_0032782_405_1280 | 291 |
| 984 | 3300046507 | Ga0495606_0068194 | Ga0495606_0068194_730_1605 | 291 |
| 985 | 3300046512 | Ga0495610_0001576 | Ga0495610_0001576_12090_12965 | 291 |
| 986 | 3300046512 | Ga0495610_0002315 | Ga0495610_0002315_11596_12471 | 291 |
| 987 | 3300046516 | Ga0495628_0105232 | Ga0495628_0105232_769_1653 | 291 |
| 988 | 3300046517 | Ga0495630_0007001 | Ga0495630_0007001_132_1016 | 291 |
| 989 | 3300046520 | Ga0495637_0046036 | Ga0495637_0046036_594_1469 | 291 |
| 990 | 3300046522 | Ga0495643_0000719 | Ga0495643_0000719_28772_29647 | 291 |
| 991 | 3300046522 | Ga0495643_0014997 | Ga0495643_0014997_152_1027 | 291 |
| 992 | 3300046529 | Ga0495652_0137274 | Ga0495652_0137274_476_1351 | 291 |
| 993 | 3300046536 | Ga0495587_0070088 | Ga0495587_0070088_929_1813 | 291 |
| 994 | 3300046536 | Ga0495587_0238841 | Ga0495587_0238841_18_893 | 291 |
| 995 | 3300046538 | Ga0495609_0000063 | Ga0495609_0000063_61333_62208 | 291 |
| 996 | 3300046558 | Ga0495633_0000123 | Ga0495633_0000123_91264_92139 | 291 |
| 997 | 3300046559 | Ga0495667_0076052 | Ga0495667_0076052_886_1770 | 291 |
| 998 | 3300046616 | Ga0495668_0241400 | Ga0495668_0241400_43_918 | 291 |
| 999 | 3300046642 | Ga0495634_0166336 | Ga0495634_0166336_429_1313 | 291 |
| 1000 | 3300046648 | Ga0495611_0010000 | Ga0495611_0010000_1419_2294 | 291 |
| 1001 | 3300046663 | Ga0495635_0253598 | Ga0495635_0253598_262_1137 | 291 |
| 1002 | 3300046679 | Ga0495623_0206754 | Ga0495623_0206754_171_1046 | 291 |
| 1003 | 3300046680 | Ga0495646_0088268 | Ga0495646_0088268_498_1382 | 291 |
| 1004 | 3300046683 | Ga0495658_0008440 | Ga0495658_0008440_256_1131 | 291 |
| 1005 | 3300046691 | Ga0495670_0025883 | Ga0495670_0025883_643_1518 | 291 |
| 1006 | 3300047315 | Ga0495581_0218718 | Ga0495581_0218718_14_1099 | 291 |
| 1007 | 3300047317 | Ga0495604_0105816 | Ga0495604_0105816_81_965 | 291 |
| 1008 | 3300047319 | Ga0495674_0034534 | Ga0495674_0034534_182_1057 | 291 |
| 1009 | 3300047319 | Ga0495674_0126667 | Ga0495674_0126667_49_933 | 291 |
| 1010 | 3300047320 | Ga0495672_0030543 | Ga0495672_0030543_1347_2225 | 291 |
| 1011 | 3300047320 | Ga0495672_0075161 | Ga0495672_0075161_164_1042 | 291 |
| 1012 | 3300047443 | Ga0495687_000001 | Ga0495687_000001_446791_447666 | 291 |
| 1013 | 3300047444 | Ga0495675_0274464 | Ga0495675_0274464_76_951 | 291 |
| 1014 | 3300047472 | Ga0495686_0000004 | Ga0495686_0000004_336291_337196 | 291 |
| 1015 | 3300047472 | Ga0495686_0052463 | Ga0495686_0052463_60_935 | 291 |
| 1016 | 3300048907 | Ga0496104_0279048 | Ga0496104_0279048_603_1487 | 291 |
| 1017 | 3300048907 | Ga0496104_0501552 | Ga0496104_0501552_179_1063 | 291 |
| 1018 | 3300048912 | Ga0496109_0044543 | Ga0496109_0044543_285_1160 | 291 |
| 1019 | 3300048913 | Ga0496110_0018044 | Ga0496110_0018044_3011_3895 | 291 |
| 1020 | 3300048917 | Ga0496114_0079330 | Ga0496114_0079330_1170_2054 | 291 |
| 1021 | 3300048918 | Ga0496115_0035249 | Ga0496115_0035249_2508_3383 | 291 |
| 1022 | 3300048918 | Ga0496115_0142278 | Ga0496115_0142278_788_1663 | 291 |
| 1023 | 3300048919 | Ga0496116_0004898 | Ga0496116_0004898_811_1686 | 291 |
| 1024 | 3300048921 | Ga0496118_0045690 | Ga0496118_0045690_2120_2995 | 291 |
| 1025 | 3300048924 | Ga0496121_0000011 | Ga0496121_0000011_400794_401669 | 291 |
| 1026 | 3300048925 | Ga0496122_0002605 | Ga0496122_0002605_9352_10227 | 291 |
| 1027 | 3300048926 | Ga0496123_0010356 | Ga0496123_0010356_2704_3579 | 291 |
| 1028 | 3300048927 | Ga0496124_0138676 | Ga0496124_0138676_181_1056 | 291 |
| 1029 | 3300048928 | Ga0496125_0000185 | Ga0496125_0000185_83137_84012 | 291 |
| 1030 | 3300048929 | Ga0496126_0177067 | Ga0496126_0177067_126_1001 | 291 |
| 1031 | 3300048929 | Ga0496126_0347944 | Ga0496126_0347944_218_1093 | 291 |
| 1032 | 3300049568 | Ga0501031_0014259 | Ga0501031_0014259_979_1857 | 291 |
| 1033 | 3300049570 | Ga0501033_0102622 | Ga0501033_0102622_318_1193 | 291 |
| 1034 | 3300049571 | Ga0501034_0012015 | Ga0501034_0012015_6930_7808 | 291 |
| 1035 | 3300049571 | Ga0501034_0058093 | Ga0501034_0058093_650_1525 | 291 |
| 1036 | 3300049571 | Ga0501034_0061631 | Ga0501034_0061631_1056_1931 | 291 |
| 1037 | 3300049571 | Ga0501034_0219801 | Ga0501034_0219801_756_1631 | 291 |
| 1038 | 3300049571 | Ga0501034_0291915 | Ga0501034_0291915_603_1478 | 291 |
| 1039 | 3300049571 | Ga0501034_0368685 | Ga0501034_0368685_13_888 | 291 |
| 1040 | 3300049572 | Ga0501036_0008645 | Ga0501036_0008645_7463_8341 | 291 |
| 1041 | 3300049573 | Ga0501037_0084518 | Ga0501037_0084518_1028_1906 | 291 |
| 1042 | 3300049573 | Ga0501037_0198426 | Ga0501037_0198426_470_1345 | 291 |
| 1043 | 3300049574 | Ga0501038_0022825 | Ga0501038_0022825_4430_5308 | 291 |
| 1044 | 3300049575 | Ga0501039_0119026 | Ga0501039_0119026_694_1572 | 291 |
| 1045 | 3300049579 | Ga0501043_0005210 | Ga0501043_0005210_8664_9542 | 291 |
| 1046 | 3300049579 | Ga0501043_0027182 | Ga0501043_0027182_957_1832 | 291 |
| 1047 | 3300049580 | Ga0501046_0006810 | Ga0501046_0006810_2509_3384 | 291 |
| 1048 | 3300049581 | Ga0501047_0006182 | Ga0501047_0006182_1667_2545 | 291 |
| 1049 | 3300049581 | Ga0501047_0019192 | Ga0501047_0019192_64_939 | 291 |
| 1050 | 3300049581 | Ga0501047_0043311 | Ga0501047_0043311_2280_3155 | 291 |
| 1051 | 3300049581 | Ga0501047_0154980 | Ga0501047_0154980_474_1352 | 291 |
| 1052 | 3300049581 | Ga0501047_0249186 | Ga0501047_0249186_734_1612 | 291 |
| 1053 | 3300049584 | Ga0501068_0035118 | Ga0501068_0035118_173_1051 | 291 |
| 1054 | 3300049588 | Ga0501072_0145354 | Ga0501072_0145354_554_1441 | 291 |
| 1055 | 3300049589 | Ga0501073_0001866 | Ga0501073_0001866_11028_11906 | 291 |
| 1056 | 3300049589 | Ga0501073_0105669 | Ga0501073_0105669_483_1370 | 291 |
| 1057 | 3300049589 | Ga0501073_0259380 | Ga0501073_0259380_35_910 | 291 |
| 1058 | 3300049590 | Ga0501074_0004312 | Ga0501074_0004312_8959_9837 | 291 |
| 1059 | 3300049654 | Ga0501207_004862 | Ga0501207_004862_594_1472 | 291 |
| 1060 | 3300049671 | Ga0501238_002917 | Ga0501238_002917_418_1296 | 291 |
| 1061 | 3300049677 | Ga0501247_001231 | Ga0501247_001231_1089_1967 | 291 |
| 1062 | 3300049683 | Ga0501253_004504 | Ga0501253_004504_398_1276 | 291 |
| 1063 | 3300049703 | Ga0501219_000052 | Ga0501219_000052_3838_4713 | 291 |
| 1064 | 3300049705 | Ga0501225_0000277 | Ga0501225_0000277_14355_15230 | 291 |
| 1065 | 3300049742 | Ga0501080_0044471 | Ga0501080_0044471_259_1137 | 291 |
| 1066 | 3300049742 | Ga0501080_0056933 | Ga0501080_0056933_1224_2102 | 291 |
| 1067 | 3300049742 | Ga0501080_0359626 | Ga0501080_0359626_36_911 | 291 |
| 1068 | 3300049758 | Ga0501241_003222 | Ga0501241_003222_1841_2716 | 291 |
| 1069 | 3300049761 | Ga0501264_000212 | Ga0501264_000212_2648_3526 | 291 |
| 1070 | 3300049775 | Ga0501279_002719 | Ga0501279_002719_1409_2284 | 291 |
| 1071 | 3300049822 | Ga0501035_0039835 | Ga0501035_0039835_2608_3486 | 291 |
| 1072 | 3300049822 | Ga0501035_0113305 | Ga0501035_0113305_1051_1929 | 291 |
| 1073 | 3300049823 | Ga0501044_0003551 | Ga0501044_0003551_7267_8145 | 291 |
| 1074 | 3300049823 | Ga0501044_0198740 | Ga0501044_0198740_559_1434 | 291 |
| 1075 | 3300050005 | Ga0501284_00029 | Ga0501284_00029_34283_35158 | 291 |
| 1076 | 3300050493 | nmdc:mga0k408_13677_c2 | nmdc:mga0k408_13677_c2_227_1102 | 291 |
| 1077 | 3300050493 | nmdc:mga0k408_227705_c1 | nmdc:mga0k408_227705_c1_78_953 | 291 |
| 1078 | 3300050493 | nmdc:mga0k408_2627_c1 | nmdc:mga0k408_2627_c1_830_1705 | 291 |
| 1079 | 3300050507 | nmdc:mga05p37_18450_c2 | nmdc:mga05p37_18450_c2_1641_2519 | 291 |
| 1080 | 3300050507 | nmdc:mga05p37_188731_c1 | nmdc:mga05p37_188731_c1_128_1003 | 291 |
| 1081 | 3300050508 | nmdc:mga09592_47012_c1 | nmdc:mga09592_47012_c1_2701_3576 | 291 |
| 1082 | 3300050510 | nmdc:mga06r32_303292_c1 | nmdc:mga06r32_303292_c1_402_1277 | 291 |
| 1083 | 3300050511 | nmdc:mga08y16_141552_c1 | nmdc:mga08y16_141552_c1_1025_1957 | 291 |
| 1084 | 3300050511 | nmdc:mga08y16_31053_c1 | nmdc:mga08y16_31053_c1_3876_4760 | 291 |
| 1085 | 3300050511 | nmdc:mga08y16_34280_c1 | nmdc:mga08y16_34280_c1_4248_5135 | 291 |
| 1086 | 3300050511 | nmdc:mga08y16_548386_c1 | nmdc:mga08y16_548386_c1_28_903 | 291 |
| 1087 | 3300050511 | nmdc:mga08y16_650243_c1 | nmdc:mga08y16_650243_c1_31_906 | 291 |
| 1088 | 3300053085 | Ga0495619_0105116 | Ga0495619_0105116_143_1027 | 291 |
| 1089 | 3300053085 | Ga0495619_0105762 | Ga0495619_0105762_496_1371 | 291 |
| 1090 | 3300053086 | Ga0500578_0000009 | Ga0500578_0000009_201199_202077 | 291 |
| 1091 | 3300053086 | Ga0500578_0132429 | Ga0500578_0132429_387_1262 | 291 |
| 1092 | 3300053088 | Ga0500644_0000035 | Ga0500644_0000035_56968_57918 | 291 |
| 1093 | 3300053088 | Ga0500644_0021498 | Ga0500644_0021498_430_1308 | 291 |
| 1094 | 3300053090 | Ga0500646_0011119 | Ga0500646_0011119_388_1311 | 291 |
| 1095 | 3300053090 | Ga0500646_0024757 | Ga0500646_0024757_234_1184 | 291 |
| 1096 | 3300053090 | Ga0500646_0038939 | Ga0500646_0038939_392_1267 | 291 |
| 1097 | 3300053092 | Ga0500583_0000147 | Ga0500583_0000147_3762_4637 | 291 |
| 1098 | 3300053092 | Ga0500583_0006066 | Ga0500583_0006066_540_1415 | 291 |
| 1099 | 3300053093 | Ga0500651_0003850 | Ga0500651_0003850_5656_6531 | 291 |
| 1100 | 3300053093 | Ga0500651_0014342 | Ga0500651_0014342_388_1263 | 291 |
| 1101 | 3300053096 | Ga0500641_0000081 | Ga0500641_0000081_4405_5316 | 291 |
| 1102 | 3300053108 | Ga0500562_000161 | Ga0500562_000161_11994_12872 | 291 |
| 1103 | 3300053108 | Ga0500562_040953 | Ga0500562_040953_302_1177 | 291 |
| 1104 | 3300053109 | Ga0500569_000486 | Ga0500569_000486_1804_2754 | 291 |
| 1105 | 3300053133 | Ga0500655_008823 | Ga0500655_008823_665_1615 | 291 |
| 1106 | 3300053134 | Ga0500658_0014621 | Ga0500658_0014621_1735_2685 | 291 |
| 1107 | 3300053137 | Ga0500561_0004593 | Ga0500561_0004593_602_1552 | 291 |
| 1108 | 3300053142 | Ga0500577_0000507 | Ga0500577_0000507_7390_8340 | 291 |
| 1109 | 3300053153 | Ga0500616_0000015 | Ga0500616_0000015_219237_220118 | 291 |
| 1110 | 3300053153 | Ga0500616_0052247 | Ga0500616_0052247_873_1748 | 291 |
| 1111 | 3300053153 | Ga0500616_0064751 | Ga0500616_0064751_453_1403 | 291 |
| 1112 | 3300053156 | Ga0500622_0000203 | Ga0500622_0000203_47419_48294 | 291 |
| 1113 | 3300053156 | Ga0500622_0027095 | Ga0500622_0027095_1359_2234 | 291 |
| 1114 | 3300053156 | Ga0500622_0027852 | Ga0500622_0027852_727_1602 | 291 |
| 1115 | 3300053156 | Ga0500622_0033407 | Ga0500622_0033407_1081_1956 | 291 |
| 1116 | 3300053160 | Ga0500633_0069739 | Ga0500633_0069739_100_1050 | 291 |
| 1117 | 3300053727 | Ga0500611_000006 | Ga0500611_000006_96008_96883 | 291 |
| 1118 | 3300053730 | Ga0500645_005960 | Ga0500645_005960_2214_3092 | 291 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5h8j-assembly1.cif.gz_H | crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with cadaverine | 0.9583 | 2 | 284 |
| 5h8j-assembly2.cif.gz_P | crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with cadaverine | 0.9578 | 2 | 280 |
| 6mg6-assembly2.cif.gz_C | crystal structure of carbon-nitrogen hydrolase from helicobacter pylori g27 | 0.956 | 3 | 286 |
| 5h8k-assembly1.cif.gz_H | crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) c158s mutant | 0.9558 | 2 | 280 |
| 6mg6-assembly2.cif.gz_D | crystal structure of carbon-nitrogen hydrolase from helicobacter pylori g27 | 0.955 | 2 | 283 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6mg6B00 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.96 | 3 | 283 | 3.60.110.10 |
| 5h8jH00 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.9583 | 2 | 284 | 3.60.110.10 |
| 1j31B00 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.9423 | 4 | 263 | 3.60.110.10 |
| af_O59829_1_271_3.60.110.10 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.9274 | 3 | 284 | 3.60.110.10 |
| 5h8jC00 | Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase | 0.9258 | 2 | 280 | 3.60.110.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5S3QQQ3-F1-model_v4 | deleted | 0.99 | 4 | 110 |
|
| AF-A0A519XWB5-F1-model_v4 | Carbon-nitrogen hydrolase | 0.9891 | 1 | 210 |
GO:0033388
GO:0050126 |
| AF-A0A6J4MZV2-F1-model_v4 | N-carbamoylputrescine amidase (EC 3.5.1.53) | 0.9867 | 11 | 181 |
GO:0033388
GO:0050126 |
| AF-A0A7C6MMM4-F1-model_v4 | deleted | 0.9822 | 6 | 235 |
|
| AF-A0A7V8SZN0-F1-model_v4 | Carbon-nitrogen hydrolase | 0.9807 | 6 | 251 |
GO:0033388
GO:0050126 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar