F490344

General Info

Members Datasets Scaffolds Average Seq Length
1118 398 1117 292

Family's Representative Sequence

Representative Sequence 3300032004|Ga0307414_10000608|Ga0307414_100006088
Length 359
Sequence MLLCTVGVGVLRWLAISIHCPLSFESFTKPIRYLGLVRKLNQYQIQELGLGLANRKSIFVSNSSKRSIVANKTVKVGLVQLSCSPDVAENMTKTIAGVREAAAKGAQVVVLQELFRSLYFCDVEDYENFKLAESIPGPSTETLGDLAKELGVVIVASLFEKRAEGLYHNTTAVLDADGTYLGKYRKMHIPDDPGYYEKFYFTPGDLGYKVFTTKFGNIGVLICWDQWYPEAARITALKGADFLVYPTAIGWHKDQAPDVNDEQYGAWQTIQRSHAVANGIPVVSVNRCGHEGDMKFWGGSFVANPFGRIIFKASHDEEQIHVEELDFAKSDQYRTHWPFLRDRRIDSYQPITKRFLDEE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
24 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
25 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
37 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
38 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
50 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
51 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
58 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
84 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
85 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
120 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
124 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
125 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
126 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
129 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
131 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
132 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
134 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
135 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
136 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
138 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
139 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
142 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
143 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
145 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
203 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
207 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
208 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
209 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
210 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
211 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
212 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
213 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
214 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
215 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
216 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
217 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
218 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
219 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
220 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
221 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
222 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
223 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
224 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
225 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
226 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
227 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
228 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
229 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
230 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
231 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
232 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
233 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
234 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
235 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
236 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
237 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
238 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
239 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
240 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
241 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
242 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
243 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
244 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
245 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
246 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
247 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
248 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
249 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
250 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
251 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
252 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
253 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
254 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
255 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
256 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
257 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
258 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
259 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
260 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
261 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
262 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
263 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
264 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
265 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
266 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
267 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
268 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
269 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
270 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
271 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
272 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
273 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
274 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
275 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
276 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
277 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
278 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
279 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
280 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
281 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
282 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
283 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
284 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
285 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
286 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
287 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
288 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
289 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
290 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
291 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
292 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
293 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
294 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
295 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
296 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
297 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
298 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
299 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
300 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
301 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
302 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
303 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
304 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
305 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
306 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
307 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
308 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
309 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
310 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
311 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
312 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
313 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
314 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
315 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
316 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
317 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
318 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
319 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
320 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
321 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
322 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
323 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
324 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
325 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
326 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
327 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
328 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
329 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
330 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
331 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
332 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
333 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
334 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
335 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
336 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
337 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
338 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
339 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
340 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
352 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
353 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
354 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
355 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
356 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
357 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
358 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
359 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
360 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
361 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
362 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
363 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
364 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
365 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
366 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
368 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
369 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
370 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
371 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
372 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
373 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
374 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
375 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
376 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
377 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
378 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
379 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
380 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
381 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
382 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
383 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
384 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
385 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
386 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
387 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
388 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
389 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
390 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
391 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
392 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
393 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
394 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
395 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
396 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
397 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
398 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0.09
Isolates 0.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.89
Nodule 0
Rhizoplane 0.98
Rhizosphere 88.1
Stem 0
Stem Tuber 0
Unclassified 4.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1599521 2162886007 Bacteria 4540
2 SwRhRL2b_contig_3865623 2162886007 Bacteria 4805
3 JGI24736J21556_1001800 3300001904 Bacteria 3847
4 JGI24737J22298_10001003 3300001990 Bacteria 9991
5 JGI24737J22298_10022757 3300001990 Bacteria 1991
6 JGI24735J21928_10000038 3300002067 Bacteria 64134
7 JGI24744J21845_10001880 3300002077 Bacteria 4219
8 JGI25162J39368_1000716 3300002737 Bacteria 22967
9 JGI25164J39214_1000601 3300002772 Bacteria 15724
10 JGI25150J39212_1000015 3300002774 Bacteria 170613
11 JGI25151J46595_10000043 3300003187 Bacteria 170613
12 JGI25165J46597_1000157 3300003214 Bacteria 108987
13 JGI25153J46596_10000009 3300003215 Bacteria 340925
14 rootH2_10002560 3300003320 Bacteria 75599
15 rootL2_10001385 3300003322 Bacteria 8933
16 rootL2_10071161 3300003322 Bacteria 1288
17 rootH1_10005851 3300003323 Bacteria 85811
18 rootH1_10007902 3300003323 Bacteria 8629
19 rootH1_10008582 3300003323 Bacteria 172664
20 rootH1_10025209 3300003323 Bacteria 3648
21 rootH1_10025210 3300003323 Bacteria 12643
22 rootH1_10061615 3300003323 Bacteria 2792
23 JGI25160J50197_1010888 3300003354 Bacteria 3260
24 Ga0055536_1000019 3300003781 Bacteria 203087
25 Ga0055530_10003660 3300003791 Bacteria 8598
26 Ga0055531_10000144 3300003794 Bacteria 82231
27 Ga0055531_10000559 3300003794 Bacteria 32705
28 Ga0058863_11478938 3300004799 Bacteria 2876
29 Ga0065165_1000470 3300005262 Bacteria 62866
30 Ga0065714_10006118 3300005288 Bacteria 5189
31 Ga0065714_10113088 3300005288 Bacteria 1446
32 Ga0065704_10002638 3300005289 Bacteria 8395
33 Ga0065704_10070962 3300005289 Bacteria 14215
34 Ga0065712_10082930 3300005290 Bacteria 2874
35 Ga0065712_10092198 3300005290 Bacteria 2340
36 Ga0065712_10143882 3300005290 Bacteria 1423
37 Ga0065712_10221579 3300005290 Bacteria 1039
38 Ga0065715_10218605 3300005293 Bacteria 1282
39 Ga0070658_10000014 3300005327 Bacteria 244978
40 Ga0070658_10033640 3300005327 Bacteria 4124
41 Ga0070658_10106653 3300005327 Bacteria 2318
42 Ga0070676_10000269 3300005328 Bacteria 22806
43 Ga0070676_10002554 3300005328 Bacteria 9358
44 Ga0070676_10022315 3300005328 Bacteria 3549
45 Ga0070683_100002314 3300005329 Bacteria 15105
46 Ga0070683_100016654 3300005329 Bacteria 6486
47 Ga0070683_100049155 3300005329 Bacteria 3900
48 Ga0070683_100050964 3300005329 Bacteria 3834
49 Ga0070683_100179132 3300005329 Bacteria 2012
50 Ga0070670_100027148 3300005331 Bacteria 4925
51 Ga0070670_100066317 3300005331 Bacteria 3097
52 Ga0070670_100120637 3300005331 Bacteria 2262
53 Ga0070670_100141292 3300005331 Bacteria 2082
54 Ga0068869_100018905 3300005334 Bacteria 4697
55 Ga0068869_100036830 3300005334 Bacteria 3475
56 Ga0068869_100046930 3300005334 Bacteria 3117
57 Ga0070666_10000135 3300005335 Bacteria 51126
58 Ga0070666_10002025 3300005335 Bacteria 12324
59 Ga0070666_10002566 3300005335 Bacteria 10980
60 Ga0070666_10282195 3300005335 Bacteria 1181
61 Ga0070680_100011377 3300005336 Bacteria 6882
62 Ga0070680_100019405 3300005336 Bacteria 5387
63 Ga0070680_100420565 3300005336 Bacteria 1140
64 Ga0070682_100019480 3300005337 Bacteria 3981
65 Ga0068868_100000346 3300005338 Bacteria 31447
66 Ga0068868_100023630 3300005338 Bacteria 4654
67 Ga0068868_100023876 3300005338 Bacteria 4633
68 Ga0068868_100074081 3300005338 Bacteria 2718
69 Ga0068868_100123383 3300005338 Bacteria 2114
70 Ga0070660_100033752 3300005339 Bacteria 3860
71 Ga0070689_100045450 3300005340 Bacteria 3382
72 Ga0070689_100063312 3300005340 Bacteria 2878
73 Ga0070689_100096685 3300005340 Bacteria 2335
74 Ga0070689_100153373 3300005340 Bacteria 1859
75 Ga0070691_10002703 3300005341 Bacteria 7902
76 Ga0070691_10013653 3300005341 Bacteria 3723
77 Ga0070691_10102297 3300005341 Bacteria 1424
78 Ga0070687_100029219 3300005343 Bacteria 2682
79 Ga0070661_100000309 3300005344 Bacteria 39394
80 Ga0070668_100001621 3300005347 Bacteria 16276
81 Ga0070668_100118657 3300005347 Bacteria 2112
82 Ga0070668_100309168 3300005347 Bacteria 1328
83 Ga0070669_100001811 3300005353 Bacteria 15389
84 Ga0070669_100026569 3300005353 Bacteria 4165
85 Ga0070669_100273468 3300005353 Bacteria 1351
86 Ga0070669_100332853 3300005353 Bacteria 1229
87 Ga0070675_100025703 3300005354 Bacteria 4721
88 Ga0070675_100029719 3300005354 Bacteria 4409
89 Ga0070675_100045543 3300005354 Bacteria 3590
90 Ga0070675_100058628 3300005354 Bacteria 3176
91 Ga0070675_100103555 3300005354 Bacteria 2400
92 Ga0070675_100134598 3300005354 Bacteria 2108
93 Ga0070675_100185362 3300005354 Bacteria 1801
94 Ga0070671_100008005 3300005355 Bacteria 8461
95 Ga0070671_100014610 3300005355 Bacteria 6349
96 Ga0070671_100044961 3300005355 Bacteria 3669
97 Ga0070671_100080801 3300005355 Bacteria 2718
98 Ga0070671_100190925 3300005355 Bacteria 1736
99 Ga0070671_100304743 3300005355 Bacteria 1356
100 Ga0070674_100001154 3300005356 Bacteria 13918
101 Ga0070674_100075747 3300005356 Bacteria 2391
102 Ga0070673_100003206 3300005364 Bacteria 10139
103 Ga0070673_100012228 3300005364 Bacteria 5887
104 Ga0070673_100033392 3300005364 Bacteria 3885
105 Ga0070673_100035168 3300005364 Bacteria 3796
106 Ga0070673_100085144 3300005364 Bacteria 2572
107 Ga0070688_100000797 3300005365 Bacteria 15547
108 Ga0070688_100010642 3300005365 Bacteria 5080
109 Ga0070688_100093239 3300005365 Bacteria 1972
110 Ga0070688_100112317 3300005365 Bacteria 1814
111 Ga0070688_100115543 3300005365 Bacteria 1791
112 Ga0070688_100152736 3300005365 Bacteria 1580
113 Ga0070659_100000107 3300005366 Bacteria 61453
114 Ga0070659_100027777 3300005366 Bacteria 4363
115 Ga0070667_100001883 3300005367 Bacteria 18625
116 Ga0070667_100022393 3300005367 Bacteria 5241
117 Ga0070667_100038061 3300005367 Bacteria 4033
118 Ga0070713_100125449 3300005436 Bacteria 2257
119 Ga0070705_100000614 3300005440 Bacteria 20625
120 Ga0070700_100274053 3300005441 Bacteria 1220
121 Ga0070663_100109107 3300005455 Bacteria 2077
122 Ga0070678_100068655 3300005456 Bacteria 2643
123 Ga0070678_100267669 3300005456 Bacteria 1440
124 Ga0070662_100000192 3300005457 Bacteria 35614
125 Ga0070662_100040400 3300005457 Bacteria 3321
126 Ga0070662_100131336 3300005457 Bacteria 1931
127 Ga0070662_100231604 3300005457 Bacteria 1478
128 Ga0070681_10022138 3300005458 Bacteria 6378
129 Ga0070681_10037085 3300005458 Bacteria 4893
130 Ga0070681_10587577 3300005458 Bacteria 1028
131 Ga0068867_100004996 3300005459 Bacteria 9349
132 Ga0068867_100006330 3300005459 Bacteria 8375
133 Ga0068867_100014723 3300005459 Bacteria 5543
134 Ga0068867_100058992 3300005459 Bacteria 2844
135 Ga0068867_100082126 3300005459 Bacteria 2430
136 Ga0068867_100085784 3300005459 Bacteria 2381
137 Ga0068867_100093402 3300005459 Bacteria 2286
138 Ga0070685_10004778 3300005466 Bacteria 6862
139 Ga0070685_10032145 3300005466 Bacteria 2938
140 Ga0070685_10131185 3300005466 Bacteria 1567
141 Ga0070698_100002401 3300005471 Bacteria 20622
142 Ga0070698_100004441 3300005471 Bacteria 15416
143 Ga0070698_100188834 3300005471 Bacteria 1998
144 Ga0070698_100337335 3300005471 Bacteria 1439
145 Ga0070679_100022452 3300005530 Bacteria 6166
146 Ga0070679_100033714 3300005530 Bacteria 5070
147 Ga0070679_100036558 3300005530 Bacteria 4873
148 Ga0070684_100000823 3300005535 Bacteria 21717
149 Ga0070684_100001699 3300005535 Bacteria 16028
150 Ga0070684_100024327 3300005535 Bacteria 5079
151 Ga0070684_100074493 3300005535 Bacteria 2992
152 Ga0070684_100363490 3300005535 Bacteria 1332
153 Ga0068853_100004185 3300005539 Bacteria 11126
154 Ga0068853_100009749 3300005539 Bacteria 7747
155 Ga0068853_100014984 3300005539 Bacteria 6369
156 Ga0068853_100021323 3300005539 Bacteria 5401
157 Ga0068853_100026820 3300005539 Bacteria 4840
158 Ga0068853_100075071 3300005539 Bacteria 2950
159 Ga0068853_100081876 3300005539 Bacteria 2827
160 Ga0068853_100086863 3300005539 Bacteria 2743
161 Ga0070672_100000840 3300005543 Bacteria 18390
162 Ga0070672_100031360 3300005543 Bacteria 3999
163 Ga0070686_100029354 3300005544 Bacteria 3345
164 Ga0070696_100008024 3300005546 Bacteria 7053
165 Ga0070665_100000001 3300005548 Bacteria 1083363
166 Ga0070665_100001766 3300005548 Bacteria 24650
167 Ga0070704_100020577 3300005549 Bacteria 4257
168 Ga0068855_100000089 3300005563 Bacteria 110845
169 Ga0068855_100003029 3300005563 Bacteria 20562
170 Ga0068855_100005857 3300005563 Bacteria 15001
171 Ga0068855_100007823 3300005563 Bacteria 12912
172 Ga0068855_100009170 3300005563 Bacteria 11950
173 Ga0068855_100081580 3300005563 Bacteria 3749
174 Ga0068855_100213189 3300005563 Bacteria 2169
175 Ga0068855_100226227 3300005563 Bacteria 2096
176 Ga0070664_100013649 3300005564 Bacteria 6620
177 Ga0070664_100014161 3300005564 Bacteria 6505
178 Ga0070664_100020475 3300005564 Bacteria 5447
179 Ga0070664_100136174 3300005564 Bacteria 2160
180 Ga0070664_100140932 3300005564 Bacteria 2123
181 Ga0070664_100294277 3300005564 Bacteria 1466
182 Ga0068857_100002744 3300005577 Bacteria 14466
183 Ga0068857_100018587 3300005577 Bacteria 6098
184 Ga0068857_100023085 3300005577 Bacteria 5472
185 Ga0068854_100022883 3300005578 Bacteria 4263
186 Ga0068854_100032235 3300005578 Bacteria 3644
187 Ga0068854_100036834 3300005578 Bacteria 3431
188 Ga0068854_100090956 3300005578 Bacteria 2270
189 Ga0068856_100000104 3300005614 Bacteria 81872
190 Ga0068856_100019556 3300005614 Bacteria 6574
191 Ga0068856_100100991 3300005614 Bacteria 2878
192 Ga0070702_100019598 3300005615 Bacteria 3532
193 Ga0070702_100031741 3300005615 Bacteria 2893
194 Ga0070702_100060720 3300005615 Bacteria 2199
195 Ga0068852_100002279 3300005616 Bacteria 13188
196 Ga0068852_100065071 3300005616 Bacteria 3180
197 Ga0068852_100251633 3300005616 Bacteria 1693
198 Ga0068852_100267830 3300005616 Bacteria 1643
199 Ga0068859_100000127 3300005617 Bacteria 72136
200 Ga0068859_100008901 3300005617 Bacteria 10134
201 Ga0068859_100020688 3300005617 Bacteria 6603
202 Ga0068859_100074856 3300005617 Bacteria 3425
203 Ga0068859_100460630 3300005617 Bacteria 1367
204 Ga0068859_100650379 3300005617 Bacteria 1146
205 Ga0068864_100003469 3300005618 Bacteria 13020
206 Ga0068864_100009571 3300005618 Bacteria 7990
207 Ga0068864_100029379 3300005618 Bacteria 4655
208 Ga0068864_100057779 3300005618 Bacteria 3352
209 Ga0068864_100071253 3300005618 Bacteria 3026
210 Ga0068864_100137455 3300005618 Bacteria 2202
211 Ga0068864_100348222 3300005618 Bacteria 1397
212 Ga0068864_100447387 3300005618 Bacteria 1235
213 Ga0068866_10000672 3300005718 Bacteria 15505
214 Ga0068866_10013596 3300005718 Bacteria 3576
215 Ga0068866_10110441 3300005718 Bacteria 1533
216 Ga0068861_100013626 3300005719 Bacteria 5692
217 Ga0068861_100016204 3300005719 Bacteria 5269
218 Ga0068861_100019242 3300005719 Bacteria 4878
219 Ga0068861_100033474 3300005719 Bacteria 3791
220 Ga0068861_100505641 3300005719 Bacteria 1093
221 Ga0068851_10000010 3300005834 Bacteria 202121
222 Ga0068851_10000863 3300005834 Bacteria 13044
223 Ga0068851_10121257 3300005834 Bacteria 1405
224 Ga0068863_100000546 3300005841 Bacteria 38297
225 Ga0068863_100001425 3300005841 Bacteria 23686
226 Ga0068863_100023248 3300005841 Bacteria 5924
227 Ga0068863_100111487 3300005841 Bacteria 2606
228 Ga0068863_100665499 3300005841 Bacteria 1033
229 Ga0068858_100000505 3300005842 Bacteria 40920
230 Ga0068858_100014075 3300005842 Bacteria 7544
231 Ga0068858_100031927 3300005842 Bacteria 4892
232 Ga0068858_100128362 3300005842 Bacteria 2376
233 Ga0068860_100000111 3300005843 Bacteria 131004
234 Ga0068860_100002119 3300005843 Bacteria 20918
235 Ga0068860_100005385 3300005843 Bacteria 12986
236 Ga0068860_100014120 3300005843 Bacteria 7833
237 Ga0068860_100018651 3300005843 Bacteria 6747
238 Ga0068860_100023982 3300005843 Bacteria 5897
239 Ga0068860_100036960 3300005843 Bacteria 4676
240 Ga0068862_100012975 3300005844 Bacteria 6891
241 Ga0081539_10033663 3300005985 Bacteria 3115
242 Ga0070715_10049955 3300006163 Bacteria 1794
243 Ga0075366_10004074 3300006195 Bacteria 7812
244 Ga0075366_10006278 3300006195 Bacteria 6501
245 Ga0075366_10011952 3300006195 Bacteria 4916
246 Ga0075366_10079830 3300006195 Bacteria 1954
247 Ga0097621_100000579 3300006237 Bacteria 25795
248 Ga0097621_100000586 3300006237 Bacteria 25626
249 Ga0097621_100002660 3300006237 Bacteria 12228
250 Ga0097621_100005487 3300006237 Bacteria 8933
251 Ga0097621_100039231 3300006237 Bacteria 3803
252 Ga0097621_100055070 3300006237 Bacteria 3247
253 Ga0097621_100311840 3300006237 Bacteria 1392
254 Ga0075370_10168223 3300006353 Bacteria 1288
255 Ga0068871_100000212 3300006358 Bacteria 40531
256 Ga0068871_100001377 3300006358 Bacteria 16266
257 Ga0068871_100001603 3300006358 Bacteria 15221
258 Ga0068871_100068598 3300006358 Bacteria 2912
259 Ga0075428_100011915 3300006844 Bacteria 9673
260 Ga0075428_100025699 3300006844 Bacteria 6520
261 Ga0075428_100180137 3300006844 Bacteria 2288
262 Ga0075431_100262683 3300006847 Bacteria 1751
263 Ga0075429_100001604 3300006880 Bacteria 18651
264 Ga0075429_100019706 3300006880 Bacteria 5848
265 Ga0068865_100000264 3300006881 Bacteria 28723
266 Ga0068865_100003908 3300006881 Bacteria 8938
267 Ga0068865_100012416 3300006881 Bacteria 5361
268 Ga0097620_100000127 3300006931 Bacteria 72136
269 Ga0097620_100008901 3300006931 Bacteria 10134
270 Ga0097620_100020689 3300006931 Bacteria 6603
271 Ga0097620_100074860 3300006931 Bacteria 3425
272 Ga0097620_100460665 3300006931 Bacteria 1367
273 Ga0097620_100650420 3300006931 Bacteria 1146
274 Ga0105240_10000074 3300009093 Bacteria 199611
275 Ga0105240_10000104 3300009093 Bacteria 172082
276 Ga0105240_10001630 3300009093 Bacteria 38080
277 Ga0105240_10003016 3300009093 Bacteria 26478
278 Ga0105240_10003457 3300009093 Bacteria 24509
279 Ga0105240_10013866 3300009093 Bacteria 11038
280 Ga0105240_10036376 3300009093 Bacteria 6335
281 Ga0105240_10063866 3300009093 Bacteria 4578
282 Ga0105240_10070596 3300009093 Bacteria 4321
283 Ga0105240_10094488 3300009093 Bacteria 3647
284 Ga0105240_10248840 3300009093 Bacteria 2057
285 Ga0105240_10270843 3300009093 Bacteria 1955
286 Ga0105240_10281100 3300009093 Bacteria 1912
287 Ga0105240_10296427 3300009093 Bacteria 1851
288 Ga0105240_10505637 3300009093 Bacteria 1343
289 Ga0111539_10001795 3300009094 Bacteria 28548
290 Ga0111539_10002481 3300009094 Bacteria 24471
291 Ga0111539_10096181 3300009094 Bacteria 3478
292 Ga0111539_10158671 3300009094 Bacteria 2646
293 Ga0111539_10295000 3300009094 Bacteria 1887
294 Ga0111539_10658699 3300009094 Bacteria 1219
295 Ga0105245_10137472 3300009098 Bacteria 2298
296 Ga0105245_10230596 3300009098 Bacteria 1791
297 Ga0105245_10679797 3300009098 Bacteria 1061
298 Ga0105247_10004365 3300009101 Bacteria 9034
299 Ga0105247_10032589 3300009101 Bacteria 3166
300 Ga0114129_10161864 3300009147 Bacteria 3056
301 Ga0114129_10164802 3300009147 Bacteria 3026
302 Ga0114129_10187296 3300009147 Bacteria 2812
303 Ga0105243_10000025 3300009148 Bacteria 193732
304 Ga0105243_10002943 3300009148 Bacteria 14082
305 Ga0105243_10024433 3300009148 Bacteria 4609
306 Ga0105243_10352515 3300009148 Bacteria 1352
307 Ga0105241_10000609 3300009174 Bacteria 26925
308 Ga0105241_10001018 3300009174 Bacteria 21338
309 Ga0105241_10001544 3300009174 Bacteria 17662
310 Ga0105241_10009620 3300009174 Bacteria 7102
311 Ga0105241_10012092 3300009174 Bacteria 6339
312 Ga0105241_10030901 3300009174 Bacteria 4006
313 Ga0105241_10114973 3300009174 Bacteria 2159
314 Ga0105241_10166860 3300009174 Bacteria 1815
315 Ga0105241_10251360 3300009174 Bacteria 1499
316 Ga0105241_10267191 3300009174 Bacteria 1456
317 Ga0105242_10025247 3300009176 Bacteria 4701
318 Ga0105242_10027904 3300009176 Bacteria 4488
319 Ga0105242_10039161 3300009176 Bacteria 3814
320 Ga0105242_10059231 3300009176 Bacteria 3141
321 Ga0105242_10307197 3300009176 Bacteria 1450
322 Ga0105248_10016149 3300009177 Bacteria 8216
323 Ga0105248_10185760 3300009177 Bacteria 2342
324 Ga0105237_10001427 3300009545 Bacteria 31582
325 Ga0105237_10001607 3300009545 Bacteria 29352
326 Ga0105237_10002980 3300009545 Bacteria 20473
327 Ga0105237_10003047 3300009545 Bacteria 20209
328 Ga0105237_10007044 3300009545 Bacteria 12367
329 Ga0105237_10011278 3300009545 Bacteria 9456
330 Ga0105237_10013498 3300009545 Bacteria 8560
331 Ga0105237_10116470 3300009545 Bacteria 2665
332 Ga0105237_10172316 3300009545 Bacteria 2164
333 Ga0105237_10186160 3300009545 Bacteria 2076
334 Ga0105238_10001119 3300009551 Bacteria 27090
335 Ga0105238_10045942 3300009551 Bacteria 4410
336 Ga0105238_10058908 3300009551 Bacteria 3849
337 Ga0105238_10154232 3300009551 Bacteria 2271
338 Ga0105249_10002959 3300009553 Bacteria 14658
339 Ga0105249_10008693 3300009553 Bacteria 8851
340 Ga0105249_10012344 3300009553 Bacteria 7527
341 Ga0105249_10021579 3300009553 Bacteria 5765
342 Ga0105249_10032963 3300009553 Bacteria 4688
343 Ga0105249_10037774 3300009553 Bacteria 4382
344 Ga0105249_10044140 3300009553 Bacteria 4054
345 Ga0105249_10071328 3300009553 Bacteria 3209
346 Ga0105249_10119889 3300009553 Bacteria 2499
347 Ga0105249_10430901 3300009553 Bacteria 1354
348 Ga0105239_10000007 3300010375 Bacteria 385297
349 Ga0105239_10000015 3300010375 Bacteria 319892
350 Ga0105239_10000048 3300010375 Bacteria 177855
351 Ga0105239_10000314 3300010375 Bacteria 71313
352 Ga0105239_10000853 3300010375 Bacteria 43358
353 Ga0105239_10000864 3300010375 Bacteria 43048
354 Ga0105239_10007377 3300010375 Bacteria 12632
355 Ga0105239_10024795 3300010375 Bacteria 6607
356 Ga0105239_10030338 3300010375 Bacteria 5944
357 Ga0105239_10044414 3300010375 Bacteria 4872
358 Ga0105239_10050569 3300010375 Bacteria 4558
359 Ga0105239_10059237 3300010375 Bacteria 4203
360 Ga0105239_10062112 3300010375 Bacteria 4101
361 Ga0105239_10069962 3300010375 Bacteria 3854
362 Ga0105239_10097637 3300010375 Bacteria 3247
363 Ga0105239_10108921 3300010375 Bacteria 3069
364 Ga0105239_10171663 3300010375 Bacteria 2425
365 Ga0105239_10335541 3300010375 Bacteria 1706
366 Ga0105246_10010437 3300011119 Bacteria 5748
367 Ga0105246_10087613 3300011119 Bacteria 2235
368 Ga0157373_10001240 3300013100 Bacteria 19499
369 Ga0157373_10002086 3300013100 Bacteria 15140
370 Ga0157373_10008399 3300013100 Bacteria 7669
371 Ga0157373_10043290 3300013100 Bacteria 3216
372 Ga0157373_10046828 3300013100 Bacteria 3085
373 Ga0157373_10073914 3300013100 Bacteria 2405
374 Ga0157373_10191475 3300013100 Bacteria 1441
375 Ga0157371_10000037 3300013102 Bacteria 214866
376 Ga0157371_10000220 3300013102 Bacteria 83813
377 Ga0157371_10002087 3300013102 Bacteria 19526
378 Ga0157371_10002091 3300013102 Bacteria 19502
379 Ga0157371_10002507 3300013102 Bacteria 17449
380 Ga0157371_10003338 3300013102 Bacteria 14645
381 Ga0157371_10007834 3300013102 Bacteria 8575
382 Ga0157371_10021914 3300013102 Bacteria 4689
383 Ga0157371_10035971 3300013102 Bacteria 3546
384 Ga0157371_10054408 3300013102 Bacteria 2843
385 Ga0157371_10118318 3300013102 Bacteria 1884
386 Ga0157371_10134964 3300013102 Bacteria 1757
387 Ga0157370_10001415 3300013104 Bacteria 29777
388 Ga0157370_10001827 3300013104 Bacteria 26213
389 Ga0157370_10002234 3300013104 Bacteria 23553
390 Ga0157370_10003187 3300013104 Bacteria 19402
391 Ga0157370_10006395 3300013104 Bacteria 12998
392 Ga0157370_10010736 3300013104 Bacteria 9630
393 Ga0157370_10010796 3300013104 Bacteria 9601
394 Ga0157370_10012309 3300013104 Bacteria 8879
395 Ga0157370_10012412 3300013104 Bacteria 8835
396 Ga0157370_10016537 3300013104 Bacteria 7463
397 Ga0157370_10019635 3300013104 Bacteria 6769
398 Ga0157370_10035920 3300013104 Bacteria 4812
399 Ga0157370_10041237 3300013104 Bacteria 4455
400 Ga0157370_10064921 3300013104 Bacteria 3454
401 Ga0157370_10065890 3300013104 Bacteria 3426
402 Ga0157370_10178285 3300013104 Bacteria 1975
403 Ga0157370_10468509 3300013104 Bacteria 1158
404 Ga0157369_10000031 3300013105 Bacteria 203214
405 Ga0157369_10000566 3300013105 Bacteria 48674
406 Ga0157369_10071400 3300013105 Bacteria 3727
407 Ga0157369_10104435 3300013105 Bacteria 3017
408 Ga0157369_10139013 3300013105 Bacteria 2571
409 Ga0157374_10000001 3300013296 Bacteria 1077351
410 Ga0157374_10001177 3300013296 Bacteria 22312
411 Ga0157374_10006147 3300013296 Bacteria 10174
412 Ga0157374_10024365 3300013296 Bacteria 5426
413 Ga0157374_10042435 3300013296 Bacteria 4196
414 Ga0157374_10047739 3300013296 Bacteria 3971
415 Ga0157374_10067364 3300013296 Bacteria 3366
416 Ga0157374_10076000 3300013296 Bacteria 3175
417 Ga0157374_10097407 3300013296 Bacteria 2815
418 Ga0157378_10001918 3300013297 Bacteria 18667
419 Ga0157378_10005877 3300013297 Bacteria 10749
420 Ga0157378_10007196 3300013297 Bacteria 9719
421 Ga0157378_10014455 3300013297 Bacteria 6910
422 Ga0157378_10021276 3300013297 Bacteria 5703
423 Ga0157378_10036254 3300013297 Bacteria 4365
424 Ga0157378_10077422 3300013297 Bacteria 2998
425 Ga0157378_10239054 3300013297 Bacteria 1734
426 Ga0163162_10000101 3300013306 Bacteria 77114
427 Ga0163162_10000227 3300013306 Bacteria 51464
428 Ga0163162_10000871 3300013306 Bacteria 28126
429 Ga0163162_10001177 3300013306 Bacteria 24418
430 Ga0163162_10002080 3300013306 Bacteria 18806
431 Ga0163162_10003406 3300013306 Bacteria 15182
432 Ga0163162_10003892 3300013306 Bacteria 14333
433 Ga0163162_10006263 3300013306 Bacteria 11529
434 Ga0163162_10009506 3300013306 Bacteria 9455
435 Ga0163162_10012052 3300013306 Bacteria 8432
436 Ga0163162_10014268 3300013306 Bacteria 7761
437 Ga0163162_10015601 3300013306 Bacteria 7425
438 Ga0163162_10025293 3300013306 Bacteria 5866
439 Ga0163162_10030170 3300013306 Bacteria 5372
440 Ga0163162_10180929 3300013306 Bacteria 2234
441 Ga0163162_10498991 3300013306 Bacteria 1347
442 Ga0163162_10679652 3300013306 Bacteria 1152
443 Ga0157372_10000020 3300013307 Bacteria 208056
444 Ga0157372_10000804 3300013307 Bacteria 34050
445 Ga0157372_10001414 3300013307 Bacteria 25877
446 Ga0157372_10005311 3300013307 Bacteria 13682
447 Ga0157372_10027413 3300013307 Bacteria 6203
448 Ga0157372_10031343 3300013307 Bacteria 5822
449 Ga0157372_10099370 3300013307 Bacteria 3319
450 Ga0157372_10113115 3300013307 Bacteria 3111
451 Ga0157372_10137839 3300013307 Bacteria 2811
452 Ga0157372_10318581 3300013307 Bacteria 1810
453 Ga0157372_10394649 3300013307 Bacteria 1612
454 Ga0157372_10704924 3300013307 Bacteria 1174
455 Ga0157375_10000118 3300013308 Bacteria 77255
456 Ga0157375_10001625 3300013308 Bacteria 19340
457 Ga0157375_10004861 3300013308 Bacteria 11676
458 Ga0157375_10007692 3300013308 Bacteria 9429
459 Ga0157375_10015273 3300013308 Bacteria 6871
460 Ga0157375_10038711 3300013308 Bacteria 4580
461 Ga0157375_10104315 3300013308 Bacteria 2924
462 Ga0157375_10114211 3300013308 Bacteria 2802
463 Ga0157375_10131057 3300013308 Bacteria 2626
464 Ga0157375_10173309 3300013308 Bacteria 2306
465 Ga0157375_10190621 3300013308 Bacteria 2205
466 Ga0157375_10250248 3300013308 Bacteria 1933
467 Ga0157375_10273768 3300013308 Bacteria 1850
468 Ga0157375_10557583 3300013308 Bacteria 1307
469 Ga0157375_10758572 3300013308 Bacteria 1121
470 Ga0163163_10000636 3300014325 Bacteria 30223
471 Ga0163163_10001351 3300014325 Bacteria 20695
472 Ga0163163_10002778 3300014325 Bacteria 14786
473 Ga0163163_10084057 3300014325 Bacteria 3189
474 Ga0157380_10001070 3300014326 Bacteria 17569
475 Ga0157380_10001555 3300014326 Bacteria 15095
476 Ga0157380_10086738 3300014326 Bacteria 2573
477 Ga0182008_10000048 3300014497 Bacteria 105176
478 Ga0182008_10000572 3300014497 Bacteria 27252
479 Ga0182008_10090120 3300014497 Bacteria 1512
480 Ga0157377_10004058 3300014745 Bacteria 6682
481 Ga0157377_10005239 3300014745 Bacteria 6072
482 Ga0157377_10030501 3300014745 Bacteria 2921
483 Ga0157379_10000536 3300014968 Bacteria 30631
484 Ga0157379_10037300 3300014968 Bacteria 4334
485 Ga0157379_10045049 3300014968 Bacteria 3938
486 Ga0157379_10193488 3300014968 Bacteria 1838
487 Ga0157379_10259554 3300014968 Bacteria 1578
488 Ga0157376_10000378 3300014969 Bacteria 29031
489 Ga0157376_10000697 3300014969 Bacteria 21724
490 Ga0157376_10000873 3300014969 Bacteria 19768
491 Ga0157376_10001271 3300014969 Bacteria 16567
492 Ga0157376_10004501 3300014969 Bacteria 9711
493 Ga0157376_10077611 3300014969 Bacteria 2841
494 Ga0157376_10120246 3300014969 Bacteria 2326
495 Ga0157376_10165142 3300014969 Bacteria 2011
496 Ga0157376_10286253 3300014969 Bacteria 1554
497 Ga0157376_10486400 3300014969 Bacteria 1210
498 Ga0182006_1000103 3300015261 Bacteria 93638
499 Ga0182006_1000159 3300015261 Bacteria 72265
500 Ga0182006_1000237 3300015261 Bacteria 52084
501 Ga0182006_1002314 3300015261 Bacteria 10497
502 Ga0182006_1006283 3300015261 Bacteria 5535
503 Ga0182007_10000002 3300015262 Bacteria 564661
504 Ga0182007_10029805 3300015262 Bacteria 1867
505 Ga0182005_1000091 3300015265 Bacteria 67859
506 Ga0183373_1004 3300015682 Bacteria 537398
507 Ga0163161_10000672 3300017792 Bacteria 27295
508 Ga0163161_10002407 3300017792 Bacteria 13412
509 Ga0163161_10002660 3300017792 Bacteria 12700
510 Ga0163161_10006842 3300017792 Bacteria 7890
511 Ga0163161_10008268 3300017792 Bacteria 7199
512 Ga0163161_10020027 3300017792 Bacteria 4693
513 Ga0163161_10022509 3300017792 Bacteria 4439
514 Ga0163161_10039109 3300017792 Bacteria 3404
515 Ga0163161_10040002 3300017792 Bacteria 3367
516 Ga0163161_10047518 3300017792 Bacteria 3099
517 Ga0163161_10073639 3300017792 Bacteria 2503
518 Ga0163161_10108403 3300017792 Bacteria 2074
519 Ga0163161_10132659 3300017792 Bacteria 1880
520 Ga0213876_10001490 3300021384 Bacteria 14554
521 Ga0213876_10022436 3300021384 Bacteria 3337
522 Ga0209563_103255 3300025230 Bacteria 3404
523 Ga0207427_100025 3300025231 Bacteria 433726
524 Ga0209437_100010 3300025233 Bacteria 838447
525 Ga0209258_100081 3300025242 Bacteria 254564
526 Ga0207425_1000023 3300025245 Bacteria 341339
527 Ga0209646_1001126 3300025246 Bacteria 7867
528 Ga0209026_1000225 3300025250 Bacteria 77234
529 Ga0209148_1000202 3300025254 Bacteria 106106
530 Ga0209129_1000032 3300025258 Bacteria 341150
531 Ga0209233_1000017 3300025261 Bacteria 898076
532 Ga0209233_1000655 3300025261 Bacteria 16841
533 Ga0209455_1000758 3300025272 Bacteria 18261
534 Ga0209676_1000009 3300025292 Bacteria 981719
535 Ga0209025_1000047 3300025294 Bacteria 341150
536 Ga0209758_1000144 3300025297 Bacteria 170724
537 Ga0209050_1000094 3300025298 Bacteria 242893
538 Ga0207426_1000093 3300025302 Bacteria 277663
539 Ga0209257_1000007 3300025304 Bacteria 1564415
540 Ga0209257_1000064 3300025304 Bacteria 356803
541 Ga0207656_10000239 3300025321 Bacteria 19231
542 Ga0207653_10034997 3300025885 Bacteria 1632
543 Ga0207682_10008876 3300025893 Bacteria 3975
544 Ga0207710_10006884 3300025900 Bacteria 4838
545 Ga0207680_10000057 3300025903 Bacteria 50978
546 Ga0207680_10003557 3300025903 Bacteria 7335
547 Ga0207680_10115000 3300025903 Bacteria 1751
548 Ga0207647_10000169 3300025904 Bacteria 52146
549 Ga0207647_10000206 3300025904 Bacteria 48374
550 Ga0207647_10006207 3300025904 Bacteria 8710
551 Ga0207645_10000536 3300025907 Bacteria 31571
552 Ga0207645_10000672 3300025907 Bacteria 28332
553 Ga0207645_10005567 3300025907 Bacteria 9116
554 Ga0207645_10084467 3300025907 Bacteria 2037
555 Ga0207645_10218207 3300025907 Bacteria 1257
556 Ga0207643_10266106 3300025908 Bacteria 1060
557 Ga0207705_10002909 3300025909 Bacteria 13096
558 Ga0207705_10077238 3300025909 Bacteria 2422
559 Ga0207654_10000940 3300025911 Bacteria 16008
560 Ga0207654_10002291 3300025911 Bacteria 9812
561 Ga0207654_10008022 3300025911 Bacteria 5323
562 Ga0207654_10040476 3300025911 Bacteria 2626
563 Ga0207654_10217055 3300025911 Bacteria 1266
564 Ga0207707_10000889 3300025912 Bacteria 29199
565 Ga0207707_10007990 3300025912 Bacteria 9188
566 Ga0207707_10496807 3300025912 Bacteria 1041
567 Ga0207695_10000048 3300025913 Bacteria 421800
568 Ga0207695_10000071 3300025913 Bacteria 315568
569 Ga0207695_10000323 3300025913 Bacteria 114265
570 Ga0207695_10008731 3300025913 Bacteria 12637
571 Ga0207695_10016782 3300025913 Bacteria 8549
572 Ga0207695_10058385 3300025913 Bacteria 4005
573 Ga0207695_10202776 3300025913 Bacteria 1897
574 Ga0207695_10235724 3300025913 Bacteria 1733
575 Ga0207695_10283985 3300025913 Bacteria 1548
576 Ga0207695_10351824 3300025913 Bacteria 1360
577 Ga0207695_10523926 3300025913 Bacteria 1067
578 Ga0207671_10003914 3300025914 Bacteria 14516
579 Ga0207671_10005064 3300025914 Bacteria 12309
580 Ga0207671_10006304 3300025914 Bacteria 10594
581 Ga0207671_10008774 3300025914 Bacteria 8516
582 Ga0207671_10016225 3300025914 Bacteria 5798
583 Ga0207671_10033095 3300025914 Bacteria 3847
584 Ga0207671_10330170 3300025914 Bacteria 1208
585 Ga0207660_10006223 3300025917 Bacteria 7753
586 Ga0207660_10018017 3300025917 Bacteria 4703
587 Ga0207662_10062713 3300025918 Bacteria 2234
588 Ga0207657_10042545 3300025919 Bacteria 4007
589 Ga0207649_10025237 3300025920 Bacteria 3463
590 Ga0207652_10011595 3300025921 Bacteria 7110
591 Ga0207652_10013482 3300025921 Bacteria 6613
592 Ga0207652_10066470 3300025921 Bacteria 3125
593 Ga0207681_10024366 3300025923 Bacteria 3883
594 Ga0207681_10046476 3300025923 Bacteria 2920
595 Ga0207681_10070425 3300025923 Bacteria 2435
596 Ga0207681_10127668 3300025923 Bacteria 1875
597 Ga0207694_10017591 3300025924 Bacteria 5403
598 Ga0207694_10127546 3300025924 Bacteria 2037
599 Ga0207694_10156064 3300025924 Bacteria 1841
600 Ga0207650_10053098 3300025925 Bacteria 3003
601 Ga0207650_10122441 3300025925 Bacteria 2027
602 Ga0207650_10162935 3300025925 Bacteria 1768
603 Ga0207650_10182155 3300025925 Bacteria 1674
604 Ga0207659_10026032 3300025926 Bacteria 3942
605 Ga0207659_10080515 3300025926 Bacteria 2406
606 Ga0207659_10157167 3300025926 Bacteria 1781
607 Ga0207659_10179472 3300025926 Bacteria 1676
608 Ga0207687_10227262 3300025927 Bacteria 1472
609 Ga0207644_10004906 3300025931 Bacteria 8720
610 Ga0207644_10008932 3300025931 Bacteria 6565
611 Ga0207644_10214632 3300025931 Bacteria 1523
612 Ga0207644_10256232 3300025931 Bacteria 1397
613 Ga0207690_10000147 3300025932 Bacteria 56329
614 Ga0207690_10008110 3300025932 Bacteria 6231
615 Ga0207690_10014393 3300025932 Bacteria 4778
616 Ga0207706_10000038 3300025933 Bacteria 132725
617 Ga0207706_10000167 3300025933 Bacteria 72622
618 Ga0207706_10003140 3300025933 Bacteria 15873
619 Ga0207706_10007966 3300025933 Bacteria 9781
620 Ga0207706_10137890 3300025933 Bacteria 2146
621 Ga0207686_10000481 3300025934 Bacteria 26333
622 Ga0207686_10002939 3300025934 Bacteria 9182
623 Ga0207686_10024483 3300025934 Bacteria 3499
624 Ga0207686_10360981 3300025934 Bacteria 1096
625 Ga0207686_10380838 3300025934 Bacteria 1070
626 Ga0207686_10462970 3300025934 Bacteria 977
627 Ga0207709_10000003 3300025935 Bacteria 1050072
628 Ga0207709_10015358 3300025935 Bacteria 4245
629 Ga0207709_10023674 3300025935 Bacteria 3497
630 Ga0207709_10430942 3300025935 Bacteria 1015
631 Ga0207670_10012693 3300025936 Bacteria 4937
632 Ga0207670_10079985 3300025936 Bacteria 2283
633 Ga0207670_10122717 3300025936 Bacteria 1891
634 Ga0207669_10001204 3300025937 Bacteria 10996
635 Ga0207704_10000042 3300025938 Bacteria 89683
636 Ga0207704_10018404 3300025938 Bacteria 3645
637 Ga0207704_10030610 3300025938 Bacteria 3020
638 Ga0207704_10032633 3300025938 Bacteria 2949
639 Ga0207704_10296384 3300025938 Bacteria 1237
640 Ga0207704_10360541 3300025938 Bacteria 1135
641 Ga0207665_10120474 3300025939 Bacteria 1853
642 Ga0207691_10000228 3300025940 Bacteria 54500
643 Ga0207691_10045382 3300025940 Bacteria 4040
644 Ga0207691_10050071 3300025940 Bacteria 3825
645 Ga0207691_10065740 3300025940 Bacteria 3281
646 Ga0207691_10095297 3300025940 Bacteria 2662
647 Ga0207691_10136167 3300025940 Bacteria 2166
648 Ga0207691_10154222 3300025940 Bacteria 2018
649 Ga0207691_10214535 3300025940 Bacteria 1671
650 Ga0207711_10028398 3300025941 Bacteria 4707
651 Ga0207711_10029091 3300025941 Bacteria 4657
652 Ga0207689_10000482 3300025942 Bacteria 37605
653 Ga0207689_10000945 3300025942 Bacteria 27917
654 Ga0207689_10005168 3300025942 Bacteria 11724
655 Ga0207689_10017098 3300025942 Bacteria 6138
656 Ga0207661_10021969 3300025944 Bacteria 4793
657 Ga0207661_10035166 3300025944 Bacteria 3901
658 Ga0207661_10092105 3300025944 Bacteria 2526
659 Ga0207661_10109608 3300025944 Bacteria 2332
660 Ga0207679_10001675 3300025945 Bacteria 13804
661 Ga0207679_10004011 3300025945 Bacteria 9141
662 Ga0207679_10053294 3300025945 Bacteria 2972
663 Ga0207679_10256138 3300025945 Bacteria 1490
664 Ga0207667_10000135 3300025949 Bacteria 111565
665 Ga0207667_10000177 3300025949 Bacteria 92852
666 Ga0207667_10013458 3300025949 Bacteria 9363
667 Ga0207667_10030139 3300025949 Bacteria 5871
668 Ga0207667_10073752 3300025949 Bacteria 3546
669 Ga0207667_10094059 3300025949 Bacteria 3095
670 Ga0207667_10357613 3300025949 Bacteria 1489
671 Ga0207667_10466872 3300025949 Bacteria 1282
672 Ga0207651_10015395 3300025960 Bacteria 4443
673 Ga0207651_10018322 3300025960 Bacteria 4162
674 Ga0207651_10266004 3300025960 Bacteria 1410
675 Ga0207651_10331379 3300025960 Bacteria 1276
676 Ga0207712_10016682 3300025961 Bacteria 4759
677 Ga0207712_10024884 3300025961 Bacteria 3972
678 Ga0207712_10026045 3300025961 Bacteria 3893
679 Ga0207712_10043054 3300025961 Bacteria 3112
680 Ga0207712_10102072 3300025961 Bacteria 2135
681 Ga0207712_10123402 3300025961 Bacteria 1963
682 Ga0207712_10176024 3300025961 Bacteria 1676
683 Ga0207668_10065915 3300025972 Bacteria 2565
684 Ga0207668_10111514 3300025972 Bacteria 2053
685 Ga0207668_10453301 3300025972 Bacteria 1095
686 Ga0207640_10018940 3300025981 Bacteria 4055
687 Ga0207640_10024008 3300025981 Bacteria 3672
688 Ga0207658_10008941 3300025986 Bacteria 6793
689 Ga0207658_10019785 3300025986 Bacteria 4658
690 Ga0207658_10037585 3300025986 Bacteria 3480
691 Ga0207658_10085379 3300025986 Bacteria 2431
692 Ga0207658_10180636 3300025986 Bacteria 1746
693 Ga0207658_10313622 3300025986 Bacteria 1355
694 Ga0207658_10373683 3300025986 Bacteria 1247
695 Ga0207677_10005483 3300026023 Bacteria 6888
696 Ga0207677_10060696 3300026023 Bacteria 2615
697 Ga0207677_10078074 3300026023 Bacteria 2363
698 Ga0207677_10323758 3300026023 Bacteria 1282
699 Ga0207703_10000924 3300026035 Bacteria 28603
700 Ga0207703_10011638 3300026035 Bacteria 6841
701 Ga0207703_10045798 3300026035 Bacteria 3519
702 Ga0207703_10372715 3300026035 Bacteria 1319
703 Ga0207703_10619095 3300026035 Bacteria 1025
704 Ga0207639_10013846 3300026041 Bacteria 5656
705 Ga0207639_10018848 3300026041 Bacteria 4911
706 Ga0207639_10047774 3300026041 Bacteria 3236
707 Ga0207639_10057307 3300026041 Bacteria 2991
708 Ga0207639_10061204 3300026041 Bacteria 2906
709 Ga0207639_10089840 3300026041 Bacteria 2455
710 Ga0207639_10093652 3300026041 Bacteria 2410
711 Ga0207639_10096563 3300026041 Bacteria 2378
712 Ga0207639_10246622 3300026041 Bacteria 1556
713 Ga0207639_10348741 3300026041 Bacteria 1321
714 Ga0207678_10077492 3300026067 Bacteria 2847
715 Ga0207708_10073643 3300026075 Bacteria 2618
716 Ga0207702_10000119 3300026078 Bacteria 92653
717 Ga0207702_10008334 3300026078 Bacteria 8751
718 Ga0207702_10047091 3300026078 Bacteria 3632
719 Ga0207702_10158637 3300026078 Bacteria 2064
720 Ga0207641_10000229 3300026088 Bacteria 72315
721 Ga0207641_10000539 3300026088 Bacteria 42499
722 Ga0207641_10013808 3300026088 Bacteria 6622
723 Ga0207641_10107505 3300026088 Bacteria 2468
724 Ga0207641_10126665 3300026088 Bacteria 2287
725 Ga0207641_10147673 3300026088 Bacteria 2127
726 Ga0207648_10000036 3300026089 Bacteria 122209
727 Ga0207648_10003557 3300026089 Bacteria 16296
728 Ga0207648_10040383 3300026089 Bacteria 4100
729 Ga0207648_10053860 3300026089 Bacteria 3515
730 Ga0207648_10075182 3300026089 Bacteria 2945
731 Ga0207648_10085784 3300026089 Bacteria 2746
732 Ga0207648_10170550 3300026089 Bacteria 1923
733 Ga0207648_10487736 3300026089 Bacteria 1126
734 Ga0207676_10001997 3300026095 Bacteria 14856
735 Ga0207676_10003168 3300026095 Bacteria 11734
736 Ga0207676_10024749 3300026095 Bacteria 4446
737 Ga0207676_10119837 3300026095 Bacteria 2217
738 Ga0207676_10142717 3300026095 Bacteria 2052
739 Ga0207676_10184824 3300026095 Bacteria 1828
740 Ga0207676_10386236 3300026095 Bacteria 1305
741 Ga0207676_10651554 3300026095 Bacteria 1016
742 Ga0207674_10016309 3300026116 Bacteria 8137
743 Ga0207674_10025163 3300026116 Bacteria 6351
744 Ga0207674_10035928 3300026116 Bacteria 5168
745 Ga0207674_10543312 3300026116 Bacteria 1123
746 Ga0207675_100000938 3300026118 Bacteria 29125
747 Ga0207675_100029699 3300026118 Bacteria 5091
748 Ga0207675_100050955 3300026118 Bacteria 3863
749 Ga0207675_100071059 3300026118 Bacteria 3254
750 Ga0207675_100191812 3300026118 Bacteria 1960
751 Ga0207683_10026994 3300026121 Bacteria 4962
752 Ga0207683_10028296 3300026121 Bacteria 4846
753 Ga0207683_10040552 3300026121 Bacteria 4064
754 Ga0207683_10315809 3300026121 Bacteria 1431
755 Ga0207683_10461876 3300026121 Bacteria 1171
756 Ga0207698_10001222 3300026142 Bacteria 15005
757 Ga0207698_10014331 3300026142 Bacteria 5267
758 Ga0207698_10093884 3300026142 Bacteria 2465
759 Ga0207698_10438985 3300026142 Bacteria 1257
760 Ga0207698_10483855 3300026142 Bacteria 1201
761 Ga0207428_10158752 3300027907 Bacteria 1718
762 Ga0268266_10000030 3300028379 Bacteria 417120
763 Ga0268266_10000049 3300028379 Bacteria 307763
764 Ga0268266_10005598 3300028379 Bacteria 11664
765 Ga0268266_10034011 3300028379 Bacteria 4333
766 Ga0268266_10145262 3300028379 Bacteria 2132
767 Ga0268265_10504682 3300028380 Bacteria 1140
768 Ga0268264_10003106 3300028381 Bacteria 14382
769 Ga0268264_10003271 3300028381 Bacteria 14012
770 Ga0268264_10007090 3300028381 Bacteria 9391
771 Ga0268264_10013186 3300028381 Bacteria 6801
772 Ga0268264_10020419 3300028381 Bacteria 5414
773 Ga0265337_1005714 3300028556 Bacteria 4889
774 Ga0265326_10005999 3300028558 Bacteria 3801
775 Ga0265319_1000171 3300028563 Bacteria 49323
776 Ga0265334_10000220 3300028573 Bacteria 33009
777 Ga0265318_10002220 3300028577 Bacteria 10479
778 Ga0265322_10034893 3300028654 Bacteria 1433
779 Ga0307517_10003658 3300028786 Bacteria 23904
780 Ga0307517_10011388 3300028786 Bacteria 12327
781 Ga0307515_10000009 3300028794 Bacteria 653206
782 Ga0307515_10000507 3300028794 Bacteria 93166
783 Ga0265338_10000448 3300028800 Bacteria 73538
784 Ga0265338_10001633 3300028800 Bacteria 35870
785 Ga0265338_10015047 3300028800 Bacteria 8539
786 Ga0265324_10014609 3300029957 Bacteria 2902
787 Ga0307511_10000276 3300030521 Bacteria 53817
788 Ga0265328_10078783 3300031239 Bacteria 1214
789 Ga0265320_10006371 3300031240 Bacteria 7443
790 Ga0265325_10039951 3300031241 Bacteria 2466
791 Ga0265329_10042288 3300031242 Bacteria 1460
792 Ga0265327_10000148 3300031251 Bacteria 151952
793 Ga0265327_10008831 3300031251 Bacteria 7420
794 Ga0265327_10091547 3300031251 Bacteria 1482
795 Ga0265327_10133319 3300031251 Bacteria 1167
796 Ga0307513_10061705 3300031456 Bacteria 3967
797 Ga0307513_10149923 3300031456 Bacteria 2243
798 Ga0307509_10043782 3300031507 Bacteria 4841
799 Ga0307509_10055932 3300031507 Bacteria 4190
800 Ga0307509_10063261 3300031507 Bacteria 3896
801 Ga0307509_10089274 3300031507 Bacteria 3161
802 Ga0307408_100000578 3300031548 Bacteria 31539
803 Ga0307408_100001086 3300031548 Bacteria 20801
804 Ga0307408_100001939 3300031548 Bacteria 14992
805 Ga0265313_10003787 3300031595 Bacteria 11994
806 Ga0265313_10028202 3300031595 Bacteria 2923
807 Ga0265313_10041092 3300031595 Bacteria 2281
808 Ga0307508_10003266 3300031616 Bacteria 16542
809 Ga0307514_10061041 3300031649 Bacteria 2873
810 Ga0265314_10048233 3300031711 Bacteria 2990
811 Ga0265342_10018127 3300031712 Bacteria 4566
812 Ga0307516_10001231 3300031730 Bacteria 35640
813 Ga0307516_10007511 3300031730 Bacteria 12531
814 Ga0307516_10420721 3300031730 Bacteria 994
815 Ga0307405_10000015 3300031731 Bacteria 206299
816 Ga0307413_10345611 3300031824 Bacteria 1146
817 Ga0307407_10000031 3300031903 Bacteria 87995
818 Ga0307412_10000049 3300031911 Bacteria 151588
819 Ga0307409_100013894 3300031995 Bacteria 5208
820 Ga0307409_100059433 3300031995 Bacteria 2975
821 Ga0307416_100000002 3300032002 Bacteria 509907
822 Ga0307416_100851260 3300032002 Bacteria 1010
823 Ga0307414_10000608 3300032004 Bacteria 18392
824 Ga0307414_10052185 3300032004 Bacteria 2844
825 Ga0307414_10061057 3300032004 Bacteria 2669
826 Ga0307414_10411462 3300032004 Bacteria 1177
827 Ga0307414_10447515 3300032004 Bacteria 1132
828 Ga0307411_10212129 3300032005 Bacteria 1496
829 Ga0307510_10000147 3300033180 Bacteria 58704
830 Ga0373934_0092268 3300035086 Bacteria 1221
831 Ga0373941_0084057 3300035115 Bacteria 1080
832 Ga0373945_0124358 3300035116 Bacteria 1028
833 Ga0373935_0091379 3300035692 Bacteria 1994
834 Ga0373927_0207455 3300035695 Bacteria 1287
835 Ga0373933_0042199 3300035724 Bacteria 2696
836 Ga0373947_0050857 3300035725 Bacteria 2492
837 Ga0373937_0096850 3300036401 Bacteria 2736
838 Ga0373937_0321850 3300036401 Bacteria 1463
839 Ga0395899_0000002 3300037312 Bacteria 1324310
840 Ga0395899_0000286 3300037312 Bacteria 65138
841 Ga0395900_0000115 3300037418 Bacteria 138474
842 Ga0395900_0004784 3300037418 Bacteria 14268
843 Ga0395900_0140357 3300037418 Bacteria 2475
844 Ga0395898_0010131 3300037466 Bacteria 9865
845 Ga0395905_0000045 3300037471 Bacteria 241370
846 Ga0395905_0001113 3300037471 Bacteria 33725
847 Ga0395905_0394886 3300037471 Bacteria 1278
848 Ga0395901_0000254 3300038443 Bacteria 66508
849 Ga0395901_0006539 3300038443 Bacteria 11789
850 Ga0395901_0116658 3300038443 Bacteria 2805
851 Ga0436365_0763276 3300039437 Bacteria 3365
852 Ga0436365_1121511 3300039437 Bacteria 10842
853 Ga0436365_1214063 3300039437 Bacteria 13888
854 Ga0436365_1871487 3300039437 Bacteria 2813
855 Ga0439436_0025603 3300041404 Bacteria 1732
856 Ga0439439_0012722 3300041406 Bacteria 2037
857 Ga0439439_0019014 3300041406 Bacteria 1702
858 Ga0439465_0006087 3300041413 Bacteria 3835
859 Ga0451853_1789420 3300041512 Bacteria 2164
860 Ga0439442_014100 3300042002 Bacteria 1645
861 Ga0439445_0063498 3300042004 Bacteria 1013
862 Ga0439449_0016294 3300042007 Bacteria 2794
863 Ga0439449_0044809 3300042007 Bacteria 1640
864 Ga0439449_0066030 3300042007 Bacteria 1334
865 Ga0439457_002393 3300042014 Bacteria 5364
866 Ga0439462_0007027 3300042015 Bacteria 2813
867 Ga0439446_0096903 3300042156 Bacteria 929
868 Ga0439434_0002629 3300042435 Bacteria 5233
869 Ga0451577_0020546 3300042876 Bacteria 6057
870 Ga0451577_0032953 3300042876 Bacteria 4670
871 Ga0451577_0351037 3300042876 Bacteria 1338
872 Ga0466969_0000921 3300044656 Bacteria 15847
873 Ga0466969_0041570 3300044656 Bacteria 2299
874 Ga0466972_0000038 3300044658 Bacteria 135937
875 Ga0466972_0000055 3300044658 Bacteria 111338
876 Ga0466972_0062541 3300044658 Bacteria 1783
877 Ga0453683_0093085 3300044673 Bacteria 1890
878 Ga0466966_0010092 3300044684 Bacteria 6263
879 Ga0466964_0011227 3300044706 Bacteria 3383
880 Ga0466964_0013406 3300044706 Bacteria 3111
881 Ga0453684_0064450 3300044712 Bacteria 4681
882 Ga0453684_0093866 3300044712 Bacteria 3694
883 Ga0453684_0231041 3300044712 Bacteria 2135
884 Ga0453684_0262477 3300044712 Bacteria 1977
885 Ga0453684_0413196 3300044712 Bacteria 1509
886 Ga0453684_0774816 3300044712 Bacteria 1036
887 Ga0466968_0011055 3300044735 Bacteria 3512
888 Ga0466968_0063728 3300044735 Bacteria 1593
889 Ga0466970_0000722 3300044765 Bacteria 16167
890 Ga0466957_0000186 3300044842 Bacteria 28257
891 Ga0466957_0002253 3300044842 Bacteria 10334
892 Ga0466959_0000157 3300045049 Bacteria 44458
893 Ga0466959_0006469 3300045049 Bacteria 8116
894 Ga0451576_0001626 3300045051 Bacteria 37654
895 Ga0451576_0048038 3300045051 Bacteria 4485
896 Ga0451576_0117261 3300045051 Bacteria 2771
897 Ga0451576_0219922 3300045051 Bacteria 1983
898 Ga0451576_0336454 3300045051 Bacteria 1580
899 Ga0495627_001652 3300046453 Bacteria 12384
900 Ga0495627_005399 3300046453 Bacteria 5158
901 Ga0495590_0015436 3300046457 Bacteria 2772
902 Ga0495629_0087417 3300046459 Bacteria 2175
903 Ga0495629_0100797 3300046459 Bacteria 2015
904 Ga0495638_0095177 3300046460 Bacteria 1789
905 Ga0495638_0135022 3300046460 Bacteria 1446
906 Ga0495638_0251708 3300046460 Bacteria 973
907 Ga0495651_0267440 3300046462 Bacteria 1161
908 Ga0495650_0000198 3300046471 Bacteria 130455
909 Ga0495650_0071548 3300046471 Bacteria 1360
910 Ga0495650_0134930 3300046471 Bacteria 897
911 Ga0495585_0002633 3300046492 Bacteria 12644
912 Ga0495585_0006258 3300046492 Bacteria 7410
913 Ga0495594_0055291 3300046499 Bacteria 2188
914 Ga0495596_0016929 3300046500 Bacteria 3024
915 Ga0495607_0055009 3300046501 Bacteria 2291
916 Ga0495583_0037848 3300046506 Bacteria 2284
917 Ga0495606_0000003 3300046507 Bacteria 449402
918 Ga0495606_0010339 3300046507 Bacteria 7760
919 Ga0495606_0012375 3300046507 Bacteria 6848
920 Ga0495606_0014704 3300046507 Bacteria 6085
921 Ga0495606_0026073 3300046507 Bacteria 4170
922 Ga0495606_0032782 3300046507 Bacteria 3594
923 Ga0495606_0054176 3300046507 Bacteria 2598
924 Ga0495606_0068194 3300046507 Bacteria 2251
925 Ga0495606_0111876 3300046507 Bacteria 1646
926 Ga0495610_0001576 3300046512 Bacteria 20073
927 Ga0495610_0002315 3300046512 Bacteria 16104
928 Ga0495610_0015317 3300046512 Bacteria 4461
929 Ga0495610_0122677 3300046512 Bacteria 1137
930 Ga0495616_0052238 3300046513 Bacteria 2035
931 Ga0495628_0105232 3300046516 Bacteria 2174
932 Ga0495630_0007001 3300046517 Bacteria 8038
933 Ga0495637_0046036 3300046520 Bacteria 1847
934 Ga0495643_0000719 3300046522 Bacteria 37837
935 Ga0495643_0014997 3300046522 Bacteria 4594
936 Ga0495648_0003102 3300046524 Bacteria 14832
937 Ga0495648_0022342 3300046524 Bacteria 4359
938 Ga0495652_0137274 3300046529 Bacteria 1928
939 Ga0495652_0311750 3300046529 Bacteria 1140
940 Ga0495587_0070088 3300046536 Bacteria 2041
941 Ga0495587_0238841 3300046536 Bacteria 1023
942 Ga0495609_0000063 3300046538 Bacteria 135584
943 Ga0495633_0000123 3300046558 Bacteria 104682
944 Ga0495633_0000267 3300046558 Bacteria 61184
945 Ga0495667_0076052 3300046559 Bacteria 2184
946 Ga0495668_0000010 3300046616 Bacteria 487308
947 Ga0495668_0241400 3300046616 Bacteria 989
948 Ga0495634_0166336 3300046642 Bacteria 1388
949 Ga0495611_0010000 3300046648 Bacteria 4013
950 Ga0495625_0000456 3300046660 Bacteria 61289
951 Ga0495625_0000524 3300046660 Bacteria 56526
952 Ga0495625_0003704 3300046660 Bacteria 14924
953 Ga0495625_0043481 3300046660 Bacteria 3257
954 Ga0495625_0077607 3300046660 Bacteria 2320
955 Ga0495625_0124116 3300046660 Bacteria 1754
956 Ga0495625_0207130 3300046660 Bacteria 1291
957 Ga0495635_0253598 3300046663 Bacteria 1186
958 Ga0495661_0000924 3300046665 Bacteria 26810
959 Ga0495661_0015466 3300046665 Bacteria 5094
960 Ga0495661_0017815 3300046665 Bacteria 4681
961 Ga0495623_0206754 3300046679 Bacteria 1126
962 Ga0495646_0088268 3300046680 Bacteria 1796
963 Ga0495658_0008440 3300046683 Bacteria 5105
964 Ga0495670_0025883 3300046691 Bacteria 2904
965 Ga0495649_0000168 3300046694 Bacteria 57053
966 Ga0495660_0007737 3300046810 Bacteria 6314
967 Ga0495581_0218718 3300047315 Bacteria 1114
968 Ga0495604_0105816 3300047317 Bacteria 2059
969 Ga0495636_0109904 3300047318 Bacteria 1212
970 Ga0495674_0034534 3300047319 Bacteria 4573
971 Ga0495674_0126667 3300047319 Bacteria 2154
972 Ga0495672_0030543 3300047320 Bacteria 3378
973 Ga0495672_0075161 3300047320 Bacteria 1901
974 Ga0495672_0089092 3300047320 Bacteria 1699
975 Ga0495687_000001 3300047443 Bacteria 1215582
976 Ga0495687_001225 3300047443 Bacteria 24525
977 Ga0495687_017007 3300047443 Bacteria 3642
978 Ga0495675_0274464 3300047444 Bacteria 1007
979 Ga0495679_024124 3300047446 Bacteria 2054
980 Ga0495673_0025798 3300047469 Bacteria 2817
981 Ga0495686_0000004 3300047472 Bacteria 869019
982 Ga0495686_0000845 3300047472 Bacteria 39321
983 Ga0495686_0000974 3300047472 Bacteria 35181
984 Ga0495686_0041318 3300047472 Bacteria 2937
985 Ga0495686_0052463 3300047472 Bacteria 2557
986 Ga0496100_0049855 3300048903 Bacteria 2710
987 Ga0496104_0279048 3300048907 Bacteria 1584
988 Ga0496104_0501552 3300048907 Bacteria 1125
989 Ga0496106_0027781 3300048909 Bacteria 4214
990 Ga0496109_0044543 3300048912 Bacteria 4025
991 Ga0496110_0018044 3300048913 Bacteria 5911
992 Ga0496114_0016464 3300048917 Bacteria 5959
993 Ga0496114_0079330 3300048917 Bacteria 2771
994 Ga0496114_0081057 3300048917 Bacteria 2741
995 Ga0496115_0035249 3300048918 Bacteria 3958
996 Ga0496115_0142278 3300048918 Bacteria 1979
997 Ga0496116_0004898 3300048919 Bacteria 12621
998 Ga0496118_0045690 3300048921 Bacteria 3415
999 Ga0496121_0000011 3300048924 Bacteria 792193
1000 Ga0496122_0002605 3300048925 Bacteria 25277
1001 Ga0496122_0005789 3300048925 Bacteria 14547
1002 Ga0496123_0010356 3300048926 Bacteria 8254
1003 Ga0496124_0138676 3300048927 Bacteria 1922
1004 Ga0496125_0000185 3300048928 Bacteria 135607
1005 Ga0496126_0177067 3300048929 Bacteria 1814
1006 Ga0496126_0347944 3300048929 Bacteria 1213
1007 Ga0495678_038134 3300049459 Bacteria 1947
1008 Ga0495682_0050695 3300049460 Bacteria 1510
1009 Ga0501031_0014259 3300049568 Bacteria 5170
1010 Ga0501033_0102622 3300049570 Bacteria 2086
1011 Ga0501034_0012015 3300049571 Bacteria 8949
1012 Ga0501034_0058093 3300049571 Bacteria 3888
1013 Ga0501034_0061631 3300049571 Bacteria 3766
1014 Ga0501034_0219801 3300049571 Bacteria 1853
1015 Ga0501034_0291915 3300049571 Bacteria 1568
1016 Ga0501034_0368685 3300049571 Bacteria 1362
1017 Ga0501036_0008645 3300049572 Bacteria 8353
1018 Ga0501036_0156326 3300049572 Bacteria 1923
1019 Ga0501037_0007731 3300049573 Bacteria 7868
1020 Ga0501037_0084518 3300049573 Bacteria 2298
1021 Ga0501037_0198426 3300049573 Bacteria 1419
1022 Ga0501038_0022825 3300049574 Bacteria 5601
1023 Ga0501038_0064235 3300049574 Bacteria 3131
1024 Ga0501039_0119026 3300049575 Bacteria 2069
1025 Ga0501039_0490305 3300049575 Bacteria 965
1026 Ga0501040_0149266 3300049576 Bacteria 1648
1027 Ga0501043_0005210 3300049579 Bacteria 10520
1028 Ga0501043_0027182 3300049579 Bacteria 4492
1029 Ga0501046_0006810 3300049580 Bacteria 10086
1030 Ga0501047_0006182 3300049581 Bacteria 11259
1031 Ga0501047_0019192 3300049581 Bacteria 6558
1032 Ga0501047_0043311 3300049581 Bacteria 4348
1033 Ga0501047_0062647 3300049581 Bacteria 3587
1034 Ga0501047_0154980 3300049581 Bacteria 2165
1035 Ga0501047_0249186 3300049581 Bacteria 1625
1036 Ga0501068_0035118 3300049584 Bacteria 2992
1037 Ga0501072_0145354 3300049588 Bacteria 1891
1038 Ga0501073_0001866 3300049589 Bacteria 15697
1039 Ga0501073_0105669 3300049589 Bacteria 1954
1040 Ga0501073_0259380 3300049589 Bacteria 1199
1041 Ga0501074_0004312 3300049590 Bacteria 10161
1042 Ga0501207_004862 3300049654 Bacteria 1843
1043 Ga0501238_002917 3300049671 Bacteria 2077
1044 Ga0501243_006992 3300049675 Bacteria 1719
1045 Ga0501247_001231 3300049677 Bacteria 2402
1046 Ga0501253_004504 3300049683 Bacteria 1764
1047 Ga0501219_000052 3300049703 Bacteria 18661
1048 Ga0501225_0000277 3300049705 Bacteria 16169
1049 Ga0501080_0044471 3300049742 Bacteria 4134
1050 Ga0501080_0056933 3300049742 Bacteria 3640
1051 Ga0501080_0359626 3300049742 Bacteria 1313
1052 Ga0501241_003222 3300049758 Bacteria 3097
1053 Ga0501264_000212 3300049761 Bacteria 9457
1054 Ga0501279_002719 3300049775 Bacteria 2309
1055 Ga0501035_0039835 3300049822 Bacteria 4250
1056 Ga0501035_0113305 3300049822 Bacteria 2376
1057 Ga0501035_0296139 3300049822 Bacteria 1364
1058 Ga0501044_0003551 3300049823 Bacteria 17548
1059 Ga0501044_0012622 3300049823 Bacteria 9148
1060 Ga0501044_0198740 3300049823 Bacteria 1964
1061 Ga0501284_00029 3300050005 Bacteria 74818
1062 nmdc:mga0k408_13677_c2 3300050493 Bacteria 3480
1063 nmdc:mga0k408_156_c1 3300050493 Bacteria 20011
1064 nmdc:mga0k408_227705_c1 3300050493 Bacteria 1113
1065 nmdc:mga0k408_2627_c1 3300050493 Bacteria 2039
1066 nmdc:mga0k408_6061_c1 3300050493 Bacteria 6444
1067 nmdc:mga0k408_93952_c1 3300050493 Bacteria 1763
1068 nmdc:mga07m45_225701_c1 3300050496 Bacteria 1090
1069 nmdc:mga05p37_18450_c2 3300050507 Bacteria 3051
1070 nmdc:mga05p37_188731_c1 3300050507 Bacteria 2504
1071 nmdc:mga09592_166862_c1 3300050508 Bacteria 1903
1072 nmdc:mga09592_47012_c1 3300050508 Bacteria 3636
1073 nmdc:mga0qj67_148647_c1 3300050509 Bacteria 1900
1074 nmdc:mga06r32_303292_c1 3300050510 Bacteria 1583
1075 nmdc:mga08y16_141552_c1 3300050511 Bacteria 2500
1076 nmdc:mga08y16_31053_c1 3300050511 Bacteria 5619
1077 nmdc:mga08y16_34280_c1 3300050511 Bacteria 5333
1078 nmdc:mga08y16_548386_c1 3300050511 Bacteria 1170
1079 nmdc:mga08y16_650243_c1 3300050511 Bacteria 1058
1080 Ga0495619_0105116 3300053085 Bacteria 1925
1081 Ga0495619_0105762 3300053085 Bacteria 1919
1082 Ga0500578_0000009 3300053086 Bacteria 219807
1083 Ga0500578_0132429 3300053086 Bacteria 1563
1084 Ga0500644_0000035 3300053088 Bacteria 82815
1085 Ga0500644_0021498 3300053088 Bacteria 1934
1086 Ga0500646_0011119 3300053090 Bacteria 2312
1087 Ga0500646_0024757 3300053090 Bacteria 1617
1088 Ga0500646_0038939 3300053090 Bacteria 1332
1089 Ga0500583_0000147 3300053092 Bacteria 29930
1090 Ga0500583_0006066 3300053092 Bacteria 4116
1091 Ga0500651_0003850 3300053093 Bacteria 8299
1092 Ga0500651_0014342 3300053093 Bacteria 4848
1093 Ga0500641_0000081 3300053096 Bacteria 38801
1094 Ga0500562_000161 3300053108 Bacteria 19289
1095 Ga0500562_040953 3300053108 Bacteria 1231
1096 Ga0500569_000486 3300053109 Bacteria 6576
1097 Ga0500608_009264 3300053122 Bacteria 4173
1098 Ga0500608_074613 3300053122 Bacteria 1609
1099 Ga0500618_000038 3300053125 Bacteria 116036
1100 Ga0500642_0019775 3300053130 Bacteria 2634
1101 Ga0500655_008823 3300053133 Bacteria 1814
1102 Ga0500658_0014621 3300053134 Bacteria 2907
1103 Ga0500561_0004593 3300053137 Bacteria 2504
1104 Ga0500573_0101342 3300053140 Bacteria 1620
1105 Ga0500577_0000507 3300053142 Bacteria 10012
1106 Ga0500616_0000015 3300053153 Bacteria 633259
1107 Ga0500616_0052247 3300053153 Bacteria 2150
1108 Ga0500616_0064751 3300053153 Bacteria 1881
1109 Ga0500622_0000203 3300053156 Bacteria 63042
1110 Ga0500622_0011602 3300053156 Bacteria 4793
1111 Ga0500622_0027095 3300053156 Bacteria 3022
1112 Ga0500622_0027852 3300053156 Bacteria 2977
1113 Ga0500622_0033407 3300053156 Bacteria 2697
1114 Ga0500624_000278 3300053157 Bacteria 17649
1115 Ga0500633_0069739 3300053160 Bacteria 1253
1116 Ga0500611_000006 3300053727 Bacteria 226069
1117 Ga0500645_005960 3300053730 Bacteria 4411

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035725 Ga0373947_0050857 Ga0373947_0050857_824_1828 279
2 3300006844 Ga0075428_100011915 Ga0075428_1000119154 286
3 3300031824 Ga0307413_10345611 Ga0307413_103456111 286
4 3300032005 Ga0307411_10212129 Ga0307411_102121291 286
5 3300049576 Ga0501040_0149266 Ga0501040_0149266_217_1086 286
6 3300050508 nmdc:mga09592_166862_c1 nmdc:mga09592_166862_c1_234_1106 286
7 3300005455 Ga0070663_100109107 Ga0070663_1001091073 287
8 3300006844 Ga0075428_100180137 Ga0075428_1001801372 287
9 3300013102 Ga0157371_10035971 Ga0157371_100359711 287
10 3300013105 Ga0157369_10000566 Ga0157369_1000056656 287
11 3300013307 Ga0157372_10000020 Ga0157372_1000002052 287
12 3300028556 Ga0265337_1005714 Ga0265337_10057144 287
13 3300028800 Ga0265338_10015047 Ga0265338_100150472 287
14 3300031241 Ga0265325_10039951 Ga0265325_100399512 287
15 3300031595 Ga0265313_10041092 Ga0265313_100410922 287
16 3300042876 Ga0451577_0351037 Ga0451577_0351037_269_1210 287
17 3300044712 Ga0453684_0064450 Ga0453684_0064450_2188_3129 287
18 3300045051 Ga0451576_0001626 Ga0451576_0001626_1450_2382 287
19 3300050509 nmdc:mga0qj67_148647_c1 nmdc:mga0qj67_148647_c1_152_1024 287
20 3300005327 Ga0070658_10000014 Ga0070658_1000001429 288
21 3300005329 Ga0070683_100016654 Ga0070683_1000166545 288
22 3300005539 Ga0068853_100081876 Ga0068853_1000818762 288
23 3300005563 Ga0068855_100226227 Ga0068855_1002262272 288
24 3300013307 Ga0157372_10005311 Ga0157372_1000531113 288
25 3300025944 Ga0207661_10035166 Ga0207661_100351664 288
26 3300029957 Ga0265324_10014609 Ga0265324_100146092 288
27 3300044673 Ga0453683_0093085 Ga0453683_0093085_316_1188 288
28 3300044712 Ga0453684_0774816 Ga0453684_0774816_90_959 288
29 3300045051 Ga0451576_0219922 Ga0451576_0219922_453_1325 288
30 3300001904 JGI24736J21556_1001800 JGI24736J21556_10018002 289
31 3300001990 JGI24737J22298_10001003 JGI24737J22298_1000100313 289
32 3300001990 JGI24737J22298_10022757 JGI24737J22298_100227572 289
33 3300002067 JGI24735J21928_10000038 JGI24735J21928_1000003823 289
34 3300002077 JGI24744J21845_10001880 JGI24744J21845_100018803 289
35 3300002737 JGI25162J39368_1000716 JGI25162J39368_100071624 289
36 3300002772 JGI25164J39214_1000601 JGI25164J39214_10006015 289
37 3300003214 JGI25165J46597_1000157 JGI25165J46597_100015713 289
38 3300003320 rootH2_10002560 rootH2_1000256024 289
39 3300003323 rootH1_10005851 rootH1_1000585177 289
40 3300003323 rootH1_10007902 rootH1_100079026 289
41 3300003323 rootH1_10025209 rootH1_100252092 289
42 3300003323 rootH1_10061615 rootH1_100616151 289
43 3300004799 Ga0058863_11478938 Ga0058863_114789382 289
44 3300005262 Ga0065165_1000470 Ga0065165_100047029 289
45 3300005288 Ga0065714_10006118 Ga0065714_100061182 289
46 3300005288 Ga0065714_10113088 Ga0065714_101130882 289
47 3300005293 Ga0065715_10218605 Ga0065715_102186052 289
48 3300005327 Ga0070658_10106653 Ga0070658_101066532 289
49 3300005328 Ga0070676_10000269 Ga0070676_1000026910 289
50 3300005328 Ga0070676_10022315 Ga0070676_100223154 289
51 3300005336 Ga0070680_100011377 Ga0070680_1000113776 289
52 3300005339 Ga0070660_100033752 Ga0070660_1000337523 289
53 3300005340 Ga0070689_100063312 Ga0070689_1000633122 289
54 3300005341 Ga0070691_10102297 Ga0070691_101022972 289
55 3300005343 Ga0070687_100029219 Ga0070687_1000292191 289
56 3300005353 Ga0070669_100332853 Ga0070669_1003328531 289
57 3300005354 Ga0070675_100185362 Ga0070675_1001853621 289
58 3300005355 Ga0070671_100008005 Ga0070671_1000080053 289
59 3300005355 Ga0070671_100014610 Ga0070671_1000146102 289
60 3300005355 Ga0070671_100080801 Ga0070671_1000808014 289
61 3300005364 Ga0070673_100003206 Ga0070673_1000032065 289
62 3300005364 Ga0070673_100033392 Ga0070673_1000333924 289
63 3300005365 Ga0070688_100112317 Ga0070688_1001123173 289
64 3300005366 Ga0070659_100000107 Ga0070659_10000010748 289
65 3300005441 Ga0070700_100274053 Ga0070700_1002740531 289
66 3300005456 Ga0070678_100267669 Ga0070678_1002676692 289
67 3300005457 Ga0070662_100000192 Ga0070662_10000019214 289
68 3300005457 Ga0070662_100131336 Ga0070662_1001313362 289
69 3300005457 Ga0070662_100231604 Ga0070662_1002316041 289
70 3300005458 Ga0070681_10022138 Ga0070681_1002213810 289
71 3300005459 Ga0068867_100006330 Ga0068867_1000063301 289
72 3300005459 Ga0068867_100085784 Ga0068867_1000857842 289
73 3300005530 Ga0070679_100033714 Ga0070679_1000337143 289
74 3300005530 Ga0070679_100036558 Ga0070679_1000365587 289
75 3300005539 Ga0068853_100009749 Ga0068853_1000097498 289
76 3300005539 Ga0068853_100075071 Ga0068853_1000750713 289
77 3300005543 Ga0070672_100031360 Ga0070672_1000313602 289
78 3300005544 Ga0070686_100029354 Ga0070686_1000293542 289
79 3300005563 Ga0068855_100009170 Ga0068855_1000091703 289
80 3300005563 Ga0068855_100081580 Ga0068855_1000815803 289
81 3300005564 Ga0070664_100020475 Ga0070664_1000204756 289
82 3300005577 Ga0068857_100023085 Ga0068857_1000230852 289
83 3300005578 Ga0068854_100036834 Ga0068854_1000368342 289
84 3300005614 Ga0068856_100000104 Ga0068856_10000010457 289
85 3300005615 Ga0070702_100019598 Ga0070702_1000195984 289
86 3300005616 Ga0068852_100002279 Ga0068852_1000022798 289
87 3300005834 Ga0068851_10121257 Ga0068851_101212572 289
88 3300005841 Ga0068863_100023248 Ga0068863_1000232482 289
89 3300006195 Ga0075366_10004074 Ga0075366_100040746 289
90 3300006195 Ga0075366_10006278 Ga0075366_100062782 289
91 3300006237 Ga0097621_100000579 Ga0097621_1000005798 289
92 3300006237 Ga0097621_100000586 Ga0097621_10000058616 289
93 3300006237 Ga0097621_100039231 Ga0097621_1000392312 289
94 3300006353 Ga0075370_10168223 Ga0075370_101682232 289
95 3300006358 Ga0068871_100000212 Ga0068871_10000021231 289
96 3300006358 Ga0068871_100001603 Ga0068871_1000016032 289
97 3300006881 Ga0068865_100003908 Ga0068865_1000039085 289
98 3300009093 Ga0105240_10000104 Ga0105240_1000010471 289
99 3300009093 Ga0105240_10063866 Ga0105240_100638665 289
100 3300009093 Ga0105240_10070596 Ga0105240_100705963 289
101 3300009093 Ga0105240_10094488 Ga0105240_100944885 289
102 3300009093 Ga0105240_10505637 Ga0105240_105056372 289
103 3300009098 Ga0105245_10230596 Ga0105245_102305963 289
104 3300009098 Ga0105245_10679797 Ga0105245_106797971 289
105 3300009148 Ga0105243_10024433 Ga0105243_100244333 289
106 3300009174 Ga0105241_10000609 Ga0105241_100006095 289
107 3300009174 Ga0105241_10009620 Ga0105241_100096207 289
108 3300009174 Ga0105241_10030901 Ga0105241_100309013 289
109 3300009176 Ga0105242_10039161 Ga0105242_100391613 289
110 3300009545 Ga0105237_10001427 Ga0105237_1000142726 289
111 3300009545 Ga0105237_10002980 Ga0105237_1000298024 289
112 3300009545 Ga0105237_10003047 Ga0105237_1000304717 289
113 3300009545 Ga0105237_10011278 Ga0105237_100112788 289
114 3300009545 Ga0105237_10172316 Ga0105237_101723162 289
115 3300009545 Ga0105237_10186160 Ga0105237_101861602 289
116 3300009551 Ga0105238_10058908 Ga0105238_100589082 289
117 3300009553 Ga0105249_10008693 Ga0105249_100086932 289
118 3300009553 Ga0105249_10044140 Ga0105249_100441403 289
119 3300010375 Ga0105239_10000007 Ga0105239_10000007145 289
120 3300010375 Ga0105239_10000015 Ga0105239_10000015221 289
121 3300010375 Ga0105239_10000864 Ga0105239_1000086440 289
122 3300010375 Ga0105239_10030338 Ga0105239_100303385 289
123 3300010375 Ga0105239_10069962 Ga0105239_100699622 289
124 3300010375 Ga0105239_10097637 Ga0105239_100976372 289
125 3300010375 Ga0105239_10335541 Ga0105239_103355412 289
126 3300013100 Ga0157373_10001240 Ga0157373_1000124011 289
127 3300013100 Ga0157373_10002086 Ga0157373_1000208614 289
128 3300013102 Ga0157371_10002507 Ga0157371_1000250711 289
129 3300013102 Ga0157371_10003338 Ga0157371_100033388 289
130 3300013102 Ga0157371_10021914 Ga0157371_100219141 289
131 3300013104 Ga0157370_10003187 Ga0157370_1000318713 289
132 3300013104 Ga0157370_10012309 Ga0157370_1001230912 289
133 3300013104 Ga0157370_10019635 Ga0157370_100196352 289
134 3300013104 Ga0157370_10064921 Ga0157370_100649214 289
135 3300013104 Ga0157370_10178285 Ga0157370_101782852 289
136 3300013105 Ga0157369_10104435 Ga0157369_101044351 289
137 3300013105 Ga0157369_10139013 Ga0157369_101390133 289
138 3300013296 Ga0157374_10001177 Ga0157374_100011773 289
139 3300013296 Ga0157374_10006147 Ga0157374_100061474 289
140 3300013296 Ga0157374_10047739 Ga0157374_100477394 289
141 3300013297 Ga0157378_10001918 Ga0157378_1000191814 289
142 3300013297 Ga0157378_10014455 Ga0157378_100144554 289
143 3300013297 Ga0157378_10021276 Ga0157378_100212762 289
144 3300013297 Ga0157378_10077422 Ga0157378_100774222 289
145 3300013306 Ga0163162_10000871 Ga0163162_100008712 289
146 3300013306 Ga0163162_10002080 Ga0163162_100020809 289
147 3300013306 Ga0163162_10003406 Ga0163162_1000340613 289
148 3300013306 Ga0163162_10025293 Ga0163162_100252932 289
149 3300013306 Ga0163162_10180929 Ga0163162_101809292 289
150 3300013307 Ga0157372_10001414 Ga0157372_1000141420 289
151 3300013307 Ga0157372_10027413 Ga0157372_100274135 289
152 3300013307 Ga0157372_10031343 Ga0157372_100313433 289
153 3300013307 Ga0157372_10113115 Ga0157372_101131153 289
154 3300013307 Ga0157372_10137839 Ga0157372_101378392 289
155 3300013308 Ga0157375_10000118 Ga0157375_1000011845 289
156 3300013308 Ga0157375_10001625 Ga0157375_100016252 289
157 3300013308 Ga0157375_10131057 Ga0157375_101310573 289
158 3300013308 Ga0157375_10190621 Ga0157375_101906213 289
159 3300013308 Ga0157375_10250248 Ga0157375_102502482 289
160 3300013308 Ga0157375_10273768 Ga0157375_102737682 289
161 3300013308 Ga0157375_10758572 Ga0157375_107585721 289
162 3300014325 Ga0163163_10000636 Ga0163163_1000063620 289
163 3300014497 Ga0182008_10000048 Ga0182008_1000004845 289
164 3300014497 Ga0182008_10090120 Ga0182008_100901201 289
165 3300014745 Ga0157377_10030501 Ga0157377_100305012 289
166 3300014968 Ga0157379_10037300 Ga0157379_100373006 289
167 3300014969 Ga0157376_10000378 Ga0157376_1000037813 289
168 3300014969 Ga0157376_10165142 Ga0157376_101651422 289
169 3300015261 Ga0182006_1000103 Ga0182006_100010321 289
170 3300015261 Ga0182006_1006283 Ga0182006_10062834 289
171 3300015262 Ga0182007_10029805 Ga0182007_100298051 289
172 3300017792 Ga0163161_10000672 Ga0163161_1000067219 289
173 3300017792 Ga0163161_10022509 Ga0163161_100225093 289
174 3300017792 Ga0163161_10040002 Ga0163161_100400023 289
175 3300017792 Ga0163161_10073639 Ga0163161_100736393 289
176 3300017792 Ga0163161_10132659 Ga0163161_101326592 289
177 3300025230 Ga0209563_103255 Ga0209563_1032553 289
178 3300025231 Ga0207427_100025 Ga0207427_100025129 289
179 3300025233 Ga0209437_100010 Ga0209437_100010391 289
180 3300025250 Ga0209026_1000225 Ga0209026_100022543 289
181 3300025261 Ga0209233_1000017 Ga0209233_1000017404 289
182 3300025261 Ga0209233_1000655 Ga0209233_100065514 289
183 3300025272 Ga0209455_1000758 Ga0209455_100075811 289
184 3300025885 Ga0207653_10034997 Ga0207653_100349971 289
185 3300025904 Ga0207647_10000169 Ga0207647_1000016928 289
186 3300025904 Ga0207647_10000206 Ga0207647_1000020629 289
187 3300025907 Ga0207645_10000672 Ga0207645_100006724 289
188 3300025907 Ga0207645_10218207 Ga0207645_102182072 289
189 3300025908 Ga0207643_10266106 Ga0207643_102661061 289
190 3300025911 Ga0207654_10000940 Ga0207654_1000094013 289
191 3300025911 Ga0207654_10002291 Ga0207654_100022914 289
192 3300025912 Ga0207707_10007990 Ga0207707_100079906 289
193 3300025913 Ga0207695_10000048 Ga0207695_1000004889 289
194 3300025913 Ga0207695_10008731 Ga0207695_1000873114 289
195 3300025913 Ga0207695_10058385 Ga0207695_100583852 289
196 3300025913 Ga0207695_10283985 Ga0207695_102839851 289
197 3300025913 Ga0207695_10351824 Ga0207695_103518242 289
198 3300025913 Ga0207695_10523926 Ga0207695_105239261 289
199 3300025914 Ga0207671_10005064 Ga0207671_100050642 289
200 3300025914 Ga0207671_10006304 Ga0207671_1000630410 289
201 3300025914 Ga0207671_10008774 Ga0207671_100087744 289
202 3300025914 Ga0207671_10016225 Ga0207671_100162255 289
203 3300025914 Ga0207671_10330170 Ga0207671_103301701 289
204 3300025917 Ga0207660_10018017 Ga0207660_100180173 289
205 3300025919 Ga0207657_10042545 Ga0207657_100425453 289
206 3300025921 Ga0207652_10011595 Ga0207652_100115958 289
207 3300025921 Ga0207652_10066470 Ga0207652_100664703 289
208 3300025924 Ga0207694_10017591 Ga0207694_100175913 289
209 3300025927 Ga0207687_10227262 Ga0207687_102272622 289
210 3300025931 Ga0207644_10004906 Ga0207644_100049064 289
211 3300025931 Ga0207644_10008932 Ga0207644_100089322 289
212 3300025931 Ga0207644_10256232 Ga0207644_102562322 289
213 3300025932 Ga0207690_10000147 Ga0207690_1000014719 289
214 3300025932 Ga0207690_10014393 Ga0207690_100143932 289
215 3300025933 Ga0207706_10000167 Ga0207706_1000016743 289
216 3300025934 Ga0207686_10380838 Ga0207686_103808381 289
217 3300025934 Ga0207686_10462970 Ga0207686_104629701 289
218 3300025935 Ga0207709_10023674 Ga0207709_100236743 289
219 3300025936 Ga0207670_10079985 Ga0207670_100799853 289
220 3300025938 Ga0207704_10000042 Ga0207704_1000004244 289
221 3300025938 Ga0207704_10296384 Ga0207704_102963842 289
222 3300025940 Ga0207691_10154222 Ga0207691_101542222 289
223 3300025941 Ga0207711_10028398 Ga0207711_100283982 289
224 3300025945 Ga0207679_10256138 Ga0207679_102561381 289
225 3300025949 Ga0207667_10073752 Ga0207667_100737523 289
226 3300025949 Ga0207667_10094059 Ga0207667_100940592 289
227 3300025960 Ga0207651_10018322 Ga0207651_100183222 289
228 3300025961 Ga0207712_10024884 Ga0207712_100248842 289
229 3300025961 Ga0207712_10026045 Ga0207712_100260454 289
230 3300025981 Ga0207640_10018940 Ga0207640_100189403 289
231 3300025986 Ga0207658_10313622 Ga0207658_103136222 289
232 3300026023 Ga0207677_10060696 Ga0207677_100606963 289
233 3300026041 Ga0207639_10057307 Ga0207639_100573073 289
234 3300026041 Ga0207639_10089840 Ga0207639_100898402 289
235 3300026041 Ga0207639_10093652 Ga0207639_100936523 289
236 3300026075 Ga0207708_10073643 Ga0207708_100736432 289
237 3300026078 Ga0207702_10000119 Ga0207702_100001199 289
238 3300026078 Ga0207702_10047091 Ga0207702_100470914 289
239 3300026088 Ga0207641_10147673 Ga0207641_101476732 289
240 3300026089 Ga0207648_10003557 Ga0207648_100035579 289
241 3300026089 Ga0207648_10085784 Ga0207648_100857843 289
242 3300026095 Ga0207676_10386236 Ga0207676_103862361 289
243 3300026121 Ga0207683_10040552 Ga0207683_100405523 289
244 3300026121 Ga0207683_10315809 Ga0207683_103158092 289
245 3300026121 Ga0207683_10461876 Ga0207683_104618761 289
246 3300026142 Ga0207698_10001222 Ga0207698_100012223 289
247 3300028379 Ga0268266_10000030 Ga0268266_10000030284 289
248 3300028380 Ga0268265_10504682 Ga0268265_105046821 289
249 3300028558 Ga0265326_10005999 Ga0265326_100059995 289
250 3300028563 Ga0265319_1000171 Ga0265319_10001717 289
251 3300028573 Ga0265334_10000220 Ga0265334_100002204 289
252 3300028577 Ga0265318_10002220 Ga0265318_100022203 289
253 3300028654 Ga0265322_10034893 Ga0265322_100348932 289
254 3300028786 Ga0307517_10011388 Ga0307517_100113883 289
255 3300028794 Ga0307515_10000507 Ga0307515_1000050730 289
256 3300028800 Ga0265338_10000448 Ga0265338_1000044819 289
257 3300028800 Ga0265338_10001633 Ga0265338_1000163317 289
258 3300031239 Ga0265328_10078783 Ga0265328_100787832 289
259 3300031240 Ga0265320_10006371 Ga0265320_100063713 289
260 3300031242 Ga0265329_10042288 Ga0265329_100422882 289
261 3300031507 Ga0307509_10089274 Ga0307509_100892743 289
262 3300031548 Ga0307408_100000578 Ga0307408_1000005782 289
263 3300031548 Ga0307408_100001086 Ga0307408_10000108616 289
264 3300031548 Ga0307408_100001939 Ga0307408_1000019399 289
265 3300031595 Ga0265313_10003787 Ga0265313_100037873 289
266 3300031711 Ga0265314_10048233 Ga0265314_100482333 289
267 3300031712 Ga0265342_10018127 Ga0265342_100181274 289
268 3300031730 Ga0307516_10420721 Ga0307516_104207211 289
269 3300032004 Ga0307414_10000608 Ga0307414_100006088 289
270 3300032004 Ga0307414_10052185 Ga0307414_100521852 289
271 3300032004 Ga0307414_10447515 Ga0307414_104475151 289
272 3300033180 Ga0307510_10000147 Ga0307510_1000014741 289
273 3300035115 Ga0373941_0084057 Ga0373941_0084057_62_931 289
274 3300037312 Ga0395899_0000002 Ga0395899_0000002_312292_313161 289
275 3300037312 Ga0395899_0000286 Ga0395899_0000286_50548_51420 289
276 3300037418 Ga0395900_0000115 Ga0395900_0000115_112820_113692 289
277 3300037418 Ga0395900_0004784 Ga0395900_0004784_12051_12920 289
278 3300037418 Ga0395900_0140357 Ga0395900_0140357_101_970 289
279 3300037466 Ga0395898_0010131 Ga0395898_0010131_8688_9560 289
280 3300037471 Ga0395905_0000045 Ga0395905_0000045_112626_113498 289
281 3300037471 Ga0395905_0001113 Ga0395905_0001113_23536_24405 289
282 3300037471 Ga0395905_0394886 Ga0395905_0394886_268_1137 289
283 3300038443 Ga0395901_0000254 Ga0395901_0000254_62439_63311 289
284 3300038443 Ga0395901_0006539 Ga0395901_0006539_10841_11710 289
285 3300038443 Ga0395901_0116658 Ga0395901_0116658_1488_2357 289
286 3300045051 Ga0451576_0117261 Ga0451576_0117261_516_1406 289
287 3300046459 Ga0495629_0100797 Ga0495629_0100797_243_1112 289
288 3300046460 Ga0495638_0135022 Ga0495638_0135022_309_1178 289
289 3300046462 Ga0495651_0267440 Ga0495651_0267440_243_1112 289
290 3300046471 Ga0495650_0000198 Ga0495650_0000198_31355_32224 289
291 3300046471 Ga0495650_0071548 Ga0495650_0071548_377_1246 289
292 3300046492 Ga0495585_0002633 Ga0495585_0002633_8988_9857 289
293 3300046492 Ga0495585_0006258 Ga0495585_0006258_1136_2005 289
294 3300046499 Ga0495594_0055291 Ga0495594_0055291_1171_2061 289
295 3300046500 Ga0495596_0016929 Ga0495596_0016929_923_1792 289
296 3300046506 Ga0495583_0037848 Ga0495583_0037848_1334_2203 289
297 3300046507 Ga0495606_0000003 Ga0495606_0000003_9854_10723 289
298 3300046507 Ga0495606_0012375 Ga0495606_0012375_3750_4619 289
299 3300046507 Ga0495606_0014704 Ga0495606_0014704_3896_4765 289
300 3300046507 Ga0495606_0054176 Ga0495606_0054176_564_1433 289
301 3300046507 Ga0495606_0111876 Ga0495606_0111876_697_1566 289
302 3300046512 Ga0495610_0015317 Ga0495610_0015317_2462_3331 289
303 3300046512 Ga0495610_0122677 Ga0495610_0122677_258_1127 289
304 3300046513 Ga0495616_0052238 Ga0495616_0052238_1102_1971 289
305 3300046524 Ga0495648_0003102 Ga0495648_0003102_11950_12819 289
306 3300046524 Ga0495648_0022342 Ga0495648_0022342_3367_4236 289
307 3300046529 Ga0495652_0311750 Ga0495652_0311750_13_882 289
308 3300046558 Ga0495633_0000267 Ga0495633_0000267_23169_24038 289
309 3300046616 Ga0495668_0000010 Ga0495668_0000010_460117_460986 289
310 3300046660 Ga0495625_0000456 Ga0495625_0000456_6885_7754 289
311 3300046660 Ga0495625_0000524 Ga0495625_0000524_27807_28676 289
312 3300046660 Ga0495625_0003704 Ga0495625_0003704_10008_10877 289
313 3300046660 Ga0495625_0043481 Ga0495625_0043481_1168_2037 289
314 3300046660 Ga0495625_0077607 Ga0495625_0077607_683_1552 289
315 3300046660 Ga0495625_0124116 Ga0495625_0124116_809_1678 289
316 3300046660 Ga0495625_0207130 Ga0495625_0207130_156_1025 289
317 3300046665 Ga0495661_0000924 Ga0495661_0000924_2812_3681 289
318 3300046665 Ga0495661_0015466 Ga0495661_0015466_3385_4254 289
319 3300046665 Ga0495661_0017815 Ga0495661_0017815_21_890 289
320 3300046694 Ga0495649_0000168 Ga0495649_0000168_28334_29203 289
321 3300046810 Ga0495660_0007737 Ga0495660_0007737_5332_6201 289
322 3300047443 Ga0495687_001225 Ga0495687_001225_20615_21484 289
323 3300047443 Ga0495687_017007 Ga0495687_017007_2025_2897 289
324 3300047446 Ga0495679_024124 Ga0495679_024124_185_1054 289
325 3300047469 Ga0495673_0025798 Ga0495673_0025798_553_1422 289
326 3300047472 Ga0495686_0000845 Ga0495686_0000845_20753_21622 289
327 3300047472 Ga0495686_0000974 Ga0495686_0000974_18443_19312 289
328 3300047472 Ga0495686_0041318 Ga0495686_0041318_473_1342 289
329 3300048917 Ga0496114_0081057 Ga0496114_0081057_1188_2057 289
330 3300048925 Ga0496122_0005789 Ga0496122_0005789_5229_6104 289
331 3300049459 Ga0495678_038134 Ga0495678_038134_159_1028 289
332 3300049460 Ga0495682_0050695 Ga0495682_0050695_623_1492 289
333 3300049572 Ga0501036_0156326 Ga0501036_0156326_785_1654 289
334 3300049573 Ga0501037_0007731 Ga0501037_0007731_5805_6674 289
335 3300049574 Ga0501038_0064235 Ga0501038_0064235_314_1183 289
336 3300049575 Ga0501039_0490305 Ga0501039_0490305_11_880 289
337 3300049581 Ga0501047_0062647 Ga0501047_0062647_1721_2590 289
338 3300049675 Ga0501243_006992 Ga0501243_006992_208_1083 289
339 3300049822 Ga0501035_0296139 Ga0501035_0296139_455_1324 289
340 3300049823 Ga0501044_0012622 Ga0501044_0012622_3515_4384 289
341 3300050493 nmdc:mga0k408_156_c1 nmdc:mga0k408_156_c1_17435_18304 289
342 3300050493 nmdc:mga0k408_6061_c1 nmdc:mga0k408_6061_c1_189_1058 289
343 3300050493 nmdc:mga0k408_93952_c1 nmdc:mga0k408_93952_c1_317_1186 289
344 3300050496 nmdc:mga07m45_225701_c1 nmdc:mga07m45_225701_c1_80_949 289
345 3300053122 Ga0500608_009264 Ga0500608_009264_519_1388 289
346 3300053122 Ga0500608_074613 Ga0500608_074613_71_991 289
347 3300053125 Ga0500618_000038 Ga0500618_000038_3371_4240 289
348 3300053130 Ga0500642_0019775 Ga0500642_0019775_920_1789 289
349 3300053140 Ga0500573_0101342 Ga0500573_0101342_154_1029 289
350 3300053156 Ga0500622_0011602 Ga0500622_0011602_2787_3656 289
351 3300053157 Ga0500624_000278 Ga0500624_000278_3327_4250 289
352 iso_pu_bacteria 2932082852 2932086400 289
353 3300005334 Ga0068869_100018905 Ga0068869_1000189051 290
354 3300005334 Ga0068869_100046930 Ga0068869_1000469301 290
355 3300005338 Ga0068868_100074081 Ga0068868_1000740812 290
356 3300005355 Ga0070671_100190925 Ga0070671_1001909251 290
357 3300005356 Ga0070674_100001154 Ga0070674_1000011544 290
358 3300005440 Ga0070705_100000614 Ga0070705_10000061412 290
359 3300005459 Ga0068867_100004996 Ga0068867_1000049964 290
360 3300005459 Ga0068867_100058992 Ga0068867_1000589921 290
361 3300005459 Ga0068867_100093402 Ga0068867_1000934021 290
362 3300005471 Ga0070698_100002401 Ga0070698_1000024019 290
363 3300005539 Ga0068853_100086863 Ga0068853_1000868632 290
364 3300005546 Ga0070696_100008024 Ga0070696_1000080244 290
365 3300005549 Ga0070704_100020577 Ga0070704_1000205772 290
366 3300005578 Ga0068854_100032235 Ga0068854_1000322353 290
367 3300005615 Ga0070702_100060720 Ga0070702_1000607202 290
368 3300005616 Ga0068852_100267830 Ga0068852_1002678302 290
369 3300005617 Ga0068859_100020688 Ga0068859_1000206883 290
370 3300005718 Ga0068866_10000672 Ga0068866_100006722 290
371 3300005719 Ga0068861_100016204 Ga0068861_1000162045 290
372 3300005719 Ga0068861_100033474 Ga0068861_1000334743 290
373 3300005843 Ga0068860_100023982 Ga0068860_1000239822 290
374 3300005843 Ga0068860_100036960 Ga0068860_1000369603 290
375 3300006237 Ga0097621_100055070 Ga0097621_1000550702 290
376 3300006847 Ga0075431_100262683 Ga0075431_1002626832 290
377 3300006881 Ga0068865_100000264 Ga0068865_10000026413 290
378 3300006931 Ga0097620_100020689 Ga0097620_1000206895 290
379 3300009148 Ga0105243_10002943 Ga0105243_100029431 290
380 3300009174 Ga0105241_10267191 Ga0105241_102671912 290
381 3300009176 Ga0105242_10027904 Ga0105242_100279042 290
382 3300009176 Ga0105242_10059231 Ga0105242_100592313 290
383 3300009177 Ga0105248_10185760 Ga0105248_101857601 290
384 3300010375 Ga0105239_10059237 Ga0105239_100592372 290
385 3300011119 Ga0105246_10010437 Ga0105246_100104374 290
386 3300013102 Ga0157371_10054408 Ga0157371_100544083 290
387 3300013102 Ga0157371_10118318 Ga0157371_101183181 290
388 3300013102 Ga0157371_10134964 Ga0157371_101349642 290
389 3300013297 Ga0157378_10005877 Ga0157378_100058774 290
390 3300013306 Ga0163162_10003892 Ga0163162_1000389211 290
391 3300013308 Ga0157375_10173309 Ga0157375_101733092 290
392 3300013308 Ga0157375_10557583 Ga0157375_105575832 290
393 3300014326 Ga0157380_10001070 Ga0157380_1000107012 290
394 3300014326 Ga0157380_10086738 Ga0157380_100867382 290
395 3300025907 Ga0207645_10000536 Ga0207645_1000053621 290
396 3300025913 Ga0207695_10202776 Ga0207695_102027762 290
397 3300025923 Ga0207681_10024366 Ga0207681_100243662 290
398 3300025931 Ga0207644_10214632 Ga0207644_102146322 290
399 3300025933 Ga0207706_10000038 Ga0207706_1000003836 290
400 3300025934 Ga0207686_10000481 Ga0207686_1000048111 290
401 3300025934 Ga0207686_10360981 Ga0207686_103609811 290
402 3300025935 Ga0207709_10015358 Ga0207709_100153582 290
403 3300025937 Ga0207669_10001204 Ga0207669_100012047 290
404 3300025938 Ga0207704_10018404 Ga0207704_100184042 290
405 3300025938 Ga0207704_10360541 Ga0207704_103605411 290
406 3300025940 Ga0207691_10095297 Ga0207691_100952973 290
407 3300025941 Ga0207711_10029091 Ga0207711_100290912 290
408 3300025942 Ga0207689_10000945 Ga0207689_100009453 290
409 3300025961 Ga0207712_10102072 Ga0207712_101020723 290
410 3300025981 Ga0207640_10024008 Ga0207640_100240081 290
411 3300025986 Ga0207658_10373683 Ga0207658_103736831 290
412 3300026023 Ga0207677_10323758 Ga0207677_103237582 290
413 3300026041 Ga0207639_10047774 Ga0207639_100477742 290
414 3300026089 Ga0207648_10000036 Ga0207648_1000003637 290
415 3300026089 Ga0207648_10075182 Ga0207648_100751821 290
416 3300026116 Ga0207674_10543312 Ga0207674_105433122 290
417 3300026118 Ga0207675_100029699 Ga0207675_1000296995 290
418 3300026118 Ga0207675_100050955 Ga0207675_1000509553 290
419 3300026118 Ga0207675_100191812 Ga0207675_1001918122 290
420 3300028381 Ga0268264_10003271 Ga0268264_1000327111 290
421 3300028381 Ga0268264_10013186 Ga0268264_100131862 290
422 3300042876 Ga0451577_0020546 Ga0451577_0020546_3420_4292 290
423 3300042876 Ga0451577_0032953 Ga0451577_0032953_3117_4040 290
424 3300044712 Ga0453684_0231041 Ga0453684_0231041_500_1423 290
425 3300045051 Ga0451576_0048038 Ga0451576_0048038_1522_2445 290
426 3300047318 Ga0495636_0109904 Ga0495636_0109904_170_1063 290
427 3300047320 Ga0495672_0089092 Ga0495672_0089092_419_1291 290
428 3300048903 Ga0496100_0049855 Ga0496100_0049855_153_1046 290
429 3300048909 Ga0496106_0027781 Ga0496106_0027781_979_1872 290
430 3300048917 Ga0496114_0016464 Ga0496114_0016464_3430_4323 290
431 2162886007 SwRhRL2b_contig_1599521 SwRhRL2b_0027.00007310 291
432 2162886007 SwRhRL2b_contig_3865623 SwRhRL2b_0963.00005680 291
433 3300002774 JGI25150J39212_1000015 JGI25150J39212_10000152 291
434 3300003187 JGI25151J46595_10000043 JGI25151J46595_10000043132 291
435 3300003215 JGI25153J46596_10000009 JGI25153J46596_10000009145 291
436 3300003322 rootL2_10001385 rootL2_100013855 291
437 3300003322 rootL2_10071161 rootL2_100711611 291
438 3300003323 rootH1_10008582 rootH1_10008582145 291
439 3300003323 rootH1_10025210 rootH1_100252106 291
440 3300003354 JGI25160J50197_1010888 JGI25160J50197_10108882 291
441 3300003781 Ga0055536_1000019 Ga0055536_100001926 291
442 3300003791 Ga0055530_10003660 Ga0055530_100036605 291
443 3300003794 Ga0055531_10000144 Ga0055531_1000014456 291
444 3300003794 Ga0055531_10000559 Ga0055531_1000055928 291
445 3300005289 Ga0065704_10002638 Ga0065704_100026384 291
446 3300005289 Ga0065704_10070962 Ga0065704_100709624 291
447 3300005290 Ga0065712_10082930 Ga0065712_100829302 291
448 3300005290 Ga0065712_10092198 Ga0065712_100921981 291
449 3300005290 Ga0065712_10143882 Ga0065712_101438822 291
450 3300005290 Ga0065712_10221579 Ga0065712_102215791 291
451 3300005327 Ga0070658_10033640 Ga0070658_100336403 291
452 3300005328 Ga0070676_10002554 Ga0070676_100025545 291
453 3300005329 Ga0070683_100002314 Ga0070683_1000023143 291
454 3300005329 Ga0070683_100049155 Ga0070683_1000491552 291
455 3300005329 Ga0070683_100050964 Ga0070683_1000509642 291
456 3300005329 Ga0070683_100179132 Ga0070683_1001791322 291
457 3300005331 Ga0070670_100027148 Ga0070670_1000271486 291
458 3300005331 Ga0070670_100066317 Ga0070670_1000663172 291
459 3300005331 Ga0070670_100120637 Ga0070670_1001206372 291
460 3300005331 Ga0070670_100141292 Ga0070670_1001412922 291
461 3300005334 Ga0068869_100036830 Ga0068869_1000368302 291
462 3300005335 Ga0070666_10000135 Ga0070666_100001358 291
463 3300005335 Ga0070666_10002025 Ga0070666_100020254 291
464 3300005335 Ga0070666_10002566 Ga0070666_100025662 291
465 3300005335 Ga0070666_10282195 Ga0070666_102821952 291
466 3300005336 Ga0070680_100019405 Ga0070680_1000194054 291
467 3300005336 Ga0070680_100420565 Ga0070680_1004205652 291
468 3300005337 Ga0070682_100019480 Ga0070682_1000194803 291
469 3300005338 Ga0068868_100000346 Ga0068868_10000034617 291
470 3300005338 Ga0068868_100023630 Ga0068868_1000236303 291
471 3300005338 Ga0068868_100023876 Ga0068868_1000238762 291
472 3300005338 Ga0068868_100123383 Ga0068868_1001233832 291
473 3300005340 Ga0070689_100045450 Ga0070689_1000454502 291
474 3300005340 Ga0070689_100096685 Ga0070689_1000966851 291
475 3300005340 Ga0070689_100153373 Ga0070689_1001533731 291
476 3300005341 Ga0070691_10002703 Ga0070691_100027034 291
477 3300005341 Ga0070691_10013653 Ga0070691_100136533 291
478 3300005344 Ga0070661_100000309 Ga0070661_10000030935 291
479 3300005347 Ga0070668_100001621 Ga0070668_1000016217 291
480 3300005347 Ga0070668_100118657 Ga0070668_1001186572 291
481 3300005347 Ga0070668_100309168 Ga0070668_1003091682 291
482 3300005353 Ga0070669_100001811 Ga0070669_1000018113 291
483 3300005353 Ga0070669_100026569 Ga0070669_1000265691 291
484 3300005353 Ga0070669_100273468 Ga0070669_1002734682 291
485 3300005354 Ga0070675_100025703 Ga0070675_1000257034 291
486 3300005354 Ga0070675_100029719 Ga0070675_1000297193 291
487 3300005354 Ga0070675_100045543 Ga0070675_1000455433 291
488 3300005354 Ga0070675_100058628 Ga0070675_1000586283 291
489 3300005354 Ga0070675_100103555 Ga0070675_1001035552 291
490 3300005354 Ga0070675_100134598 Ga0070675_1001345984 291
491 3300005355 Ga0070671_100044961 Ga0070671_1000449612 291
492 3300005355 Ga0070671_100304743 Ga0070671_1003047431 291
493 3300005356 Ga0070674_100075747 Ga0070674_1000757473 291
494 3300005364 Ga0070673_100012228 Ga0070673_1000122285 291
495 3300005364 Ga0070673_100035168 Ga0070673_1000351681 291
496 3300005364 Ga0070673_100085144 Ga0070673_1000851441 291
497 3300005365 Ga0070688_100000797 Ga0070688_10000079710 291
498 3300005365 Ga0070688_100010642 Ga0070688_1000106424 291
499 3300005365 Ga0070688_100093239 Ga0070688_1000932392 291
500 3300005365 Ga0070688_100115543 Ga0070688_1001155433 291
501 3300005365 Ga0070688_100152736 Ga0070688_1001527362 291
502 3300005366 Ga0070659_100027777 Ga0070659_1000277772 291
503 3300005367 Ga0070667_100001883 Ga0070667_1000018837 291
504 3300005367 Ga0070667_100022393 Ga0070667_1000223932 291
505 3300005367 Ga0070667_100038061 Ga0070667_1000380613 291
506 3300005436 Ga0070713_100125449 Ga0070713_1001254492 291
507 3300005456 Ga0070678_100068655 Ga0070678_1000686553 291
508 3300005457 Ga0070662_100040400 Ga0070662_1000404003 291
509 3300005458 Ga0070681_10037085 Ga0070681_100370855 291
510 3300005458 Ga0070681_10587577 Ga0070681_105875771 291
511 3300005459 Ga0068867_100014723 Ga0068867_1000147236 291
512 3300005459 Ga0068867_100082126 Ga0068867_1000821262 291
513 3300005466 Ga0070685_10004778 Ga0070685_100047784 291
514 3300005466 Ga0070685_10032145 Ga0070685_100321452 291
515 3300005466 Ga0070685_10131185 Ga0070685_101311851 291
516 3300005471 Ga0070698_100004441 Ga0070698_1000044417 291
517 3300005471 Ga0070698_100188834 Ga0070698_1001888342 291
518 3300005471 Ga0070698_100337335 Ga0070698_1003373352 291
519 3300005530 Ga0070679_100022452 Ga0070679_1000224525 291
520 3300005535 Ga0070684_100000823 Ga0070684_10000082314 291
521 3300005535 Ga0070684_100001699 Ga0070684_1000016992 291
522 3300005535 Ga0070684_100024327 Ga0070684_1000243274 291
523 3300005535 Ga0070684_100074493 Ga0070684_1000744933 291
524 3300005535 Ga0070684_100363490 Ga0070684_1003634902 291
525 3300005539 Ga0068853_100004185 Ga0068853_1000041854 291
526 3300005539 Ga0068853_100014984 Ga0068853_1000149842 291
527 3300005539 Ga0068853_100021323 Ga0068853_1000213233 291
528 3300005539 Ga0068853_100026820 Ga0068853_1000268203 291
529 3300005543 Ga0070672_100000840 Ga0070672_1000008404 291
530 3300005548 Ga0070665_100000001 Ga0070665_100000001646 291
531 3300005548 Ga0070665_100001766 Ga0070665_1000017668 291
532 3300005563 Ga0068855_100000089 Ga0068855_10000008953 291
533 3300005563 Ga0068855_100003029 Ga0068855_1000030299 291
534 3300005563 Ga0068855_100005857 Ga0068855_10000585711 291
535 3300005563 Ga0068855_100007823 Ga0068855_1000078238 291
536 3300005563 Ga0068855_100213189 Ga0068855_1002131892 291
537 3300005564 Ga0070664_100013649 Ga0070664_1000136495 291
538 3300005564 Ga0070664_100014161 Ga0070664_1000141612 291
539 3300005564 Ga0070664_100136174 Ga0070664_1001361742 291
540 3300005564 Ga0070664_100140932 Ga0070664_1001409322 291
541 3300005564 Ga0070664_100294277 Ga0070664_1002942772 291
542 3300005577 Ga0068857_100002744 Ga0068857_1000027449 291
543 3300005577 Ga0068857_100018587 Ga0068857_1000185875 291
544 3300005578 Ga0068854_100022883 Ga0068854_1000228834 291
545 3300005578 Ga0068854_100090956 Ga0068854_1000909562 291
546 3300005614 Ga0068856_100019556 Ga0068856_1000195562 291
547 3300005614 Ga0068856_100100991 Ga0068856_1001009912 291
548 3300005615 Ga0070702_100031741 Ga0070702_1000317413 291
549 3300005616 Ga0068852_100065071 Ga0068852_1000650713 291
550 3300005616 Ga0068852_100251633 Ga0068852_1002516332 291
551 3300005617 Ga0068859_100000127 Ga0068859_10000012745 291
552 3300005617 Ga0068859_100008901 Ga0068859_1000089015 291
553 3300005617 Ga0068859_100074856 Ga0068859_1000748563 291
554 3300005617 Ga0068859_100460630 Ga0068859_1004606302 291
555 3300005617 Ga0068859_100650379 Ga0068859_1006503792 291
556 3300005618 Ga0068864_100003469 Ga0068864_1000034698 291
557 3300005618 Ga0068864_100009571 Ga0068864_1000095719 291
558 3300005618 Ga0068864_100029379 Ga0068864_1000293793 291
559 3300005618 Ga0068864_100057779 Ga0068864_1000577793 291
560 3300005618 Ga0068864_100071253 Ga0068864_1000712533 291
561 3300005618 Ga0068864_100137455 Ga0068864_1001374552 291
562 3300005618 Ga0068864_100348222 Ga0068864_1003482222 291
563 3300005618 Ga0068864_100447387 Ga0068864_1004473872 291
564 3300005718 Ga0068866_10013596 Ga0068866_100135963 291
565 3300005718 Ga0068866_10110441 Ga0068866_101104412 291
566 3300005719 Ga0068861_100013626 Ga0068861_1000136262 291
567 3300005719 Ga0068861_100019242 Ga0068861_1000192422 291
568 3300005719 Ga0068861_100505641 Ga0068861_1005056411 291
569 3300005834 Ga0068851_10000010 Ga0068851_100000109 291
570 3300005834 Ga0068851_10000863 Ga0068851_100008633 291
571 3300005841 Ga0068863_100000546 Ga0068863_1000005467 291
572 3300005841 Ga0068863_100001425 Ga0068863_1000014252 291
573 3300005841 Ga0068863_100111487 Ga0068863_1001114872 291
574 3300005841 Ga0068863_100665499 Ga0068863_1006654991 291
575 3300005842 Ga0068858_100000505 Ga0068858_10000050518 291
576 3300005842 Ga0068858_100014075 Ga0068858_1000140758 291
577 3300005842 Ga0068858_100031927 Ga0068858_1000319276 291
578 3300005842 Ga0068858_100128362 Ga0068858_1001283622 291
579 3300005843 Ga0068860_100000111 Ga0068860_10000011153 291
580 3300005843 Ga0068860_100002119 Ga0068860_10000211917 291
581 3300005843 Ga0068860_100005385 Ga0068860_1000053857 291
582 3300005843 Ga0068860_100014120 Ga0068860_1000141203 291
583 3300005843 Ga0068860_100018651 Ga0068860_1000186514 291
584 3300005844 Ga0068862_100012975 Ga0068862_1000129752 291
585 3300005985 Ga0081539_10033663 Ga0081539_100336633 291
586 3300006163 Ga0070715_10049955 Ga0070715_100499552 291
587 3300006195 Ga0075366_10011952 Ga0075366_100119522 291
588 3300006195 Ga0075366_10079830 Ga0075366_100798302 291
589 3300006237 Ga0097621_100002660 Ga0097621_1000026608 291
590 3300006237 Ga0097621_100005487 Ga0097621_1000054877 291
591 3300006237 Ga0097621_100311840 Ga0097621_1003118402 291
592 3300006358 Ga0068871_100001377 Ga0068871_1000013774 291
593 3300006358 Ga0068871_100068598 Ga0068871_1000685984 291
594 3300006844 Ga0075428_100025699 Ga0075428_1000256994 291
595 3300006880 Ga0075429_100001604 Ga0075429_1000016049 291
596 3300006880 Ga0075429_100019706 Ga0075429_1000197063 291
597 3300006881 Ga0068865_100012416 Ga0068865_1000124164 291
598 3300006931 Ga0097620_100000127 Ga0097620_10000012726 291
599 3300006931 Ga0097620_100008901 Ga0097620_1000089015 291
600 3300006931 Ga0097620_100074860 Ga0097620_1000748603 291
601 3300006931 Ga0097620_100460665 Ga0097620_1004606652 291
602 3300006931 Ga0097620_100650420 Ga0097620_1006504201 291
603 3300009093 Ga0105240_10000074 Ga0105240_1000007465 291
604 3300009093 Ga0105240_10001630 Ga0105240_1000163011 291
605 3300009093 Ga0105240_10003016 Ga0105240_1000301622 291
606 3300009093 Ga0105240_10003457 Ga0105240_1000345722 291
607 3300009093 Ga0105240_10013866 Ga0105240_100138668 291
608 3300009093 Ga0105240_10036376 Ga0105240_100363766 291
609 3300009093 Ga0105240_10248840 Ga0105240_102488402 291
610 3300009093 Ga0105240_10270843 Ga0105240_102708432 291
611 3300009093 Ga0105240_10281100 Ga0105240_102811002 291
612 3300009093 Ga0105240_10296427 Ga0105240_102964272 291
613 3300009094 Ga0111539_10001795 Ga0111539_1000179527 291
614 3300009094 Ga0111539_10002481 Ga0111539_100024812 291
615 3300009094 Ga0111539_10096181 Ga0111539_100961812 291
616 3300009094 Ga0111539_10158671 Ga0111539_101586711 291
617 3300009094 Ga0111539_10295000 Ga0111539_102950001 291
618 3300009094 Ga0111539_10658699 Ga0111539_106586992 291
619 3300009098 Ga0105245_10137472 Ga0105245_101374723 291
620 3300009101 Ga0105247_10004365 Ga0105247_100043656 291
621 3300009101 Ga0105247_10032589 Ga0105247_100325891 291
622 3300009147 Ga0114129_10161864 Ga0114129_101618643 291
623 3300009147 Ga0114129_10164802 Ga0114129_101648023 291
624 3300009147 Ga0114129_10187296 Ga0114129_101872963 291
625 3300009148 Ga0105243_10000025 Ga0105243_10000025107 291
626 3300009148 Ga0105243_10352515 Ga0105243_103525152 291
627 3300009174 Ga0105241_10001018 Ga0105241_100010184 291
628 3300009174 Ga0105241_10001544 Ga0105241_100015447 291
629 3300009174 Ga0105241_10012092 Ga0105241_100120927 291
630 3300009174 Ga0105241_10114973 Ga0105241_101149732 291
631 3300009174 Ga0105241_10166860 Ga0105241_101668602 291
632 3300009174 Ga0105241_10251360 Ga0105241_102513602 291
633 3300009176 Ga0105242_10025247 Ga0105242_100252474 291
634 3300009176 Ga0105242_10307197 Ga0105242_103071971 291
635 3300009177 Ga0105248_10016149 Ga0105248_100161492 291
636 3300009545 Ga0105237_10001607 Ga0105237_100016071 291
637 3300009545 Ga0105237_10007044 Ga0105237_100070442 291
638 3300009545 Ga0105237_10013498 Ga0105237_100134983 291
639 3300009545 Ga0105237_10116470 Ga0105237_101164702 291
640 3300009551 Ga0105238_10001119 Ga0105238_1000111912 291
641 3300009551 Ga0105238_10045942 Ga0105238_100459422 291
642 3300009551 Ga0105238_10154232 Ga0105238_101542322 291
643 3300009553 Ga0105249_10002959 Ga0105249_100029598 291
644 3300009553 Ga0105249_10012344 Ga0105249_100123444 291
645 3300009553 Ga0105249_10021579 Ga0105249_100215795 291
646 3300009553 Ga0105249_10032963 Ga0105249_100329632 291
647 3300009553 Ga0105249_10037774 Ga0105249_100377745 291
648 3300009553 Ga0105249_10071328 Ga0105249_100713282 291
649 3300009553 Ga0105249_10119889 Ga0105249_101198893 291
650 3300009553 Ga0105249_10430901 Ga0105249_104309012 291
651 3300010375 Ga0105239_10000048 Ga0105239_1000004819 291
652 3300010375 Ga0105239_10000314 Ga0105239_1000031424 291
653 3300010375 Ga0105239_10000853 Ga0105239_1000085322 291
654 3300010375 Ga0105239_10007377 Ga0105239_100073773 291
655 3300010375 Ga0105239_10024795 Ga0105239_100247955 291
656 3300010375 Ga0105239_10044414 Ga0105239_100444142 291
657 3300010375 Ga0105239_10050569 Ga0105239_100505694 291
658 3300010375 Ga0105239_10062112 Ga0105239_100621122 291
659 3300010375 Ga0105239_10108921 Ga0105239_101089212 291
660 3300010375 Ga0105239_10171663 Ga0105239_101716631 291
661 3300011119 Ga0105246_10087613 Ga0105246_100876131 291
662 3300013100 Ga0157373_10008399 Ga0157373_100083994 291
663 3300013100 Ga0157373_10043290 Ga0157373_100432901 291
664 3300013100 Ga0157373_10046828 Ga0157373_100468283 291
665 3300013100 Ga0157373_10073914 Ga0157373_100739142 291
666 3300013100 Ga0157373_10191475 Ga0157373_101914752 291
667 3300013102 Ga0157371_10000037 Ga0157371_10000037189 291
668 3300013102 Ga0157371_10000220 Ga0157371_1000022060 291
669 3300013102 Ga0157371_10002087 Ga0157371_100020879 291
670 3300013102 Ga0157371_10002091 Ga0157371_100020914 291
671 3300013102 Ga0157371_10007834 Ga0157371_100078344 291
672 3300013104 Ga0157370_10001415 Ga0157370_100014153 291
673 3300013104 Ga0157370_10001827 Ga0157370_1000182723 291
674 3300013104 Ga0157370_10002234 Ga0157370_100022349 291
675 3300013104 Ga0157370_10006395 Ga0157370_100063954 291
676 3300013104 Ga0157370_10010736 Ga0157370_100107363 291
677 3300013104 Ga0157370_10010796 Ga0157370_100107963 291
678 3300013104 Ga0157370_10012412 Ga0157370_100124124 291
679 3300013104 Ga0157370_10016537 Ga0157370_100165376 291
680 3300013104 Ga0157370_10035920 Ga0157370_100359203 291
681 3300013104 Ga0157370_10041237 Ga0157370_100412372 291
682 3300013104 Ga0157370_10065890 Ga0157370_100658903 291
683 3300013104 Ga0157370_10468509 Ga0157370_104685091 291
684 3300013105 Ga0157369_10000031 Ga0157369_10000031122 291
685 3300013105 Ga0157369_10071400 Ga0157369_100714004 291
686 3300013296 Ga0157374_10000001 Ga0157374_10000001282 291
687 3300013296 Ga0157374_10024365 Ga0157374_100243652 291
688 3300013296 Ga0157374_10042435 Ga0157374_100424351 291
689 3300013296 Ga0157374_10067364 Ga0157374_100673642 291
690 3300013296 Ga0157374_10076000 Ga0157374_100760003 291
691 3300013296 Ga0157374_10097407 Ga0157374_100974072 291
692 3300013297 Ga0157378_10007196 Ga0157378_100071968 291
693 3300013297 Ga0157378_10036254 Ga0157378_100362543 291
694 3300013297 Ga0157378_10239054 Ga0157378_102390542 291
695 3300013306 Ga0163162_10000101 Ga0163162_1000010114 291
696 3300013306 Ga0163162_10000227 Ga0163162_100002273 291
697 3300013306 Ga0163162_10001177 Ga0163162_100011775 291
698 3300013306 Ga0163162_10006263 Ga0163162_100062639 291
699 3300013306 Ga0163162_10009506 Ga0163162_100095067 291
700 3300013306 Ga0163162_10012052 Ga0163162_100120522 291
701 3300013306 Ga0163162_10014268 Ga0163162_100142688 291
702 3300013306 Ga0163162_10015601 Ga0163162_100156019 291
703 3300013306 Ga0163162_10030170 Ga0163162_100301703 291
704 3300013306 Ga0163162_10498991 Ga0163162_104989911 291
705 3300013306 Ga0163162_10679652 Ga0163162_106796522 291
706 3300013307 Ga0157372_10000804 Ga0157372_1000080422 291
707 3300013307 Ga0157372_10099370 Ga0157372_100993702 291
708 3300013307 Ga0157372_10318581 Ga0157372_103185812 291
709 3300013307 Ga0157372_10394649 Ga0157372_103946491 291
710 3300013307 Ga0157372_10704924 Ga0157372_107049241 291
711 3300013308 Ga0157375_10004861 Ga0157375_100048619 291
712 3300013308 Ga0157375_10007692 Ga0157375_100076924 291
713 3300013308 Ga0157375_10015273 Ga0157375_100152737 291
714 3300013308 Ga0157375_10038711 Ga0157375_100387112 291
715 3300013308 Ga0157375_10104315 Ga0157375_101043153 291
716 3300013308 Ga0157375_10114211 Ga0157375_101142113 291
717 3300014325 Ga0163163_10001351 Ga0163163_1000135120 291
718 3300014325 Ga0163163_10002778 Ga0163163_100027783 291
719 3300014325 Ga0163163_10084057 Ga0163163_100840571 291
720 3300014326 Ga0157380_10001555 Ga0157380_100015553 291
721 3300014497 Ga0182008_10000572 Ga0182008_1000057220 291
722 3300014745 Ga0157377_10004058 Ga0157377_100040585 291
723 3300014745 Ga0157377_10005239 Ga0157377_100052392 291
724 3300014968 Ga0157379_10000536 Ga0157379_100005368 291
725 3300014968 Ga0157379_10045049 Ga0157379_100450491 291
726 3300014968 Ga0157379_10193488 Ga0157379_101934882 291
727 3300014968 Ga0157379_10259554 Ga0157379_102595541 291
728 3300014969 Ga0157376_10000697 Ga0157376_100006978 291
729 3300014969 Ga0157376_10000873 Ga0157376_1000087312 291
730 3300014969 Ga0157376_10001271 Ga0157376_100012717 291
731 3300014969 Ga0157376_10004501 Ga0157376_100045014 291
732 3300014969 Ga0157376_10077611 Ga0157376_100776112 291
733 3300014969 Ga0157376_10120246 Ga0157376_101202462 291
734 3300014969 Ga0157376_10286253 Ga0157376_102862531 291
735 3300014969 Ga0157376_10486400 Ga0157376_104864001 291
736 3300015261 Ga0182006_1000159 Ga0182006_10001596 291
737 3300015261 Ga0182006_1000237 Ga0182006_100023716 291
738 3300015261 Ga0182006_1002314 Ga0182006_10023143 291
739 3300015262 Ga0182007_10000002 Ga0182007_10000002152 291
740 3300015265 Ga0182005_1000091 Ga0182005_100009123 291
741 3300015682 Ga0183373_1004 Ga0183373_1004325 291
742 3300017792 Ga0163161_10002407 Ga0163161_100024074 291
743 3300017792 Ga0163161_10002660 Ga0163161_100026606 291
744 3300017792 Ga0163161_10006842 Ga0163161_100068423 291
745 3300017792 Ga0163161_10008268 Ga0163161_100082682 291
746 3300017792 Ga0163161_10020027 Ga0163161_100200272 291
747 3300017792 Ga0163161_10039109 Ga0163161_100391094 291
748 3300017792 Ga0163161_10047518 Ga0163161_100475182 291
749 3300017792 Ga0163161_10108403 Ga0163161_101084032 291
750 3300021384 Ga0213876_10001490 Ga0213876_100014902 291
751 3300021384 Ga0213876_10022436 Ga0213876_100224362 291
752 3300025242 Ga0209258_100081 Ga0209258_100081149 291
753 3300025245 Ga0207425_1000023 Ga0207425_1000023144 291
754 3300025246 Ga0209646_1001126 Ga0209646_10011268 291
755 3300025254 Ga0209148_1000202 Ga0209148_100020287 291
756 3300025258 Ga0209129_1000032 Ga0209129_1000032129 291
757 3300025292 Ga0209676_1000009 Ga0209676_1000009154 291
758 3300025294 Ga0209025_1000047 Ga0209025_1000047129 291
759 3300025297 Ga0209758_1000144 Ga0209758_10001442 291
760 3300025298 Ga0209050_1000094 Ga0209050_1000094154 291
761 3300025302 Ga0207426_1000093 Ga0207426_100009354 291
762 3300025304 Ga0209257_1000007 Ga0209257_1000007509 291
763 3300025304 Ga0209257_1000064 Ga0209257_1000064184 291
764 3300025321 Ga0207656_10000239 Ga0207656_100002399 291
765 3300025893 Ga0207682_10008876 Ga0207682_100088762 291
766 3300025900 Ga0207710_10006884 Ga0207710_100068843 291
767 3300025903 Ga0207680_10000057 Ga0207680_100000576 291
768 3300025903 Ga0207680_10003557 Ga0207680_100035574 291
769 3300025903 Ga0207680_10115000 Ga0207680_101150002 291
770 3300025904 Ga0207647_10006207 Ga0207647_100062078 291
771 3300025907 Ga0207645_10005567 Ga0207645_100055672 291
772 3300025907 Ga0207645_10084467 Ga0207645_100844672 291
773 3300025909 Ga0207705_10002909 Ga0207705_100029094 291
774 3300025909 Ga0207705_10077238 Ga0207705_100772382 291
775 3300025911 Ga0207654_10008022 Ga0207654_100080222 291
776 3300025911 Ga0207654_10040476 Ga0207654_100404762 291
777 3300025911 Ga0207654_10217055 Ga0207654_102170551 291
778 3300025912 Ga0207707_10000889 Ga0207707_1000088924 291
779 3300025912 Ga0207707_10496807 Ga0207707_104968071 291
780 3300025913 Ga0207695_10000071 Ga0207695_10000071185 291
781 3300025913 Ga0207695_10000323 Ga0207695_100003234 291
782 3300025913 Ga0207695_10016782 Ga0207695_100167828 291
783 3300025913 Ga0207695_10235724 Ga0207695_102357242 291
784 3300025914 Ga0207671_10003914 Ga0207671_100039141 291
785 3300025914 Ga0207671_10033095 Ga0207671_100330952 291
786 3300025917 Ga0207660_10006223 Ga0207660_100062232 291
787 3300025918 Ga0207662_10062713 Ga0207662_100627132 291
788 3300025920 Ga0207649_10025237 Ga0207649_100252374 291
789 3300025921 Ga0207652_10013482 Ga0207652_100134827 291
790 3300025923 Ga0207681_10046476 Ga0207681_100464762 291
791 3300025923 Ga0207681_10070425 Ga0207681_100704251 291
792 3300025923 Ga0207681_10127668 Ga0207681_101276682 291
793 3300025924 Ga0207694_10127546 Ga0207694_101275462 291
794 3300025924 Ga0207694_10156064 Ga0207694_101560642 291
795 3300025925 Ga0207650_10053098 Ga0207650_100530983 291
796 3300025925 Ga0207650_10122441 Ga0207650_101224412 291
797 3300025925 Ga0207650_10162935 Ga0207650_101629352 291
798 3300025925 Ga0207650_10182155 Ga0207650_101821552 291
799 3300025926 Ga0207659_10026032 Ga0207659_100260322 291
800 3300025926 Ga0207659_10080515 Ga0207659_100805152 291
801 3300025926 Ga0207659_10157167 Ga0207659_101571674 291
802 3300025926 Ga0207659_10179472 Ga0207659_101794722 291
803 3300025932 Ga0207690_10008110 Ga0207690_100081104 291
804 3300025933 Ga0207706_10003140 Ga0207706_100031402 291
805 3300025933 Ga0207706_10007966 Ga0207706_100079668 291
806 3300025933 Ga0207706_10137890 Ga0207706_101378901 291
807 3300025934 Ga0207686_10002939 Ga0207686_100029397 291
808 3300025934 Ga0207686_10024483 Ga0207686_100244832 291
809 3300025935 Ga0207709_10000003 Ga0207709_10000003818 291
810 3300025935 Ga0207709_10430942 Ga0207709_104309421 291
811 3300025936 Ga0207670_10012693 Ga0207670_100126935 291
812 3300025936 Ga0207670_10122717 Ga0207670_101227172 291
813 3300025938 Ga0207704_10030610 Ga0207704_100306103 291
814 3300025938 Ga0207704_10032633 Ga0207704_100326333 291
815 3300025939 Ga0207665_10120474 Ga0207665_101204742 291
816 3300025940 Ga0207691_10000228 Ga0207691_1000022833 291
817 3300025940 Ga0207691_10045382 Ga0207691_100453823 291
818 3300025940 Ga0207691_10050071 Ga0207691_100500713 291
819 3300025940 Ga0207691_10065740 Ga0207691_100657402 291
820 3300025940 Ga0207691_10136167 Ga0207691_101361672 291
821 3300025940 Ga0207691_10214535 Ga0207691_102145351 291
822 3300025942 Ga0207689_10000482 Ga0207689_1000048211 291
823 3300025942 Ga0207689_10005168 Ga0207689_100051684 291
824 3300025942 Ga0207689_10017098 Ga0207689_100170984 291
825 3300025944 Ga0207661_10021969 Ga0207661_100219693 291
826 3300025944 Ga0207661_10092105 Ga0207661_100921052 291
827 3300025944 Ga0207661_10109608 Ga0207661_101096082 291
828 3300025945 Ga0207679_10001675 Ga0207679_100016752 291
829 3300025945 Ga0207679_10004011 Ga0207679_100040116 291
830 3300025945 Ga0207679_10053294 Ga0207679_100532942 291
831 3300025949 Ga0207667_10000135 Ga0207667_1000013560 291
832 3300025949 Ga0207667_10000177 Ga0207667_1000017768 291
833 3300025949 Ga0207667_10013458 Ga0207667_100134585 291
834 3300025949 Ga0207667_10030139 Ga0207667_100301394 291
835 3300025949 Ga0207667_10357613 Ga0207667_103576132 291
836 3300025949 Ga0207667_10466872 Ga0207667_104668722 291
837 3300025960 Ga0207651_10015395 Ga0207651_100153953 291
838 3300025960 Ga0207651_10266004 Ga0207651_102660041 291
839 3300025960 Ga0207651_10331379 Ga0207651_103313792 291
840 3300025961 Ga0207712_10016682 Ga0207712_100166824 291
841 3300025961 Ga0207712_10043054 Ga0207712_100430542 291
842 3300025961 Ga0207712_10123402 Ga0207712_101234022 291
843 3300025961 Ga0207712_10176024 Ga0207712_101760241 291
844 3300025972 Ga0207668_10065915 Ga0207668_100659151 291
845 3300025972 Ga0207668_10111514 Ga0207668_101115142 291
846 3300025972 Ga0207668_10453301 Ga0207668_104533012 291
847 3300025986 Ga0207658_10008941 Ga0207658_100089413 291
848 3300025986 Ga0207658_10019785 Ga0207658_100197852 291
849 3300025986 Ga0207658_10037585 Ga0207658_100375853 291
850 3300025986 Ga0207658_10085379 Ga0207658_100853792 291
851 3300025986 Ga0207658_10180636 Ga0207658_101806362 291
852 3300026023 Ga0207677_10005483 Ga0207677_100054838 291
853 3300026023 Ga0207677_10078074 Ga0207677_100780741 291
854 3300026035 Ga0207703_10000924 Ga0207703_100009248 291
855 3300026035 Ga0207703_10011638 Ga0207703_100116386 291
856 3300026035 Ga0207703_10045798 Ga0207703_100457982 291
857 3300026035 Ga0207703_10372715 Ga0207703_103727151 291
858 3300026035 Ga0207703_10619095 Ga0207703_106190952 291
859 3300026041 Ga0207639_10013846 Ga0207639_100138464 291
860 3300026041 Ga0207639_10018848 Ga0207639_100188483 291
861 3300026041 Ga0207639_10061204 Ga0207639_100612043 291
862 3300026041 Ga0207639_10096563 Ga0207639_100965633 291
863 3300026041 Ga0207639_10246622 Ga0207639_102466222 291
864 3300026041 Ga0207639_10348741 Ga0207639_103487412 291
865 3300026067 Ga0207678_10077492 Ga0207678_100774923 291
866 3300026078 Ga0207702_10008334 Ga0207702_100083343 291
867 3300026078 Ga0207702_10158637 Ga0207702_101586372 291
868 3300026088 Ga0207641_10000229 Ga0207641_1000022945 291
869 3300026088 Ga0207641_10000539 Ga0207641_100005398 291
870 3300026088 Ga0207641_10013808 Ga0207641_100138084 291
871 3300026088 Ga0207641_10107505 Ga0207641_101075053 291
872 3300026088 Ga0207641_10126665 Ga0207641_101266652 291
873 3300026089 Ga0207648_10040383 Ga0207648_100403835 291
874 3300026089 Ga0207648_10053860 Ga0207648_100538602 291
875 3300026089 Ga0207648_10170550 Ga0207648_101705502 291
876 3300026089 Ga0207648_10487736 Ga0207648_104877361 291
877 3300026095 Ga0207676_10001997 Ga0207676_100019976 291
878 3300026095 Ga0207676_10003168 Ga0207676_100031684 291
879 3300026095 Ga0207676_10024749 Ga0207676_100247493 291
880 3300026095 Ga0207676_10119837 Ga0207676_101198372 291
881 3300026095 Ga0207676_10142717 Ga0207676_101427172 291
882 3300026095 Ga0207676_10184824 Ga0207676_101848241 291
883 3300026095 Ga0207676_10651554 Ga0207676_106515541 291
884 3300026116 Ga0207674_10016309 Ga0207674_1001630910 291
885 3300026116 Ga0207674_10025163 Ga0207674_100251633 291
886 3300026116 Ga0207674_10035928 Ga0207674_100359281 291
887 3300026118 Ga0207675_100000938 Ga0207675_10000093818 291
888 3300026118 Ga0207675_100071059 Ga0207675_1000710592 291
889 3300026121 Ga0207683_10026994 Ga0207683_100269941 291
890 3300026121 Ga0207683_10028296 Ga0207683_100282963 291
891 3300026142 Ga0207698_10014331 Ga0207698_100143314 291
892 3300026142 Ga0207698_10093884 Ga0207698_100938842 291
893 3300026142 Ga0207698_10438985 Ga0207698_104389851 291
894 3300026142 Ga0207698_10483855 Ga0207698_104838551 291
895 3300027907 Ga0207428_10158752 Ga0207428_101587521 291
896 3300028379 Ga0268266_10000049 Ga0268266_100000497 291
897 3300028379 Ga0268266_10005598 Ga0268266_100055988 291
898 3300028379 Ga0268266_10034011 Ga0268266_100340113 291
899 3300028379 Ga0268266_10145262 Ga0268266_101452622 291
900 3300028381 Ga0268264_10003106 Ga0268264_100031064 291
901 3300028381 Ga0268264_10007090 Ga0268264_100070905 291
902 3300028381 Ga0268264_10020419 Ga0268264_100204194 291
903 3300028786 Ga0307517_10003658 Ga0307517_100036588 291
904 3300028794 Ga0307515_10000009 Ga0307515_10000009187 291
905 3300030521 Ga0307511_10000276 Ga0307511_1000027626 291
906 3300031251 Ga0265327_10000148 Ga0265327_10000148125 291
907 3300031251 Ga0265327_10008831 Ga0265327_100088313 291
908 3300031251 Ga0265327_10091547 Ga0265327_100915472 291
909 3300031251 Ga0265327_10133319 Ga0265327_101333192 291
910 3300031456 Ga0307513_10061705 Ga0307513_100617054 291
911 3300031456 Ga0307513_10149923 Ga0307513_101499231 291
912 3300031507 Ga0307509_10043782 Ga0307509_100437823 291
913 3300031507 Ga0307509_10055932 Ga0307509_100559323 291
914 3300031507 Ga0307509_10063261 Ga0307509_100632612 291
915 3300031595 Ga0265313_10028202 Ga0265313_100282022 291
916 3300031616 Ga0307508_10003266 Ga0307508_100032669 291
917 3300031649 Ga0307514_10061041 Ga0307514_100610412 291
918 3300031730 Ga0307516_10001231 Ga0307516_1000123130 291
919 3300031730 Ga0307516_10007511 Ga0307516_100075116 291
920 3300031731 Ga0307405_10000015 Ga0307405_1000001519 291
921 3300031903 Ga0307407_10000031 Ga0307407_1000003115 291
922 3300031911 Ga0307412_10000049 Ga0307412_1000004949 291
923 3300031995 Ga0307409_100013894 Ga0307409_1000138942 291
924 3300031995 Ga0307409_100059433 Ga0307409_1000594333 291
925 3300032002 Ga0307416_100000002 Ga0307416_100000002135 291
926 3300032002 Ga0307416_100851260 Ga0307416_1008512601 291
927 3300032004 Ga0307414_10061057 Ga0307414_100610573 291
928 3300032004 Ga0307414_10411462 Ga0307414_104114622 291
929 3300035086 Ga0373934_0092268 Ga0373934_0092268_274_1158 291
930 3300035116 Ga0373945_0124358 Ga0373945_0124358_36_914 291
931 3300035692 Ga0373935_0091379 Ga0373935_0091379_624_1508 291
932 3300035695 Ga0373927_0207455 Ga0373927_0207455_389_1267 291
933 3300035724 Ga0373933_0042199 Ga0373933_0042199_865_1749 291
934 3300036401 Ga0373937_0096850 Ga0373937_0096850_917_1801 291
935 3300036401 Ga0373937_0321850 Ga0373937_0321850_486_1361 291
936 3300039437 Ga0436365_0763276 Ga0436365_0763276_1535_2410 291
937 3300039437 Ga0436365_1121511 Ga0436365_1121511_8647_9522 291
938 3300039437 Ga0436365_1214063 Ga0436365_1214063_302_1177 291
939 3300039437 Ga0436365_1871487 Ga0436365_1871487_1031_1909 291
940 3300041404 Ga0439436_0025603 Ga0439436_0025603_141_1016 291
941 3300041406 Ga0439439_0012722 Ga0439439_0012722_581_1456 291
942 3300041406 Ga0439439_0019014 Ga0439439_0019014_710_1591 291
943 3300041413 Ga0439465_0006087 Ga0439465_0006087_201_1076 291
944 3300041512 Ga0451853_1789420 Ga0451853_1789420_1069_1944 291
945 3300042002 Ga0439442_014100 Ga0439442_014100_397_1278 291
946 3300042004 Ga0439445_0063498 Ga0439445_0063498_118_1002 291
947 3300042007 Ga0439449_0016294 Ga0439449_0016294_1009_1884 291
948 3300042007 Ga0439449_0044809 Ga0439449_0044809_607_1482 291
949 3300042007 Ga0439449_0066030 Ga0439449_0066030_72_947 291
950 3300042014 Ga0439457_002393 Ga0439457_002393_3231_4106 291
951 3300042015 Ga0439462_0007027 Ga0439462_0007027_719_1594 291
952 3300042156 Ga0439446_0096903 Ga0439446_0096903_33_917 291
953 3300042435 Ga0439434_0002629 Ga0439434_0002629_65_949 291
954 3300044656 Ga0466969_0000921 Ga0466969_0000921_695_1573 291
955 3300044656 Ga0466969_0041570 Ga0466969_0041570_1015_1893 291
956 3300044658 Ga0466972_0000038 Ga0466972_0000038_97217_98092 291
957 3300044658 Ga0466972_0000055 Ga0466972_0000055_13116_13991 291
958 3300044658 Ga0466972_0062541 Ga0466972_0062541_233_1159 291
959 3300044684 Ga0466966_0010092 Ga0466966_0010092_855_1733 291
960 3300044706 Ga0466964_0011227 Ga0466964_0011227_1598_2476 291
961 3300044706 Ga0466964_0013406 Ga0466964_0013406_787_1665 291
962 3300044712 Ga0453684_0093866 Ga0453684_0093866_2424_3299 291
963 3300044712 Ga0453684_0262477 Ga0453684_0262477_872_1747 291
964 3300044712 Ga0453684_0413196 Ga0453684_0413196_101_988 291
965 3300044735 Ga0466968_0011055 Ga0466968_0011055_2549_3427 291
966 3300044735 Ga0466968_0063728 Ga0466968_0063728_538_1413 291
967 3300044765 Ga0466970_0000722 Ga0466970_0000722_6677_7552 291
968 3300044842 Ga0466957_0000186 Ga0466957_0000186_5161_6126 291
969 3300044842 Ga0466957_0002253 Ga0466957_0002253_1684_2562 291
970 3300045049 Ga0466959_0000157 Ga0466959_0000157_11676_12554 291
971 3300045049 Ga0466959_0006469 Ga0466959_0006469_6328_7209 291
972 3300045051 Ga0451576_0336454 Ga0451576_0336454_37_918 291
973 3300046453 Ga0495627_001652 Ga0495627_001652_840_1715 291
974 3300046453 Ga0495627_005399 Ga0495627_005399_4225_5100 291
975 3300046457 Ga0495590_0015436 Ga0495590_0015436_508_1383 291
976 3300046459 Ga0495629_0087417 Ga0495629_0087417_707_1582 291
977 3300046460 Ga0495638_0095177 Ga0495638_0095177_851_1726 291
978 3300046460 Ga0495638_0251708 Ga0495638_0251708_40_915 291
979 3300046471 Ga0495650_0134930 Ga0495650_0134930_10_885 291
980 3300046501 Ga0495607_0055009 Ga0495607_0055009_610_1485 291
981 3300046507 Ga0495606_0010339 Ga0495606_0010339_738_1613 291
982 3300046507 Ga0495606_0026073 Ga0495606_0026073_2344_3219 291
983 3300046507 Ga0495606_0032782 Ga0495606_0032782_405_1280 291
984 3300046507 Ga0495606_0068194 Ga0495606_0068194_730_1605 291
985 3300046512 Ga0495610_0001576 Ga0495610_0001576_12090_12965 291
986 3300046512 Ga0495610_0002315 Ga0495610_0002315_11596_12471 291
987 3300046516 Ga0495628_0105232 Ga0495628_0105232_769_1653 291
988 3300046517 Ga0495630_0007001 Ga0495630_0007001_132_1016 291
989 3300046520 Ga0495637_0046036 Ga0495637_0046036_594_1469 291
990 3300046522 Ga0495643_0000719 Ga0495643_0000719_28772_29647 291
991 3300046522 Ga0495643_0014997 Ga0495643_0014997_152_1027 291
992 3300046529 Ga0495652_0137274 Ga0495652_0137274_476_1351 291
993 3300046536 Ga0495587_0070088 Ga0495587_0070088_929_1813 291
994 3300046536 Ga0495587_0238841 Ga0495587_0238841_18_893 291
995 3300046538 Ga0495609_0000063 Ga0495609_0000063_61333_62208 291
996 3300046558 Ga0495633_0000123 Ga0495633_0000123_91264_92139 291
997 3300046559 Ga0495667_0076052 Ga0495667_0076052_886_1770 291
998 3300046616 Ga0495668_0241400 Ga0495668_0241400_43_918 291
999 3300046642 Ga0495634_0166336 Ga0495634_0166336_429_1313 291
1000 3300046648 Ga0495611_0010000 Ga0495611_0010000_1419_2294 291
1001 3300046663 Ga0495635_0253598 Ga0495635_0253598_262_1137 291
1002 3300046679 Ga0495623_0206754 Ga0495623_0206754_171_1046 291
1003 3300046680 Ga0495646_0088268 Ga0495646_0088268_498_1382 291
1004 3300046683 Ga0495658_0008440 Ga0495658_0008440_256_1131 291
1005 3300046691 Ga0495670_0025883 Ga0495670_0025883_643_1518 291
1006 3300047315 Ga0495581_0218718 Ga0495581_0218718_14_1099 291
1007 3300047317 Ga0495604_0105816 Ga0495604_0105816_81_965 291
1008 3300047319 Ga0495674_0034534 Ga0495674_0034534_182_1057 291
1009 3300047319 Ga0495674_0126667 Ga0495674_0126667_49_933 291
1010 3300047320 Ga0495672_0030543 Ga0495672_0030543_1347_2225 291
1011 3300047320 Ga0495672_0075161 Ga0495672_0075161_164_1042 291
1012 3300047443 Ga0495687_000001 Ga0495687_000001_446791_447666 291
1013 3300047444 Ga0495675_0274464 Ga0495675_0274464_76_951 291
1014 3300047472 Ga0495686_0000004 Ga0495686_0000004_336291_337196 291
1015 3300047472 Ga0495686_0052463 Ga0495686_0052463_60_935 291
1016 3300048907 Ga0496104_0279048 Ga0496104_0279048_603_1487 291
1017 3300048907 Ga0496104_0501552 Ga0496104_0501552_179_1063 291
1018 3300048912 Ga0496109_0044543 Ga0496109_0044543_285_1160 291
1019 3300048913 Ga0496110_0018044 Ga0496110_0018044_3011_3895 291
1020 3300048917 Ga0496114_0079330 Ga0496114_0079330_1170_2054 291
1021 3300048918 Ga0496115_0035249 Ga0496115_0035249_2508_3383 291
1022 3300048918 Ga0496115_0142278 Ga0496115_0142278_788_1663 291
1023 3300048919 Ga0496116_0004898 Ga0496116_0004898_811_1686 291
1024 3300048921 Ga0496118_0045690 Ga0496118_0045690_2120_2995 291
1025 3300048924 Ga0496121_0000011 Ga0496121_0000011_400794_401669 291
1026 3300048925 Ga0496122_0002605 Ga0496122_0002605_9352_10227 291
1027 3300048926 Ga0496123_0010356 Ga0496123_0010356_2704_3579 291
1028 3300048927 Ga0496124_0138676 Ga0496124_0138676_181_1056 291
1029 3300048928 Ga0496125_0000185 Ga0496125_0000185_83137_84012 291
1030 3300048929 Ga0496126_0177067 Ga0496126_0177067_126_1001 291
1031 3300048929 Ga0496126_0347944 Ga0496126_0347944_218_1093 291
1032 3300049568 Ga0501031_0014259 Ga0501031_0014259_979_1857 291
1033 3300049570 Ga0501033_0102622 Ga0501033_0102622_318_1193 291
1034 3300049571 Ga0501034_0012015 Ga0501034_0012015_6930_7808 291
1035 3300049571 Ga0501034_0058093 Ga0501034_0058093_650_1525 291
1036 3300049571 Ga0501034_0061631 Ga0501034_0061631_1056_1931 291
1037 3300049571 Ga0501034_0219801 Ga0501034_0219801_756_1631 291
1038 3300049571 Ga0501034_0291915 Ga0501034_0291915_603_1478 291
1039 3300049571 Ga0501034_0368685 Ga0501034_0368685_13_888 291
1040 3300049572 Ga0501036_0008645 Ga0501036_0008645_7463_8341 291
1041 3300049573 Ga0501037_0084518 Ga0501037_0084518_1028_1906 291
1042 3300049573 Ga0501037_0198426 Ga0501037_0198426_470_1345 291
1043 3300049574 Ga0501038_0022825 Ga0501038_0022825_4430_5308 291
1044 3300049575 Ga0501039_0119026 Ga0501039_0119026_694_1572 291
1045 3300049579 Ga0501043_0005210 Ga0501043_0005210_8664_9542 291
1046 3300049579 Ga0501043_0027182 Ga0501043_0027182_957_1832 291
1047 3300049580 Ga0501046_0006810 Ga0501046_0006810_2509_3384 291
1048 3300049581 Ga0501047_0006182 Ga0501047_0006182_1667_2545 291
1049 3300049581 Ga0501047_0019192 Ga0501047_0019192_64_939 291
1050 3300049581 Ga0501047_0043311 Ga0501047_0043311_2280_3155 291
1051 3300049581 Ga0501047_0154980 Ga0501047_0154980_474_1352 291
1052 3300049581 Ga0501047_0249186 Ga0501047_0249186_734_1612 291
1053 3300049584 Ga0501068_0035118 Ga0501068_0035118_173_1051 291
1054 3300049588 Ga0501072_0145354 Ga0501072_0145354_554_1441 291
1055 3300049589 Ga0501073_0001866 Ga0501073_0001866_11028_11906 291
1056 3300049589 Ga0501073_0105669 Ga0501073_0105669_483_1370 291
1057 3300049589 Ga0501073_0259380 Ga0501073_0259380_35_910 291
1058 3300049590 Ga0501074_0004312 Ga0501074_0004312_8959_9837 291
1059 3300049654 Ga0501207_004862 Ga0501207_004862_594_1472 291
1060 3300049671 Ga0501238_002917 Ga0501238_002917_418_1296 291
1061 3300049677 Ga0501247_001231 Ga0501247_001231_1089_1967 291
1062 3300049683 Ga0501253_004504 Ga0501253_004504_398_1276 291
1063 3300049703 Ga0501219_000052 Ga0501219_000052_3838_4713 291
1064 3300049705 Ga0501225_0000277 Ga0501225_0000277_14355_15230 291
1065 3300049742 Ga0501080_0044471 Ga0501080_0044471_259_1137 291
1066 3300049742 Ga0501080_0056933 Ga0501080_0056933_1224_2102 291
1067 3300049742 Ga0501080_0359626 Ga0501080_0359626_36_911 291
1068 3300049758 Ga0501241_003222 Ga0501241_003222_1841_2716 291
1069 3300049761 Ga0501264_000212 Ga0501264_000212_2648_3526 291
1070 3300049775 Ga0501279_002719 Ga0501279_002719_1409_2284 291
1071 3300049822 Ga0501035_0039835 Ga0501035_0039835_2608_3486 291
1072 3300049822 Ga0501035_0113305 Ga0501035_0113305_1051_1929 291
1073 3300049823 Ga0501044_0003551 Ga0501044_0003551_7267_8145 291
1074 3300049823 Ga0501044_0198740 Ga0501044_0198740_559_1434 291
1075 3300050005 Ga0501284_00029 Ga0501284_00029_34283_35158 291
1076 3300050493 nmdc:mga0k408_13677_c2 nmdc:mga0k408_13677_c2_227_1102 291
1077 3300050493 nmdc:mga0k408_227705_c1 nmdc:mga0k408_227705_c1_78_953 291
1078 3300050493 nmdc:mga0k408_2627_c1 nmdc:mga0k408_2627_c1_830_1705 291
1079 3300050507 nmdc:mga05p37_18450_c2 nmdc:mga05p37_18450_c2_1641_2519 291
1080 3300050507 nmdc:mga05p37_188731_c1 nmdc:mga05p37_188731_c1_128_1003 291
1081 3300050508 nmdc:mga09592_47012_c1 nmdc:mga09592_47012_c1_2701_3576 291
1082 3300050510 nmdc:mga06r32_303292_c1 nmdc:mga06r32_303292_c1_402_1277 291
1083 3300050511 nmdc:mga08y16_141552_c1 nmdc:mga08y16_141552_c1_1025_1957 291
1084 3300050511 nmdc:mga08y16_31053_c1 nmdc:mga08y16_31053_c1_3876_4760 291
1085 3300050511 nmdc:mga08y16_34280_c1 nmdc:mga08y16_34280_c1_4248_5135 291
1086 3300050511 nmdc:mga08y16_548386_c1 nmdc:mga08y16_548386_c1_28_903 291
1087 3300050511 nmdc:mga08y16_650243_c1 nmdc:mga08y16_650243_c1_31_906 291
1088 3300053085 Ga0495619_0105116 Ga0495619_0105116_143_1027 291
1089 3300053085 Ga0495619_0105762 Ga0495619_0105762_496_1371 291
1090 3300053086 Ga0500578_0000009 Ga0500578_0000009_201199_202077 291
1091 3300053086 Ga0500578_0132429 Ga0500578_0132429_387_1262 291
1092 3300053088 Ga0500644_0000035 Ga0500644_0000035_56968_57918 291
1093 3300053088 Ga0500644_0021498 Ga0500644_0021498_430_1308 291
1094 3300053090 Ga0500646_0011119 Ga0500646_0011119_388_1311 291
1095 3300053090 Ga0500646_0024757 Ga0500646_0024757_234_1184 291
1096 3300053090 Ga0500646_0038939 Ga0500646_0038939_392_1267 291
1097 3300053092 Ga0500583_0000147 Ga0500583_0000147_3762_4637 291
1098 3300053092 Ga0500583_0006066 Ga0500583_0006066_540_1415 291
1099 3300053093 Ga0500651_0003850 Ga0500651_0003850_5656_6531 291
1100 3300053093 Ga0500651_0014342 Ga0500651_0014342_388_1263 291
1101 3300053096 Ga0500641_0000081 Ga0500641_0000081_4405_5316 291
1102 3300053108 Ga0500562_000161 Ga0500562_000161_11994_12872 291
1103 3300053108 Ga0500562_040953 Ga0500562_040953_302_1177 291
1104 3300053109 Ga0500569_000486 Ga0500569_000486_1804_2754 291
1105 3300053133 Ga0500655_008823 Ga0500655_008823_665_1615 291
1106 3300053134 Ga0500658_0014621 Ga0500658_0014621_1735_2685 291
1107 3300053137 Ga0500561_0004593 Ga0500561_0004593_602_1552 291
1108 3300053142 Ga0500577_0000507 Ga0500577_0000507_7390_8340 291
1109 3300053153 Ga0500616_0000015 Ga0500616_0000015_219237_220118 291
1110 3300053153 Ga0500616_0052247 Ga0500616_0052247_873_1748 291
1111 3300053153 Ga0500616_0064751 Ga0500616_0064751_453_1403 291
1112 3300053156 Ga0500622_0000203 Ga0500622_0000203_47419_48294 291
1113 3300053156 Ga0500622_0027095 Ga0500622_0027095_1359_2234 291
1114 3300053156 Ga0500622_0027852 Ga0500622_0027852_727_1602 291
1115 3300053156 Ga0500622_0033407 Ga0500622_0033407_1081_1956 291
1116 3300053160 Ga0500633_0069739 Ga0500633_0069739_100_1050 291
1117 3300053727 Ga0500611_000006 Ga0500611_000006_96008_96883 291
1118 3300053730 Ga0500645_005960 Ga0500645_005960_2214_3092 291

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00795

CN_hydrolase

Carbon-nitrogen hydrolase

75

335

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5h8j-assembly1.cif.gz_H crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with cadaverine 0.9583 2 284
5h8j-assembly2.cif.gz_P crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with cadaverine 0.9578 2 280
6mg6-assembly2.cif.gz_C crystal structure of carbon-nitrogen hydrolase from helicobacter pylori g27 0.956 3 286
5h8k-assembly1.cif.gz_H crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) c158s mutant 0.9558 2 280
6mg6-assembly2.cif.gz_D crystal structure of carbon-nitrogen hydrolase from helicobacter pylori g27 0.955 2 283
ID Description Score Start End Superfamily
6mg6B00 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.96 3 283 3.60.110.10
5h8jH00 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9583 2 284 3.60.110.10
1j31B00 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9423 4 263 3.60.110.10
af_O59829_1_271_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9274 3 284 3.60.110.10
5h8jC00 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.9258 2 280 3.60.110.10
ID Description Score Start End GO Terms
AF-A0A5S3QQQ3-F1-model_v4 deleted 0.99 4 110
AF-A0A519XWB5-F1-model_v4 Carbon-nitrogen hydrolase 0.9891 1 210 GO:0033388
GO:0050126
AF-A0A6J4MZV2-F1-model_v4 N-carbamoylputrescine amidase (EC 3.5.1.53) 0.9867 11 181 GO:0033388
GO:0050126
AF-A0A7C6MMM4-F1-model_v4 deleted 0.9822 6 235
AF-A0A7V8SZN0-F1-model_v4 Carbon-nitrogen hydrolase 0.9807 6 251 GO:0033388
GO:0050126

Feature Viewer

pLDDT pTM Quality
91.94 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map