F490359
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1119 | 482 | 2238 | 297 |
Family's Representative Sequence
| Representative Sequence | 3300005841|Ga0068863_100256214|Ga0068863_1002562142 |
| Length | 346 |
| Sequence | MTVSATSAQGLDMPHLLKKRLKLNPFVDLGTVQGGDKRAFLFNVPADSQSMAHETLVSLDLPGVDKLRSGKVREVFDLGETLLFVATDRLSAFDVILPDPIPFKGAVLNQISAFWFQKIQLATNHFVTTDFAKFPAELQPYRAQLAGRSMIVRRTKPLPIECVVRGYLAGSGWKDYQATGEVCGHRLPAGLRLASELPEPIFTPSTKNEAGHDLNINWTQCCDAIGKSLARKVRDLSLRIYLAGKEHAAKRGIIVADTKFEFGLAGEELLLIDECLTPDSSRFWPADSYAPGKSPPSFDKQFVRDYLETLDWNKTPPGPRLPADVIEKTSAKYRDAFQRLTKSELS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 2 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 4 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 5 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 6 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 7 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 8 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 9 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 10 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 11 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 17 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 25 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 55 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 72 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 74 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 75 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 76 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 77 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 78 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 79 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 80 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 81 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 82 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 83 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 84 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 88 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 90 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 91 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 92 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 93 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 94 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 95 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 96 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 97 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 98 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 100 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 101 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 115 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 116 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013874 | Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 | Metagenome | Rhizosphere |
| 126 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 129 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 133 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 134 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 135 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 136 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 144 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 146 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 152 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 155 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 223 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 227 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 228 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 229 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 230 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 231 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 232 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 233 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 234 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 235 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 236 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 237 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 238 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 239 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 240 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 241 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 242 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 243 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 244 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 245 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 246 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 247 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 248 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 249 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 250 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 251 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 252 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 253 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 254 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 255 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 256 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 257 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 258 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 259 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 260 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 261 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 262 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 263 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 264 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 265 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 266 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 267 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 268 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 269 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 270 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 271 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 272 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 273 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 274 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 275 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 276 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 277 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 278 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 279 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 280 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 281 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 282 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 283 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 284 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 285 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 286 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 287 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 288 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 289 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 290 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 291 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 292 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 293 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 294 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 295 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 296 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 297 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 298 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 299 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 300 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 301 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 302 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 303 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 304 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 305 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 306 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 307 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 308 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 309 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 310 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 311 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 312 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 381 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 382 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 383 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 384 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 385 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 386 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 387 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 388 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 389 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 390 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 391 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 392 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 393 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 394 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 395 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 396 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 397 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 398 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 399 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 400 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 401 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 402 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 405 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 406 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 407 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 408 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 409 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 410 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 411 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 412 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 413 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 414 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 415 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 416 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 417 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 418 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 419 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 421 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 422 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 423 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 424 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 425 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 426 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 427 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 428 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 429 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 430 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 431 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 432 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 433 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 434 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 435 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 436 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 437 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 438 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 439 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 440 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 441 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 442 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 443 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 444 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 445 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 446 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 447 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 448 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 449 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 454 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 455 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 456 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 457 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 458 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 459 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 460 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 461 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 462 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 463 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 464 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 465 | 2524614729 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 466 | 2627854209 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 467 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 468 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 469 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 470 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 471 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 472 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 473 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 474 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 475 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 476 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 477 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 478 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 479 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 480 | 2995948881 | Lysobacter enzymogenes B25 | Isolate | Unclassified |
| 481 | 8001522603 | Methylomicrobium sp. RS1 | Isolate | Unclassified |
| 482 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.3 |
| Metatranscriptomes | 0.09 |
| Isolates | 1.61 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.83 |
| Nodule | 0 |
| Rhizoplane | 4.2 |
| Rhizosphere | 86.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.34 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068863_100256214 | 3300005841 | Bacteria | 1691 |
| 2 | CNXas_1000053 | 3300000545 | Bacteria | 22078 |
| 3 | JGI25162J39368_1000837 | 3300002737 | Bacteria | 20279 |
| 4 | JGI25157J39369_1000177 | 3300002741 | Bacteria | 53890 |
| 5 | JGI25163J39215_1002314 | 3300002771 | Bacteria | 2049 |
| 6 | JGI25164J39214_1000159 | 3300002772 | Bacteria | 63983 |
| 7 | JGI25151J46595_10001571 | 3300003187 | Bacteria | 15244 |
| 8 | JGI25165J46597_1000287 | 3300003214 | Bacteria | 64000 |
| 9 | rootH1_10130599 | 3300003323 | Bacteria | 4508 |
| 10 | Ga0055535_1000329 | 3300003761 | Bacteria | 47890 |
| 11 | Ga0055542_1000547 | 3300003762 | Bacteria | 33443 |
| 12 | Ga0055529_1000108 | 3300003763 | Bacteria | 122223 |
| 13 | Ga0055536_1002534 | 3300003781 | Bacteria | 10230 |
| 14 | Ga0055536_1020770 | 3300003781 | Bacteria | 2015 |
| 15 | Ga0055536_1037451 | 3300003781 | Bacteria | 1187 |
| 16 | Ga0055530_10001342 | 3300003791 | Bacteria | 18385 |
| 17 | Ga0055531_10001941 | 3300003794 | Bacteria | 14444 |
| 18 | Ga0055531_10025470 | 3300003794 | Bacteria | 2146 |
| 19 | Ga0065712_10077015 | 3300005290 | Bacteria | 3563 |
| 20 | Ga0065715_10091766 | 3300005293 | Bacteria | 5565 |
| 21 | Ga0065707_10021569 | 3300005295 | Unclassified | 1746 |
| 22 | Ga0065707_10082772 | 3300005295 | Bacteria | 12215 |
| 23 | Ga0065707_10084930 | 3300005295 | Bacteria | 6627 |
| 24 | Ga0065707_10120764 | 3300005295 | Bacteria | 2126 |
| 25 | Ga0065707_10166743 | 3300005295 | Bacteria | 1516 |
| 26 | Ga0070676_10005061 | 3300005328 | Bacteria | 6989 |
| 27 | Ga0070676_10009567 | 3300005328 | Bacteria | 5235 |
| 28 | Ga0070676_10015813 | 3300005328 | Bacteria | 4163 |
| 29 | Ga0070676_10019381 | 3300005328 | Bacteria | 3784 |
| 30 | Ga0070676_10072619 | 3300005328 | Bacteria | 2069 |
| 31 | Ga0070683_100066760 | 3300005329 | Bacteria | 3351 |
| 32 | Ga0070690_100013171 | 3300005330 | Bacteria | 4882 |
| 33 | Ga0070690_100014709 | 3300005330 | Bacteria | 4647 |
| 34 | Ga0070690_100041653 | 3300005330 | Bacteria | 2908 |
| 35 | Ga0070670_100016518 | 3300005331 | Bacteria | 6336 |
| 36 | Ga0070670_100018329 | 3300005331 | Bacteria | 6006 |
| 37 | Ga0070670_100026951 | 3300005331 | Bacteria | 4943 |
| 38 | Ga0070670_100127393 | 3300005331 | Bacteria | 2198 |
| 39 | Ga0070677_10016848 | 3300005333 | Bacteria | 2608 |
| 40 | Ga0068869_100081038 | 3300005334 | Bacteria | 2423 |
| 41 | Ga0070666_10015646 | 3300005335 | Bacteria | 4841 |
| 42 | Ga0070666_10068861 | 3300005335 | Bacteria | 2405 |
| 43 | Ga0070666_10136193 | 3300005335 | Bacteria | 1709 |
| 44 | Ga0070680_100009323 | 3300005336 | Bacteria | 7539 |
| 45 | Ga0070680_100060056 | 3300005336 | Bacteria | 3111 |
| 46 | Ga0070680_100276719 | 3300005336 | Bacteria | 1421 |
| 47 | Ga0070682_100118532 | 3300005337 | Bacteria | 1773 |
| 48 | Ga0068868_100014018 | 3300005338 | Bacteria | 5898 |
| 49 | Ga0068868_100016352 | 3300005338 | Bacteria | 5509 |
| 50 | Ga0068868_100039621 | 3300005338 | Bacteria | 3662 |
| 51 | Ga0068868_100041492 | 3300005338 | Bacteria | 3585 |
| 52 | Ga0068868_100132026 | 3300005338 | Bacteria | 2044 |
| 53 | Ga0070689_100000945 | 3300005340 | Bacteria | 18075 |
| 54 | Ga0070689_100001450 | 3300005340 | Bacteria | 15138 |
| 55 | Ga0070689_100012449 | 3300005340 | Bacteria | 6129 |
| 56 | Ga0070689_100081283 | 3300005340 | Bacteria | 2544 |
| 57 | Ga0070689_100154175 | 3300005340 | Bacteria | 1854 |
| 58 | Ga0070687_100000577 | 3300005343 | Bacteria | 12201 |
| 59 | Ga0070687_100086250 | 3300005343 | Bacteria | 1725 |
| 60 | Ga0070661_100028400 | 3300005344 | Bacteria | 4035 |
| 61 | Ga0070661_100065072 | 3300005344 | Bacteria | 2679 |
| 62 | Ga0070668_100008104 | 3300005347 | Bacteria | 7803 |
| 63 | Ga0070668_100072757 | 3300005347 | Bacteria | 2679 |
| 64 | Ga0070668_100102853 | 3300005347 | Bacteria | 2266 |
| 65 | Ga0070668_100234977 | 3300005347 | Bacteria | 1517 |
| 66 | Ga0070668_100458069 | 3300005347 | Bacteria | 1098 |
| 67 | Ga0070668_100466121 | 3300005347 | Bacteria | 1089 |
| 68 | Ga0070669_100002483 | 3300005353 | Bacteria | 13359 |
| 69 | Ga0070669_100060779 | 3300005353 | Bacteria | 2776 |
| 70 | Ga0070669_100087759 | 3300005353 | Bacteria | 2326 |
| 71 | Ga0070675_100001717 | 3300005354 | Bacteria | 16184 |
| 72 | Ga0070675_100002965 | 3300005354 | Bacteria | 12811 |
| 73 | Ga0070675_100010769 | 3300005354 | Bacteria | 7154 |
| 74 | Ga0070675_100048024 | 3300005354 | Bacteria | 3499 |
| 75 | Ga0070675_100077596 | 3300005354 | Bacteria | 2765 |
| 76 | Ga0070675_100140321 | 3300005354 | Unclassified | 2065 |
| 77 | Ga0070675_100174081 | 3300005354 | Bacteria | 1857 |
| 78 | Ga0070675_100314314 | 3300005354 | Bacteria | 1383 |
| 79 | Ga0070671_100010170 | 3300005355 | Bacteria | 7551 |
| 80 | Ga0070671_100021794 | 3300005355 | Bacteria | 5233 |
| 81 | Ga0070671_100023724 | 3300005355 | Bacteria | 5021 |
| 82 | Ga0070671_100041962 | 3300005355 | Bacteria | 3803 |
| 83 | Ga0070671_100162934 | 3300005355 | Bacteria | 1885 |
| 84 | Ga0070674_100000943 | 3300005356 | Bacteria | 15159 |
| 85 | Ga0070674_100013991 | 3300005356 | Bacteria | 4977 |
| 86 | Ga0070674_100023293 | 3300005356 | Bacteria | 4006 |
| 87 | Ga0070674_100025646 | 3300005356 | Bacteria | 3840 |
| 88 | Ga0070674_100050426 | 3300005356 | Bacteria | 2866 |
| 89 | Ga0070673_100001757 | 3300005364 | Bacteria | 12923 |
| 90 | Ga0070673_100004145 | 3300005364 | Bacteria | 9129 |
| 91 | Ga0070673_100026784 | 3300005364 | Bacteria | 4263 |
| 92 | Ga0070673_100050461 | 3300005364 | Bacteria | 3253 |
| 93 | Ga0070673_100050659 | 3300005364 | Bacteria | 3247 |
| 94 | Ga0070673_100086795 | 3300005364 | Bacteria | 2550 |
| 95 | Ga0070688_100025361 | 3300005365 | Bacteria | 3510 |
| 96 | Ga0070688_100033591 | 3300005365 | Bacteria | 3102 |
| 97 | Ga0070688_100096141 | 3300005365 | Unclassified | 1945 |
| 98 | Ga0070659_100003104 | 3300005366 | Bacteria | 11813 |
| 99 | Ga0070667_100001144 | 3300005367 | Bacteria | 24083 |
| 100 | Ga0070667_100001152 | 3300005367 | Bacteria | 23990 |
| 101 | Ga0070667_100063863 | 3300005367 | Bacteria | 3122 |
| 102 | Ga0070667_100136318 | 3300005367 | Bacteria | 2146 |
| 103 | Ga0070667_100160666 | 3300005367 | Bacteria | 1979 |
| 104 | Ga0070709_10074566 | 3300005434 | Bacteria | 2199 |
| 105 | Ga0070709_10157158 | 3300005434 | Bacteria | 1577 |
| 106 | Ga0070709_10162600 | 3300005434 | Bacteria | 1553 |
| 107 | Ga0070713_100000635 | 3300005436 | Bacteria | 22421 |
| 108 | Ga0070713_100451815 | 3300005436 | Bacteria | 1207 |
| 109 | Ga0070710_10041243 | 3300005437 | Bacteria | 2547 |
| 110 | Ga0070701_10015659 | 3300005438 | Bacteria | 3508 |
| 111 | Ga0070711_100001699 | 3300005439 | Bacteria | 12200 |
| 112 | Ga0070711_100010266 | 3300005439 | Bacteria | 5793 |
| 113 | Ga0070711_100020880 | 3300005439 | Bacteria | 4227 |
| 114 | Ga0070705_100096360 | 3300005440 | Bacteria | 1857 |
| 115 | Ga0070705_100159346 | 3300005440 | Bacteria | 1507 |
| 116 | Ga0070705_100289564 | 3300005440 | Bacteria | 1168 |
| 117 | Ga0070700_100028284 | 3300005441 | Bacteria | 3332 |
| 118 | Ga0070694_100054385 | 3300005444 | Bacteria | 2712 |
| 119 | Ga0070708_100061928 | 3300005445 | Bacteria | 3344 |
| 120 | Ga0070708_100108787 | 3300005445 | Bacteria | 2546 |
| 121 | Ga0070663_100055413 | 3300005455 | Bacteria | 2838 |
| 122 | Ga0070678_100003884 | 3300005456 | Bacteria | 8396 |
| 123 | Ga0070678_100136932 | 3300005456 | Bacteria | 1954 |
| 124 | Ga0070678_100230905 | 3300005456 | Bacteria | 1542 |
| 125 | Ga0070662_100002487 | 3300005457 | Bacteria | 11357 |
| 126 | Ga0070662_100102116 | 3300005457 | Bacteria | 2172 |
| 127 | Ga0070662_100130834 | 3300005457 | Bacteria | 1934 |
| 128 | Ga0070662_100158043 | 3300005457 | Unclassified | 1771 |
| 129 | Ga0070662_100179390 | 3300005457 | Bacteria | 1668 |
| 130 | Ga0070681_10006880 | 3300005458 | Bacteria | 11070 |
| 131 | Ga0070681_10015633 | 3300005458 | Bacteria | 7558 |
| 132 | Ga0070681_10155029 | 3300005458 | Bacteria | 2216 |
| 133 | Ga0068867_100057000 | 3300005459 | Bacteria | 2892 |
| 134 | Ga0070685_10035477 | 3300005466 | Bacteria | 2813 |
| 135 | Ga0070685_10038178 | 3300005466 | Bacteria | 2723 |
| 136 | Ga0070706_100028777 | 3300005467 | Bacteria | 5117 |
| 137 | Ga0070706_100075924 | 3300005467 | Bacteria | 3110 |
| 138 | Ga0070707_100000049 | 3300005468 | Bacteria | 102972 |
| 139 | Ga0070707_100007424 | 3300005468 | Bacteria | 10179 |
| 140 | Ga0070707_100036291 | 3300005468 | Bacteria | 4702 |
| 141 | Ga0070707_100075070 | 3300005468 | Bacteria | 3260 |
| 142 | Ga0070707_100128199 | 3300005468 | Bacteria | 2466 |
| 143 | Ga0070707_100167331 | 3300005468 | Unclassified | 2142 |
| 144 | Ga0070707_100277610 | 3300005468 | Bacteria | 1629 |
| 145 | Ga0070698_100123519 | 3300005471 | Bacteria | 2547 |
| 146 | Ga0070699_100265886 | 3300005518 | Bacteria | 1534 |
| 147 | Ga0070679_100004933 | 3300005530 | Bacteria | 12310 |
| 148 | Ga0070679_100085288 | 3300005530 | Bacteria | 3145 |
| 149 | Ga0070679_100226203 | 3300005530 | Bacteria | 1831 |
| 150 | Ga0070679_100330174 | 3300005530 | Bacteria | 1474 |
| 151 | Ga0070697_100006541 | 3300005536 | Bacteria | 9025 |
| 152 | Ga0070697_100132275 | 3300005536 | Bacteria | 2093 |
| 153 | Ga0070697_100255962 | 3300005536 | Bacteria | 1498 |
| 154 | Ga0070697_100318771 | 3300005536 | Bacteria | 1338 |
| 155 | Ga0070672_100001943 | 3300005543 | Bacteria | 12956 |
| 156 | Ga0070672_100002408 | 3300005543 | Bacteria | 11848 |
| 157 | Ga0070672_100011227 | 3300005543 | Bacteria | 6245 |
| 158 | Ga0070672_100038187 | 3300005543 | Bacteria | 3667 |
| 159 | Ga0070672_100131034 | 3300005543 | Bacteria | 2061 |
| 160 | Ga0070672_100275064 | 3300005543 | Bacteria | 1423 |
| 161 | Ga0070672_100368504 | 3300005543 | Bacteria | 1227 |
| 162 | Ga0070686_100014455 | 3300005544 | Bacteria | 4552 |
| 163 | Ga0070686_100015716 | 3300005544 | Bacteria | 4391 |
| 164 | Ga0070686_100047307 | 3300005544 | Bacteria | 2720 |
| 165 | Ga0070686_100142040 | 3300005544 | Bacteria | 1672 |
| 166 | Ga0070695_100008782 | 3300005545 | Bacteria | 6005 |
| 167 | Ga0070696_100253881 | 3300005546 | Bacteria | 1331 |
| 168 | Ga0070696_100261723 | 3300005546 | Bacteria | 1312 |
| 169 | Ga0070693_100016370 | 3300005547 | Bacteria | 3838 |
| 170 | Ga0070665_100009546 | 3300005548 | Bacteria | 9813 |
| 171 | Ga0070665_100016694 | 3300005548 | Bacteria | 7357 |
| 172 | Ga0070665_100167823 | 3300005548 | Bacteria | 2197 |
| 173 | Ga0070665_100378535 | 3300005548 | Bacteria | 1423 |
| 174 | Ga0070704_100007181 | 3300005549 | Bacteria | 6621 |
| 175 | Ga0070704_100010173 | 3300005549 | Bacteria | 5721 |
| 176 | Ga0068855_100002029 | 3300005563 | Bacteria | 25111 |
| 177 | Ga0068855_100004382 | 3300005563 | Bacteria | 17249 |
| 178 | Ga0068855_100020496 | 3300005563 | Bacteria | 7927 |
| 179 | Ga0068855_100021246 | 3300005563 | Bacteria | 7781 |
| 180 | Ga0068855_100188006 | 3300005563 | Bacteria | 2331 |
| 181 | Ga0070664_100000478 | 3300005564 | Bacteria | 30240 |
| 182 | Ga0068856_100049179 | 3300005614 | Bacteria | 4156 |
| 183 | Ga0068856_100210301 | 3300005614 | Bacteria | 1960 |
| 184 | Ga0070702_100029377 | 3300005615 | Bacteria | 2989 |
| 185 | Ga0070702_100095611 | 3300005615 | Bacteria | 1811 |
| 186 | Ga0068859_100000831 | 3300005617 | Bacteria | 31419 |
| 187 | Ga0068859_100033950 | 3300005617 | Bacteria | 5122 |
| 188 | Ga0068864_100007046 | 3300005618 | Bacteria | 9229 |
| 189 | Ga0068864_100045068 | 3300005618 | Bacteria | 3783 |
| 190 | Ga0068864_100146428 | 3300005618 | Bacteria | 2136 |
| 191 | Ga0068866_10011945 | 3300005718 | Bacteria | 3774 |
| 192 | Ga0068866_10018274 | 3300005718 | Bacteria | 3168 |
| 193 | Ga0068866_10112429 | 3300005718 | Bacteria | 1522 |
| 194 | Ga0068861_100004533 | 3300005719 | Bacteria | 9328 |
| 195 | Ga0068861_100015762 | 3300005719 | Bacteria | 5335 |
| 196 | Ga0068870_10055258 | 3300005840 | Bacteria | 2115 |
| 197 | Ga0068870_10056769 | 3300005840 | Bacteria | 2091 |
| 198 | Ga0068863_100001040 | 3300005841 | Bacteria | 27786 |
| 199 | Ga0068863_100014440 | 3300005841 | Bacteria | 7606 |
| 200 | Ga0068863_100018533 | 3300005841 | Bacteria | 6662 |
| 201 | Ga0068863_100161412 | 3300005841 | Bacteria | 2147 |
| 202 | Ga0068863_100215302 | 3300005841 | Bacteria | 1850 |
| 203 | Ga0068858_100070305 | 3300005842 | Bacteria | 3244 |
| 204 | Ga0068858_100135763 | 3300005842 | Bacteria | 2308 |
| 205 | Ga0068858_100268276 | 3300005842 | Bacteria | 1623 |
| 206 | Ga0068860_100001229 | 3300005843 | Bacteria | 27945 |
| 207 | Ga0068860_100005012 | 3300005843 | Bacteria | 13483 |
| 208 | Ga0068860_100010393 | 3300005843 | Bacteria | 9206 |
| 209 | Ga0068860_100032175 | 3300005843 | Bacteria | 5041 |
| 210 | Ga0068860_100044910 | 3300005843 | Bacteria | 4211 |
| 211 | Ga0068860_100108360 | 3300005843 | Bacteria | 2655 |
| 212 | Ga0068862_100001139 | 3300005844 | Bacteria | 25183 |
| 213 | Ga0068862_100004453 | 3300005844 | Bacteria | 11818 |
| 214 | Ga0068862_100008015 | 3300005844 | Bacteria | 8742 |
| 215 | Ga0068862_100050351 | 3300005844 | Bacteria | 3560 |
| 216 | Ga0068862_100058472 | 3300005844 | Bacteria | 3307 |
| 217 | Ga0068862_100082852 | 3300005844 | Bacteria | 2785 |
| 218 | Ga0068862_100354687 | 3300005844 | Bacteria | 1362 |
| 219 | Ga0081455_10000192 | 3300005937 | Bacteria | 77713 |
| 220 | Ga0081455_10003245 | 3300005937 | Bacteria | 18830 |
| 221 | Ga0081455_10003695 | 3300005937 | Bacteria | 17523 |
| 222 | Ga0081455_10006042 | 3300005937 | Bacteria | 13104 |
| 223 | Ga0081455_10325496 | 3300005937 | Bacteria | 1093 |
| 224 | Ga0081540_1035648 | 3300005983 | Bacteria | 2664 |
| 225 | Ga0081539_10000383 | 3300005985 | Bacteria | 95995 |
| 226 | Ga0081539_10002232 | 3300005985 | Bacteria | 28218 |
| 227 | Ga0081539_10030194 | 3300005985 | Bacteria | 3370 |
| 228 | Ga0081539_10041447 | 3300005985 | Bacteria | 2691 |
| 229 | Ga0070717_10536548 | 3300006028 | Bacteria | 1059 |
| 230 | Ga0070716_100007793 | 3300006173 | Bacteria | 5289 |
| 231 | Ga0070716_100018410 | 3300006173 | Bacteria | 3639 |
| 232 | Ga0070716_100047887 | 3300006173 | Bacteria | 2413 |
| 233 | Ga0070712_100002312 | 3300006175 | Bacteria | 11742 |
| 234 | Ga0070712_100071788 | 3300006175 | Bacteria | 2478 |
| 235 | Ga0075369_10111558 | 3300006186 | Bacteria | 1233 |
| 236 | Ga0097621_100008000 | 3300006237 | Bacteria | 7588 |
| 237 | Ga0097621_100016502 | 3300006237 | Bacteria | 5585 |
| 238 | Ga0097621_100020951 | 3300006237 | Bacteria | 5045 |
| 239 | Ga0097621_100023330 | 3300006237 | Bacteria | 4816 |
| 240 | Ga0097621_100063875 | 3300006237 | Bacteria | 3026 |
| 241 | Ga0068871_100012976 | 3300006358 | Bacteria | 6170 |
| 242 | Ga0068871_100041971 | 3300006358 | Bacteria | 3670 |
| 243 | Ga0068871_100071935 | 3300006358 | Bacteria | 2846 |
| 244 | Ga0068871_100193900 | 3300006358 | Bacteria | 1751 |
| 245 | Ga0068871_100459876 | 3300006358 | Bacteria | 1142 |
| 246 | Ga0075428_100001274 | 3300006844 | Bacteria | 26894 |
| 247 | Ga0075428_100003879 | 3300006844 | Bacteria | 16435 |
| 248 | Ga0075428_100005990 | 3300006844 | Bacteria | 13502 |
| 249 | Ga0075428_100010791 | 3300006844 | Bacteria | 10153 |
| 250 | Ga0075428_100059535 | 3300006844 | Bacteria | 4182 |
| 251 | Ga0075430_100000913 | 3300006846 | Bacteria | 23184 |
| 252 | Ga0075430_100057950 | 3300006846 | Bacteria | 3257 |
| 253 | Ga0075430_100114313 | 3300006846 | Bacteria | 2249 |
| 254 | Ga0075431_100001253 | 3300006847 | Bacteria | 23092 |
| 255 | Ga0075431_100005040 | 3300006847 | Bacteria | 12994 |
| 256 | Ga0075431_100052449 | 3300006847 | Bacteria | 4206 |
| 257 | Ga0075433_10067805 | 3300006852 | Bacteria | 3131 |
| 258 | Ga0075434_100004319 | 3300006871 | Bacteria | 12780 |
| 259 | Ga0075429_100000022 | 3300006880 | Bacteria | 68533 |
| 260 | Ga0075429_100181450 | 3300006880 | Bacteria | 1845 |
| 261 | Ga0075429_100362807 | 3300006880 | Bacteria | 1268 |
| 262 | Ga0068865_100013725 | 3300006881 | Bacteria | 5131 |
| 263 | Ga0068865_100020816 | 3300006881 | Bacteria | 4259 |
| 264 | Ga0068865_100057160 | 3300006881 | Bacteria | 2721 |
| 265 | Ga0075436_100056445 | 3300006914 | Bacteria | 2712 |
| 266 | Ga0097620_100000831 | 3300006931 | Bacteria | 31419 |
| 267 | Ga0097620_100033950 | 3300006931 | Bacteria | 5122 |
| 268 | Ga0099794_10024955 | 3300007265 | Bacteria | 2748 |
| 269 | Ga0099795_10000048 | 3300007788 | Bacteria | 26858 |
| 270 | Ga0099795_10000148 | 3300007788 | Bacteria | 11732 |
| 271 | Ga0105250_10000024 | 3300009092 | Bacteria | 218115 |
| 272 | Ga0105240_10000901 | 3300009093 | Bacteria | 53028 |
| 273 | Ga0105240_10014105 | 3300009093 | Bacteria | 10922 |
| 274 | Ga0105240_10026721 | 3300009093 | Bacteria | 7571 |
| 275 | Ga0105240_10083685 | 3300009093 | Bacteria | 3914 |
| 276 | Ga0105240_10203690 | 3300009093 | Bacteria | 2317 |
| 277 | Ga0105240_10643913 | 3300009093 | Bacteria | 1162 |
| 278 | Ga0111539_10002430 | 3300009094 | Bacteria | 24767 |
| 279 | Ga0111539_10003440 | 3300009094 | Bacteria | 20847 |
| 280 | Ga0111539_10006408 | 3300009094 | Bacteria | 15177 |
| 281 | Ga0111539_10037630 | 3300009094 | Bacteria | 5842 |
| 282 | Ga0111539_10076014 | 3300009094 | Bacteria | 3955 |
| 283 | Ga0111539_10084162 | 3300009094 | Bacteria | 3740 |
| 284 | Ga0111539_10112002 | 3300009094 | Bacteria | 3201 |
| 285 | Ga0105245_10001689 | 3300009098 | Bacteria | 20076 |
| 286 | Ga0105245_10030551 | 3300009098 | Bacteria | 4764 |
| 287 | Ga0105245_10045099 | 3300009098 | Bacteria | 3936 |
| 288 | Ga0105247_10008112 | 3300009101 | Bacteria | 6415 |
| 289 | Ga0105247_10051584 | 3300009101 | Bacteria | 2534 |
| 290 | Ga0114129_10000119 | 3300009147 | Bacteria | 79679 |
| 291 | Ga0114129_10056261 | 3300009147 | Bacteria | 5510 |
| 292 | Ga0114129_10289232 | 3300009147 | Bacteria | 2187 |
| 293 | Ga0114129_10458134 | 3300009147 | Bacteria | 1671 |
| 294 | Ga0114129_10562462 | 3300009147 | Bacteria | 1482 |
| 295 | Ga0105243_10031692 | 3300009148 | Bacteria | 4077 |
| 296 | Ga0105241_10107967 | 3300009174 | Bacteria | 2224 |
| 297 | Ga0105241_10112391 | 3300009174 | Bacteria | 2182 |
| 298 | Ga0105242_10044172 | 3300009176 | Bacteria | 3607 |
| 299 | Ga0105242_10142480 | 3300009176 | Bacteria | 2081 |
| 300 | Ga0105248_10003905 | 3300009177 | Bacteria | 16485 |
| 301 | Ga0105248_10042203 | 3300009177 | Bacteria | 5115 |
| 302 | Ga0105248_10052989 | 3300009177 | Bacteria | 4552 |
| 303 | Ga0105237_10051480 | 3300009545 | Bacteria | 4136 |
| 304 | Ga0105237_10073452 | 3300009545 | Bacteria | 3412 |
| 305 | Ga0105237_10157361 | 3300009545 | Bacteria | 2269 |
| 306 | Ga0105238_10024802 | 3300009551 | Bacteria | 6112 |
| 307 | Ga0105238_10035681 | 3300009551 | Bacteria | 5054 |
| 308 | Ga0105238_10128745 | 3300009551 | Bacteria | 2510 |
| 309 | Ga0105238_10159039 | 3300009551 | Bacteria | 2235 |
| 310 | Ga0105238_10316408 | 3300009551 | Bacteria | 1546 |
| 311 | Ga0105238_10423924 | 3300009551 | Bacteria | 1325 |
| 312 | Ga0105249_10013319 | 3300009553 | Bacteria | 7261 |
| 313 | Ga0105249_10099754 | 3300009553 | Bacteria | 2730 |
| 314 | Ga0105249_10134454 | 3300009553 | Bacteria | 2365 |
| 315 | Ga0105249_10304139 | 3300009553 | Bacteria | 1600 |
| 316 | Ga0105030_100699 | 3300009987 | Bacteria | 2954 |
| 317 | Ga0099796_10000013 | 3300010159 | Bacteria | 54630 |
| 318 | Ga0105239_10003699 | 3300010375 | Bacteria | 18629 |
| 319 | Ga0105239_10308610 | 3300010375 | Bacteria | 1783 |
| 320 | Ga0105239_10655159 | 3300010375 | Bacteria | 1199 |
| 321 | Ga0105246_10266363 | 3300011119 | Bacteria | 1367 |
| 322 | Ga0157370_10007337 | 3300013104 | Bacteria | 12029 |
| 323 | Ga0157370_10078111 | 3300013104 | Bacteria | 3117 |
| 324 | Ga0157369_10004204 | 3300013105 | Bacteria | 17052 |
| 325 | Ga0157369_10089167 | 3300013105 | Bacteria | 3293 |
| 326 | Ga0157369_10507723 | 3300013105 | Bacteria | 1247 |
| 327 | Ga0157374_10003141 | 3300013296 | Bacteria | 13882 |
| 328 | Ga0157374_10004874 | 3300013296 | Bacteria | 11257 |
| 329 | Ga0157374_10004940 | 3300013296 | Bacteria | 11191 |
| 330 | Ga0157374_10018270 | 3300013296 | Bacteria | 6187 |
| 331 | Ga0157374_10102434 | 3300013296 | Bacteria | 2746 |
| 332 | Ga0157374_10120606 | 3300013296 | Bacteria | 2530 |
| 333 | Ga0157374_10123081 | 3300013296 | Bacteria | 2505 |
| 334 | Ga0157374_10177158 | 3300013296 | Bacteria | 2081 |
| 335 | Ga0157378_10015300 | 3300013297 | Bacteria | 6720 |
| 336 | Ga0157378_10025804 | 3300013297 | Bacteria | 5177 |
| 337 | Ga0157378_10099785 | 3300013297 | Bacteria | 2649 |
| 338 | Ga0157378_10124859 | 3300013297 | Bacteria | 2377 |
| 339 | Ga0163162_10026276 | 3300013306 | Bacteria | 5754 |
| 340 | Ga0163162_10030229 | 3300013306 | Bacteria | 5368 |
| 341 | Ga0163162_10037397 | 3300013306 | Bacteria | 4844 |
| 342 | Ga0163162_10056546 | 3300013306 | Bacteria | 3951 |
| 343 | Ga0163162_10157536 | 3300013306 | Bacteria | 2391 |
| 344 | Ga0163162_10557177 | 3300013306 | Bacteria | 1274 |
| 345 | Ga0157372_10011446 | 3300013307 | Bacteria | 9431 |
| 346 | Ga0157372_10018240 | 3300013307 | Bacteria | 7544 |
| 347 | Ga0157372_10032248 | 3300013307 | Bacteria | 5743 |
| 348 | Ga0157372_10147056 | 3300013307 | Bacteria | 2717 |
| 349 | Ga0157375_10000847 | 3300013308 | Bacteria | 26687 |
| 350 | Ga0157375_10001173 | 3300013308 | Bacteria | 22614 |
| 351 | Ga0157375_10017319 | 3300013308 | Bacteria | 6500 |
| 352 | Ga0157375_10018258 | 3300013308 | Bacteria | 6357 |
| 353 | Ga0157375_10021318 | 3300013308 | Bacteria | 5939 |
| 354 | Ga0157375_10127837 | 3300013308 | Bacteria | 2658 |
| 355 | Ga0157375_10172603 | 3300013308 | Bacteria | 2310 |
| 356 | Ga0157375_10175425 | 3300013308 | Bacteria | 2292 |
| 357 | Ga0157375_10663138 | 3300013308 | Bacteria | 1199 |
| 358 | Ga0157514_105626 | 3300013874 | Bacteria | 1647 |
| 359 | Ga0163163_10000651 | 3300014325 | Bacteria | 29734 |
| 360 | Ga0163163_10013480 | 3300014325 | Bacteria | 7488 |
| 361 | Ga0163163_10696742 | 3300014325 | Bacteria | 1079 |
| 362 | Ga0157380_10006559 | 3300014326 | Bacteria | 8209 |
| 363 | Ga0157380_10021197 | 3300014326 | Bacteria | 4871 |
| 364 | Ga0157380_10115984 | 3300014326 | Bacteria | 2259 |
| 365 | Ga0182008_10141322 | 3300014497 | Bacteria | 1204 |
| 366 | Ga0157377_10015235 | 3300014745 | Bacteria | 3928 |
| 367 | Ga0157379_10000140 | 3300014968 | Bacteria | 51940 |
| 368 | Ga0157379_10001153 | 3300014968 | Bacteria | 21560 |
| 369 | Ga0157379_10034646 | 3300014968 | Bacteria | 4502 |
| 370 | Ga0157379_10039315 | 3300014968 | Bacteria | 4220 |
| 371 | Ga0157379_10605188 | 3300014968 | Bacteria | 1023 |
| 372 | Ga0157376_10010708 | 3300014969 | Bacteria | 6723 |
| 373 | Ga0157376_10021870 | 3300014969 | Bacteria | 4973 |
| 374 | Ga0157376_10059428 | 3300014969 | Bacteria | 3205 |
| 375 | Ga0157376_10079436 | 3300014969 | Bacteria | 2812 |
| 376 | Ga0157376_10180015 | 3300014969 | Bacteria | 1931 |
| 377 | Ga0157376_10334301 | 3300014969 | Bacteria | 1444 |
| 378 | Ga0182006_1000426 | 3300015261 | Bacteria | 33653 |
| 379 | Ga0182007_10019720 | 3300015262 | Bacteria | 2420 |
| 380 | Ga0182005_1000177 | 3300015265 | Bacteria | 43741 |
| 381 | Ga0183360_10001 | 3300015689 | Bacteria | 3943671 |
| 382 | Ga0163161_10165243 | 3300017792 | Bacteria | 1689 |
| 383 | Ga0209760_100925 | 3300025207 | Bacteria | 3634 |
| 384 | Ga0209784_100076 | 3300025224 | Bacteria | 139766 |
| 385 | Ga0207427_100097 | 3300025231 | Bacteria | 122973 |
| 386 | Ga0209437_100116 | 3300025233 | Bacteria | 209449 |
| 387 | Ga0209258_100214 | 3300025242 | Bacteria | 115049 |
| 388 | Ga0207425_1012309 | 3300025245 | Bacteria | 2012 |
| 389 | Ga0209026_1000152 | 3300025250 | Bacteria | 110285 |
| 390 | Ga0209148_1000047 | 3300025254 | Bacteria | 434369 |
| 391 | Ga0209759_1000477 | 3300025256 | Bacteria | 44647 |
| 392 | Ga0209233_1000100 | 3300025261 | Bacteria | 293905 |
| 393 | Ga0209455_1000056 | 3300025272 | Bacteria | 349821 |
| 394 | Ga0209455_1008009 | 3300025272 | Bacteria | 2920 |
| 395 | Ga0209675_1008947 | 3300025291 | Bacteria | 3600 |
| 396 | Ga0209676_1000902 | 3300025292 | Bacteria | 37485 |
| 397 | Ga0209676_1001161 | 3300025292 | Bacteria | 28651 |
| 398 | Ga0209676_1003988 | 3300025292 | Bacteria | 8526 |
| 399 | Ga0209025_1000006 | 3300025294 | Bacteria | 1153444 |
| 400 | Ga0209564_1008169 | 3300025295 | Bacteria | 5229 |
| 401 | Ga0209758_1010914 | 3300025297 | Bacteria | 5352 |
| 402 | Ga0209758_1022287 | 3300025297 | Bacteria | 2913 |
| 403 | Ga0209758_1035471 | 3300025297 | Bacteria | 1966 |
| 404 | Ga0209050_1001357 | 3300025298 | Bacteria | 26808 |
| 405 | Ga0209050_1020156 | 3300025298 | Bacteria | 2493 |
| 406 | Ga0209256_1003764 | 3300025299 | Bacteria | 10230 |
| 407 | Ga0209256_1005859 | 3300025299 | Bacteria | 6819 |
| 408 | Ga0209051_1004483 | 3300025303 | Bacteria | 8585 |
| 409 | Ga0209257_1000210 | 3300025304 | Bacteria | 140822 |
| 410 | Ga0209257_1003174 | 3300025304 | Bacteria | 14617 |
| 411 | Ga0207697_10000127 | 3300025315 | Bacteria | 36502 |
| 412 | Ga0207697_10000230 | 3300025315 | Bacteria | 30289 |
| 413 | Ga0207697_10002319 | 3300025315 | Bacteria | 9913 |
| 414 | Ga0207697_10034143 | 3300025315 | Bacteria | 2082 |
| 415 | Ga0207696_1000096 | 3300025711 | Bacteria | 177263 |
| 416 | Ga0207692_10045343 | 3300025898 | Bacteria | 2199 |
| 417 | Ga0207642_10012409 | 3300025899 | Bacteria | 3075 |
| 418 | Ga0207710_10005865 | 3300025900 | Bacteria | 5267 |
| 419 | Ga0207688_10000591 | 3300025901 | Bacteria | 17806 |
| 420 | Ga0207688_10036345 | 3300025901 | Unclassified | 2730 |
| 421 | Ga0207680_10023677 | 3300025903 | Bacteria | 3358 |
| 422 | Ga0207680_10064604 | 3300025903 | Bacteria | 2244 |
| 423 | Ga0207680_10204137 | 3300025903 | Bacteria | 1348 |
| 424 | Ga0207685_10006566 | 3300025905 | Bacteria | 3178 |
| 425 | Ga0207699_10130360 | 3300025906 | Bacteria | 1639 |
| 426 | Ga0207645_10000171 | 3300025907 | Bacteria | 51812 |
| 427 | Ga0207645_10006341 | 3300025907 | Bacteria | 8505 |
| 428 | Ga0207645_10013669 | 3300025907 | Bacteria | 5461 |
| 429 | Ga0207645_10032058 | 3300025907 | Bacteria | 3379 |
| 430 | Ga0207645_10038449 | 3300025907 | Bacteria | 3069 |
| 431 | Ga0207643_10049139 | 3300025908 | Bacteria | 2390 |
| 432 | Ga0207643_10076788 | 3300025908 | Bacteria | 1930 |
| 433 | Ga0207643_10093215 | 3300025908 | Bacteria | 1758 |
| 434 | Ga0207643_10247148 | 3300025908 | Bacteria | 1098 |
| 435 | Ga0207684_10037866 | 3300025910 | Unclassified | 4092 |
| 436 | Ga0207684_10098239 | 3300025910 | Bacteria | 2500 |
| 437 | Ga0207707_10001141 | 3300025912 | Bacteria | 25186 |
| 438 | Ga0207707_10088618 | 3300025912 | Bacteria | 2703 |
| 439 | Ga0207695_10005812 | 3300025913 | Bacteria | 16234 |
| 440 | Ga0207695_10012567 | 3300025913 | Bacteria | 10146 |
| 441 | Ga0207695_10036780 | 3300025913 | Bacteria | 5288 |
| 442 | Ga0207695_10130051 | 3300025913 | Bacteria | 2476 |
| 443 | Ga0207695_10171000 | 3300025913 | Bacteria | 2098 |
| 444 | Ga0207693_10000503 | 3300025915 | Bacteria | 35359 |
| 445 | Ga0207693_10005444 | 3300025915 | Bacteria | 10616 |
| 446 | Ga0207693_10256185 | 3300025915 | Bacteria | 1372 |
| 447 | Ga0207663_10011802 | 3300025916 | Bacteria | 4704 |
| 448 | Ga0207663_10023100 | 3300025916 | Bacteria | 3564 |
| 449 | Ga0207660_10019218 | 3300025917 | Bacteria | 4564 |
| 450 | Ga0207660_10074190 | 3300025917 | Bacteria | 2482 |
| 451 | Ga0207660_10211583 | 3300025917 | Bacteria | 1519 |
| 452 | Ga0207662_10016842 | 3300025918 | Bacteria | 4129 |
| 453 | Ga0207662_10091820 | 3300025918 | Bacteria | 1868 |
| 454 | Ga0207662_10126810 | 3300025918 | Bacteria | 1605 |
| 455 | Ga0207649_10041309 | 3300025920 | Bacteria | 2807 |
| 456 | Ga0207652_10002545 | 3300025921 | Bacteria | 15309 |
| 457 | Ga0207652_10093156 | 3300025921 | Bacteria | 2651 |
| 458 | Ga0207652_10223712 | 3300025921 | Bacteria | 1696 |
| 459 | Ga0207646_10000115 | 3300025922 | Bacteria | 110424 |
| 460 | Ga0207646_10176222 | 3300025922 | Bacteria | 1931 |
| 461 | Ga0207681_10001338 | 3300025923 | Bacteria | 15901 |
| 462 | Ga0207681_10068054 | 3300025923 | Bacteria | 2471 |
| 463 | Ga0207681_10116045 | 3300025923 | Bacteria | 1955 |
| 464 | Ga0207681_10207184 | 3300025923 | Bacteria | 1509 |
| 465 | Ga0207681_10290062 | 3300025923 | Bacteria | 1291 |
| 466 | Ga0207694_10059801 | 3300025924 | Bacteria | 2964 |
| 467 | Ga0207694_10221015 | 3300025924 | Bacteria | 1545 |
| 468 | Ga0207650_10032005 | 3300025925 | Bacteria | 3803 |
| 469 | Ga0207650_10093412 | 3300025925 | Bacteria | 2303 |
| 470 | Ga0207650_10107177 | 3300025925 | Unclassified | 2158 |
| 471 | Ga0207650_10158378 | 3300025925 | Bacteria | 1792 |
| 472 | Ga0207659_10003201 | 3300025926 | Bacteria | 9791 |
| 473 | Ga0207659_10011180 | 3300025926 | Bacteria | 5663 |
| 474 | Ga0207659_10035522 | 3300025926 | Bacteria | 3445 |
| 475 | Ga0207659_10044224 | 3300025926 | Bacteria | 3132 |
| 476 | Ga0207659_10058465 | 3300025926 | Bacteria | 2768 |
| 477 | Ga0207659_10151725 | 3300025926 | Bacteria | 1810 |
| 478 | Ga0207687_10090224 | 3300025927 | Bacteria | 2233 |
| 479 | Ga0207687_10171123 | 3300025927 | Bacteria | 1675 |
| 480 | Ga0207664_10020285 | 3300025929 | Bacteria | 4923 |
| 481 | Ga0207644_10009392 | 3300025931 | Bacteria | 6423 |
| 482 | Ga0207644_10019599 | 3300025931 | Bacteria | 4591 |
| 483 | Ga0207644_10022203 | 3300025931 | Bacteria | 4334 |
| 484 | Ga0207644_10059011 | 3300025931 | Unclassified | 2774 |
| 485 | Ga0207644_10143243 | 3300025931 | Bacteria | 1842 |
| 486 | Ga0207706_10000921 | 3300025933 | Bacteria | 30112 |
| 487 | Ga0207706_10104054 | 3300025933 | Bacteria | 2497 |
| 488 | Ga0207706_10116337 | 3300025933 | Bacteria | 2352 |
| 489 | Ga0207706_10212264 | 3300025933 | Bacteria | 1696 |
| 490 | Ga0207686_10011202 | 3300025934 | Bacteria | 4904 |
| 491 | Ga0207686_10067655 | 3300025934 | Bacteria | 2286 |
| 492 | Ga0207686_10119445 | 3300025934 | Bacteria | 1792 |
| 493 | Ga0207670_10009590 | 3300025936 | Bacteria | 5531 |
| 494 | Ga0207670_10045538 | 3300025936 | Bacteria | 2909 |
| 495 | Ga0207670_10054826 | 3300025936 | Bacteria | 2692 |
| 496 | Ga0207670_10060043 | 3300025936 | Bacteria | 2589 |
| 497 | Ga0207670_10065040 | 3300025936 | Bacteria | 2502 |
| 498 | Ga0207669_10003041 | 3300025937 | Bacteria | 7222 |
| 499 | Ga0207669_10020808 | 3300025937 | Bacteria | 3448 |
| 500 | Ga0207669_10063271 | 3300025937 | Bacteria | 2283 |
| 501 | Ga0207704_10006008 | 3300025938 | Bacteria | 5627 |
| 502 | Ga0207704_10062251 | 3300025938 | Bacteria | 2319 |
| 503 | Ga0207665_10001022 | 3300025939 | Bacteria | 18882 |
| 504 | Ga0207665_10022922 | 3300025939 | Bacteria | 4110 |
| 505 | Ga0207665_10038899 | 3300025939 | Bacteria | 3169 |
| 506 | Ga0207665_10079680 | 3300025939 | Bacteria | 2251 |
| 507 | Ga0207665_10290627 | 3300025939 | Bacteria | 1219 |
| 508 | Ga0207691_10000559 | 3300025940 | Bacteria | 37169 |
| 509 | Ga0207691_10001130 | 3300025940 | Bacteria | 26498 |
| 510 | Ga0207691_10012145 | 3300025940 | Bacteria | 8257 |
| 511 | Ga0207691_10014279 | 3300025940 | Bacteria | 7575 |
| 512 | Ga0207691_10072437 | 3300025940 | Bacteria | 3108 |
| 513 | Ga0207691_10114204 | 3300025940 | Bacteria | 2399 |
| 514 | Ga0207691_10138756 | 3300025940 | Bacteria | 2143 |
| 515 | Ga0207691_10218961 | 3300025940 | Bacteria | 1651 |
| 516 | Ga0207711_10049042 | 3300025941 | Bacteria | 3614 |
| 517 | Ga0207711_10301688 | 3300025941 | Bacteria | 1477 |
| 518 | Ga0207689_10002452 | 3300025942 | Bacteria | 17282 |
| 519 | Ga0207689_10055262 | 3300025942 | Bacteria | 3268 |
| 520 | Ga0207689_10089737 | 3300025942 | Bacteria | 2525 |
| 521 | Ga0207689_10131883 | 3300025942 | Bacteria | 2056 |
| 522 | Ga0207661_10011542 | 3300025944 | Bacteria | 6407 |
| 523 | Ga0207679_10044562 | 3300025945 | Bacteria | 3201 |
| 524 | Ga0207679_10276241 | 3300025945 | Bacteria | 1439 |
| 525 | Ga0207667_10003042 | 3300025949 | Bacteria | 20811 |
| 526 | Ga0207667_10007832 | 3300025949 | Bacteria | 12766 |
| 527 | Ga0207667_10015125 | 3300025949 | Bacteria | 8774 |
| 528 | Ga0207667_10016187 | 3300025949 | Bacteria | 8430 |
| 529 | Ga0207667_10050891 | 3300025949 | Bacteria | 4370 |
| 530 | Ga0207651_10018685 | 3300025960 | Bacteria | 4133 |
| 531 | Ga0207651_10096373 | 3300025960 | Bacteria | 2181 |
| 532 | Ga0207651_10131406 | 3300025960 | Unclassified | 1917 |
| 533 | Ga0207651_10132280 | 3300025960 | Bacteria | 1912 |
| 534 | Ga0207712_10011043 | 3300025961 | Bacteria | 5749 |
| 535 | Ga0207668_10000957 | 3300025972 | Bacteria | 17416 |
| 536 | Ga0207668_10018195 | 3300025972 | Bacteria | 4416 |
| 537 | Ga0207668_10041479 | 3300025972 | Bacteria | 3111 |
| 538 | Ga0207668_10078135 | 3300025972 | Bacteria | 2389 |
| 539 | Ga0207668_10366227 | 3300025972 | Bacteria | 1209 |
| 540 | Ga0207658_10000131 | 3300025986 | Bacteria | 80909 |
| 541 | Ga0207658_10004264 | 3300025986 | Bacteria | 9962 |
| 542 | Ga0207658_10013569 | 3300025986 | Bacteria | 5571 |
| 543 | Ga0207658_10038107 | 3300025986 | Bacteria | 3460 |
| 544 | Ga0207658_10088850 | 3300025986 | Bacteria | 2390 |
| 545 | Ga0207658_10120211 | 3300025986 | Bacteria | 2093 |
| 546 | Ga0207658_10206184 | 3300025986 | Bacteria | 1644 |
| 547 | Ga0207677_10054699 | 3300026023 | Bacteria | 2725 |
| 548 | Ga0207677_10207243 | 3300026023 | Unclassified | 1563 |
| 549 | Ga0207677_10230151 | 3300026023 | Unclassified | 1492 |
| 550 | Ga0207703_10016287 | 3300026035 | Bacteria | 5795 |
| 551 | Ga0207703_10099428 | 3300026035 | Bacteria | 2462 |
| 552 | Ga0207703_10446782 | 3300026035 | Unclassified | 1207 |
| 553 | Ga0207639_10065784 | 3300026041 | Bacteria | 2815 |
| 554 | Ga0207639_10240985 | 3300026041 | Bacteria | 1572 |
| 555 | Ga0207708_10039861 | 3300026075 | Bacteria | 3580 |
| 556 | Ga0207702_10023010 | 3300026078 | Bacteria | 5169 |
| 557 | Ga0207702_10152734 | 3300026078 | Bacteria | 2102 |
| 558 | Ga0207641_10001631 | 3300026088 | Bacteria | 21877 |
| 559 | Ga0207641_10007657 | 3300026088 | Bacteria | 8979 |
| 560 | Ga0207641_10010738 | 3300026088 | Bacteria | 7508 |
| 561 | Ga0207641_10177441 | 3300026088 | Bacteria | 1949 |
| 562 | Ga0207641_10335107 | 3300026088 | Bacteria | 1438 |
| 563 | Ga0207648_10000450 | 3300026089 | Bacteria | 45586 |
| 564 | Ga0207648_10009740 | 3300026089 | Bacteria | 9187 |
| 565 | Ga0207676_10011037 | 3300026095 | Bacteria | 6446 |
| 566 | Ga0207674_10096108 | 3300026116 | Bacteria | 2948 |
| 567 | Ga0207674_10200954 | 3300026116 | Bacteria | 1942 |
| 568 | Ga0207675_100000186 | 3300026118 | Bacteria | 56221 |
| 569 | Ga0207675_100009520 | 3300026118 | Bacteria | 9089 |
| 570 | Ga0207675_100012136 | 3300026118 | Bacteria | 8049 |
| 571 | Ga0207675_100013158 | 3300026118 | Bacteria | 7723 |
| 572 | Ga0207675_100123924 | 3300026118 | Bacteria | 2447 |
| 573 | Ga0207683_10003057 | 3300026121 | Bacteria | 14629 |
| 574 | Ga0207683_10048708 | 3300026121 | Bacteria | 3709 |
| 575 | Ga0207683_10127022 | 3300026121 | Bacteria | 2292 |
| 576 | Ga0207683_10285550 | 3300026121 | Bacteria | 1508 |
| 577 | Ga0207698_10260058 | 3300026142 | Bacteria | 1594 |
| 578 | Ga0209984_1007099 | 3300027424 | Bacteria | 1387 |
| 579 | Ga0209179_1000025 | 3300027512 | Bacteria | 37683 |
| 580 | Ga0209970_1000774 | 3300027614 | Bacteria | 5588 |
| 581 | Ga0210002_1000587 | 3300027617 | Bacteria | 4931 |
| 582 | Ga0209983_1001502 | 3300027665 | Bacteria | 5192 |
| 583 | Ga0209588_1014692 | 3300027671 | Bacteria | 2400 |
| 584 | Ga0209971_1004126 | 3300027682 | Bacteria | 3441 |
| 585 | Ga0209998_10002195 | 3300027717 | Bacteria | 4532 |
| 586 | Ga0209974_10000104 | 3300027876 | Bacteria | 23941 |
| 587 | Ga0207428_10005148 | 3300027907 | Bacteria | 12247 |
| 588 | Ga0207428_10051710 | 3300027907 | Bacteria | 3283 |
| 589 | Ga0207428_10059740 | 3300027907 | Bacteria | 3022 |
| 590 | Ga0207428_10073196 | 3300027907 | Bacteria | 2688 |
| 591 | Ga0207428_10182389 | 3300027907 | Bacteria | 1585 |
| 592 | Ga0268266_10079426 | 3300028379 | Bacteria | 2856 |
| 593 | Ga0268266_10092394 | 3300028379 | Bacteria | 2655 |
| 594 | Ga0268266_10096839 | 3300028379 | Bacteria | 2595 |
| 595 | Ga0268266_10232811 | 3300028379 | Bacteria | 1697 |
| 596 | Ga0268265_10000879 | 3300028380 | Bacteria | 28089 |
| 597 | Ga0268265_10043119 | 3300028380 | Bacteria | 3351 |
| 598 | Ga0268265_10063385 | 3300028380 | Bacteria | 2843 |
| 599 | Ga0268265_10080292 | 3300028380 | Bacteria | 2572 |
| 600 | Ga0268265_10150675 | 3300028380 | Bacteria | 1961 |
| 601 | Ga0268264_10000102 | 3300028381 | Bacteria | 222526 |
| 602 | Ga0268264_10013464 | 3300028381 | Bacteria | 6734 |
| 603 | Ga0268264_10013892 | 3300028381 | Bacteria | 6620 |
| 604 | Ga0268264_10071509 | 3300028381 | Bacteria | 2939 |
| 605 | Ga0265334_10012805 | 3300028573 | Bacteria | 3518 |
| 606 | Ga0265338_10003632 | 3300028800 | Bacteria | 21487 |
| 607 | Ga0307511_10004214 | 3300030521 | Bacteria | 14673 |
| 608 | Ga0307511_10036113 | 3300030521 | Bacteria | 4298 |
| 609 | Ga0265760_10002154 | 3300031090 | Bacteria | 5762 |
| 610 | Ga0265339_10054301 | 3300031249 | Bacteria | 2176 |
| 611 | Ga0265331_10009421 | 3300031250 | Bacteria | 5481 |
| 612 | Ga0265327_10000556 | 3300031251 | Bacteria | 63939 |
| 613 | Ga0265327_10003741 | 3300031251 | Bacteria | 14146 |
| 614 | Ga0265327_10017089 | 3300031251 | Bacteria | 4569 |
| 615 | Ga0265327_10017852 | 3300031251 | Bacteria | 4426 |
| 616 | Ga0265327_10093483 | 3300031251 | Bacteria | 1463 |
| 617 | Ga0265316_10000167 | 3300031344 | Bacteria | 74551 |
| 618 | Ga0307513_10008759 | 3300031456 | Bacteria | 12885 |
| 619 | Ga0307513_10183040 | 3300031456 | Bacteria | 1956 |
| 620 | Ga0307513_10259883 | 3300031456 | Bacteria | 1527 |
| 621 | Ga0307509_10209922 | 3300031507 | Bacteria | 1773 |
| 622 | Ga0307408_100036559 | 3300031548 | Bacteria | 3453 |
| 623 | Ga0307408_100076964 | 3300031548 | Bacteria | 2483 |
| 624 | Ga0307408_100262339 | 3300031548 | Bacteria | 1430 |
| 625 | Ga0307408_100323812 | 3300031548 | Bacteria | 1299 |
| 626 | Ga0307408_100521352 | 3300031548 | Bacteria | 1044 |
| 627 | Ga0265313_10044529 | 3300031595 | Bacteria | 2166 |
| 628 | Ga0307508_10261319 | 3300031616 | Bacteria | 1326 |
| 629 | Ga0316575_10006188 | 3300031665 | Bacteria | 4294 |
| 630 | Ga0316575_10008075 | 3300031665 | Bacteria | 3826 |
| 631 | Ga0316575_10009617 | 3300031665 | Bacteria | 3541 |
| 632 | Ga0316575_10024359 | 3300031665 | Bacteria | 2343 |
| 633 | Ga0316579_10009386 | 3300031691 | Bacteria | 4112 |
| 634 | Ga0316576_10005106 | 3300031727 | Bacteria | 7966 |
| 635 | Ga0316576_10018540 | 3300031727 | Bacteria | 4753 |
| 636 | Ga0316576_10056216 | 3300031727 | Bacteria | 2873 |
| 637 | Ga0316576_10066117 | 3300031727 | Bacteria | 2658 |
| 638 | Ga0316576_10101925 | 3300031727 | Bacteria | 2146 |
| 639 | Ga0316578_10051924 | 3300031728 | Bacteria | 2401 |
| 640 | Ga0316578_10058275 | 3300031728 | Bacteria | 2271 |
| 641 | Ga0307516_10000081 | 3300031730 | Bacteria | 105223 |
| 642 | Ga0307405_10028693 | 3300031731 | Bacteria | 3244 |
| 643 | Ga0316577_10000946 | 3300031733 | Bacteria | 12913 |
| 644 | Ga0316577_10007228 | 3300031733 | Bacteria | 5918 |
| 645 | Ga0316577_10074569 | 3300031733 | Bacteria | 1894 |
| 646 | Ga0307413_10165982 | 3300031824 | Unclassified | 1557 |
| 647 | Ga0307413_10293709 | 3300031824 | Bacteria | 1229 |
| 648 | Ga0307410_10108025 | 3300031852 | Bacteria | 2008 |
| 649 | Ga0307410_10248047 | 3300031852 | Bacteria | 1383 |
| 650 | Ga0307406_10115597 | 3300031901 | Bacteria | 1855 |
| 651 | Ga0307406_10150755 | 3300031901 | Bacteria | 1658 |
| 652 | Ga0307407_10015223 | 3300031903 | Bacteria | 3793 |
| 653 | Ga0307407_10050152 | 3300031903 | Bacteria | 2387 |
| 654 | Ga0307407_10066608 | 3300031903 | Bacteria | 2125 |
| 655 | Ga0307409_100002001 | 3300031995 | Bacteria | 10456 |
| 656 | Ga0307409_100047196 | 3300031995 | Bacteria | 3267 |
| 657 | Ga0307409_100459714 | 3300031995 | Bacteria | 1230 |
| 658 | Ga0307416_100018243 | 3300032002 | Bacteria | 4937 |
| 659 | Ga0307416_100023642 | 3300032002 | Bacteria | 4465 |
| 660 | Ga0307416_100028901 | 3300032002 | Bacteria | 4132 |
| 661 | Ga0307416_100114613 | 3300032002 | Bacteria | 2385 |
| 662 | Ga0307414_10046280 | 3300032004 | Bacteria | 2985 |
| 663 | Ga0307411_10017297 | 3300032005 | Bacteria | 4104 |
| 664 | Ga0307411_10214136 | 3300032005 | Bacteria | 1490 |
| 665 | Ga0307415_100545326 | 3300032126 | Bacteria | 1022 |
| 666 | Ga0316580_10012862 | 3300032139 | Bacteria | 2550 |
| 667 | Ga0316580_10042730 | 3300032139 | Bacteria | 1399 |
| 668 | Ga0307510_10000006 | 3300033180 | Bacteria | 566474 |
| 669 | Ga0373934_0000368 | 3300035086 | Bacteria | 15752 |
| 670 | Ga0373934_0000410 | 3300035086 | Bacteria | 15055 |
| 671 | Ga0373944_0017915 | 3300035089 | Bacteria | 2017 |
| 672 | Ga0373944_0056672 | 3300035089 | Bacteria | 1248 |
| 673 | Ga0373923_0018514 | 3300035111 | Bacteria | 2682 |
| 674 | Ga0373923_0050074 | 3300035111 | Bacteria | 1748 |
| 675 | Ga0373936_0006311 | 3300035113 | Bacteria | 4468 |
| 676 | Ga0373945_0097279 | 3300035116 | Bacteria | 1148 |
| 677 | Ga0373945_0140497 | 3300035116 | Bacteria | 973 |
| 678 | Ga0373953_0020584 | 3300035117 | Bacteria | 2466 |
| 679 | Ga0373954_0001420 | 3300035118 | Bacteria | 9700 |
| 680 | Ga0373954_0004483 | 3300035118 | Bacteria | 6010 |
| 681 | Ga0373954_0032778 | 3300035118 | Bacteria | 2403 |
| 682 | Ga0373954_0035135 | 3300035118 | Bacteria | 2323 |
| 683 | Ga0373956_0010617 | 3300035119 | Bacteria | 3779 |
| 684 | Ga0373957_0003247 | 3300035120 | Bacteria | 4781 |
| 685 | Ga0373957_0014510 | 3300035120 | Bacteria | 2694 |
| 686 | Ga0373943_0053245 | 3300035170 | Bacteria | 1998 |
| 687 | Ga0373943_0115360 | 3300035170 | Bacteria | 1422 |
| 688 | Ga0373955_0001973 | 3300035172 | Bacteria | 8838 |
| 689 | Ga0373955_0031395 | 3300035172 | Bacteria | 2782 |
| 690 | Ga0373955_0078054 | 3300035172 | Bacteria | 1865 |
| 691 | Ga0316574_0000907 | 3300035398 | Bacteria | 13124 |
| 692 | Ga0316574_0004321 | 3300035398 | Bacteria | 7422 |
| 693 | Ga0316574_0006853 | 3300035398 | Bacteria | 6195 |
| 694 | Ga0316574_0021411 | 3300035398 | Bacteria | 3838 |
| 695 | Ga0316574_0030227 | 3300035398 | Bacteria | 3279 |
| 696 | Ga0316574_0032277 | 3300035398 | Bacteria | 3182 |
| 697 | Ga0316574_0044614 | 3300035398 | Bacteria | 2743 |
| 698 | Ga0316574_0112790 | 3300035398 | Bacteria | 1743 |
| 699 | Ga0316574_0114889 | 3300035398 | Bacteria | 1726 |
| 700 | Ga0373924_0003250 | 3300035410 | Bacteria | 5560 |
| 701 | Ga0373935_0001511 | 3300035692 | Bacteria | 12932 |
| 702 | Ga0373935_0032184 | 3300035692 | Bacteria | 3258 |
| 703 | Ga0373935_0317485 | 3300035692 | Bacteria | 1105 |
| 704 | Ga0373927_0000002 | 3300035695 | Bacteria | 966219 |
| 705 | Ga0373927_0045147 | 3300035695 | Bacteria | 2851 |
| 706 | Ga0373927_0101301 | 3300035695 | Bacteria | 1873 |
| 707 | Ga0373933_0000335 | 3300035724 | Bacteria | 30249 |
| 708 | Ga0373933_0101203 | 3300035724 | Bacteria | 1788 |
| 709 | Ga0373947_0014892 | 3300035725 | Bacteria | 4463 |
| 710 | Ga0373947_0022163 | 3300035725 | Bacteria | 3681 |
| 711 | Ga0373947_0108948 | 3300035725 | Bacteria | 1748 |
| 712 | Ga0373947_0279906 | 3300035725 | Bacteria | 1109 |
| 713 | Ga0373937_0001114 | 3300036401 | Bacteria | 22657 |
| 714 | Ga0373937_0018294 | 3300036401 | Bacteria | 6255 |
| 715 | Ga0373937_0019437 | 3300036401 | Bacteria | 6081 |
| 716 | Ga0373937_0040334 | 3300036401 | Bacteria | 4255 |
| 717 | Ga0373937_0140081 | 3300036401 | Bacteria | 2262 |
| 718 | Ga0373937_0182014 | 3300036401 | Bacteria | 1974 |
| 719 | Ga0373937_0202480 | 3300036401 | Bacteria | 1866 |
| 720 | Ga0373937_0267009 | 3300036401 | Bacteria | 1614 |
| 721 | Ga0316582_0019082 | 3300036647 | Bacteria | 4006 |
| 722 | Ga0316582_0019741 | 3300036647 | Bacteria | 3951 |
| 723 | Ga0316584_0029803 | 3300036712 | Bacteria | 4029 |
| 724 | Ga0316584_0067900 | 3300036712 | Bacteria | 2672 |
| 725 | Ga0373925_0035071 | 3300037068 | Bacteria | 3700 |
| 726 | Ga0373925_0051829 | 3300037068 | Bacteria | 3064 |
| 727 | Ga0373925_0149829 | 3300037068 | Bacteria | 1831 |
| 728 | Ga0373925_0181274 | 3300037068 | Bacteria | 1667 |
| 729 | Ga0395899_0003927 | 3300037312 | Bacteria | 11720 |
| 730 | Ga0395900_0016871 | 3300037418 | Bacteria | 7453 |
| 731 | Ga0395900_0208144 | 3300037418 | Bacteria | 1976 |
| 732 | Ga0395898_0019512 | 3300037466 | Bacteria | 6899 |
| 733 | Ga0395898_0388359 | 3300037466 | Bacteria | 1331 |
| 734 | Ga0395905_0000491 | 3300037471 | Bacteria | 54464 |
| 735 | Ga0395905_0001364 | 3300037471 | Bacteria | 29717 |
| 736 | Ga0316581_0008820 | 3300037588 | Bacteria | 2755 |
| 737 | Ga0316581_0031972 | 3300037588 | Bacteria | 1587 |
| 738 | Ga0436364_1265600 | 3300037853 | Bacteria | 1134 |
| 739 | Ga0395901_0016944 | 3300038443 | Bacteria | 7427 |
| 740 | Ga0436365_0183573 | 3300039437 | Bacteria | 1259 |
| 741 | Ga0436365_0185309 | 3300039437 | Bacteria | 2223 |
| 742 | Ga0436365_0831110 | 3300039437 | Bacteria | 13047 |
| 743 | Ga0436363_0158878 | 3300039450 | Bacteria | 7240 |
| 744 | Ga0436363_1045643 | 3300039450 | Unclassified | 1761 |
| 745 | Ga0436363_1321922 | 3300039450 | Bacteria | 2662 |
| 746 | Ga0439447_000636 | 3300041407 | Bacteria | 13075 |
| 747 | Ga0451841_1321531 | 3300041498 | Bacteria | 2285 |
| 748 | Ga0439441_009725 | 3300042001 | Bacteria | 1599 |
| 749 | Ga0439442_006739 | 3300042002 | Bacteria | 2308 |
| 750 | Ga0439449_0027011 | 3300042007 | Bacteria | 2142 |
| 751 | Ga0439449_0034393 | 3300042007 | Bacteria | 1887 |
| 752 | Ga0439452_025133 | 3300042010 | Bacteria | 1515 |
| 753 | Ga0439454_012946 | 3300042011 | Bacteria | 1138 |
| 754 | Ga0450914_007621 | 3300042118 | Bacteria | 982 |
| 755 | Ga0450920_000265 | 3300042122 | Bacteria | 7823 |
| 756 | Ga0450923_000721 | 3300042125 | Bacteria | 3912 |
| 757 | Ga0450923_036647 | 3300042125 | Bacteria | 1018 |
| 758 | Ga0450891_007844 | 3300042129 | Bacteria | 979 |
| 759 | Ga0450894_004353 | 3300042131 | Bacteria | 1840 |
| 760 | Ga0450896_004094 | 3300042133 | Bacteria | 1966 |
| 761 | Ga0450898_017616 | 3300042134 | Bacteria | 1230 |
| 762 | Ga0450910_008149 | 3300042147 | Bacteria | 1470 |
| 763 | Ga0450908_000566 | 3300042184 | Bacteria | 7101 |
| 764 | Ga0439435_0007663 | 3300042436 | Bacteria | 2479 |
| 765 | Ga0439444_0008815 | 3300042437 | Bacteria | 1577 |
| 766 | Ga0451577_0064238 | 3300042876 | Bacteria | 3273 |
| 767 | Ga0451577_0303388 | 3300042876 | Bacteria | 1447 |
| 768 | Ga0466966_0071783 | 3300044684 | Bacteria | 2169 |
| 769 | Ga0453684_0014076 | 3300044712 | Bacteria | 12865 |
| 770 | Ga0453684_0037359 | 3300044712 | Bacteria | 6667 |
| 771 | Ga0453684_0567487 | 3300044712 | Bacteria | 1248 |
| 772 | Ga0466957_0103105 | 3300044842 | Bacteria | 1801 |
| 773 | Ga0466959_0062293 | 3300045049 | Bacteria | 2711 |
| 774 | Ga0451576_0002379 | 3300045051 | Bacteria | 28340 |
| 775 | Ga0451576_0040111 | 3300045051 | Bacteria | 4957 |
| 776 | Ga0451576_0068419 | 3300045051 | Bacteria | 3695 |
| 777 | Ga0451576_0101804 | 3300045051 | Bacteria | 2987 |
| 778 | Ga0466967_0011944 | 3300045976 | Bacteria | 6617 |
| 779 | Ga0466967_0342586 | 3300045976 | Bacteria | 1446 |
| 780 | Ga0495617_000131 | 3300046452 | Bacteria | 49764 |
| 781 | Ga0495617_001386 | 3300046452 | Bacteria | 10676 |
| 782 | Ga0495592_0029149 | 3300046454 | Bacteria | 4178 |
| 783 | Ga0495592_0048971 | 3300046454 | Bacteria | 3142 |
| 784 | Ga0495603_0075883 | 3300046455 | Bacteria | 1973 |
| 785 | Ga0495603_0098263 | 3300046455 | Bacteria | 1710 |
| 786 | Ga0495629_0034030 | 3300046459 | Bacteria | 3603 |
| 787 | Ga0495629_0159541 | 3300046459 | Bacteria | 1567 |
| 788 | Ga0495638_0000180 | 3300046460 | Bacteria | 96716 |
| 789 | Ga0495638_0005940 | 3300046460 | Bacteria | 8961 |
| 790 | Ga0495638_0103716 | 3300046460 | Bacteria | 1697 |
| 791 | Ga0495641_0023815 | 3300046461 | Bacteria | 3033 |
| 792 | Ga0495651_0000408 | 3300046462 | Bacteria | 33285 |
| 793 | Ga0495651_0001927 | 3300046462 | Bacteria | 16055 |
| 794 | Ga0495651_0080049 | 3300046462 | Bacteria | 2468 |
| 795 | Ga0495653_0007912 | 3300046463 | Bacteria | 8701 |
| 796 | Ga0495650_0006073 | 3300046471 | Bacteria | 7624 |
| 797 | Ga0495650_0013234 | 3300046471 | Bacteria | 4378 |
| 798 | Ga0495580_0008617 | 3300046472 | Bacteria | 8087 |
| 799 | Ga0495580_0039451 | 3300046472 | Bacteria | 3378 |
| 800 | Ga0495580_0058235 | 3300046472 | Bacteria | 2718 |
| 801 | Ga0495580_0121921 | 3300046472 | Bacteria | 1810 |
| 802 | Ga0495664_0014727 | 3300046477 | Bacteria | 4437 |
| 803 | Ga0495584_0001164 | 3300046491 | Bacteria | 16193 |
| 804 | Ga0495585_0000437 | 3300046492 | Bacteria | 39894 |
| 805 | Ga0495594_0056106 | 3300046499 | Bacteria | 2173 |
| 806 | Ga0495607_0000654 | 3300046501 | Bacteria | 33669 |
| 807 | Ga0495606_0000918 | 3300046507 | Bacteria | 43503 |
| 808 | Ga0495606_0009672 | 3300046507 | Bacteria | 8115 |
| 809 | Ga0495608_0067704 | 3300046511 | Bacteria | 2335 |
| 810 | Ga0495616_0000190 | 3300046513 | Bacteria | 51392 |
| 811 | Ga0495616_0000360 | 3300046513 | Bacteria | 35740 |
| 812 | Ga0495618_0076527 | 3300046514 | Bacteria | 2133 |
| 813 | Ga0495618_0137694 | 3300046514 | Bacteria | 1561 |
| 814 | Ga0495620_0000719 | 3300046515 | Bacteria | 20409 |
| 815 | Ga0495628_0004271 | 3300046516 | Bacteria | 12709 |
| 816 | Ga0495628_0066181 | 3300046516 | Bacteria | 2825 |
| 817 | Ga0495628_0085758 | 3300046516 | Bacteria | 2442 |
| 818 | Ga0495628_0144119 | 3300046516 | Bacteria | 1817 |
| 819 | Ga0495630_0075496 | 3300046517 | Bacteria | 2540 |
| 820 | Ga0495630_0252477 | 3300046517 | Bacteria | 1347 |
| 821 | Ga0495631_0000389 | 3300046518 | Bacteria | 30279 |
| 822 | Ga0495631_0000631 | 3300046518 | Bacteria | 23012 |
| 823 | Ga0495632_0000135 | 3300046519 | Bacteria | 75082 |
| 824 | Ga0495632_0007588 | 3300046519 | Bacteria | 6788 |
| 825 | Ga0495637_0034945 | 3300046520 | Bacteria | 2198 |
| 826 | Ga0495644_0005069 | 3300046523 | Bacteria | 5153 |
| 827 | Ga0495648_0003653 | 3300046524 | Bacteria | 13457 |
| 828 | Ga0495648_0005315 | 3300046524 | Bacteria | 10739 |
| 829 | Ga0495663_0028503 | 3300046525 | Bacteria | 1644 |
| 830 | Ga0495666_0005322 | 3300046526 | Bacteria | 6489 |
| 831 | Ga0495652_0041652 | 3300046529 | Bacteria | 3963 |
| 832 | Ga0495652_0290449 | 3300046529 | Bacteria | 1193 |
| 833 | Ga0495665_0026288 | 3300046531 | Bacteria | 3126 |
| 834 | Ga0495640_0006168 | 3300046533 | Bacteria | 9502 |
| 835 | Ga0495586_0106170 | 3300046535 | Bacteria | 1561 |
| 836 | Ga0495586_0130027 | 3300046535 | Bacteria | 1409 |
| 837 | Ga0495587_0005354 | 3300046536 | Bacteria | 8392 |
| 838 | Ga0495609_0015535 | 3300046538 | Bacteria | 3562 |
| 839 | Ga0495621_0002704 | 3300046539 | Bacteria | 4808 |
| 840 | Ga0495622_0027562 | 3300046557 | Bacteria | 2652 |
| 841 | Ga0495622_0042981 | 3300046557 | Bacteria | 2101 |
| 842 | Ga0495667_0007860 | 3300046559 | Bacteria | 7226 |
| 843 | Ga0495656_0027319 | 3300046615 | Bacteria | 2278 |
| 844 | Ga0495656_0072717 | 3300046615 | Bacteria | 1531 |
| 845 | Ga0495668_0001101 | 3300046616 | Bacteria | 27963 |
| 846 | Ga0495668_0004981 | 3300046616 | Bacteria | 9190 |
| 847 | Ga0495634_0050977 | 3300046642 | Bacteria | 2777 |
| 848 | Ga0495611_0000004 | 3300046648 | Bacteria | 308149 |
| 849 | Ga0495611_0000285 | 3300046648 | Bacteria | 34425 |
| 850 | Ga0495625_0000617 | 3300046660 | Bacteria | 51659 |
| 851 | Ga0495625_0009073 | 3300046660 | Bacteria | 8390 |
| 852 | Ga0495625_0065486 | 3300046660 | Bacteria | 2561 |
| 853 | Ga0495635_0134045 | 3300046663 | Bacteria | 1688 |
| 854 | Ga0495659_0005803 | 3300046664 | Bacteria | 3895 |
| 855 | Ga0495661_0001370 | 3300046665 | Bacteria | 20570 |
| 856 | Ga0495657_0007507 | 3300046675 | Bacteria | 8425 |
| 857 | Ga0495599_0004788 | 3300046678 | Bacteria | 8046 |
| 858 | Ga0495647_0002069 | 3300046681 | Bacteria | 6279 |
| 859 | Ga0495647_0028686 | 3300046681 | Bacteria | 2054 |
| 860 | Ga0495658_0009573 | 3300046683 | Bacteria | 4832 |
| 861 | Ga0495658_0036728 | 3300046683 | Bacteria | 2705 |
| 862 | Ga0495658_0060184 | 3300046683 | Bacteria | 2177 |
| 863 | Ga0495669_0043136 | 3300046684 | Bacteria | 2007 |
| 864 | Ga0495613_0008505 | 3300046689 | Bacteria | 7616 |
| 865 | Ga0495613_0262702 | 3300046689 | Bacteria | 1202 |
| 866 | Ga0495670_0000884 | 3300046691 | Bacteria | 14524 |
| 867 | Ga0495671_0010269 | 3300046692 | Bacteria | 5198 |
| 868 | Ga0495671_0026160 | 3300046692 | Bacteria | 3027 |
| 869 | Ga0495671_0076964 | 3300046692 | Bacteria | 1636 |
| 870 | Ga0495649_0003176 | 3300046694 | Bacteria | 11231 |
| 871 | Ga0495649_0003223 | 3300046694 | Bacteria | 11133 |
| 872 | Ga0495589_0002511 | 3300046794 | Bacteria | 10232 |
| 873 | Ga0495600_0031607 | 3300046809 | Bacteria | 3430 |
| 874 | Ga0495660_0000356 | 3300046810 | Bacteria | 40494 |
| 875 | Ga0495660_0000685 | 3300046810 | Bacteria | 25950 |
| 876 | Ga0495604_0071290 | 3300047317 | Bacteria | 2628 |
| 877 | Ga0495604_0201517 | 3300047317 | Bacteria | 1380 |
| 878 | Ga0495636_0013408 | 3300047318 | Bacteria | 3253 |
| 879 | Ga0495674_0012393 | 3300047319 | Bacteria | 8034 |
| 880 | Ga0495680_0426497 | 3300047322 | Bacteria | 911 |
| 881 | Ga0495679_000011 | 3300047446 | Bacteria | 324498 |
| 882 | Ga0495673_0000036 | 3300047469 | Bacteria | 311035 |
| 883 | Ga0495673_0000151 | 3300047469 | Bacteria | 122181 |
| 884 | Ga0495673_0003447 | 3300047469 | Bacteria | 10415 |
| 885 | Ga0495681_0014156 | 3300047470 | Bacteria | 4589 |
| 886 | Ga0495684_0008689 | 3300047471 | Bacteria | 7855 |
| 887 | Ga0495686_0002323 | 3300047472 | Bacteria | 18182 |
| 888 | Ga0495614_0007216 | 3300048089 | Bacteria | 4953 |
| 889 | Ga0496100_0014939 | 3300048903 | Bacteria | 4524 |
| 890 | Ga0496100_0049219 | 3300048903 | Bacteria | 2724 |
| 891 | Ga0496100_0074816 | 3300048903 | Bacteria | 2270 |
| 892 | Ga0496100_0079114 | 3300048903 | Bacteria | 2214 |
| 893 | Ga0496101_0002453 | 3300048904 | Bacteria | 11402 |
| 894 | Ga0496101_0005357 | 3300048904 | Bacteria | 8175 |
| 895 | Ga0496101_0146004 | 3300048904 | Bacteria | 1806 |
| 896 | Ga0496102_0170892 | 3300048905 | Bacteria | 2046 |
| 897 | Ga0496104_0026561 | 3300048907 | Bacteria | 5349 |
| 898 | Ga0496104_0078178 | 3300048907 | Bacteria | 3152 |
| 899 | Ga0496104_0194561 | 3300048907 | Bacteria | 1940 |
| 900 | Ga0496104_0461198 | 3300048907 | Bacteria | 1182 |
| 901 | Ga0496105_0000580 | 3300048908 | Bacteria | 24291 |
| 902 | Ga0496105_0113849 | 3300048908 | Bacteria | 2231 |
| 903 | Ga0496106_0000566 | 3300048909 | Bacteria | 26337 |
| 904 | Ga0496106_0069150 | 3300048909 | Bacteria | 2694 |
| 905 | Ga0496106_0145522 | 3300048909 | Bacteria | 1866 |
| 906 | Ga0496106_0175758 | 3300048909 | Bacteria | 1699 |
| 907 | Ga0496107_0005975 | 3300048910 | Bacteria | 8341 |
| 908 | Ga0496107_0186452 | 3300048910 | Bacteria | 1541 |
| 909 | Ga0496107_0192992 | 3300048910 | Bacteria | 1513 |
| 910 | Ga0496108_0001827 | 3300048911 | Bacteria | 17004 |
| 911 | Ga0496108_0017773 | 3300048911 | Bacteria | 5816 |
| 912 | Ga0496108_0040285 | 3300048911 | Bacteria | 3893 |
| 913 | Ga0496109_0002877 | 3300048912 | Bacteria | 14402 |
| 914 | Ga0496109_0038885 | 3300048912 | Bacteria | 4304 |
| 915 | Ga0496109_0053143 | 3300048912 | Bacteria | 3693 |
| 916 | Ga0496109_0214444 | 3300048912 | Bacteria | 1810 |
| 917 | Ga0496110_0006554 | 3300048913 | Bacteria | 9241 |
| 918 | Ga0496110_0022928 | 3300048913 | Bacteria | 5305 |
| 919 | Ga0496111_0001612 | 3300048914 | Bacteria | 13057 |
| 920 | Ga0496111_0094679 | 3300048914 | Bacteria | 2191 |
| 921 | Ga0496112_0037819 | 3300048915 | Bacteria | 4712 |
| 922 | Ga0496112_0058925 | 3300048915 | Bacteria | 3783 |
| 923 | Ga0496112_0146886 | 3300048915 | Bacteria | 2326 |
| 924 | Ga0496112_0384375 | 3300048915 | Bacteria | 1344 |
| 925 | Ga0496113_0107043 | 3300048916 | Bacteria | 2172 |
| 926 | Ga0496113_0148860 | 3300048916 | Bacteria | 1846 |
| 927 | Ga0496114_0012763 | 3300048917 | Bacteria | 6727 |
| 928 | Ga0496114_0224762 | 3300048917 | Bacteria | 1648 |
| 929 | Ga0496114_0265174 | 3300048917 | Bacteria | 1513 |
| 930 | Ga0496114_0295362 | 3300048917 | Bacteria | 1430 |
| 931 | Ga0496115_0000135 | 3300048918 | Bacteria | 67733 |
| 932 | Ga0496115_0007937 | 3300048918 | Bacteria | 7831 |
| 933 | Ga0496115_0008471 | 3300048918 | Bacteria | 7607 |
| 934 | Ga0496115_0011136 | 3300048918 | Bacteria | 6739 |
| 935 | Ga0496115_0446265 | 3300048918 | Bacteria | 1045 |
| 936 | Ga0496119_0014503 | 3300048922 | Bacteria | 6159 |
| 937 | Ga0496120_0002881 | 3300048923 | Bacteria | 16484 |
| 938 | Ga0496121_0001803 | 3300048924 | Bacteria | 34595 |
| 939 | Ga0496121_0003261 | 3300048924 | Bacteria | 23328 |
| 940 | Ga0496121_0033724 | 3300048924 | Bacteria | 4626 |
| 941 | Ga0496121_0034585 | 3300048924 | Bacteria | 4547 |
| 942 | Ga0496122_0059687 | 3300048925 | Bacteria | 2814 |
| 943 | Ga0496122_0060937 | 3300048925 | Bacteria | 2774 |
| 944 | Ga0496122_0120871 | 3300048925 | Bacteria | 1689 |
| 945 | Ga0496123_0071204 | 3300048926 | Bacteria | 2170 |
| 946 | Ga0496123_0167255 | 3300048926 | Bacteria | 1164 |
| 947 | Ga0496125_0029540 | 3300048928 | Bacteria | 4924 |
| 948 | Ga0496126_0038468 | 3300048929 | Bacteria | 4451 |
| 949 | Ga0496126_0046614 | 3300048929 | Bacteria | 3973 |
| 950 | Ga0496126_0052844 | 3300048929 | Bacteria | 3690 |
| 951 | Ga0496126_0065365 | 3300048929 | Bacteria | 3255 |
| 952 | Ga0495678_000067 | 3300049459 | Bacteria | 132540 |
| 953 | Ga0495682_0044085 | 3300049460 | Bacteria | 1632 |
| 954 | Ga0495682_0094802 | 3300049460 | Bacteria | 1071 |
| 955 | Ga0501031_0017509 | 3300049568 | Bacteria | 4658 |
| 956 | Ga0501031_0060896 | 3300049568 | Bacteria | 2460 |
| 957 | Ga0501032_0039245 | 3300049569 | Bacteria | 3221 |
| 958 | Ga0501033_0006636 | 3300049570 | Bacteria | 9050 |
| 959 | Ga0501034_0021355 | 3300049571 | Bacteria | 6601 |
| 960 | Ga0501036_0001084 | 3300049572 | Bacteria | 20626 |
| 961 | Ga0501036_0184721 | 3300049572 | Bacteria | 1754 |
| 962 | Ga0501037_0010840 | 3300049573 | Bacteria | 6697 |
| 963 | Ga0501038_0006113 | 3300049574 | Bacteria | 11142 |
| 964 | Ga0501038_0081494 | 3300049574 | Bacteria | 2726 |
| 965 | Ga0501038_0096827 | 3300049574 | Bacteria | 2462 |
| 966 | Ga0501039_0001878 | 3300049575 | Bacteria | 15530 |
| 967 | Ga0501039_0035236 | 3300049575 | Bacteria | 3862 |
| 968 | Ga0501039_0335905 | 3300049575 | Bacteria | 1187 |
| 969 | Ga0501040_0008280 | 3300049576 | Bacteria | 6764 |
| 970 | Ga0501041_0001352 | 3300049577 | Bacteria | 13505 |
| 971 | Ga0501041_0004090 | 3300049577 | Bacteria | 8424 |
| 972 | Ga0501041_0004174 | 3300049577 | Bacteria | 8363 |
| 973 | Ga0501042_0021423 | 3300049578 | Bacteria | 4505 |
| 974 | Ga0501042_0054772 | 3300049578 | Bacteria | 2845 |
| 975 | Ga0501042_0117642 | 3300049578 | Bacteria | 1913 |
| 976 | Ga0501042_0120685 | 3300049578 | Bacteria | 1887 |
| 977 | Ga0501043_0003354 | 3300049579 | Bacteria | 13194 |
| 978 | Ga0501043_0033076 | 3300049579 | Bacteria | 4067 |
| 979 | Ga0501046_0004568 | 3300049580 | Bacteria | 12530 |
| 980 | Ga0501046_0059561 | 3300049580 | Bacteria | 2991 |
| 981 | Ga0501046_0061552 | 3300049580 | Bacteria | 2934 |
| 982 | Ga0501046_0381646 | 3300049580 | Bacteria | 1020 |
| 983 | Ga0501047_0017266 | 3300049581 | Bacteria | 6910 |
| 984 | Ga0501048_0125258 | 3300049582 | Bacteria | 1816 |
| 985 | Ga0501048_0209418 | 3300049582 | Bacteria | 1383 |
| 986 | Ga0501048_0238749 | 3300049582 | Bacteria | 1290 |
| 987 | Ga0501067_0007592 | 3300049583 | Bacteria | 6029 |
| 988 | Ga0501068_0004281 | 3300049584 | Bacteria | 7751 |
| 989 | Ga0501068_0067378 | 3300049584 | Bacteria | 2181 |
| 990 | Ga0501068_0128373 | 3300049584 | Bacteria | 1584 |
| 991 | Ga0501069_0024446 | 3300049585 | Bacteria | 3295 |
| 992 | Ga0501070_0008384 | 3300049586 | Bacteria | 8731 |
| 993 | Ga0501070_0066896 | 3300049586 | Bacteria | 2976 |
| 994 | Ga0501071_0001102 | 3300049587 | Bacteria | 15055 |
| 995 | Ga0501071_0007186 | 3300049587 | Bacteria | 7284 |
| 996 | Ga0501071_0088804 | 3300049587 | Bacteria | 2268 |
| 997 | Ga0501071_0164848 | 3300049587 | Bacteria | 1658 |
| 998 | Ga0501071_0313432 | 3300049587 | Bacteria | 1190 |
| 999 | Ga0501072_0004768 | 3300049588 | Bacteria | 10324 |
| 1000 | Ga0501072_0021469 | 3300049588 | Bacteria | 5006 |
| 1001 | Ga0501072_0030487 | 3300049588 | Bacteria | 4219 |
| 1002 | Ga0501072_0083607 | 3300049588 | Bacteria | 2530 |
| 1003 | Ga0501072_0112566 | 3300049588 | Bacteria | 2167 |
| 1004 | Ga0501073_0000353 | 3300049589 | Bacteria | 31030 |
| 1005 | Ga0501073_0001886 | 3300049589 | Bacteria | 15613 |
| 1006 | Ga0501073_0026530 | 3300049589 | Bacteria | 4150 |
| 1007 | Ga0501073_0315840 | 3300049589 | Bacteria | 1078 |
| 1008 | Ga0501074_0003294 | 3300049590 | Bacteria | 11426 |
| 1009 | Ga0501074_0019490 | 3300049590 | Bacteria | 4926 |
| 1010 | Ga0501075_0000520 | 3300049591 | Bacteria | 23251 |
| 1011 | Ga0501075_0013581 | 3300049591 | Bacteria | 5815 |
| 1012 | Ga0501075_0145419 | 3300049591 | Bacteria | 1807 |
| 1013 | Ga0501076_0002351 | 3300049592 | Bacteria | 12937 |
| 1014 | Ga0501076_0002386 | 3300049592 | Bacteria | 12862 |
| 1015 | Ga0501076_0016740 | 3300049592 | Bacteria | 5562 |
| 1016 | Ga0501076_0030284 | 3300049592 | Bacteria | 4215 |
| 1017 | Ga0501076_0103409 | 3300049592 | Bacteria | 2298 |
| 1018 | Ga0501076_0165545 | 3300049592 | Bacteria | 1802 |
| 1019 | Ga0501076_0274709 | 3300049592 | Bacteria | 1380 |
| 1020 | Ga0501077_0004241 | 3300049593 | Bacteria | 8667 |
| 1021 | Ga0501077_0107752 | 3300049593 | Bacteria | 1765 |
| 1022 | Ga0501077_0131792 | 3300049593 | Bacteria | 1585 |
| 1023 | Ga0501077_0143422 | 3300049593 | Bacteria | 1515 |
| 1024 | Ga0501209_012427 | 3300049656 | Bacteria | 1815 |
| 1025 | Ga0501249_034133 | 3300049679 | Bacteria | 1140 |
| 1026 | Ga0501250_014979 | 3300049680 | Bacteria | 948 |
| 1027 | Ga0501079_0000016 | 3300049741 | Bacteria | 65975 |
| 1028 | Ga0501079_0001155 | 3300049741 | Bacteria | 18458 |
| 1029 | Ga0501079_0010787 | 3300049741 | Bacteria | 6957 |
| 1030 | Ga0501080_0000344 | 3300049742 | Bacteria | 35777 |
| 1031 | Ga0501080_0003150 | 3300049742 | Bacteria | 14528 |
| 1032 | Ga0501080_0005196 | 3300049742 | Bacteria | 11600 |
| 1033 | Ga0501080_0013763 | 3300049742 | Bacteria | 7449 |
| 1034 | Ga0501081_0005614 | 3300049743 | Bacteria | 8104 |
| 1035 | Ga0501081_0016366 | 3300049743 | Bacteria | 4901 |
| 1036 | Ga0501081_0038157 | 3300049743 | Bacteria | 3280 |
| 1037 | Ga0501081_0277979 | 3300049743 | Bacteria | 1225 |
| 1038 | Ga0501083_0063859 | 3300049744 | Bacteria | 2455 |
| 1039 | Ga0501083_0130495 | 3300049744 | Bacteria | 1647 |
| 1040 | Ga0501083_0267820 | 3300049744 | Bacteria | 1111 |
| 1041 | Ga0501035_0017079 | 3300049822 | Bacteria | 6686 |
| 1042 | Ga0501035_0035198 | 3300049822 | Bacteria | 4545 |
| 1043 | Ga0501035_0038779 | 3300049822 | Bacteria | 4313 |
| 1044 | Ga0501035_0163012 | 3300049822 | Bacteria | 1929 |
| 1045 | Ga0501044_0076307 | 3300049823 | Bacteria | 3402 |
| 1046 | Ga0501045_0002571 | 3300049824 | Bacteria | 12379 |
| 1047 | Ga0501045_0038353 | 3300049824 | Bacteria | 3484 |
| 1048 | nmdc:mga05p37_122_c1 | 3300050507 | Bacteria | 70077 |
| 1049 | nmdc:mga05p37_46323_c1 | 3300050507 | Bacteria | 5347 |
| 1050 | nmdc:mga09592_120_c1 | 3300050508 | Bacteria | 50062 |
| 1051 | nmdc:mga09592_380_c1 | 3300050508 | Bacteria | 32519 |
| 1052 | nmdc:mga09592_415926_c1 | 3300050508 | Bacteria | 1162 |
| 1053 | nmdc:mga09592_66814_c1 | 3300050508 | Bacteria | 3048 |
| 1054 | nmdc:mga0qj67_186476_c1 | 3300050509 | Bacteria | 1685 |
| 1055 | nmdc:mga0qj67_386_c1 | 3300050509 | Bacteria | 30425 |
| 1056 | nmdc:mga0qj67_51284_c1 | 3300050509 | Bacteria | 3262 |
| 1057 | nmdc:mga0qj67_64402_c1 | 3300050509 | Bacteria | 2915 |
| 1058 | nmdc:mga06r32_137_c1 | 3300050510 | Bacteria | 54136 |
| 1059 | nmdc:mga06r32_36556_c1 | 3300050510 | Bacteria | 4642 |
| 1060 | nmdc:mga06r32_42737_c1 | 3300050510 | Bacteria | 4311 |
| 1061 | nmdc:mga06r32_4682_c1 | 3300050510 | Bacteria | 12287 |
| 1062 | nmdc:mga06r32_8162_c1 | 3300050510 | Bacteria | 9421 |
| 1063 | nmdc:mga08y16_1797_c1 | 3300050511 | Bacteria | 21750 |
| 1064 | nmdc:mga08y16_3233_c1 | 3300050511 | Bacteria | 16874 |
| 1065 | nmdc:mga08y16_54603_c1 | 3300050511 | Bacteria | 4174 |
| 1066 | nmdc:mga08y16_59886_c1 | 3300050511 | Bacteria | 3977 |
| 1067 | nmdc:mga08y16_62003_c1 | 3300050511 | Bacteria | 3905 |
| 1068 | nmdc:mga08y16_98316_c1 | 3300050511 | Bacteria | 3048 |
| 1069 | nmdc:mga0n895_563584_c1 | 3300050512 | Bacteria | 1144 |
| 1070 | nmdc:mga0n895_736_c1 | 3300050512 | Bacteria | 23112 |
| 1071 | nmdc:mga0rr50_27752_c1 | 3300050513 | Bacteria | 3969 |
| 1072 | nmdc:mga0rr50_54044_c1 | 3300050513 | Bacteria | 2990 |
| 1073 | nmdc:mga08x19_47292_c1 | 3300050514 | Bacteria | 2754 |
| 1074 | nmdc:mga0a205_9711_c1 | 3300050515 | Bacteria | 8813 |
| 1075 | Ga0495601_0008506 | 3300053077 | Bacteria | 6060 |
| 1076 | Ga0495601_0053019 | 3300053077 | Bacteria | 2563 |
| 1077 | Ga0495612_0144958 | 3300053078 | Bacteria | 1031 |
| 1078 | Ga0495655_0059876 | 3300053083 | Bacteria | 1035 |
| 1079 | Ga0495595_0001644 | 3300053084 | Bacteria | 8749 |
| 1080 | Ga0500643_000012 | 3300053087 | Bacteria | 369839 |
| 1081 | Ga0500583_0004089 | 3300053092 | Bacteria | 4701 |
| 1082 | Ga0500583_0073946 | 3300053092 | Bacteria | 1635 |
| 1083 | Ga0500556_0000313 | 3300053104 | Bacteria | 36728 |
| 1084 | Ga0500588_0041615 | 3300053146 | Bacteria | 1387 |
| 1085 | Ga0500622_0001607 | 3300053156 | Bacteria | 17745 |
| 1086 | Ga0500622_0004452 | 3300053156 | Bacteria | 8795 |
| 1087 | Ga0500622_0027685 | 3300053156 | Bacteria | 2988 |
| 1088 | Ga0500633_0021636 | 3300053160 | Bacteria | 1958 |
| 1089 | Ga0500636_0001930 | 3300053177 | Bacteria | 11386 |
| 1090 | Ga0500637_0014858 | 3300053178 | Bacteria | 4112 |
| 1091 | Ga0500637_0065022 | 3300053178 | Bacteria | 2092 |
| 1092 | Ga0500625_003485 | 3300053729 | Bacteria | 6229 |
| 1093 | Ga0501084_0038603 | 3300054114 | Bacteria | 3992 |
| 1094 | Ga0501084_0164994 | 3300054114 | Bacteria | 1869 |
| 1095 | Ga0501084_0204297 | 3300054114 | Bacteria | 1667 |
| 1096 | Ga0501082_0000552 | 3300060353 | Bacteria | 33331 |
| 1097 | Ga0501082_0019061 | 3300060353 | Bacteria | 5911 |
| 1098 | Ga0501082_0034152 | 3300060353 | Bacteria | 4387 |
| 1099 | Ga0530510_0000463 | 3300061734 | Bacteria | 26209 |
| 1100 | Ga0530510_0012087 | 3300061734 | Bacteria | 6058 |
| 1101 | Ga0530510_0167072 | 3300061734 | Bacteria | 1629 |
| 1102 | 2525558229 | 2524614729 | Bacteria | 3091755 |
| 1103 | 2630650217 | 2627854209 | Bacteria | 3093011 |
| 1104 | 2643818476 | 2643221559 | Bacteria | 4424915 |
| 1105 | 2643938383 | 2643221586 | Bacteria | 4446529 |
| 1106 | 2643973179 | 2643221593 | Bacteria | 6296053 |
| 1107 | 2644079034 | 2643221612 | Bacteria | 4361984 |
| 1108 | 2644530649 | 2643221695 | Bacteria | 3441323 |
| 1109 | 2644661227 | 2643221720 | Bacteria | 4694283 |
| 1110 | 2644693811 | 2643221727 | Bacteria | 4415595 |
| 1111 | 2644699304 | 2643221728 | Bacteria | 4797149 |
| 1112 | 2721028995 | 2718218334 | Bacteria | 4765486 |
| 1113 | 2735835425 | 2734482264 | Unclassified | 5014763 |
| 1114 | 2739227377 | 2738543009 | Bacteria | 4944499 |
| 1115 | 2842918714 | 2842914999 | Bacteria | 4419378 |
| 1116 | 2919087207 | 2919085039 | Bacteria | 4532964 |
| 1117 | 2995949806 | 2995948881 | Bacteria | 6358104 |
| 1118 | 8001522921 | 8001522603 | Bacteria | 4726425 |
| 1119 | 8003015325 | 8003014200 | Bacteria | 4059994 |
| 1120 | Ga0068863_100256214 | |||
| 1121 | CNXas_1000053 | |||
| 1122 | JGI25162J39368_1000837 | |||
| 1123 | JGI25157J39369_1000177 | |||
| 1124 | JGI25163J39215_1002314 | |||
| 1125 | JGI25164J39214_1000159 | |||
| 1126 | JGI25151J46595_10001571 | |||
| 1127 | JGI25165J46597_1000287 | |||
| 1128 | rootH1_10130599 | |||
| 1129 | Ga0055535_1000329 | |||
| 1130 | Ga0055542_1000547 | |||
| 1131 | Ga0055529_1000108 | |||
| 1132 | Ga0055536_1002534 | |||
| 1133 | Ga0055536_1020770 | |||
| 1134 | Ga0055536_1037451 | |||
| 1135 | Ga0055530_10001342 | |||
| 1136 | Ga0055531_10001941 | |||
| 1137 | Ga0055531_10025470 | |||
| 1138 | Ga0065712_10077015 | |||
| 1139 | Ga0065715_10091766 | |||
| 1140 | Ga0065707_10021569 | |||
| 1141 | Ga0065707_10082772 | |||
| 1142 | Ga0065707_10084930 | |||
| 1143 | Ga0065707_10120764 | |||
| 1144 | Ga0065707_10166743 | |||
| 1145 | Ga0070676_10005061 | |||
| 1146 | Ga0070676_10009567 | |||
| 1147 | Ga0070676_10015813 | |||
| 1148 | Ga0070676_10019381 | |||
| 1149 | Ga0070676_10072619 | |||
| 1150 | Ga0070683_100066760 | |||
| 1151 | Ga0070690_100013171 | |||
| 1152 | Ga0070690_100014709 | |||
| 1153 | Ga0070690_100041653 | |||
| 1154 | Ga0070670_100016518 | |||
| 1155 | Ga0070670_100018329 | |||
| 1156 | Ga0070670_100026951 | |||
| 1157 | Ga0070670_100127393 | |||
| 1158 | Ga0070677_10016848 | |||
| 1159 | Ga0068869_100081038 | |||
| 1160 | Ga0070666_10015646 | |||
| 1161 | Ga0070666_10068861 | |||
| 1162 | Ga0070666_10136193 | |||
| 1163 | Ga0070680_100009323 | |||
| 1164 | Ga0070680_100060056 | |||
| 1165 | Ga0070680_100276719 | |||
| 1166 | Ga0070682_100118532 | |||
| 1167 | Ga0068868_100014018 | |||
| 1168 | Ga0068868_100016352 | |||
| 1169 | Ga0068868_100039621 | |||
| 1170 | Ga0068868_100041492 | |||
| 1171 | Ga0068868_100132026 | |||
| 1172 | Ga0070689_100000945 | |||
| 1173 | Ga0070689_100001450 | |||
| 1174 | Ga0070689_100012449 | |||
| 1175 | Ga0070689_100081283 | |||
| 1176 | Ga0070689_100154175 | |||
| 1177 | Ga0070687_100000577 | |||
| 1178 | Ga0070687_100086250 | |||
| 1179 | Ga0070661_100028400 | |||
| 1180 | Ga0070661_100065072 | |||
| 1181 | Ga0070668_100008104 | |||
| 1182 | Ga0070668_100072757 | |||
| 1183 | Ga0070668_100102853 | |||
| 1184 | Ga0070668_100234977 | |||
| 1185 | Ga0070668_100458069 | |||
| 1186 | Ga0070668_100466121 | |||
| 1187 | Ga0070669_100002483 | |||
| 1188 | Ga0070669_100060779 | |||
| 1189 | Ga0070669_100087759 | |||
| 1190 | Ga0070675_100001717 | |||
| 1191 | Ga0070675_100002965 | |||
| 1192 | Ga0070675_100010769 | |||
| 1193 | Ga0070675_100048024 | |||
| 1194 | Ga0070675_100077596 | |||
| 1195 | Ga0070675_100140321 | |||
| 1196 | Ga0070675_100174081 | |||
| 1197 | Ga0070675_100314314 | |||
| 1198 | Ga0070671_100010170 | |||
| 1199 | Ga0070671_100021794 | |||
| 1200 | Ga0070671_100023724 | |||
| 1201 | Ga0070671_100041962 | |||
| 1202 | Ga0070671_100162934 | |||
| 1203 | Ga0070674_100000943 | |||
| 1204 | Ga0070674_100013991 | |||
| 1205 | Ga0070674_100023293 | |||
| 1206 | Ga0070674_100025646 | |||
| 1207 | Ga0070674_100050426 | |||
| 1208 | Ga0070673_100001757 | |||
| 1209 | Ga0070673_100004145 | |||
| 1210 | Ga0070673_100026784 | |||
| 1211 | Ga0070673_100050461 | |||
| 1212 | Ga0070673_100050659 | |||
| 1213 | Ga0070673_100086795 | |||
| 1214 | Ga0070688_100025361 | |||
| 1215 | Ga0070688_100033591 | |||
| 1216 | Ga0070688_100096141 | |||
| 1217 | Ga0070659_100003104 | |||
| 1218 | Ga0070667_100001144 | |||
| 1219 | Ga0070667_100001152 | |||
| 1220 | Ga0070667_100063863 | |||
| 1221 | Ga0070667_100136318 | |||
| 1222 | Ga0070667_100160666 | |||
| 1223 | Ga0070709_10074566 | |||
| 1224 | Ga0070709_10157158 | |||
| 1225 | Ga0070709_10162600 | |||
| 1226 | Ga0070713_100000635 | |||
| 1227 | Ga0070713_100451815 | |||
| 1228 | Ga0070710_10041243 | |||
| 1229 | Ga0070701_10015659 | |||
| 1230 | Ga0070711_100001699 | |||
| 1231 | Ga0070711_100010266 | |||
| 1232 | Ga0070711_100020880 | |||
| 1233 | Ga0070705_100096360 | |||
| 1234 | Ga0070705_100159346 | |||
| 1235 | Ga0070705_100289564 | |||
| 1236 | Ga0070700_100028284 | |||
| 1237 | Ga0070694_100054385 | |||
| 1238 | Ga0070708_100061928 | |||
| 1239 | Ga0070708_100108787 | |||
| 1240 | Ga0070663_100055413 | |||
| 1241 | Ga0070678_100003884 | |||
| 1242 | Ga0070678_100136932 | |||
| 1243 | Ga0070678_100230905 | |||
| 1244 | Ga0070662_100002487 | |||
| 1245 | Ga0070662_100102116 | |||
| 1246 | Ga0070662_100130834 | |||
| 1247 | Ga0070662_100158043 | |||
| 1248 | Ga0070662_100179390 | |||
| 1249 | Ga0070681_10006880 | |||
| 1250 | Ga0070681_10015633 | |||
| 1251 | Ga0070681_10155029 | |||
| 1252 | Ga0068867_100057000 | |||
| 1253 | Ga0070685_10035477 | |||
| 1254 | Ga0070685_10038178 | |||
| 1255 | Ga0070706_100028777 | |||
| 1256 | Ga0070706_100075924 | |||
| 1257 | Ga0070707_100000049 | |||
| 1258 | Ga0070707_100007424 | |||
| 1259 | Ga0070707_100036291 | |||
| 1260 | Ga0070707_100075070 | |||
| 1261 | Ga0070707_100128199 | |||
| 1262 | Ga0070707_100167331 | |||
| 1263 | Ga0070707_100277610 | |||
| 1264 | Ga0070698_100123519 | |||
| 1265 | Ga0070699_100265886 | |||
| 1266 | Ga0070679_100004933 | |||
| 1267 | Ga0070679_100085288 | |||
| 1268 | Ga0070679_100226203 | |||
| 1269 | Ga0070679_100330174 | |||
| 1270 | Ga0070697_100006541 | |||
| 1271 | Ga0070697_100132275 | |||
| 1272 | Ga0070697_100255962 | |||
| 1273 | Ga0070697_100318771 | |||
| 1274 | Ga0070672_100001943 | |||
| 1275 | Ga0070672_100002408 | |||
| 1276 | Ga0070672_100011227 | |||
| 1277 | Ga0070672_100038187 | |||
| 1278 | Ga0070672_100131034 | |||
| 1279 | Ga0070672_100275064 | |||
| 1280 | Ga0070672_100368504 | |||
| 1281 | Ga0070686_100014455 | |||
| 1282 | Ga0070686_100015716 | |||
| 1283 | Ga0070686_100047307 | |||
| 1284 | Ga0070686_100142040 | |||
| 1285 | Ga0070695_100008782 | |||
| 1286 | Ga0070696_100253881 | |||
| 1287 | Ga0070696_100261723 | |||
| 1288 | Ga0070693_100016370 | |||
| 1289 | Ga0070665_100009546 | |||
| 1290 | Ga0070665_100016694 | |||
| 1291 | Ga0070665_100167823 | |||
| 1292 | Ga0070665_100378535 | |||
| 1293 | Ga0070704_100007181 | |||
| 1294 | Ga0070704_100010173 | |||
| 1295 | Ga0068855_100002029 | |||
| 1296 | Ga0068855_100004382 | |||
| 1297 | Ga0068855_100020496 | |||
| 1298 | Ga0068855_100021246 | |||
| 1299 | Ga0068855_100188006 | |||
| 1300 | Ga0070664_100000478 | |||
| 1301 | Ga0068856_100049179 | |||
| 1302 | Ga0068856_100210301 | |||
| 1303 | Ga0070702_100029377 | |||
| 1304 | Ga0070702_100095611 | |||
| 1305 | Ga0068859_100000831 | |||
| 1306 | Ga0068859_100033950 | |||
| 1307 | Ga0068864_100007046 | |||
| 1308 | Ga0068864_100045068 | |||
| 1309 | Ga0068864_100146428 | |||
| 1310 | Ga0068866_10011945 | |||
| 1311 | Ga0068866_10018274 | |||
| 1312 | Ga0068866_10112429 | |||
| 1313 | Ga0068861_100004533 | |||
| 1314 | Ga0068861_100015762 | |||
| 1315 | Ga0068870_10055258 | |||
| 1316 | Ga0068870_10056769 | |||
| 1317 | Ga0068863_100001040 | |||
| 1318 | Ga0068863_100014440 | |||
| 1319 | Ga0068863_100018533 | |||
| 1320 | Ga0068863_100161412 | |||
| 1321 | Ga0068863_100215302 | |||
| 1322 | Ga0068858_100070305 | |||
| 1323 | Ga0068858_100135763 | |||
| 1324 | Ga0068858_100268276 | |||
| 1325 | Ga0068860_100001229 | |||
| 1326 | Ga0068860_100005012 | |||
| 1327 | Ga0068860_100010393 | |||
| 1328 | Ga0068860_100032175 | |||
| 1329 | Ga0068860_100044910 | |||
| 1330 | Ga0068860_100108360 | |||
| 1331 | Ga0068862_100001139 | |||
| 1332 | Ga0068862_100004453 | |||
| 1333 | Ga0068862_100008015 | |||
| 1334 | Ga0068862_100050351 | |||
| 1335 | Ga0068862_100058472 | |||
| 1336 | Ga0068862_100082852 | |||
| 1337 | Ga0068862_100354687 | |||
| 1338 | Ga0081455_10000192 | |||
| 1339 | Ga0081455_10003245 | |||
| 1340 | Ga0081455_10003695 | |||
| 1341 | Ga0081455_10006042 | |||
| 1342 | Ga0081455_10325496 | |||
| 1343 | Ga0081540_1035648 | |||
| 1344 | Ga0081539_10000383 | |||
| 1345 | Ga0081539_10002232 | |||
| 1346 | Ga0081539_10030194 | |||
| 1347 | Ga0081539_10041447 | |||
| 1348 | Ga0070717_10536548 | |||
| 1349 | Ga0070716_100007793 | |||
| 1350 | Ga0070716_100018410 | |||
| 1351 | Ga0070716_100047887 | |||
| 1352 | Ga0070712_100002312 | |||
| 1353 | Ga0070712_100071788 | |||
| 1354 | Ga0075369_10111558 | |||
| 1355 | Ga0097621_100008000 | |||
| 1356 | Ga0097621_100016502 | |||
| 1357 | Ga0097621_100020951 | |||
| 1358 | Ga0097621_100023330 | |||
| 1359 | Ga0097621_100063875 | |||
| 1360 | Ga0068871_100012976 | |||
| 1361 | Ga0068871_100041971 | |||
| 1362 | Ga0068871_100071935 | |||
| 1363 | Ga0068871_100193900 | |||
| 1364 | Ga0068871_100459876 | |||
| 1365 | Ga0075428_100001274 | |||
| 1366 | Ga0075428_100003879 | |||
| 1367 | Ga0075428_100005990 | |||
| 1368 | Ga0075428_100010791 | |||
| 1369 | Ga0075428_100059535 | |||
| 1370 | Ga0075430_100000913 | |||
| 1371 | Ga0075430_100057950 | |||
| 1372 | Ga0075430_100114313 | |||
| 1373 | Ga0075431_100001253 | |||
| 1374 | Ga0075431_100005040 | |||
| 1375 | Ga0075431_100052449 | |||
| 1376 | Ga0075433_10067805 | |||
| 1377 | Ga0075434_100004319 | |||
| 1378 | Ga0075429_100000022 | |||
| 1379 | Ga0075429_100181450 | |||
| 1380 | Ga0075429_100362807 | |||
| 1381 | Ga0068865_100013725 | |||
| 1382 | Ga0068865_100020816 | |||
| 1383 | Ga0068865_100057160 | |||
| 1384 | Ga0075436_100056445 | |||
| 1385 | Ga0097620_100000831 | |||
| 1386 | Ga0097620_100033950 | |||
| 1387 | Ga0099794_10024955 | |||
| 1388 | Ga0099795_10000048 | |||
| 1389 | Ga0099795_10000148 | |||
| 1390 | Ga0105250_10000024 | |||
| 1391 | Ga0105240_10000901 | |||
| 1392 | Ga0105240_10014105 | |||
| 1393 | Ga0105240_10026721 | |||
| 1394 | Ga0105240_10083685 | |||
| 1395 | Ga0105240_10203690 | |||
| 1396 | Ga0105240_10643913 | |||
| 1397 | Ga0111539_10002430 | |||
| 1398 | Ga0111539_10003440 | |||
| 1399 | Ga0111539_10006408 | |||
| 1400 | Ga0111539_10037630 | |||
| 1401 | Ga0111539_10076014 | |||
| 1402 | Ga0111539_10084162 | |||
| 1403 | Ga0111539_10112002 | |||
| 1404 | Ga0105245_10001689 | |||
| 1405 | Ga0105245_10030551 | |||
| 1406 | Ga0105245_10045099 | |||
| 1407 | Ga0105247_10008112 | |||
| 1408 | Ga0105247_10051584 | |||
| 1409 | Ga0114129_10000119 | |||
| 1410 | Ga0114129_10056261 | |||
| 1411 | Ga0114129_10289232 | |||
| 1412 | Ga0114129_10458134 | |||
| 1413 | Ga0114129_10562462 | |||
| 1414 | Ga0105243_10031692 | |||
| 1415 | Ga0105241_10107967 | |||
| 1416 | Ga0105241_10112391 | |||
| 1417 | Ga0105242_10044172 | |||
| 1418 | Ga0105242_10142480 | |||
| 1419 | Ga0105248_10003905 | |||
| 1420 | Ga0105248_10042203 | |||
| 1421 | Ga0105248_10052989 | |||
| 1422 | Ga0105237_10051480 | |||
| 1423 | Ga0105237_10073452 | |||
| 1424 | Ga0105237_10157361 | |||
| 1425 | Ga0105238_10024802 | |||
| 1426 | Ga0105238_10035681 | |||
| 1427 | Ga0105238_10128745 | |||
| 1428 | Ga0105238_10159039 | |||
| 1429 | Ga0105238_10316408 | |||
| 1430 | Ga0105238_10423924 | |||
| 1431 | Ga0105249_10013319 | |||
| 1432 | Ga0105249_10099754 | |||
| 1433 | Ga0105249_10134454 | |||
| 1434 | Ga0105249_10304139 | |||
| 1435 | Ga0105030_100699 | |||
| 1436 | Ga0099796_10000013 | |||
| 1437 | Ga0105239_10003699 | |||
| 1438 | Ga0105239_10308610 | |||
| 1439 | Ga0105239_10655159 | |||
| 1440 | Ga0105246_10266363 | |||
| 1441 | Ga0157370_10007337 | |||
| 1442 | Ga0157370_10078111 | |||
| 1443 | Ga0157369_10004204 | |||
| 1444 | Ga0157369_10089167 | |||
| 1445 | Ga0157369_10507723 | |||
| 1446 | Ga0157374_10003141 | |||
| 1447 | Ga0157374_10004874 | |||
| 1448 | Ga0157374_10004940 | |||
| 1449 | Ga0157374_10018270 | |||
| 1450 | Ga0157374_10102434 | |||
| 1451 | Ga0157374_10120606 | |||
| 1452 | Ga0157374_10123081 | |||
| 1453 | Ga0157374_10177158 | |||
| 1454 | Ga0157378_10015300 | |||
| 1455 | Ga0157378_10025804 | |||
| 1456 | Ga0157378_10099785 | |||
| 1457 | Ga0157378_10124859 | |||
| 1458 | Ga0163162_10026276 | |||
| 1459 | Ga0163162_10030229 | |||
| 1460 | Ga0163162_10037397 | |||
| 1461 | Ga0163162_10056546 | |||
| 1462 | Ga0163162_10157536 | |||
| 1463 | Ga0163162_10557177 | |||
| 1464 | Ga0157372_10011446 | |||
| 1465 | Ga0157372_10018240 | |||
| 1466 | Ga0157372_10032248 | |||
| 1467 | Ga0157372_10147056 | |||
| 1468 | Ga0157375_10000847 | |||
| 1469 | Ga0157375_10001173 | |||
| 1470 | Ga0157375_10017319 | |||
| 1471 | Ga0157375_10018258 | |||
| 1472 | Ga0157375_10021318 | |||
| 1473 | Ga0157375_10127837 | |||
| 1474 | Ga0157375_10172603 | |||
| 1475 | Ga0157375_10175425 | |||
| 1476 | Ga0157375_10663138 | |||
| 1477 | Ga0157514_105626 | |||
| 1478 | Ga0163163_10000651 | |||
| 1479 | Ga0163163_10013480 | |||
| 1480 | Ga0163163_10696742 | |||
| 1481 | Ga0157380_10006559 | |||
| 1482 | Ga0157380_10021197 | |||
| 1483 | Ga0157380_10115984 | |||
| 1484 | Ga0182008_10141322 | |||
| 1485 | Ga0157377_10015235 | |||
| 1486 | Ga0157379_10000140 | |||
| 1487 | Ga0157379_10001153 | |||
| 1488 | Ga0157379_10034646 | |||
| 1489 | Ga0157379_10039315 | |||
| 1490 | Ga0157379_10605188 | |||
| 1491 | Ga0157376_10010708 | |||
| 1492 | Ga0157376_10021870 | |||
| 1493 | Ga0157376_10059428 | |||
| 1494 | Ga0157376_10079436 | |||
| 1495 | Ga0157376_10180015 | |||
| 1496 | Ga0157376_10334301 | |||
| 1497 | Ga0182006_1000426 | |||
| 1498 | Ga0182007_10019720 | |||
| 1499 | Ga0182005_1000177 | |||
| 1500 | Ga0183360_10001 | |||
| 1501 | Ga0163161_10165243 | |||
| 1502 | Ga0209760_100925 | |||
| 1503 | Ga0209784_100076 | |||
| 1504 | Ga0207427_100097 | |||
| 1505 | Ga0209437_100116 | |||
| 1506 | Ga0209258_100214 | |||
| 1507 | Ga0207425_1012309 | |||
| 1508 | Ga0209026_1000152 | |||
| 1509 | Ga0209148_1000047 | |||
| 1510 | Ga0209759_1000477 | |||
| 1511 | Ga0209233_1000100 | |||
| 1512 | Ga0209455_1000056 | |||
| 1513 | Ga0209455_1008009 | |||
| 1514 | Ga0209675_1008947 | |||
| 1515 | Ga0209676_1000902 | |||
| 1516 | Ga0209676_1001161 | |||
| 1517 | Ga0209676_1003988 | |||
| 1518 | Ga0209025_1000006 | |||
| 1519 | Ga0209564_1008169 | |||
| 1520 | Ga0209758_1010914 | |||
| 1521 | Ga0209758_1022287 | |||
| 1522 | Ga0209758_1035471 | |||
| 1523 | Ga0209050_1001357 | |||
| 1524 | Ga0209050_1020156 | |||
| 1525 | Ga0209256_1003764 | |||
| 1526 | Ga0209256_1005859 | |||
| 1527 | Ga0209051_1004483 | |||
| 1528 | Ga0209257_1000210 | |||
| 1529 | Ga0209257_1003174 | |||
| 1530 | Ga0207697_10000127 | |||
| 1531 | Ga0207697_10000230 | |||
| 1532 | Ga0207697_10002319 | |||
| 1533 | Ga0207697_10034143 | |||
| 1534 | Ga0207696_1000096 | |||
| 1535 | Ga0207692_10045343 | |||
| 1536 | Ga0207642_10012409 | |||
| 1537 | Ga0207710_10005865 | |||
| 1538 | Ga0207688_10000591 | |||
| 1539 | Ga0207688_10036345 | |||
| 1540 | Ga0207680_10023677 | |||
| 1541 | Ga0207680_10064604 | |||
| 1542 | Ga0207680_10204137 | |||
| 1543 | Ga0207685_10006566 | |||
| 1544 | Ga0207699_10130360 | |||
| 1545 | Ga0207645_10000171 | |||
| 1546 | Ga0207645_10006341 | |||
| 1547 | Ga0207645_10013669 | |||
| 1548 | Ga0207645_10032058 | |||
| 1549 | Ga0207645_10038449 | |||
| 1550 | Ga0207643_10049139 | |||
| 1551 | Ga0207643_10076788 | |||
| 1552 | Ga0207643_10093215 | |||
| 1553 | Ga0207643_10247148 | |||
| 1554 | Ga0207684_10037866 | |||
| 1555 | Ga0207684_10098239 | |||
| 1556 | Ga0207707_10001141 | |||
| 1557 | Ga0207707_10088618 | |||
| 1558 | Ga0207695_10005812 | |||
| 1559 | Ga0207695_10012567 | |||
| 1560 | Ga0207695_10036780 | |||
| 1561 | Ga0207695_10130051 | |||
| 1562 | Ga0207695_10171000 | |||
| 1563 | Ga0207693_10000503 | |||
| 1564 | Ga0207693_10005444 | |||
| 1565 | Ga0207693_10256185 | |||
| 1566 | Ga0207663_10011802 | |||
| 1567 | Ga0207663_10023100 | |||
| 1568 | Ga0207660_10019218 | |||
| 1569 | Ga0207660_10074190 | |||
| 1570 | Ga0207660_10211583 | |||
| 1571 | Ga0207662_10016842 | |||
| 1572 | Ga0207662_10091820 | |||
| 1573 | Ga0207662_10126810 | |||
| 1574 | Ga0207649_10041309 | |||
| 1575 | Ga0207652_10002545 | |||
| 1576 | Ga0207652_10093156 | |||
| 1577 | Ga0207652_10223712 | |||
| 1578 | Ga0207646_10000115 | |||
| 1579 | Ga0207646_10176222 | |||
| 1580 | Ga0207681_10001338 | |||
| 1581 | Ga0207681_10068054 | |||
| 1582 | Ga0207681_10116045 | |||
| 1583 | Ga0207681_10207184 | |||
| 1584 | Ga0207681_10290062 | |||
| 1585 | Ga0207694_10059801 | |||
| 1586 | Ga0207694_10221015 | |||
| 1587 | Ga0207650_10032005 | |||
| 1588 | Ga0207650_10093412 | |||
| 1589 | Ga0207650_10107177 | |||
| 1590 | Ga0207650_10158378 | |||
| 1591 | Ga0207659_10003201 | |||
| 1592 | Ga0207659_10011180 | |||
| 1593 | Ga0207659_10035522 | |||
| 1594 | Ga0207659_10044224 | |||
| 1595 | Ga0207659_10058465 | |||
| 1596 | Ga0207659_10151725 | |||
| 1597 | Ga0207687_10090224 | |||
| 1598 | Ga0207687_10171123 | |||
| 1599 | Ga0207664_10020285 | |||
| 1600 | Ga0207644_10009392 | |||
| 1601 | Ga0207644_10019599 | |||
| 1602 | Ga0207644_10022203 | |||
| 1603 | Ga0207644_10059011 | |||
| 1604 | Ga0207644_10143243 | |||
| 1605 | Ga0207706_10000921 | |||
| 1606 | Ga0207706_10104054 | |||
| 1607 | Ga0207706_10116337 | |||
| 1608 | Ga0207706_10212264 | |||
| 1609 | Ga0207686_10011202 | |||
| 1610 | Ga0207686_10067655 | |||
| 1611 | Ga0207686_10119445 | |||
| 1612 | Ga0207670_10009590 | |||
| 1613 | Ga0207670_10045538 | |||
| 1614 | Ga0207670_10054826 | |||
| 1615 | Ga0207670_10060043 | |||
| 1616 | Ga0207670_10065040 | |||
| 1617 | Ga0207669_10003041 | |||
| 1618 | Ga0207669_10020808 | |||
| 1619 | Ga0207669_10063271 | |||
| 1620 | Ga0207704_10006008 | |||
| 1621 | Ga0207704_10062251 | |||
| 1622 | Ga0207665_10001022 | |||
| 1623 | Ga0207665_10022922 | |||
| 1624 | Ga0207665_10038899 | |||
| 1625 | Ga0207665_10079680 | |||
| 1626 | Ga0207665_10290627 | |||
| 1627 | Ga0207691_10000559 | |||
| 1628 | Ga0207691_10001130 | |||
| 1629 | Ga0207691_10012145 | |||
| 1630 | Ga0207691_10014279 | |||
| 1631 | Ga0207691_10072437 | |||
| 1632 | Ga0207691_10114204 | |||
| 1633 | Ga0207691_10138756 | |||
| 1634 | Ga0207691_10218961 | |||
| 1635 | Ga0207711_10049042 | |||
| 1636 | Ga0207711_10301688 | |||
| 1637 | Ga0207689_10002452 | |||
| 1638 | Ga0207689_10055262 | |||
| 1639 | Ga0207689_10089737 | |||
| 1640 | Ga0207689_10131883 | |||
| 1641 | Ga0207661_10011542 | |||
| 1642 | Ga0207679_10044562 | |||
| 1643 | Ga0207679_10276241 | |||
| 1644 | Ga0207667_10003042 | |||
| 1645 | Ga0207667_10007832 | |||
| 1646 | Ga0207667_10015125 | |||
| 1647 | Ga0207667_10016187 | |||
| 1648 | Ga0207667_10050891 | |||
| 1649 | Ga0207651_10018685 | |||
| 1650 | Ga0207651_10096373 | |||
| 1651 | Ga0207651_10131406 | |||
| 1652 | Ga0207651_10132280 | |||
| 1653 | Ga0207712_10011043 | |||
| 1654 | Ga0207668_10000957 | |||
| 1655 | Ga0207668_10018195 | |||
| 1656 | Ga0207668_10041479 | |||
| 1657 | Ga0207668_10078135 | |||
| 1658 | Ga0207668_10366227 | |||
| 1659 | Ga0207658_10000131 | |||
| 1660 | Ga0207658_10004264 | |||
| 1661 | Ga0207658_10013569 | |||
| 1662 | Ga0207658_10038107 | |||
| 1663 | Ga0207658_10088850 | |||
| 1664 | Ga0207658_10120211 | |||
| 1665 | Ga0207658_10206184 | |||
| 1666 | Ga0207677_10054699 | |||
| 1667 | Ga0207677_10207243 | |||
| 1668 | Ga0207677_10230151 | |||
| 1669 | Ga0207703_10016287 | |||
| 1670 | Ga0207703_10099428 | |||
| 1671 | Ga0207703_10446782 | |||
| 1672 | Ga0207639_10065784 | |||
| 1673 | Ga0207639_10240985 | |||
| 1674 | Ga0207708_10039861 | |||
| 1675 | Ga0207702_10023010 | |||
| 1676 | Ga0207702_10152734 | |||
| 1677 | Ga0207641_10001631 | |||
| 1678 | Ga0207641_10007657 | |||
| 1679 | Ga0207641_10010738 | |||
| 1680 | Ga0207641_10177441 | |||
| 1681 | Ga0207641_10335107 | |||
| 1682 | Ga0207648_10000450 | |||
| 1683 | Ga0207648_10009740 | |||
| 1684 | Ga0207676_10011037 | |||
| 1685 | Ga0207674_10096108 | |||
| 1686 | Ga0207674_10200954 | |||
| 1687 | Ga0207675_100000186 | |||
| 1688 | Ga0207675_100009520 | |||
| 1689 | Ga0207675_100012136 | |||
| 1690 | Ga0207675_100013158 | |||
| 1691 | Ga0207675_100123924 | |||
| 1692 | Ga0207683_10003057 | |||
| 1693 | Ga0207683_10048708 | |||
| 1694 | Ga0207683_10127022 | |||
| 1695 | Ga0207683_10285550 | |||
| 1696 | Ga0207698_10260058 | |||
| 1697 | Ga0209984_1007099 | |||
| 1698 | Ga0209179_1000025 | |||
| 1699 | Ga0209970_1000774 | |||
| 1700 | Ga0210002_1000587 | |||
| 1701 | Ga0209983_1001502 | |||
| 1702 | Ga0209588_1014692 | |||
| 1703 | Ga0209971_1004126 | |||
| 1704 | Ga0209998_10002195 | |||
| 1705 | Ga0209974_10000104 | |||
| 1706 | Ga0207428_10005148 | |||
| 1707 | Ga0207428_10051710 | |||
| 1708 | Ga0207428_10059740 | |||
| 1709 | Ga0207428_10073196 | |||
| 1710 | Ga0207428_10182389 | |||
| 1711 | Ga0268266_10079426 | |||
| 1712 | Ga0268266_10092394 | |||
| 1713 | Ga0268266_10096839 | |||
| 1714 | Ga0268266_10232811 | |||
| 1715 | Ga0268265_10000879 | |||
| 1716 | Ga0268265_10043119 | |||
| 1717 | Ga0268265_10063385 | |||
| 1718 | Ga0268265_10080292 | |||
| 1719 | Ga0268265_10150675 | |||
| 1720 | Ga0268264_10000102 | |||
| 1721 | Ga0268264_10013464 | |||
| 1722 | Ga0268264_10013892 | |||
| 1723 | Ga0268264_10071509 | |||
| 1724 | Ga0265334_10012805 | |||
| 1725 | Ga0265338_10003632 | |||
| 1726 | Ga0307511_10004214 | |||
| 1727 | Ga0307511_10036113 | |||
| 1728 | Ga0265760_10002154 | |||
| 1729 | Ga0265339_10054301 | |||
| 1730 | Ga0265331_10009421 | |||
| 1731 | Ga0265327_10000556 | |||
| 1732 | Ga0265327_10003741 | |||
| 1733 | Ga0265327_10017089 | |||
| 1734 | Ga0265327_10017852 | |||
| 1735 | Ga0265327_10093483 | |||
| 1736 | Ga0265316_10000167 | |||
| 1737 | Ga0307513_10008759 | |||
| 1738 | Ga0307513_10183040 | |||
| 1739 | Ga0307513_10259883 | |||
| 1740 | Ga0307509_10209922 | |||
| 1741 | Ga0307408_100036559 | |||
| 1742 | Ga0307408_100076964 | |||
| 1743 | Ga0307408_100262339 | |||
| 1744 | Ga0307408_100323812 | |||
| 1745 | Ga0307408_100521352 | |||
| 1746 | Ga0265313_10044529 | |||
| 1747 | Ga0307508_10261319 | |||
| 1748 | Ga0316575_10006188 | |||
| 1749 | Ga0316575_10008075 | |||
| 1750 | Ga0316575_10009617 | |||
| 1751 | Ga0316575_10024359 | |||
| 1752 | Ga0316579_10009386 | |||
| 1753 | Ga0316576_10005106 | |||
| 1754 | Ga0316576_10018540 | |||
| 1755 | Ga0316576_10056216 | |||
| 1756 | Ga0316576_10066117 | |||
| 1757 | Ga0316576_10101925 | |||
| 1758 | Ga0316578_10051924 | |||
| 1759 | Ga0316578_10058275 | |||
| 1760 | Ga0307516_10000081 | |||
| 1761 | Ga0307405_10028693 | |||
| 1762 | Ga0316577_10000946 | |||
| 1763 | Ga0316577_10007228 | |||
| 1764 | Ga0316577_10074569 | |||
| 1765 | Ga0307413_10165982 | |||
| 1766 | Ga0307413_10293709 | |||
| 1767 | Ga0307410_10108025 | |||
| 1768 | Ga0307410_10248047 | |||
| 1769 | Ga0307406_10115597 | |||
| 1770 | Ga0307406_10150755 | |||
| 1771 | Ga0307407_10015223 | |||
| 1772 | Ga0307407_10050152 | |||
| 1773 | Ga0307407_10066608 | |||
| 1774 | Ga0307409_100002001 | |||
| 1775 | Ga0307409_100047196 | |||
| 1776 | Ga0307409_100459714 | |||
| 1777 | Ga0307416_100018243 | |||
| 1778 | Ga0307416_100023642 | |||
| 1779 | Ga0307416_100028901 | |||
| 1780 | Ga0307416_100114613 | |||
| 1781 | Ga0307414_10046280 | |||
| 1782 | Ga0307411_10017297 | |||
| 1783 | Ga0307411_10214136 | |||
| 1784 | Ga0307415_100545326 | |||
| 1785 | Ga0316580_10012862 | |||
| 1786 | Ga0316580_10042730 | |||
| 1787 | Ga0307510_10000006 | |||
| 1788 | Ga0373934_0000368 | |||
| 1789 | Ga0373934_0000410 | |||
| 1790 | Ga0373944_0017915 | |||
| 1791 | Ga0373944_0056672 | |||
| 1792 | Ga0373923_0018514 | |||
| 1793 | Ga0373923_0050074 | |||
| 1794 | Ga0373936_0006311 | |||
| 1795 | Ga0373945_0097279 | |||
| 1796 | Ga0373945_0140497 | |||
| 1797 | Ga0373953_0020584 | |||
| 1798 | Ga0373954_0001420 | |||
| 1799 | Ga0373954_0004483 | |||
| 1800 | Ga0373954_0032778 | |||
| 1801 | Ga0373954_0035135 | |||
| 1802 | Ga0373956_0010617 | |||
| 1803 | Ga0373957_0003247 | |||
| 1804 | Ga0373957_0014510 | |||
| 1805 | Ga0373943_0053245 | |||
| 1806 | Ga0373943_0115360 | |||
| 1807 | Ga0373955_0001973 | |||
| 1808 | Ga0373955_0031395 | |||
| 1809 | Ga0373955_0078054 | |||
| 1810 | Ga0316574_0000907 | |||
| 1811 | Ga0316574_0004321 | |||
| 1812 | Ga0316574_0006853 | |||
| 1813 | Ga0316574_0021411 | |||
| 1814 | Ga0316574_0030227 | |||
| 1815 | Ga0316574_0032277 | |||
| 1816 | Ga0316574_0044614 | |||
| 1817 | Ga0316574_0112790 | |||
| 1818 | Ga0316574_0114889 | |||
| 1819 | Ga0373924_0003250 | |||
| 1820 | Ga0373935_0001511 | |||
| 1821 | Ga0373935_0032184 | |||
| 1822 | Ga0373935_0317485 | |||
| 1823 | Ga0373927_0000002 | |||
| 1824 | Ga0373927_0045147 | |||
| 1825 | Ga0373927_0101301 | |||
| 1826 | Ga0373933_0000335 | |||
| 1827 | Ga0373933_0101203 | |||
| 1828 | Ga0373947_0014892 | |||
| 1829 | Ga0373947_0022163 | |||
| 1830 | Ga0373947_0108948 | |||
| 1831 | Ga0373947_0279906 | |||
| 1832 | Ga0373937_0001114 | |||
| 1833 | Ga0373937_0018294 | |||
| 1834 | Ga0373937_0019437 | |||
| 1835 | Ga0373937_0040334 | |||
| 1836 | Ga0373937_0140081 | |||
| 1837 | Ga0373937_0182014 | |||
| 1838 | Ga0373937_0202480 | |||
| 1839 | Ga0373937_0267009 | |||
| 1840 | Ga0316582_0019082 | |||
| 1841 | Ga0316582_0019741 | |||
| 1842 | Ga0316584_0029803 | |||
| 1843 | Ga0316584_0067900 | |||
| 1844 | Ga0373925_0035071 | |||
| 1845 | Ga0373925_0051829 | |||
| 1846 | Ga0373925_0149829 | |||
| 1847 | Ga0373925_0181274 | |||
| 1848 | Ga0395899_0003927 | |||
| 1849 | Ga0395900_0016871 | |||
| 1850 | Ga0395900_0208144 | |||
| 1851 | Ga0395898_0019512 | |||
| 1852 | Ga0395898_0388359 | |||
| 1853 | Ga0395905_0000491 | |||
| 1854 | Ga0395905_0001364 | |||
| 1855 | Ga0316581_0008820 | |||
| 1856 | Ga0316581_0031972 | |||
| 1857 | Ga0436364_1265600 | |||
| 1858 | Ga0395901_0016944 | |||
| 1859 | Ga0436365_0183573 | |||
| 1860 | Ga0436365_0185309 | |||
| 1861 | Ga0436365_0831110 | |||
| 1862 | Ga0436363_0158878 | |||
| 1863 | Ga0436363_1045643 | |||
| 1864 | Ga0436363_1321922 | |||
| 1865 | Ga0439447_000636 | |||
| 1866 | Ga0451841_1321531 | |||
| 1867 | Ga0439441_009725 | |||
| 1868 | Ga0439442_006739 | |||
| 1869 | Ga0439449_0027011 | |||
| 1870 | Ga0439449_0034393 | |||
| 1871 | Ga0439452_025133 | |||
| 1872 | Ga0439454_012946 | |||
| 1873 | Ga0450914_007621 | |||
| 1874 | Ga0450920_000265 | |||
| 1875 | Ga0450923_000721 | |||
| 1876 | Ga0450923_036647 | |||
| 1877 | Ga0450891_007844 | |||
| 1878 | Ga0450894_004353 | |||
| 1879 | Ga0450896_004094 | |||
| 1880 | Ga0450898_017616 | |||
| 1881 | Ga0450910_008149 | |||
| 1882 | Ga0450908_000566 | |||
| 1883 | Ga0439435_0007663 | |||
| 1884 | Ga0439444_0008815 | |||
| 1885 | Ga0451577_0064238 | |||
| 1886 | Ga0451577_0303388 | |||
| 1887 | Ga0466966_0071783 | |||
| 1888 | Ga0453684_0014076 | |||
| 1889 | Ga0453684_0037359 | |||
| 1890 | Ga0453684_0567487 | |||
| 1891 | Ga0466957_0103105 | |||
| 1892 | Ga0466959_0062293 | |||
| 1893 | Ga0451576_0002379 | |||
| 1894 | Ga0451576_0040111 | |||
| 1895 | Ga0451576_0068419 | |||
| 1896 | Ga0451576_0101804 | |||
| 1897 | Ga0466967_0011944 | |||
| 1898 | Ga0466967_0342586 | |||
| 1899 | Ga0495617_000131 | |||
| 1900 | Ga0495617_001386 | |||
| 1901 | Ga0495592_0029149 | |||
| 1902 | Ga0495592_0048971 | |||
| 1903 | Ga0495603_0075883 | |||
| 1904 | Ga0495603_0098263 | |||
| 1905 | Ga0495629_0034030 | |||
| 1906 | Ga0495629_0159541 | |||
| 1907 | Ga0495638_0000180 | |||
| 1908 | Ga0495638_0005940 | |||
| 1909 | Ga0495638_0103716 | |||
| 1910 | Ga0495641_0023815 | |||
| 1911 | Ga0495651_0000408 | |||
| 1912 | Ga0495651_0001927 | |||
| 1913 | Ga0495651_0080049 | |||
| 1914 | Ga0495653_0007912 | |||
| 1915 | Ga0495650_0006073 | |||
| 1916 | Ga0495650_0013234 | |||
| 1917 | Ga0495580_0008617 | |||
| 1918 | Ga0495580_0039451 | |||
| 1919 | Ga0495580_0058235 | |||
| 1920 | Ga0495580_0121921 | |||
| 1921 | Ga0495664_0014727 | |||
| 1922 | Ga0495584_0001164 | |||
| 1923 | Ga0495585_0000437 | |||
| 1924 | Ga0495594_0056106 | |||
| 1925 | Ga0495607_0000654 | |||
| 1926 | Ga0495606_0000918 | |||
| 1927 | Ga0495606_0009672 | |||
| 1928 | Ga0495608_0067704 | |||
| 1929 | Ga0495616_0000190 | |||
| 1930 | Ga0495616_0000360 | |||
| 1931 | Ga0495618_0076527 | |||
| 1932 | Ga0495618_0137694 | |||
| 1933 | Ga0495620_0000719 | |||
| 1934 | Ga0495628_0004271 | |||
| 1935 | Ga0495628_0066181 | |||
| 1936 | Ga0495628_0085758 | |||
| 1937 | Ga0495628_0144119 | |||
| 1938 | Ga0495630_0075496 | |||
| 1939 | Ga0495630_0252477 | |||
| 1940 | Ga0495631_0000389 | |||
| 1941 | Ga0495631_0000631 | |||
| 1942 | Ga0495632_0000135 | |||
| 1943 | Ga0495632_0007588 | |||
| 1944 | Ga0495637_0034945 | |||
| 1945 | Ga0495644_0005069 | |||
| 1946 | Ga0495648_0003653 | |||
| 1947 | Ga0495648_0005315 | |||
| 1948 | Ga0495663_0028503 | |||
| 1949 | Ga0495666_0005322 | |||
| 1950 | Ga0495652_0041652 | |||
| 1951 | Ga0495652_0290449 | |||
| 1952 | Ga0495665_0026288 | |||
| 1953 | Ga0495640_0006168 | |||
| 1954 | Ga0495586_0106170 | |||
| 1955 | Ga0495586_0130027 | |||
| 1956 | Ga0495587_0005354 | |||
| 1957 | Ga0495609_0015535 | |||
| 1958 | Ga0495621_0002704 | |||
| 1959 | Ga0495622_0027562 | |||
| 1960 | Ga0495622_0042981 | |||
| 1961 | Ga0495667_0007860 | |||
| 1962 | Ga0495656_0027319 | |||
| 1963 | Ga0495656_0072717 | |||
| 1964 | Ga0495668_0001101 | |||
| 1965 | Ga0495668_0004981 | |||
| 1966 | Ga0495634_0050977 | |||
| 1967 | Ga0495611_0000004 | |||
| 1968 | Ga0495611_0000285 | |||
| 1969 | Ga0495625_0000617 | |||
| 1970 | Ga0495625_0009073 | |||
| 1971 | Ga0495625_0065486 | |||
| 1972 | Ga0495635_0134045 | |||
| 1973 | Ga0495659_0005803 | |||
| 1974 | Ga0495661_0001370 | |||
| 1975 | Ga0495657_0007507 | |||
| 1976 | Ga0495599_0004788 | |||
| 1977 | Ga0495647_0002069 | |||
| 1978 | Ga0495647_0028686 | |||
| 1979 | Ga0495658_0009573 | |||
| 1980 | Ga0495658_0036728 | |||
| 1981 | Ga0495658_0060184 | |||
| 1982 | Ga0495669_0043136 | |||
| 1983 | Ga0495613_0008505 | |||
| 1984 | Ga0495613_0262702 | |||
| 1985 | Ga0495670_0000884 | |||
| 1986 | Ga0495671_0010269 | |||
| 1987 | Ga0495671_0026160 | |||
| 1988 | Ga0495671_0076964 | |||
| 1989 | Ga0495649_0003176 | |||
| 1990 | Ga0495649_0003223 | |||
| 1991 | Ga0495589_0002511 | |||
| 1992 | Ga0495600_0031607 | |||
| 1993 | Ga0495660_0000356 | |||
| 1994 | Ga0495660_0000685 | |||
| 1995 | Ga0495604_0071290 | |||
| 1996 | Ga0495604_0201517 | |||
| 1997 | Ga0495636_0013408 | |||
| 1998 | Ga0495674_0012393 | |||
| 1999 | Ga0495680_0426497 | |||
| 2000 | Ga0495679_000011 | |||
| 2001 | Ga0495673_0000036 | |||
| 2002 | Ga0495673_0000151 | |||
| 2003 | Ga0495673_0003447 | |||
| 2004 | Ga0495681_0014156 | |||
| 2005 | Ga0495684_0008689 | |||
| 2006 | Ga0495686_0002323 | |||
| 2007 | Ga0495614_0007216 | |||
| 2008 | Ga0496100_0014939 | |||
| 2009 | Ga0496100_0049219 | |||
| 2010 | Ga0496100_0074816 | |||
| 2011 | Ga0496100_0079114 | |||
| 2012 | Ga0496101_0002453 | |||
| 2013 | Ga0496101_0005357 | |||
| 2014 | Ga0496101_0146004 | |||
| 2015 | Ga0496102_0170892 | |||
| 2016 | Ga0496104_0026561 | |||
| 2017 | Ga0496104_0078178 | |||
| 2018 | Ga0496104_0194561 | |||
| 2019 | Ga0496104_0461198 | |||
| 2020 | Ga0496105_0000580 | |||
| 2021 | Ga0496105_0113849 | |||
| 2022 | Ga0496106_0000566 | |||
| 2023 | Ga0496106_0069150 | |||
| 2024 | Ga0496106_0145522 | |||
| 2025 | Ga0496106_0175758 | |||
| 2026 | Ga0496107_0005975 | |||
| 2027 | Ga0496107_0186452 | |||
| 2028 | Ga0496107_0192992 | |||
| 2029 | Ga0496108_0001827 | |||
| 2030 | Ga0496108_0017773 | |||
| 2031 | Ga0496108_0040285 | |||
| 2032 | Ga0496109_0002877 | |||
| 2033 | Ga0496109_0038885 | |||
| 2034 | Ga0496109_0053143 | |||
| 2035 | Ga0496109_0214444 | |||
| 2036 | Ga0496110_0006554 | |||
| 2037 | Ga0496110_0022928 | |||
| 2038 | Ga0496111_0001612 | |||
| 2039 | Ga0496111_0094679 | |||
| 2040 | Ga0496112_0037819 | |||
| 2041 | Ga0496112_0058925 | |||
| 2042 | Ga0496112_0146886 | |||
| 2043 | Ga0496112_0384375 | |||
| 2044 | Ga0496113_0107043 | |||
| 2045 | Ga0496113_0148860 | |||
| 2046 | Ga0496114_0012763 | |||
| 2047 | Ga0496114_0224762 | |||
| 2048 | Ga0496114_0265174 | |||
| 2049 | Ga0496114_0295362 | |||
| 2050 | Ga0496115_0000135 | |||
| 2051 | Ga0496115_0007937 | |||
| 2052 | Ga0496115_0008471 | |||
| 2053 | Ga0496115_0011136 | |||
| 2054 | Ga0496115_0446265 | |||
| 2055 | Ga0496119_0014503 | |||
| 2056 | Ga0496120_0002881 | |||
| 2057 | Ga0496121_0001803 | |||
| 2058 | Ga0496121_0003261 | |||
| 2059 | Ga0496121_0033724 | |||
| 2060 | Ga0496121_0034585 | |||
| 2061 | Ga0496122_0059687 | |||
| 2062 | Ga0496122_0060937 | |||
| 2063 | Ga0496122_0120871 | |||
| 2064 | Ga0496123_0071204 | |||
| 2065 | Ga0496123_0167255 | |||
| 2066 | Ga0496125_0029540 | |||
| 2067 | Ga0496126_0038468 | |||
| 2068 | Ga0496126_0046614 | |||
| 2069 | Ga0496126_0052844 | |||
| 2070 | Ga0496126_0065365 | |||
| 2071 | Ga0495678_000067 | |||
| 2072 | Ga0495682_0044085 | |||
| 2073 | Ga0495682_0094802 | |||
| 2074 | Ga0501031_0017509 | |||
| 2075 | Ga0501031_0060896 | |||
| 2076 | Ga0501032_0039245 | |||
| 2077 | Ga0501033_0006636 | |||
| 2078 | Ga0501034_0021355 | |||
| 2079 | Ga0501036_0001084 | |||
| 2080 | Ga0501036_0184721 | |||
| 2081 | Ga0501037_0010840 | |||
| 2082 | Ga0501038_0006113 | |||
| 2083 | Ga0501038_0081494 | |||
| 2084 | Ga0501038_0096827 | |||
| 2085 | Ga0501039_0001878 | |||
| 2086 | Ga0501039_0035236 | |||
| 2087 | Ga0501039_0335905 | |||
| 2088 | Ga0501040_0008280 | |||
| 2089 | Ga0501041_0001352 | |||
| 2090 | Ga0501041_0004090 | |||
| 2091 | Ga0501041_0004174 | |||
| 2092 | Ga0501042_0021423 | |||
| 2093 | Ga0501042_0054772 | |||
| 2094 | Ga0501042_0117642 | |||
| 2095 | Ga0501042_0120685 | |||
| 2096 | Ga0501043_0003354 | |||
| 2097 | Ga0501043_0033076 | |||
| 2098 | Ga0501046_0004568 | |||
| 2099 | Ga0501046_0059561 | |||
| 2100 | Ga0501046_0061552 | |||
| 2101 | Ga0501046_0381646 | |||
| 2102 | Ga0501047_0017266 | |||
| 2103 | Ga0501048_0125258 | |||
| 2104 | Ga0501048_0209418 | |||
| 2105 | Ga0501048_0238749 | |||
| 2106 | Ga0501067_0007592 | |||
| 2107 | Ga0501068_0004281 | |||
| 2108 | Ga0501068_0067378 | |||
| 2109 | Ga0501068_0128373 | |||
| 2110 | Ga0501069_0024446 | |||
| 2111 | Ga0501070_0008384 | |||
| 2112 | Ga0501070_0066896 | |||
| 2113 | Ga0501071_0001102 | |||
| 2114 | Ga0501071_0007186 | |||
| 2115 | Ga0501071_0088804 | |||
| 2116 | Ga0501071_0164848 | |||
| 2117 | Ga0501071_0313432 | |||
| 2118 | Ga0501072_0004768 | |||
| 2119 | Ga0501072_0021469 | |||
| 2120 | Ga0501072_0030487 | |||
| 2121 | Ga0501072_0083607 | |||
| 2122 | Ga0501072_0112566 | |||
| 2123 | Ga0501073_0000353 | |||
| 2124 | Ga0501073_0001886 | |||
| 2125 | Ga0501073_0026530 | |||
| 2126 | Ga0501073_0315840 | |||
| 2127 | Ga0501074_0003294 | |||
| 2128 | Ga0501074_0019490 | |||
| 2129 | Ga0501075_0000520 | |||
| 2130 | Ga0501075_0013581 | |||
| 2131 | Ga0501075_0145419 | |||
| 2132 | Ga0501076_0002351 | |||
| 2133 | Ga0501076_0002386 | |||
| 2134 | Ga0501076_0016740 | |||
| 2135 | Ga0501076_0030284 | |||
| 2136 | Ga0501076_0103409 | |||
| 2137 | Ga0501076_0165545 | |||
| 2138 | Ga0501076_0274709 | |||
| 2139 | Ga0501077_0004241 | |||
| 2140 | Ga0501077_0107752 | |||
| 2141 | Ga0501077_0131792 | |||
| 2142 | Ga0501077_0143422 | |||
| 2143 | Ga0501209_012427 | |||
| 2144 | Ga0501249_034133 | |||
| 2145 | Ga0501250_014979 | |||
| 2146 | Ga0501079_0000016 | |||
| 2147 | Ga0501079_0001155 | |||
| 2148 | Ga0501079_0010787 | |||
| 2149 | Ga0501080_0000344 | |||
| 2150 | Ga0501080_0003150 | |||
| 2151 | Ga0501080_0005196 | |||
| 2152 | Ga0501080_0013763 | |||
| 2153 | Ga0501081_0005614 | |||
| 2154 | Ga0501081_0016366 | |||
| 2155 | Ga0501081_0038157 | |||
| 2156 | Ga0501081_0277979 | |||
| 2157 | Ga0501083_0063859 | |||
| 2158 | Ga0501083_0130495 | |||
| 2159 | Ga0501083_0267820 | |||
| 2160 | Ga0501035_0017079 | |||
| 2161 | Ga0501035_0035198 | |||
| 2162 | Ga0501035_0038779 | |||
| 2163 | Ga0501035_0163012 | |||
| 2164 | Ga0501044_0076307 | |||
| 2165 | Ga0501045_0002571 | |||
| 2166 | Ga0501045_0038353 | |||
| 2167 | nmdc:mga05p37_122_c1 | |||
| 2168 | nmdc:mga05p37_46323_c1 | |||
| 2169 | nmdc:mga09592_120_c1 | |||
| 2170 | nmdc:mga09592_380_c1 | |||
| 2171 | nmdc:mga09592_415926_c1 | |||
| 2172 | nmdc:mga09592_66814_c1 | |||
| 2173 | nmdc:mga0qj67_186476_c1 | |||
| 2174 | nmdc:mga0qj67_386_c1 | |||
| 2175 | nmdc:mga0qj67_51284_c1 | |||
| 2176 | nmdc:mga0qj67_64402_c1 | |||
| 2177 | nmdc:mga06r32_137_c1 | |||
| 2178 | nmdc:mga06r32_36556_c1 | |||
| 2179 | nmdc:mga06r32_42737_c1 | |||
| 2180 | nmdc:mga06r32_4682_c1 | |||
| 2181 | nmdc:mga06r32_8162_c1 | |||
| 2182 | nmdc:mga08y16_1797_c1 | |||
| 2183 | nmdc:mga08y16_3233_c1 | |||
| 2184 | nmdc:mga08y16_54603_c1 | |||
| 2185 | nmdc:mga08y16_59886_c1 | |||
| 2186 | nmdc:mga08y16_62003_c1 | |||
| 2187 | nmdc:mga08y16_98316_c1 | |||
| 2188 | nmdc:mga0n895_563584_c1 | |||
| 2189 | nmdc:mga0n895_736_c1 | |||
| 2190 | nmdc:mga0rr50_27752_c1 | |||
| 2191 | nmdc:mga0rr50_54044_c1 | |||
| 2192 | nmdc:mga08x19_47292_c1 | |||
| 2193 | nmdc:mga0a205_9711_c1 | |||
| 2194 | Ga0495601_0008506 | |||
| 2195 | Ga0495601_0053019 | |||
| 2196 | Ga0495612_0144958 | |||
| 2197 | Ga0495655_0059876 | |||
| 2198 | Ga0495595_0001644 | |||
| 2199 | Ga0500643_000012 | |||
| 2200 | Ga0500583_0004089 | |||
| 2201 | Ga0500583_0073946 | |||
| 2202 | Ga0500556_0000313 | |||
| 2203 | Ga0500588_0041615 | |||
| 2204 | Ga0500622_0001607 | |||
| 2205 | Ga0500622_0004452 | |||
| 2206 | Ga0500622_0027685 | |||
| 2207 | Ga0500633_0021636 | |||
| 2208 | Ga0500636_0001930 | |||
| 2209 | Ga0500637_0014858 | |||
| 2210 | Ga0500637_0065022 | |||
| 2211 | Ga0500625_003485 | |||
| 2212 | Ga0501084_0038603 | |||
| 2213 | Ga0501084_0164994 | |||
| 2214 | Ga0501084_0204297 | |||
| 2215 | Ga0501082_0000552 | |||
| 2216 | Ga0501082_0019061 | |||
| 2217 | Ga0501082_0034152 | |||
| 2218 | Ga0530510_0000463 | |||
| 2219 | Ga0530510_0012087 | |||
| 2220 | Ga0530510_0167072 | |||
| 2221 | 2525558229 | |||
| 2222 | 2630650217 | |||
| 2223 | 2643818476 | |||
| 2224 | 2643938383 | |||
| 2225 | 2643973179 | |||
| 2226 | 2644079034 | |||
| 2227 | 2644530649 | |||
| 2228 | 2644661227 | |||
| 2229 | 2644693811 | |||
| 2230 | 2644699304 | |||
| 2231 | 2721028995 | |||
| 2232 | 2735835425 | |||
| 2233 | 2739227377 | |||
| 2234 | 2842918714 | |||
| 2235 | 2919087207 | |||
| 2236 | 2995949806 | |||
| 2237 | 8001522921 | |||
| 2238 | 8003015325 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2cnq-assembly1.cif.gz_A | atomic resolution structure of saicar-synthase from saccharomyces cerevisiae complexed with adp, aicar, succinate | 0.9398 | 6 | 296 |
| 1obg-assembly1.cif.gz_A | saicar-synthase complexed with atp | 0.9324 | 6 | 296 |
| 1obd-assembly1.cif.gz_A | saicar-synthase complexed with atp | 0.9309 | 6 | 294 |
| 2cnv-assembly1.cif.gz_A | saicar-synthase from saccharomyces cerevisiae complexed saicar | 0.9229 | 6 | 294 |
| 2cnq-assembly1.cif.gz_A | atomic resolution structure of saicar-synthase from saccharomyces cerevisiae complexed with adp, aicar, succinate | 0.9214 | 6 | 296 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3r9rA02 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.9723 | 107 | 247 | 3.30.470.20 |
| 1obgA02 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.9576 | 106 | 247 | 3.30.470.20 |
| 3r9rA02 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.9396 | 107 | 247 | 3.30.470.20 |
| af_P38025_185_330_3.30.470.20 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.9307 | 108 | 239 | 3.30.470.20 |
| af_A0A1D8PRQ1_1_101_3.30.200.20 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.9276 | 6 | 104 | 3.30.200.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A535BLM7-F1-model_v4 | phosphoribosylaminoimidazolesuccinocarboxamide synthase (EC 6.3.2.6) | 0.9981 | 56 | 296 |
GO:0004639
GO:0005524 GO:0005737 GO:0006189 |
| AF-A0A2V5X396-F1-model_v4 | Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6) (SAICAR synthetase) | 0.9968 | 1 | 296 |
GO:0004639
GO:0005524 GO:0005737 GO:0006189 |
| AF-A0A7W0YC12-F1-model_v4 | Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6) (SAICAR synthetase) | 0.9955 | 1 | 296 |
GO:0004639
GO:0005524 GO:0005737 GO:0006189 |
| AF-A0A7X7XHC9-F1-model_v4 | Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6) (SAICAR synthetase) | 0.9954 | 4 | 295 |
GO:0004639
GO:0005524 GO:0005737 GO:0006189 |
| AF-A0A2V6HF81-F1-model_v4 | phosphoribosylaminoimidazolesuccinocarboxamide synthase (EC 6.3.2.6) | 0.9942 | 1 | 242 |
GO:0004639
GO:0005524 GO:0005737 GO:0006189 |