F490367

General Info

Members Datasets Scaffolds Average Seq Length
1119 818 2236 164

Family's Representative Sequence

Representative Sequence 3300028380|Ga0268265_11013156|Ga0268265_110131561
Length 192
Sequence VPRVTVDLRDLDWRSEVHAEASARAAGPEVNIRARFVFIARQASIDQRCQFGTASVKIAVDHYLPLQEAIPVIPMLALYRTYNLGVAFSMLSGMDGWFIVGMRLIIVAFVLYLWHRTAKDRWLAHLGYALIIAGAIGNLIDRFAYGHVIDYILFHTETWSFAVFNLADSFITVGAGCVILDEMLQKPKKADH

Samples

Sample ID Description Type Environment
1 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
19 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
22 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
23 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
24 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
27 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
47 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
48 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
49 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
50 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
57 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
69 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
70 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
71 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
72 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
73 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
74 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
75 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
76 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
77 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
78 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
80 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
81 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
82 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
83 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
85 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
86 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
87 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
90 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
92 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
94 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
97 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
115 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
117 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
120 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
121 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
127 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
130 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
131 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
132 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
133 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
134 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
135 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
136 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
137 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
138 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
139 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
140 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
141 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
142 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
143 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
144 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
145 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
146 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
147 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
148 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
149 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
150 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
151 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
152 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
153 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
154 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
155 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
158 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
159 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
160 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
161 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
162 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
163 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
164 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
165 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
166 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
167 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
168 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
169 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
170 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
171 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
172 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
173 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
174 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
175 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
176 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
177 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
178 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
179 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
180 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
181 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
182 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
183 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
184 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
185 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
186 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
187 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
188 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
189 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
190 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
191 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
192 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
193 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
194 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
195 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
196 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
197 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
198 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
199 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
200 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
201 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
202 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
203 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
204 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
205 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
206 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
209 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
210 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
211 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
212 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
213 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
214 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
215 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
216 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
217 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
218 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
219 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
220 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
221 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
222 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
223 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
224 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
225 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
226 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
232 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
233 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
234 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
235 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
236 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
237 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
238 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
239 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
240 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
241 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
242 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
243 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
244 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
245 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
246 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
247 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
248 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
249 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
250 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
251 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
252 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
253 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
254 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
255 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
256 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
257 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
258 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
259 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
260 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
261 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
262 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
263 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
264 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
265 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
266 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
268 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
269 2509276019 Ensifer aridi TW10 Isolate Nodule
270 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
271 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
272 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
273 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
274 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
275 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
276 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
277 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
278 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
279 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
280 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
281 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
282 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
283 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
284 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
285 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
286 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
287 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
288 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
289 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
290 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
291 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
292 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
293 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
294 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
295 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
296 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
297 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
298 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
299 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
300 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
301 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
302 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
303 2516143018 Ensifer sp. BR816 Isolate Nodule
304 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
305 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
306 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
307 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
308 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
309 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
310 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
311 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
312 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
313 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
314 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
315 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
316 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
317 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
318 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
319 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
320 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
321 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
322 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
323 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
324 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
325 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
326 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
327 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
328 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
329 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
330 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
331 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
332 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
333 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
334 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
335 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
336 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
337 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
338 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
339 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
340 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
341 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
342 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
343 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
344 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
345 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
346 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
347 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
348 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
349 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
350 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
351 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
352 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
353 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
354 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
355 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
356 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
357 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
358 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
359 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
360 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
361 2643221557 Ensifer sp. Root558 Isolate Unclassified
362 2643221558 Rhizobium sp. Root149 Isolate Unclassified
363 2643221568 Rhizobium sp. Root564 Isolate Unclassified
364 2643221582 Rhizobium sp. Root651 Isolate Unclassified
365 2643221599 Rhizobium sp. Root708 Isolate Unclassified
366 2643221610 Ensifer sp. Root74 Isolate Unclassified
367 2643221618 Ensifer sp. Root231 Isolate Unclassified
368 2643221626 Ensifer sp. Root31 Isolate Unclassified
369 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
370 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
371 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
372 2643221655 Ensifer sp. Root1252 Isolate Unclassified
373 2643221659 Ensifer sp. Root127 Isolate Unclassified
374 2643221668 Ensifer sp. Root423 Isolate Unclassified
375 2643221675 Ensifer sp. Root1298 Isolate Unclassified
376 2643221680 Ensifer sp. Root1312 Isolate Unclassified
377 2643221688 Rhizobium sp. Root482 Isolate Unclassified
378 2643221693 Rhizobium sp. Root491 Isolate Unclassified
379 2643221698 Ensifer sp. Root142 Isolate Unclassified
380 2643221712 Ensifer sp. Root258 Isolate Unclassified
381 2643221718 Rhizobium sp. Root268 Isolate Unclassified
382 2643221723 Ensifer sp. Root278 Isolate Unclassified
383 2643221726 Ensifer sp. Root954 Isolate Unclassified
384 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
385 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
386 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
387 2718217882 Rhizobium sp. N741 Isolate Nodule
388 2718217927 Rhizobium sp. N324 Isolate Nodule
389 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
390 2718218009 Rhizobium sp. N561 Isolate Nodule
391 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
392 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
393 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
394 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
395 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
396 2718218363 Rhizobium sp. N113 Isolate Nodule
397 2718218365 Rhizobium sp. N731 Isolate Nodule
398 2718218366 Rhizobium sp. N621 Isolate Nodule
399 2718218423 Rhizobium sp. N941 Isolate Nodule
400 2721755514 Rhizobium sp. N6212 Isolate Nodule
401 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
402 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
403 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
404 2721755809 Rhizobium sp. N541 Isolate Nodule
405 2721755810 Rhizobium sp. N871 Isolate Nodule
406 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
407 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
408 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
409 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
410 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
411 2728369365 Rhizobium sp. N1341 Isolate Nodule
412 2728369397 Rhizobium sp. N1314 Isolate Nodule
413 2738541293 Rhizobium sp. GV031 Isolate Unclassified
414 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
415 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
416 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
417 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
418 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
419 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
420 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
421 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
422 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
423 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
424 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
425 2791355256 Rhizobium sp. M10 Isolate Nodule
426 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
427 2791355260 Rhizobium sp. L9 Isolate Nodule
428 2791355261 Rhizobium sp. J15 Isolate Nodule
429 2791355262 Rhizobium sp. M1 Isolate Nodule
430 2791355263 Rhizobium chutanense C5 Isolate Nodule
431 2791355264 Rhizobium sp. S9 Isolate Nodule
432 2791355265 Rhizobium sp. H4 Isolate Nodule
433 2791355266 Rhizobium sp. L43 Isolate Nodule
434 2791355267 Rhizobium sp. L18 Isolate Nodule
435 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
436 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
437 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
438 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
439 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
440 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
441 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
442 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
443 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
444 2802429633 Rhizobium anhuiense J3 Isolate Nodule
445 2802429634 Rhizobium anhuiense S10 Isolate Nodule
446 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
447 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
448 2802429637 Rhizobium anhuiense C15 Isolate Nodule
449 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
450 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
451 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
452 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
453 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
454 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
455 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
456 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
457 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
458 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
459 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
460 2838048938 Rhizobium pisi 27/80 Isolate Nodule
461 2838061910 Rhizobium phaseoli L15 Isolate Nodule
462 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
463 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
464 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
465 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
466 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
467 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
468 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
469 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
470 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
471 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
472 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
473 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
474 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
475 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
476 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
477 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
478 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
479 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
480 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
481 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
482 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
483 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
484 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
485 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
486 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
487 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
488 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
489 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
490 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
491 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
492 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
493 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
494 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
495 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
496 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
497 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
498 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
499 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
500 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
501 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
502 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
503 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
504 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
505 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
506 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
507 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
508 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
509 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
510 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
511 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
512 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
513 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
514 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
515 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
516 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
517 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
518 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
519 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
520 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
521 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
522 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
523 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
524 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
525 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
526 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
527 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
528 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
529 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
530 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
531 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
532 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
533 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
534 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
535 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
536 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
537 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
538 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
539 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
540 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
541 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
542 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
543 2844163670 Ensifer sp. 1H6 Isolate Unclassified
544 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
545 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
546 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
547 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
548 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
549 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
550 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
551 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
552 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
553 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
554 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
555 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
556 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
557 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
558 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
559 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
560 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
561 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
562 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
563 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
564 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
565 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
566 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
567 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
568 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
569 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
570 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
571 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
572 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
573 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
574 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
575 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
576 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
577 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
578 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
579 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
580 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
581 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
582 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
583 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
584 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
585 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
586 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
587 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
588 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
589 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
590 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
591 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
592 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
593 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
594 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
595 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
596 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
597 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
598 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
599 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
600 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
601 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
602 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
603 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
604 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
605 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
606 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
607 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
608 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
609 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
610 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
611 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
612 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
613 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
614 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
615 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
616 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
617 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
618 2933599457 Rhizobium phaseoli M3 Isolate Nodule
619 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
620 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
621 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
622 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
623 2936381700 Rhizobium chutanense C16 Isolate Unclassified
624 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
625 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
626 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
627 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
628 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
629 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
630 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
631 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
632 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
633 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
634 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
635 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
636 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
637 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
638 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
639 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
640 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
641 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
642 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
643 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
644 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
645 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
646 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
647 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
648 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
649 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
650 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
651 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
652 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
653 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
654 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
655 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
656 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
657 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
658 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
659 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
660 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
661 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
662 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
663 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
664 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
665 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
666 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
667 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
668 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
669 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
670 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
671 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
672 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
673 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
674 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
675 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
676 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
677 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
678 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
679 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
680 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
681 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
682 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
683 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
684 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
685 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
686 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
687 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
688 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
689 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
690 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
691 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
692 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
693 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
694 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
695 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
696 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
697 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
698 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
699 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
700 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
701 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
702 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
703 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
704 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
705 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
706 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
707 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
708 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
709 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
710 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
711 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
712 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
713 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
714 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
715 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
716 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
717 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
718 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
719 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
720 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
721 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
722 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
723 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
724 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
725 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
726 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
727 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
728 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
729 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
730 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
731 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
732 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
733 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
734 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
735 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
736 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
737 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
738 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
739 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
740 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
741 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
742 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
743 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
744 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
745 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
746 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
747 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
748 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
749 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
750 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
751 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
752 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
753 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
754 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
755 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
756 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
757 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
758 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
759 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
760 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
761 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
762 2996887358 Rhizobium sp. R711 Isolate Nodule
763 2996893221 Rhizobium sp. R635 Isolate Nodule
764 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
765 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
766 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
767 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
768 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
769 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
770 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
771 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
772 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
773 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
774 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
775 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
776 8005258706 Rhizobium sp. R693 Isolate Nodule
777 8005275841 Rhizobium sp. N4311 Isolate Nodule
778 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
779 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
780 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
781 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
782 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
783 8005321885 Rhizobium sp. R72 Isolate Nodule
784 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
785 8005382845 Rhizobium sp. R634 Isolate Nodule
786 8005395548 Rhizobium sp. R339 Isolate Nodule
787 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
788 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
789 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
790 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
791 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
792 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
793 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
794 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
795 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
796 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
797 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
798 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
799 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
800 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
801 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
802 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
803 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
804 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
805 8018176218 Rhizobium sp. N122 Isolate Nodule
806 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
807 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
808 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
809 8024501048 Rhizobium sp. H4 Isolate Nodule
810 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
811 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
812 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
813 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
814 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
815 8056382006 Rhizobium croatiense 13T Isolate Nodule
816 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
817 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
818 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 50.67
Metatranscriptomes 0.09
Isolates 49.24

Biome Distribution

Category Percentage (%)
Aerial Root 0.45
Bulb 0
Endosphere 19.48
Nodule 38.96
Rhizoplane 1.97
Rhizosphere 22.16
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0268265_11013156 3300028380 Bacteria 821
2 JGI24740J21852_10102744 3300001979 Bacteria 726
3 JGI24738J21930_10105116 3300002075 Bacteria 605
4 JGI25156J39149_1000011 3300002705 Bacteria 198215
5 JGI25154J39366_1000030 3300002738 Bacteria 191444
6 JGI25158J39367_1000066 3300002739 Bacteria 23379
7 JGI25158J39367_1005895 3300002739 Bacteria 1773
8 JGI25157J39369_1000013 3300002741 Bacteria 198211
9 JGI25152J39213_1000663 3300002773 Bacteria 17990
10 JGI25152J39213_1001585 3300002773 Bacteria 9541
11 JGI25152J39213_1002362 3300002773 Bacteria 7245
12 JGI25152J39213_1011893 3300002773 Bacteria 1898
13 JGI25150J39212_1000735 3300002774 Bacteria 11633
14 JGI25150J39212_1002444 3300002774 Bacteria 4614
15 JGI25150J39212_1023947 3300002774 Bacteria 902
16 JGI25159J45721_1000003 3300002987 Bacteria 274069
17 JGI25159J45721_1000157 3300002987 Bacteria 31990
18 JGI25159J45721_1034705 3300002987 Bacteria 779
19 JGI25151J46595_10000555 3300003187 Bacteria 34026
20 JGI25151J46595_10001025 3300003187 Bacteria 20943
21 JGI25151J46595_10004676 3300003187 Bacteria 7201
22 JGI25151J46595_10007941 3300003187 Bacteria 5146
23 JGI25151J46595_10044072 3300003187 Bacteria 1589
24 JGI25165J46597_1000968 3300003214 Bacteria 19421
25 JGI25165J46597_1000992 3300003214 Bacteria 18853
26 JGI25165J46597_1006805 3300003214 Bacteria 1981
27 JGI25153J46596_10000745 3300003215 Bacteria 19895
28 JGI25153J46596_10052810 3300003215 Bacteria 1154
29 JGI25153J46596_10059094 3300003215 Bacteria 1051
30 rootH1_10066899 3300003316 Bacteria 1401
31 rootH2_10051353 3300003320 Bacteria 1559
32 rootH2_10064542 3300003320 Bacteria 3637
33 rootL2_10064081 3300003322 Bacteria 7976
34 rootH1_10070667 3300003323 Bacteria 2567
35 JGI25160J50197_1000003 3300003354 Bacteria 482719
36 JGI25160J50197_1000012 3300003354 Bacteria 267582
37 JGI25160J50197_1000414 3300003354 Bacteria 27125
38 JGI25160J50197_1005082 3300003354 Bacteria 5548
39 JGI25160J50197_1006911 3300003354 Bacteria 4517
40 JGI25161J50226_1000002 3300003374 Bacteria 420324
41 JGI25161J50226_1000168 3300003374 Bacteria 45114
42 JGI25161J50226_1000912 3300003374 Bacteria 10639
43 JGI25161J50226_1003778 3300003374 Bacteria 3360
44 Ga0055526_1001137 3300003771 Bacteria 19271
45 Ga0055526_1002723 3300003771 Bacteria 11747
46 Ga0055526_1005177 3300003771 Bacteria 7582
47 Ga0055526_1021865 3300003771 Bacteria 2203
48 Ga0055524_1002577 3300003775 Bacteria 9237
49 Ga0055524_1002757 3300003775 Bacteria 8835
50 Ga0055524_1003841 3300003775 Bacteria 7131
51 Ga0055524_1010386 3300003775 Bacteria 3710
52 Ga0055524_1017139 3300003775 Bacteria 2566
53 Ga0055524_1062623 3300003775 Bacteria 761
54 Ga0055524_1073927 3300003775 Bacteria 645
55 Ga0055536_1005610 3300003781 Bacteria 6079
56 Ga0055528_1000285 3300003790 Bacteria 43196
57 Ga0055528_1000643 3300003790 Bacteria 25587
58 Ga0055528_1003528 3300003790 Bacteria 7806
59 Ga0055528_1013953 3300003790 Bacteria 3009
60 Ga0055528_1019291 3300003790 Bacteria 2266
61 Ga0055528_1042406 3300003790 Bacteria 1002
62 Ga0055540_1000356 3300003792 Bacteria 38898
63 Ga0055540_1020189 3300003792 Bacteria 1770
64 Ga0055540_1023188 3300003792 Bacteria 1568
65 Ga0055540_1031800 3300003792 Bacteria 1210
66 Ga0055531_10004718 3300003794 Bacteria 8153
67 Ga0055531_10006517 3300003794 Bacteria 6618
68 Ga0055531_10055847 3300003794 Bacteria 1001
69 Ga0058692_1003540 3300003856 Bacteria 4798
70 Ga0058692_1009418 3300003856 Bacteria 2462
71 Ga0055543_1000011 3300004625 Bacteria 196089
72 Ga0055543_1000037 3300004625 Bacteria 125386
73 Ga0055543_1000043 3300004625 Bacteria 116599
74 Ga0055543_1000647 3300004625 Bacteria 18553
75 Ga0065165_1000025 3300005262 Bacteria 246909
76 Ga0065165_1003533 3300005262 Bacteria 10818
77 Ga0065165_1009269 3300005262 Bacteria 4441
78 Ga0065165_1010135 3300005262 Bacteria 4121
79 Ga0070670_100000416 3300005331 Bacteria 35091
80 Ga0070668_100183643 3300005347 Bacteria 1710
81 Ga0070669_100678655 3300005353 Bacteria 869
82 Ga0070669_100795623 3300005353 Bacteria 803
83 Ga0070671_100102821 3300005355 Bacteria 2397
84 Ga0070667_100193191 3300005367 Bacteria 1804
85 Ga0070667_100595185 3300005367 Bacteria 1019
86 Ga0070663_100216222 3300005455 Bacteria 1503
87 Ga0070663_101495157 3300005455 Bacteria 600
88 Ga0070665_100014592 3300005548 Bacteria 7884
89 Ga0070665_100034581 3300005548 Bacteria 5082
90 Ga0070665_100274768 3300005548 Bacteria 1687
91 Ga0068856_100023642 3300005614 Bacteria 5976
92 Ga0068856_100207946 3300005614 Bacteria 1972
93 Ga0068851_10089457 3300005834 Bacteria 1619
94 Ga0075365_10005737 3300006038 Bacteria 6736
95 Ga0075365_10006214 3300006038 Bacteria 6548
96 Ga0075368_10000085 3300006042 Bacteria 23151
97 Ga0075363_100086831 3300006048 Bacteria 1718
98 Ga0075362_10001424 3300006177 Bacteria 7630
99 Ga0075362_10024346 3300006177 Bacteria 2567
100 Ga0075362_10104043 3300006177 Bacteria 1330
101 Ga0075367_10003607 3300006178 Bacteria 7415
102 Ga0075367_10076937 3300006178 Bacteria 2014
103 Ga0075367_10896271 3300006178 Bacteria 565
104 Ga0075369_10003035 3300006186 Bacteria 6070
105 Ga0075369_10008799 3300006186 Bacteria 3900
106 Ga0075369_10141669 3300006186 Bacteria 1096
107 Ga0075366_10007945 3300006195 Bacteria 5871
108 Ga0075366_10018267 3300006195 Bacteria 4047
109 Ga0075370_10004010 3300006353 Bacteria 7078
110 Ga0079104_1000033 3300006946 Bacteria 202636
111 Ga0079104_1000847 3300006946 Bacteria 25429
112 Ga0079104_1002810 3300006946 Bacteria 8764
113 Ga0099826_10385756 3300006948 Bacteria 685
114 Ga0105251_10004499 3300009011 Bacteria 9455
115 Ga0105244_10061736 3300009036 Bacteria 1885
116 Ga0105244_10254915 3300009036 Bacteria 817
117 Ga0105250_10189751 3300009092 Bacteria 865
118 Ga0105240_10000024 3300009093 Bacteria 375919
119 Ga0105243_10068948 3300009148 Bacteria 2851
120 Ga0105248_10157053 3300009177 Bacteria 2566
121 Ga0105237_10002690 3300009545 Bacteria 21778
122 Ga0105237_11617147 3300009545 Bacteria 655
123 Ga0105249_10057824 3300009553 Bacteria 3553
124 Ga0123341_1000225 3300009765 Bacteria 29755
125 Ga0123341_1071252 3300009765 Bacteria 1506
126 Ga0123342_1006191 3300009766 Bacteria 16763
127 Ga0123342_1021815 3300009766 Bacteria 4438
128 Ga0105239_10004676 3300010375 Bacteria 16261
129 Ga0105239_11044224 3300010375 Bacteria 940
130 Ga0105246_10164472 3300011119 Bacteria 1693
131 Ga0105246_10375743 3300011119 Bacteria 1173
132 Ga0157313_1002095 3300012503 Bacteria 1157
133 Ga0157373_10019888 3300013100 Bacteria 4884
134 Ga0157373_10044973 3300013100 Bacteria 3152
135 Ga0157371_10000004 3300013102 Bacteria 512593
136 Ga0157371_10007868 3300013102 Bacteria 8558
137 Ga0157370_10000165 3300013104 Bacteria 81259
138 Ga0157370_10000236 3300013104 Bacteria 70330
139 Ga0157370_10032600 3300013104 Bacteria 5086
140 Ga0157370_10380351 3300013104 Bacteria 1300
141 Ga0157369_10041578 3300013105 Bacteria 5017
142 Ga0157369_10187657 3300013105 Bacteria 2173
143 Ga0157369_10222175 3300013105 Bacteria 1977
144 Ga0171463_1001 3300013249 Bacteria 1406070
145 Ga0157378_10211230 3300013297 Bacteria 1840
146 Ga0157372_10196262 3300013307 Bacteria 2338
147 Ga0157372_10513291 3300013307 Bacteria 1397
148 Ga0182008_10063065 3300014497 Bacteria 1826
149 Ga0182007_10004455 3300015262 Bacteria 6348
150 Ga0183363_1051 3300015690 Bacteria 37819
151 Ga0214544_1000105 3300021320 Bacteria 114109
152 Ga0214542_1000029 3300021321 Bacteria 174097
153 Ga0214542_1029334 3300021321 Bacteria 2264
154 Ga0214543_1000027 3300021327 Bacteria 215065
155 Ga0214543_1000040 3300021327 Bacteria 174142
156 Ga0228711_1000013 3300022739 Bacteria 132585
157 Ga0228710_1000008 3300022740 Bacteria 174306
158 Ga0209435_100026 3300025206 Bacteria 198295
159 Ga0209436_100048 3300025208 Bacteria 66177
160 Ga0209436_100220 3300025208 Bacteria 26273
161 Ga0209436_111372 3300025208 Bacteria 1566
162 Ga0209563_107296 3300025230 Bacteria 1827
163 Ga0209437_100050 3300025233 Bacteria 394010
164 Ga0209437_100056 3300025233 Bacteria 363071
165 Ga0207425_1000012 3300025245 Bacteria 528324
166 Ga0207425_1001222 3300025245 Bacteria 11284
167 Ga0207425_1009744 3300025245 Bacteria 2375
168 Ga0207425_1011616 3300025245 Bacteria 2092
169 Ga0209646_1000084 3300025246 Bacteria 198295
170 Ga0209646_1008688 3300025246 Bacteria 1628
171 Ga0209026_1000080 3300025250 Bacteria 198295
172 Ga0209677_100706 3300025253 Bacteria 17067
173 Ga0209759_1000061 3300025256 Bacteria 198295
174 Ga0209759_1018398 3300025256 Bacteria 1688
175 Ga0209129_1000110 3300025258 Bacteria 150918
176 Ga0209129_1000192 3300025258 Bacteria 83041
177 Ga0209129_1001057 3300025258 Bacteria 16254
178 Ga0209129_1001331 3300025258 Bacteria 13958
179 Ga0209129_1001810 3300025258 Bacteria 11355
180 Ga0209129_1002698 3300025258 Bacteria 8341
181 Ga0209129_1006102 3300025258 Bacteria 4021
182 Ga0209233_1000037 3300025261 Bacteria 554620
183 Ga0209233_1000071 3300025261 Bacteria 363290
184 Ga0209233_1000234 3300025261 Bacteria 95145
185 Ga0209565_1042157 3300025263 Bacteria 847
186 Ga0209673_1000024 3300025273 Bacteria 409632
187 Ga0209673_1000063 3300025273 Bacteria 256709
188 Ga0209673_1000677 3300025273 Bacteria 49184
189 Ga0209673_1002544 3300025273 Bacteria 12454
190 Ga0209673_1003382 3300025273 Bacteria 9488
191 Ga0209673_1003971 3300025273 Bacteria 8246
192 Ga0209673_1005862 3300025273 Bacteria 6079
193 Ga0209673_1008183 3300025273 Bacteria 4696
194 Ga0209130_1000002 3300025284 Bacteria 722648
195 Ga0209130_1000005 3300025284 Bacteria 599620
196 Ga0209130_1000028 3300025284 Bacteria 325668
197 Ga0209130_1003346 3300025284 Bacteria 6893
198 Ga0209130_1017279 3300025284 Bacteria 1723
199 Ga0209130_1041260 3300025284 Bacteria 889
200 Ga0209676_1009525 3300025292 Bacteria 4180
201 Ga0209676_1016493 3300025292 Bacteria 2662
202 Ga0209676_1095137 3300025292 Bacteria 646
203 Ga0209025_1000024 3300025294 Bacteria 528324
204 Ga0209025_1000037 3300025294 Bacteria 383429
205 Ga0209025_1000060 3300025294 Bacteria 305017
206 Ga0209025_1000105 3300025294 Bacteria 224157
207 Ga0209025_1000235 3300025294 Bacteria 129981
208 Ga0209025_1000748 3300025294 Bacteria 54646
209 Ga0209025_1015658 3300025294 Bacteria 4551
210 Ga0209025_1023271 3300025294 Bacteria 3245
211 Ga0209025_1027930 3300025294 Bacteria 2780
212 Ga0209025_1030347 3300025294 Bacteria 2590
213 Ga0209025_1136227 3300025294 Bacteria 704
214 Ga0209564_1000138 3300025295 Bacteria 181512
215 Ga0209564_1000217 3300025295 Bacteria 131090
216 Ga0209564_1000746 3300025295 Bacteria 46142
217 Ga0209564_1001016 3300025295 Bacteria 34616
218 Ga0209564_1001885 3300025295 Bacteria 18863
219 Ga0209564_1059020 3300025295 Bacteria 873
220 Ga0209758_1000150 3300025297 Bacteria 163494
221 Ga0209758_1000170 3300025297 Bacteria 149476
222 Ga0209758_1000911 3300025297 Bacteria 40057
223 Ga0209758_1003440 3300025297 Bacteria 14403
224 Ga0209758_1009125 3300025297 Bacteria 6247
225 Ga0209758_1013864 3300025297 Bacteria 4347
226 Ga0209758_1015231 3300025297 Bacteria 4003
227 Ga0209758_1022005 3300025297 Bacteria 2944
228 Ga0209758_1031702 3300025297 Bacteria 2163
229 Ga0209050_1002722 3300025298 Bacteria 14314
230 Ga0209050_1004886 3300025298 Bacteria 8780
231 Ga0209050_1045439 3300025298 Bacteria 1164
232 Ga0209256_1000027 3300025299 Bacteria 423283
233 Ga0209256_1000814 3300025299 Bacteria 39865
234 Ga0209256_1000911 3300025299 Bacteria 36227
235 Ga0209256_1002182 3300025299 Bacteria 16805
236 Ga0209256_1003078 3300025299 Bacteria 12242
237 Ga0209256_1012347 3300025299 Bacteria 3288
238 Ga0209256_1034153 3300025299 Bacteria 1358
239 Ga0207426_1000012 3300025302 Bacteria 730942
240 Ga0207426_1000013 3300025302 Bacteria 721897
241 Ga0207426_1000015 3300025302 Bacteria 599316
242 Ga0207426_1000070 3300025302 Bacteria 331559
243 Ga0207426_1001610 3300025302 Bacteria 17908
244 Ga0209051_1000197 3300025303 Bacteria 106822
245 Ga0209051_1001528 3300025303 Bacteria 19270
246 Ga0209051_1002357 3300025303 Bacteria 13666
247 Ga0209051_1010103 3300025303 Bacteria 4801
248 Ga0209051_1015389 3300025303 Bacteria 3519
249 Ga0209051_1019603 3300025303 Bacteria 2944
250 Ga0209051_1021337 3300025303 Bacteria 2761
251 Ga0209257_1000940 3300025304 Bacteria 40225
252 Ga0209257_1005057 3300025304 Bacteria 9578
253 Ga0209257_1021606 3300025304 Bacteria 2331
254 Ga0207656_10237032 3300025321 Bacteria 891
255 Ga0207696_1088220 3300025711 Bacteria 851
256 Ga0207713_1098576 3300025735 Bacteria 1013
257 Ga0207680_10215359 3300025903 Bacteria 1315
258 Ga0207695_10000036 3300025913 Bacteria 477897
259 Ga0207671_10000354 3300025914 Bacteria 66092
260 Ga0207681_10745221 3300025923 Bacteria 816
261 Ga0207650_10001599 3300025925 Bacteria 16169
262 Ga0207644_10177900 3300025931 Bacteria 1665
263 Ga0207709_10158489 3300025935 Bacteria 1576
264 Ga0207709_10169119 3300025935 Bacteria 1532
265 Ga0207668_10016889 3300025972 Bacteria 4566
266 Ga0207668_11064327 3300025972 Bacteria 724
267 Ga0207658_10159063 3300025986 Bacteria 1850
268 Ga0207658_10581981 3300025986 Bacteria 1004
269 Ga0207639_11001127 3300026041 Bacteria 783
270 Ga0207678_10211369 3300026067 Bacteria 1660
271 Ga0207702_10069457 3300026078 Bacteria 3029
272 Ga0209281_1000043 3300027111 Bacteria 341543
273 Ga0209281_1000134 3300027111 Bacteria 185406
274 Ga0209281_1000319 3300027111 Bacteria 84764
275 Ga0209371_1000009 3300027312 Bacteria 963030
276 Ga0209371_1000989 3300027312 Bacteria 21873
277 Ga0209282_1000029 3300027666 Bacteria 157883
278 Ga0209813_10004005 3300027866 Bacteria 3490
279 Ga0209813_10139579 3300027866 Bacteria 859
280 Ga0268266_10024437 3300028379 Bacteria 5139
281 Ga0268266_10084496 3300028379 Bacteria 2772
282 Ga0268266_10197692 3300028379 Bacteria 1839
283 Ga0307515_10004718 3300028794 Bacteria 27930
284 Ga0307515_10019713 3300028794 Bacteria 12108
285 Ga0268256_1000010 3300030500 Bacteria 963034
286 Ga0268256_1000953 3300030500 Bacteria 19750
287 Ga0316182_1363077 3300030745 Bacteria 1348
288 Ga0307408_100346805 3300031548 Bacteria 1259
289 Ga0307408_100363551 3300031548 Bacteria 1232
290 Ga0307408_100576674 3300031548 Bacteria 996
291 Ga0307408_101108487 3300031548 Bacteria 734
292 Ga0307405_10000625 3300031731 Bacteria 13601
293 Ga0307405_10276857 3300031731 Bacteria 1261
294 Ga0307405_10866366 3300031731 Bacteria 762
295 Ga0307410_10211655 3300031852 Bacteria 1486
296 Ga0307406_10002131 3300031901 Bacteria 10773
297 Ga0307406_10196256 3300031901 Bacteria 1482
298 Ga0307412_10001093 3300031911 Bacteria 15531
299 Ga0307412_10218587 3300031911 Bacteria 1459
300 Ga0315914_1000021 3300031967 Bacteria 119592
301 Ga0307416_101600062 3300032002 Bacteria 757
302 Ga0315913_1000014 3300033430 Bacteria 120114
303 Ga0315915_1000003 3300033464 Bacteria 407996
304 Ga0373946_0323485 3300035171 Bacteria 767
305 Ga0439436_0004715 3300041404 Bacteria 4184
306 Ga0439439_0028630 3300041406 Bacteria 1412
307 Ga0439465_0003635 3300041413 Bacteria 5028
308 Ga0439465_0009943 3300041413 Bacteria 2995
309 Ga0439465_0090846 3300041413 Bacteria 1044
310 Ga0451787_099691 3300041441 Bacteria 1210
311 Ga0451795_1357312 3300041456 Bacteria 1286
312 Ga0451798_0293113 3300041458 Bacteria 1992
313 Ga0451833_0531636 3300041491 Bacteria 1364
314 Ga0451835_0748514 3300041492 Bacteria 1556
315 Ga0451837_0636364 3300041494 Bacteria 1594
316 Ga0451837_0733956 3300041494 Bacteria 1390
317 Ga0451839_1484877 3300041496 Bacteria 1322
318 Ga0451841_0020640 3300041498 Bacteria 4043
319 Ga0451841_1015729 3300041498 Bacteria 1255
320 Ga0451841_1026053 3300041498 Bacteria 2003
321 Ga0451845_0073539 3300041501 Bacteria 1559
322 Ga0451849_1033839 3300041505 Bacteria 674
323 Ga0451851_1300213 3300041507 Bacteria 2060
324 Ga0451843_1430945 3300041509 Bacteria 926
325 Ga0451855_0411571 3300041511 Bacteria 1428
326 Ga0451855_1685201 3300041511 Bacteria 680
327 Ga0451853_2285167 3300041512 Bacteria 2513
328 Ga0451853_2951466 3300041512 Bacteria 1231
329 Ga0439431_0081136 3300041997 Bacteria 875
330 Ga0439449_0050715 3300042007 Bacteria 1535
331 Ga0439462_0028235 3300042015 Bacteria 1483
332 Ga0439462_0036385 3300042015 Bacteria 1310
333 Ga0466965_0104356 3300044683 Bacteria 1452
334 Ga0466963_0005366 3300044694 Bacteria 7501
335 Ga0466968_0068276 3300044735 Bacteria 1543
336 Ga0466968_0218562 3300044735 Bacteria 897
337 Ga0466970_0005392 3300044765 Bacteria 6343
338 Ga0466967_0344732 3300045976 Bacteria 1441
339 Ga0495617_136005 3300046452 Bacteria 786
340 Ga0495627_000976 3300046453 Bacteria 19517
341 Ga0495590_0137180 3300046457 Bacteria 882
342 Ga0495590_0144343 3300046457 Bacteria 860
343 Ga0495638_0000467 3300046460 Bacteria 48587
344 Ga0495638_0143609 3300046460 Bacteria 1390
345 Ga0495650_0105191 3300046471 Bacteria 1055
346 Ga0495605_0009076 3300046474 Bacteria 5598
347 Ga0495605_0081112 3300046474 Bacteria 1517
348 Ga0495662_0134855 3300046476 Bacteria 1214
349 Ga0495584_0164455 3300046491 Bacteria 1128
350 Ga0495585_0033364 3300046492 Bacteria 2914
351 Ga0495585_0034650 3300046492 Bacteria 2854
352 Ga0495596_0105702 3300046500 Bacteria 1093
353 Ga0495607_0049308 3300046501 Bacteria 2456
354 Ga0495607_0096366 3300046501 Bacteria 1593
355 Ga0495583_0011761 3300046506 Bacteria 5007
356 Ga0495583_0036746 3300046506 Bacteria 2327
357 Ga0495583_0043764 3300046506 Bacteria 2083
358 Ga0495606_0001911 3300046507 Bacteria 25953
359 Ga0495606_0012052 3300046507 Bacteria 6977
360 Ga0495606_0111411 3300046507 Bacteria 1650
361 Ga0495610_0002588 3300046512 Bacteria 15003
362 Ga0495610_0110716 3300046512 Bacteria 1217
363 Ga0495610_0118611 3300046512 Bacteria 1162
364 Ga0495616_0068866 3300046513 Bacteria 1717
365 Ga0495620_0110525 3300046515 Bacteria 1089
366 Ga0495631_0005728 3300046518 Bacteria 6479
367 Ga0495632_0011941 3300046519 Bacteria 5039
368 Ga0495632_0110687 3300046519 Bacteria 1289
369 Ga0495643_0027564 3300046522 Bacteria 3191
370 Ga0495643_0058364 3300046522 Bacteria 2054
371 Ga0495643_0135733 3300046522 Bacteria 1231
372 Ga0495643_0206558 3300046522 Bacteria 940
373 Ga0495643_0272797 3300046522 Bacteria 781
374 Ga0495648_0086268 3300046524 Bacteria 1771
375 Ga0495648_0158041 3300046524 Bacteria 1175
376 Ga0495648_0211278 3300046524 Bacteria 964
377 Ga0495663_0066553 3300046525 Bacteria 1141
378 Ga0495652_0384774 3300046529 Bacteria 997
379 Ga0495654_0000070 3300046530 Bacteria 117357
380 Ga0495587_0025222 3300046536 Bacteria 3634
381 Ga0495609_0100554 3300046538 Bacteria 1253
382 Ga0495622_0002942 3300046557 Bacteria 8115
383 Ga0495633_0029327 3300046558 Bacteria 2677
384 Ga0495633_0104809 3300046558 Bacteria 1312
385 Ga0495668_0049952 3300046616 Bacteria 2319
386 Ga0495668_0091137 3300046616 Bacteria 1670
387 Ga0495611_0034043 3300046648 Bacteria 2250
388 Ga0495611_0217061 3300046648 Bacteria 890
389 Ga0495625_0001943 3300046660 Bacteria 23383
390 Ga0495661_0000064 3300046665 Bacteria 129689
391 Ga0495661_0117895 3300046665 Bacteria 1470
392 Ga0495588_0005508 3300046674 Bacteria 5638
393 Ga0495588_0095951 3300046674 Bacteria 1555
394 Ga0495671_0013457 3300046692 Bacteria 4431
395 Ga0495671_0136080 3300046692 Bacteria 1198
396 Ga0495649_0027242 3300046694 Bacteria 3172
397 Ga0495649_0049841 3300046694 Bacteria 2274
398 Ga0495600_0051042 3300046809 Bacteria 2699
399 Ga0495660_0053577 3300046810 Bacteria 2189
400 Ga0495604_0147382 3300047317 Bacteria 1676
401 Ga0495636_0048773 3300047318 Bacteria 1770
402 Ga0495636_0187038 3300047318 Bacteria 942
403 Ga0495674_0166307 3300047319 Bacteria 1843
404 Ga0495672_0014128 3300047320 Bacteria 5478
405 Ga0495676_0249972 3300047321 Bacteria 1210
406 Ga0495683_0101732 3300047323 Bacteria 1381
407 Ga0495687_061117 3300047443 Bacteria 1551
408 Ga0495687_131849 3300047443 Bacteria 883
409 Ga0495679_077824 3300047446 Bacteria 946
410 Ga0495673_0184567 3300047469 Bacteria 788
411 Ga0495673_0211617 3300047469 Bacteria 721
412 Ga0495681_0001384 3300047470 Bacteria 18311
413 Ga0495686_0017458 3300047472 Bacteria 4835
414 Ga0495686_0089052 3300047472 Bacteria 1875
415 Ga0495686_0106715 3300047472 Bacteria 1684
416 Ga0495626_0058722 3300048091 Bacteria 1757
417 Ga0496100_0029793 3300048903 Bacteria 3379
418 Ga0496100_0138678 3300048903 Bacteria 1721
419 Ga0496101_0174857 3300048904 Bacteria 1651
420 Ga0496102_0017302 3300048905 Bacteria 6313
421 Ga0496103_0590241 3300048906 Bacteria 708
422 Ga0496107_0340913 3300048910 Bacteria 1115
423 Ga0496110_0225195 3300048913 Bacteria 1705
424 Ga0496110_0354338 3300048913 Bacteria 1337
425 Ga0496110_0371169 3300048913 Bacteria 1304
426 Ga0496111_0034194 3300048914 Bacteria 3628
427 Ga0496113_0072315 3300048916 Bacteria 2624
428 Ga0496114_0070347 3300048917 Bacteria 2939
429 Ga0496116_0000240 3300048919 Bacteria 100232
430 Ga0496116_0027132 3300048919 Bacteria 4173
431 Ga0496116_0039088 3300048919 Bacteria 3284
432 Ga0496116_0062589 3300048919 Bacteria 2402
433 Ga0496116_0068279 3300048919 Bacteria 2265
434 Ga0496116_0153686 3300048919 Bacteria 1274
435 Ga0496117_0000002 3300048920 Bacteria 2483758
436 Ga0496117_0001724 3300048920 Bacteria 30250
437 Ga0496117_0012948 3300048920 Bacteria 7308
438 Ga0496117_0014076 3300048920 Bacteria 6919
439 Ga0496117_0042458 3300048920 Bacteria 3318
440 Ga0496117_0154120 3300048920 Bacteria 1355
441 Ga0496117_0205505 3300048920 Bacteria 1109
442 Ga0496118_0000651 3300048921 Bacteria 56681
443 Ga0496118_0011235 3300048921 Bacteria 8766
444 Ga0496118_0014538 3300048921 Bacteria 7361
445 Ga0496118_0024579 3300048921 Bacteria 5195
446 Ga0496118_0033045 3300048921 Bacteria 4252
447 Ga0496118_0161586 3300048921 Bacteria 1384
448 Ga0496118_0242360 3300048921 Bacteria 1031
449 Ga0496119_0011730 3300048922 Bacteria 7210
450 Ga0496119_0052097 3300048922 Bacteria 2509
451 Ga0496119_0057217 3300048922 Bacteria 2358
452 Ga0496119_0070369 3300048922 Bacteria 2052
453 Ga0496119_0087711 3300048922 Bacteria 1775
454 Ga0496120_0000034 3300048923 Bacteria 215228
455 Ga0496120_0010536 3300048923 Bacteria 6439
456 Ga0496120_0013587 3300048923 Bacteria 5471
457 Ga0496121_0000220 3300048924 Bacteria 123930
458 Ga0496121_0003996 3300048924 Bacteria 20341
459 Ga0496121_0025639 3300048924 Bacteria 5588
460 Ga0496121_0034146 3300048924 Bacteria 4583
461 Ga0496121_0038875 3300048924 Bacteria 4203
462 Ga0496121_0042511 3300048924 Bacteria 3950
463 Ga0496121_0083173 3300048924 Bacteria 2528
464 Ga0496122_0000001 3300048925 Bacteria 1827766
465 Ga0496122_0000309 3300048925 Bacteria 107844
466 Ga0496122_0003816 3300048925 Bacteria 19395
467 Ga0496122_0045966 3300048925 Bacteria 3386
468 Ga0496122_0068498 3300048925 Bacteria 2547
469 Ga0496122_0069684 3300048925 Bacteria 2517
470 Ga0496122_0091517 3300048925 Bacteria 2071
471 Ga0496122_0111991 3300048925 Bacteria 1788
472 Ga0496123_0000001 3300048926 Bacteria 1831497
473 Ga0496123_0000396 3300048926 Bacteria 81106
474 Ga0496123_0009540 3300048926 Bacteria 8727
475 Ga0496123_0047278 3300048926 Bacteria 2909
476 Ga0496123_0054435 3300048926 Bacteria 2634
477 Ga0496123_0055175 3300048926 Bacteria 2609
478 Ga0496123_0059438 3300048926 Bacteria 2471
479 Ga0496123_0357709 3300048926 Bacteria 677
480 Ga0496124_0000083 3300048927 Bacteria 207798
481 Ga0496124_0000532 3300048927 Bacteria 64777
482 Ga0496124_0009307 3300048927 Bacteria 10124
483 Ga0496124_0010687 3300048927 Bacteria 9259
484 Ga0496124_0062545 3300048927 Bacteria 3114
485 Ga0496124_0070190 3300048927 Bacteria 2906
486 Ga0496124_0077886 3300048927 Bacteria 2733
487 Ga0496124_0086224 3300048927 Bacteria 2570
488 Ga0496124_0125351 3300048927 Bacteria 2047
489 Ga0496124_0150029 3300048927 Bacteria 1830
490 Ga0496124_0231723 3300048927 Bacteria 1380
491 Ga0496124_0256731 3300048927 Bacteria 1289
492 Ga0496124_0270291 3300048927 Bacteria 1245
493 Ga0496125_0000001 3300048928 Bacteria 1766138
494 Ga0496125_0022345 3300048928 Bacteria 5877
495 Ga0496125_0024406 3300048928 Bacteria 5561
496 Ga0496125_0026537 3300048928 Bacteria 5274
497 Ga0496125_0047131 3300048928 Bacteria 3608
498 Ga0496125_0104487 3300048928 Bacteria 2074
499 Ga0496126_0000322 3300048929 Bacteria 102330
500 Ga0496126_0000923 3300048929 Bacteria 50791
501 Ga0496126_0084226 3300048929 Bacteria 2804
502 Ga0496126_0147603 3300048929 Bacteria 2018
503 Ga0496126_0160177 3300048929 Bacteria 1923
504 Ga0496126_0263804 3300048929 Bacteria 1431
505 Ga0496126_0476710 3300048929 Bacteria 1000
506 Ga0495678_016827 3300049459 Bacteria 3330
507 Ga0501034_0141013 3300049571 Bacteria 2390
508 Ga0501034_0329515 3300049571 Bacteria 1458
509 Ga0501034_0514855 3300049571 Bacteria 1109
510 Ga0501037_0222720 3300049573 Bacteria 1327
511 Ga0501038_0204010 3300049574 Bacteria 1585
512 Ga0501038_0581849 3300049574 Bacteria 849
513 Ga0501043_0073173 3300049579 Bacteria 2692
514 Ga0501047_0046402 3300049581 Bacteria 4199
515 Ga0501068_0652556 3300049584 Bacteria 687
516 Ga0501238_024457 3300049671 Bacteria 863
517 Ga0501083_0046288 3300049744 Bacteria 2941
518 Ga0501083_0123116 3300049744 Bacteria 1701
519 Ga0501276_019614 3300049773 Bacteria 638
520 Ga0501044_0673971 3300049823 Bacteria 921
521 nmdc:mga03683_20296_c1 3300050489 Bacteria 2548
522 nmdc:mga03683_67085_c1 3300050489 Bacteria 1527
523 nmdc:mga00v17_100_c1 3300050491 Bacteria 50846
524 nmdc:mga00v17_2996_c1 3300050491 Bacteria 8679
525 nmdc:mga00v17_7106_c1 3300050491 Bacteria 5963
526 nmdc:mga0yw44_42223_c1 3300050492 Bacteria 2718
527 nmdc:mga0yw44_633763_c1 3300050492 Bacteria 726
528 nmdc:mga0yw44_69588_c1 3300050492 Bacteria 2180
529 nmdc:mga0yw44_7601_c1 3300050492 Bacteria 5344
530 nmdc:mga0k408_41179_c1 3300050493 Bacteria 2659
531 nmdc:mga0k408_494227_c1 3300050493 Bacteria 725
532 nmdc:mga0k408_77511_c1 3300050493 Bacteria 1944
533 nmdc:mga06z11_6107_c1 3300050494 Bacteria 4875
534 nmdc:mga04h51_39039_c1 3300050495 Bacteria 1541
535 nmdc:mga07m45_1262_c1 3300050496 Bacteria 11509
536 nmdc:mga07m45_73203_c1 3300050496 Bacteria 1951
537 nmdc:mga0sz30_1486_c1 3300050516 Bacteria 8356
538 nmdc:mga0sz30_70_c1 3300050516 Bacteria 39892
539 Ga0495601_0095472 3300053077 Bacteria 1917
540 Ga0500610_0017984 3300053079 Bacteria 3406
541 Ga0500578_0353916 3300053086 Bacteria 857
542 Ga0500643_059145 3300053087 Bacteria 1079
543 Ga0500651_0210777 3300053093 Bacteria 1143
544 Ga0500556_0130664 3300053104 Bacteria 984
545 Ga0500569_044792 3300053109 Bacteria 1311
546 Ga0500594_0002982 3300053118 Bacteria 3702
547 Ga0500594_0012681 3300053118 Bacteria 1992
548 Ga0500618_000565 3300053125 Bacteria 22969
549 Ga0500618_000572 3300053125 Bacteria 22765
550 Ga0500618_028701 3300053125 Bacteria 1315
551 Ga0500652_286741 3300053131 Bacteria 641
552 Ga0500655_022967 3300053133 Bacteria 1176
553 Ga0500658_0001181 3300053134 Bacteria 10641
554 Ga0500559_0002567 3300053136 Bacteria 9306
555 Ga0500561_0000112 3300053137 Bacteria 15641
556 Ga0500568_0008395 3300053139 Bacteria 4978
557 Ga0500568_0015345 3300053139 Bacteria 3431
558 Ga0500568_0108758 3300053139 Bacteria 1037
559 Ga0500573_0384446 3300053140 Bacteria 670
560 Ga0500588_0004803 3300053146 Bacteria 2952
561 Ga0500590_008471 3300053148 Bacteria 5132
562 Ga0500616_0001070 3300053153 Bacteria 28660
563 Ga0500622_0001430 3300053156 Bacteria 19148
564 Ga0500634_0017980 3300053161 Bacteria 3790
565 Ga0500636_0000022 3300053177 Bacteria 93090
566 Ga0587098_068364 3300059604 Bacteria 571
567 Ga0501082_0073053 3300060353 Bacteria 2954
568 2509108958 2508501122 Bacteria 6292184
569 2509375320 2509276019 Bacteria 6802256
570 2509388792 2509276021 Bacteria 7634384
571 2509444379 2509276033 Bacteria 7180565
572 2510307255 2510065057 Bacteria 6649661
573 2510897363 2510461076 Bacteria 8618824
574 2511134605 2510917022 Bacteria 6504556
575 2511171497 2510917026 Bacteria 7046020
576 2511181322 2510917028 Bacteria 6185411
577 2511499003 2511231052 Bacteria 6974333
578 2512531601 2512047086 Bacteria 6850303
579 2512973045 2512875026 Bacteria 6861065
580 2513570269 2513237084 Bacteria 7231967
581 2513574749 2513237085 Bacteria 7695351
582 2513586138 2513237086 Bacteria 7265287
583 2513595314 2513237088 Bacteria 6927906
584 2513604373 2513237089 Bacteria 6553624
585 2513616140 2513237091 Bacteria 6900273
586 2513633997 2513237093 Bacteria 7545552
587 2513707369 2513237103 Bacteria 7647401
588 2513866591 2513237138 Bacteria 7368160
589 2513882707 2513237140 Bacteria 7076289
590 2513906507 2513237143 Bacteria 6664116
591 2513911304 2513237144 Bacteria 7530820
592 2513924497 2513237146 Bacteria 7166346
593 2513983107 2513237156 Bacteria 6402557
594 2513996442 2513237159 Bacteria 6810126
595 2514007073 2513237160 Bacteria 6650282
596 2514022130 2513237162 Bacteria 7468464
597 2515109989 2515075009 Bacteria 7288508
598 2515607422 2515154107 Bacteria 6795637
599 2515633982 2515154113 Bacteria 7807172
600 2515641198 2515154114 Bacteria 7848616
601 2515659795 2515154116 Bacteria 7552979
602 2515740936 2515154134 Bacteria 7220242
603 2516204628 2516143018 Bacteria 6951533
604 2516895278 2516653046 Bacteria 6989037
605 2517038684 2516653077 Bacteria 7555578
606 2517078932 2516653085 Bacteria 7346596
607 2517097735 2517093000 Bacteria 7412387
608 2517409154 2517287029 Bacteria 6905599
609 2517568337 2517487022 Bacteria 7227575
610 2524450839 2524023207 Bacteria 6813453
611 2524458104 2524023209 Bacteria 6679728
612 2530648150 2529292951 Bacteria 6916614
613 2535514787 2534681796 Bacteria 7146037
614 2537873371 2537561587 Bacteria 5425293
615 2551679952 2551306084 Bacteria 8942552
616 2551683693 2551306085 Bacteria 7347181
617 2551694868 2551306086 Bacteria 6843938
618 2551698941 2551306087 Bacteria 7351905
619 2551709720 2551306089 Bacteria 7162724
620 2551716234 2551306090 Bacteria 7953713
621 2551724649 2551306091 Bacteria 7086830
622 2551735449 2551306092 Bacteria 6992595
623 2551741203 2551306093 Bacteria 7064773
624 2554246371 2554235003 Bacteria 5877155
625 2558866409 2558860100 Bacteria 8458965
626 2559293593 2558860242 Bacteria 5568029
627 2585201070 2582581294 Bacteria 6626667
628 2585223468 2582581298 Bacteria 7315509
629 2585229531 2582581299 Bacteria 6518058
630 2585256200 2582581304 Bacteria 5831370
631 2585264939 2582581306 Bacteria 6450535
632 2585273686 2582581307 Bacteria 6597605
633 2585279989 2582581308 Bacteria 7413247
634 2585330398 2582581316 Bacteria 7774528
635 2585386003 2582581865 Bacteria 6644329
636 2585398873 2582581867 Bacteria 7184437
637 2585523735 2585427526 Bacteria 7258840
638 2585533757 2585427527 Bacteria 7273426
639 2585541868 2585427528 Bacteria 6842387
640 2585545936 2585427529 Bacteria 7395659
641 2585553350 2585427530 Bacteria 7383882
642 2585559860 2585427531 Bacteria 6992870
643 2585819007 2585427590 Bacteria 6824633
644 2585840484 2585427593 Bacteria 7141551
645 2585843923 2585427594 Bacteria 6180594
646 2585900538 2585427608 Bacteria 6544331
647 2585905962 2585427609 Bacteria 6667127
648 2585994120 2585427633 Bacteria 6413184
649 2587978923 2585428125 Bacteria 6662905
650 2599419540 2599185170 Bacteria 7295545
651 2599605834 2599185210 Bacteria 5624189
652 2599718959 2599185236 Bacteria 6875203
653 2600195009 2599185352 Bacteria 7228948
654 2600376608 2600254933 Bacteria 4750527
655 2601609385 2600255279 Bacteria 5605316
656 2601746160 2600255308 Bacteria 5611129
657 2616293748 2615840624 Bacteria 6557588
658 2616309373 2615840626 Bacteria 7921970
659 2616556299 2615840698 Bacteria 7319877
660 2617380507 2617270742 Bacteria 6808054
661 2643805983 2643221557 Bacteria 7184309
662 2643812662 2643221558 Bacteria 5460675
663 2643857390 2643221568 Bacteria 5187270
664 2643920755 2643221582 Bacteria 5804683
665 2644004621 2643221599 Bacteria 6292121
666 2644066159 2643221610 Bacteria 7480339
667 2644103597 2643221618 Bacteria 7717186
668 2644144476 2643221626 Bacteria 8069654
669 2644196870 2643221634 Bacteria 6705461
670 2644207130 2643221637 Bacteria 5345260
671 2644237470 2643221643 Bacteria 5749658
672 2644306527 2643221655 Bacteria 7722067
673 2644330717 2643221659 Bacteria 7890716
674 2644377243 2643221668 Bacteria 7306521
675 2644417490 2643221675 Bacteria 7473456
676 2644450886 2643221680 Bacteria 7473610
677 2644495548 2643221688 Bacteria 5260751
678 2644519440 2643221693 Bacteria 5513853
679 2644542478 2643221698 Bacteria 7756764
680 2644612138 2643221712 Bacteria 7729434
681 2644650778 2643221718 Bacteria 5345506
682 2644671667 2643221723 Bacteria 7095460
683 2644692691 2643221726 Bacteria 7455827
684 2657682932 2657244999 Bacteria 5946535
685 2671113919 2667528174 Bacteria 6435400
686 2692317582 2690316117 Bacteria 6800650
687 2719179223 2718217882 Bacteria 6556348
688 2719383791 2718217927 Bacteria 6972593
689 2719663586 2718217997 Bacteria 6740740
690 2719729893 2718218009 Bacteria 6478651
691 2720490005 2718218199 Bacteria 6740745
692 2720611382 2718218232 Bacteria 6720332
693 2720618231 2718218233 Bacteria 6662049
694 2720629634 2718218235 Bacteria 6630699
695 2720773330 2718218269 Bacteria 6906114
696 2721145316 2718218363 Bacteria 6524337
697 2721156831 2718218365 Bacteria 6274507
698 2721162211 2718218366 Bacteria 6425255
699 2721397549 2718218423 Bacteria 6438183
700 2722838381 2721755514 Bacteria 6424414
701 2723025009 2721755556 Bacteria 6745503
702 2723558587 2721755684 Bacteria 6859907
703 2723565156 2721755685 Bacteria 6704835
704 2724036359 2721755809 Bacteria 6438790
705 2724042649 2721755810 Bacteria 6479005
706 2724087937 2721755819 Bacteria 6906405
707 2724102421 2721755822 Bacteria 6726041
708 2724108325 2721755823 Bacteria 6752556
709 2725950616 2724679232 Bacteria 7646494
710 2730105945 2728369352 Bacteria 6745171
711 2730162460 2728369365 Bacteria 6555560
712 2730296463 2728369397 Bacteria 6274511
713 2738804567 2738541293 Bacteria 7065685
714 2738948696 2738541317 Bacteria 5340176
715 2739036907 2738541333 Bacteria 7106503
716 2753459783 2751185821 Bacteria 6189929
717 2766063381 2765235942 Bacteria 7445910
718 2776911702 2775507049 Bacteria 6284736
719 2778177064 2775507266 Bacteria 7392367
720 2792583190 2791355082 Bacteria 5973319
721 2792621131 2791355091 Bacteria 6135441
722 2792625345 2791355092 Bacteria 6248105
723 2792637775 2791355094 Bacteria 7011481
724 2793282897 2791355253 Bacteria 5171699
725 2793296816 2791355256 Bacteria 6798008
726 2793314015 2791355259 Bacteria 7254731
727 2793322300 2791355260 Bacteria 6598818
728 2793328994 2791355261 Bacteria 6661293
729 2793336260 2791355262 Bacteria 6774204
730 2793343906 2791355263 Bacteria 6872478
731 2793349465 2791355264 Bacteria 6429314
732 2793352680 2791355265 Bacteria 6539969
733 2793358308 2791355266 Bacteria 7116587
734 2793365539 2791355267 Bacteria 7222458
735 2802718612 2802428858 Bacteria 6636079
736 2802724293 2802428859 Bacteria 6667919
737 2802730045 2802428860 Bacteria 6525526
738 2802737388 2802428861 Bacteria 6534206
739 2802742304 2802428862 Bacteria 6633353
740 2802748987 2802428863 Bacteria 6410669
741 2804750650 2802429268 Bacteria 6094027
742 2805928163 2802429605 Bacteria 6875453
743 2805935514 2802429606 Bacteria 6346811
744 2806046681 2802429633 Bacteria 7341974
745 2806051442 2802429634 Bacteria 7083200
746 2806059431 2802429635 Bacteria 7650140
747 2806066604 2802429636 Bacteria 7597525
748 2806073662 2802429637 Bacteria 7067217
749 2808986636 2808606387 Bacteria 5697198
750 2819556708 2818991439 Bacteria 6907412
751 2819608660 2818991448 Bacteria 6772224
752 2819640770 2818991453 Bacteria 7181617
753 2819685978 2818991461 Bacteria 7026071
754 2821123384 2821123053 Bacteria 7836056
755 2838020611 2838016132 Bacteria 6577831
756 2838026417 2838022645 Bacteria 6494267
757 2838029549 2838029111 Bacteria 6603031
758 2838039925 2838035591 Bacteria 7166484
759 2838048474 2838042994 Bacteria 6046894
760 2838053119 2838048938 Bacteria 6044578
761 2838065867 2838061910 Bacteria 6794874
762 2838070735 2838068647 Bacteria 6208656
763 2838075047 2838074704 Bacteria 6785777
764 2838664209 2838661181 Bacteria 7385261
765 2838674357 2838668709 Bacteria 6671819
766 2838677443 2838675328 Bacteria 4909118
767 2838680232 2838680041 Bacteria 6545511
768 2838689636 2838686498 Bacteria 7807632
769 2838695737 2838694306 Bacteria 6853137
770 2838706733 2838701080 Bacteria 6669771
771 2838709112 2838707686 Bacteria 6619912
772 2838716331 2838714209 Bacteria 5525906
773 2838719869 2838719591 Bacteria 5523910
774 2838727083 2838724970 Bacteria 4908691
775 2838731669 2838729681 Bacteria 7400765
776 2838739593 2838736955 Bacteria 5760694
777 2838744610 2838742623 Bacteria 7396178
778 2841844283 2841840854 Bacteria 5761912
779 2841846800 2841846520 Bacteria 5345850
780 2841853151 2841851746 Bacteria 7532261
781 2841860671 2841859092 Bacteria 5436171
782 2841868908 2841864319 Bacteria 6742987
783 2842079652 2842077413 Bacteria 6508645
784 2842112531 2842110456 Bacteria 7656360
785 2842120270 2842118031 Bacteria 7033875
786 2842127171 2842124991 Bacteria 5346824
787 2842132336 2842130223 Bacteria 4909145
788 2842144004 2842140634 Bacteria 5759631
789 2842151386 2842146304 Bacteria 5957337
790 2842152495 2842152218 Bacteria 4908957
791 2842160477 2842156927 Bacteria 6894975
792 2842165543 2842163707 Bacteria 6916235
793 2842172576 2842170452 Bacteria 5525737
794 2842176114 2842175837 Bacteria 4908771
795 2842183857 2842180545 Bacteria 6888678
796 2842189438 2842187318 Bacteria 5524014
797 2842198162 2842192696 Bacteria 6147454
798 2842202178 2842198810 Bacteria 6608673
799 2842211182 2842205361 Bacteria 6340321
800 2842213752 2842211629 Bacteria 5523832
801 2842219208 2842217011 Bacteria 7497767
802 2842224630 2842224351 Bacteria 5524473
803 2842231438 2842229732 Bacteria 7475766
804 2842238523 2842237096 Bacteria 6620661
805 2842246092 2842243621 Bacteria 7421798
806 2842256524 2842250916 Bacteria 6579627
807 2842260470 2842257432 Bacteria 7401195
808 2842268361 2842264693 Bacteria 6472963
809 2842273880 2842271015 Bacteria 7807131
810 2842284635 2842278818 Bacteria 6340002
811 2842286481 2842285085 Bacteria 6011953
812 2842293313 2842291075 Bacteria 7076806
813 2842299712 2842298080 Bacteria 6123127
814 2842308891 2842304105 Bacteria 7023636
815 2842312432 2842311132 Bacteria 6616990
816 2842322010 2842317721 Bacteria 6793725
817 2842344438 2842341865 Bacteria 7003929
818 2842359766 2842357229 Bacteria 6485165
819 2842367480 2842363717 Bacteria 6844742
820 2842370694 2842370503 Bacteria 7038661
821 2842379710 2842377471 Bacteria 7140707
822 2842386781 2842384541 Bacteria 7057858
823 2842401642 2842395702 Bacteria 6780583
824 2842403966 2842402390 Bacteria 6681310
825 2842410331 2842409023 Bacteria 6687331
826 2842416979 2842415677 Bacteria 6596907
827 2842424350 2842422224 Bacteria 6239196
828 2842432333 2842428310 Bacteria 6767288
829 2842438637 2842434925 Bacteria 6502746
830 2842445267 2842441272 Bacteria 6769273
831 2842452853 2842447887 Bacteria 6754142
832 2842466332 2842462802 Bacteria 6588055
833 2842473152 2842469257 Bacteria 6752936
834 2842476021 2842475841 Bacteria 6603183
835 2842486105 2842482326 Bacteria 7212537
836 2842494624 2842489311 Bacteria 6620893
837 2842499916 2842495871 Bacteria 6820686
838 2842503077 2842502639 Bacteria 6604161
839 2842512939 2842509118 Bacteria 6850950
840 2842517456 2842515876 Bacteria 5436280
841 2842521363 2842521101 Bacteria 6569494
842 2842923019 2842922631 Bacteria 5824079
843 2844170129 2844163670 Bacteria 7266046
844 2844456383 2844454524 Bacteria 7952546
845 2847417348 2847417321 Bacteria 6913799
846 2848992133 2848992105 Bacteria 6810864
847 2850079615 2850079185 Bacteria 6848280
848 2852388164 2852387548 Bacteria 8025568
849 2854897960 2854896431 Bacteria 5869725
850 2854919661 2854916844 Bacteria 5725939
851 2855827915 2855825444 Bacteria 6785811
852 2855839672 2855839649 Bacteria 7135830
853 2855875226 2855872281 Bacteria 6964271
854 2857521975 2857516855 Bacteria 7787325
855 2857533666 2857531043 Bacteria 6754041
856 2858803011 2858800743 Bacteria 6603254
857 2891375289 2891373044 Bacteria 5202277
858 2896384757 2896384573 Bacteria 7700774
859 2899794537 2899792073 Bacteria 4926588
860 2899845882 2899845264 Bacteria 5672268
861 2913298259 2913295892 Bacteria 6333755
862 2913311489 2913308742 Bacteria 5350706
863 2915986537 2915980308 Bacteria 6624279
864 2915990393 2915986958 Bacteria 6739310
865 2915997304 2915993759 Bacteria 7016183
866 2916004842 2916000859 Bacteria 6865702
867 2916008245 2916007675 Bacteria 6898660
868 2916021348 2916014648 Bacteria 6946486
869 2916028304 2916021584 Bacteria 6854472
870 2916032766 2916028427 Bacteria 6748433
871 2916038277 2916035215 Bacteria 6755766
872 2916044609 2916041962 Bacteria 6820487
873 2916053566 2916048683 Bacteria 6543552
874 2916057104 2916055098 Bacteria 6758838
875 2916067742 2916061851 Bacteria 6737736
876 2916075207 2916068649 Bacteria 6943657
877 2916077987 2916076590 Bacteria 6596108
878 2919101654 2919100787 Bacteria 7710546
879 2919116535 2919114240 Bacteria 5700270
880 2919166633 2919166419 Bacteria 4952238
881 2919172316 2919171160 Bacteria 6499771
882 2919408537 2919408235 Bacteria 6149349
883 2920763697 2920760137 Bacteria 7427611
884 2920823020 2920822456 Bacteria 6897201
885 2921204081 2921201388 Bacteria 6926299
886 2921214918 2921208531 Bacteria 6745326
887 2921242199 2921237296 Bacteria 6876710
888 2921248508 2921244191 Bacteria 6568419
889 2921252615 2921250672 Bacteria 6677771
890 2921259914 2921257292 Bacteria 6808382
891 2921267381 2921263974 Bacteria 6864552
892 2921284423 2921282425 Bacteria 6826397
893 2921292198 2921289301 Bacteria 7316391
894 2921296966 2921296804 Bacteria 7176999
895 2923556400 2923556063 Bacteria 6793593
896 2924146206 2924144063 Bacteria 6883928
897 2924156359 2924150972 Bacteria 7169444
898 2924164609 2924158325 Bacteria 7188855
899 2924171951 2924165586 Bacteria 7260590
900 2924177157 2924172951 Bacteria 6749356
901 2924184438 2924179722 Bacteria 6843264
902 2924190935 2924186466 Bacteria 6876637
903 2924200224 2924193448 Bacteria 6955718
904 2924202543 2924200457 Bacteria 6757188
905 2924209528 2924207177 Bacteria 6917007
906 2924215888 2924214083 Bacteria 7080103
907 2924227359 2924221636 Bacteria 7113495
908 2924230075 2924228884 Bacteria 6633132
909 2926754557 2926754445 Bacteria 5964435
910 2926761728 2926760298 Bacteria 5505990
911 2929142148 2929138655 Bacteria 5810547
912 2933007142 2933006813 Bacteria 4912075
913 2933015267 2933011516 Bacteria 5439334
914 2933018229 2933016740 Bacteria 6355406
915 2933575335 2933570622 Bacteria 7023390
916 2933588580 2933586486 Bacteria 7667493
917 2933594345 2933594066 Bacteria 5594265
918 2933601539 2933599457 Bacteria 5858799
919 2935896257 2935894831 Bacteria 6620579
920 2935902538 2935901341 Bacteria 7341747
921 2936369300 2936367885 Bacteria 7324495
922 2936377352 2936375103 Bacteria 6652732
923 2936385757 2936381700 Bacteria 7006523
924 2936998591 2936996657 Bacteria 6298727
925 2937006388 2937002841 Bacteria 6934057
926 2937011746 2937009748 Bacteria 6746052
927 2937018452 2937016420 Bacteria 6782579
928 2937023508 2937023124 Bacteria 6815156
929 2937031630 2937029754 Bacteria 6424026
930 2937037686 2937036028 Bacteria 6846469
931 2937045094 2937042894 Bacteria 6741576
932 2937054303 2937049772 Bacteria 6757901
933 2937062388 2937056579 Bacteria 7107896
934 2937066741 2937063883 Bacteria 7199456
935 2937072937 2937071275 Bacteria 6984483
936 2937081681 2937078374 Bacteria 6610289
937 2937089449 2937084907 Bacteria 6618516
938 2937097167 2937091812 Bacteria 6979387
939 2937104585 2937098957 Bacteria 7249374
940 2937108349 2937106411 Bacteria 6947143
941 2937116398 2937113482 Bacteria 6505872
942 2937121937 2937119839 Bacteria 6597547
943 2937129605 2937126314 Bacteria 6771275
944 2941501021 2941499720 Bacteria 7599444
945 2957377843 2957375807 Bacteria 6425588
946 2957384397 2957382221 Bacteria 6737050
947 2957393245 2957388812 Bacteria 6778072
948 2957400750 2957395598 Bacteria 6822399
949 2957403436 2957402308 Bacteria 6741770
950 2957413457 2957408893 Bacteria 6558585
951 2957417368 2957415311 Bacteria 6991633
952 2957429893 2957422303 Bacteria 7172205
953 2957434688 2957430029 Bacteria 7022557
954 2957443317 2957437181 Bacteria 6568994
955 2957446809 2957443900 Bacteria 6869977
956 2957452890 2957450854 Bacteria 6765715
957 2957463837 2957457609 Bacteria 6967680
958 2957467230 2957464669 Bacteria 6568877
959 2957476123 2957471148 Bacteria 6797643
960 2957481209 2957478035 Bacteria 6756658
961 2957486661 2957484790 Bacteria 6703082
962 2957492989 2957491536 Bacteria 6695180
963 2957503093 2957498199 Bacteria 7126688
964 2957510191 2957505466 Bacteria 7253085
965 2960587660 2960584000 Bacteria 6864594
966 2960593324 2960591022 Bacteria 6622873
967 2960600840 2960597568 Bacteria 6550735
968 2960604386 2960603979 Bacteria 6898737
969 2960613767 2960610863 Bacteria 6691244
970 2960620415 2960617483 Bacteria 6727748
971 2960627063 2960624210 Bacteria 6875384
972 2960637110 2960631154 Bacteria 6732508
973 2960642565 2960637947 Bacteria 7296468
974 2960652402 2960645483 Bacteria 7211087
975 2960657618 2960652885 Bacteria 7083688
976 2960660716 2960660292 Bacteria 7041660
977 2960670239 2960667422 Bacteria 6763020
978 2960676817 2960674078 Bacteria 6609048
979 2960684569 2960680706 Bacteria 6624464
980 2960693460 2960687367 Bacteria 6535474
981 2960697435 2960693952 Bacteria 6749742
982 2964613410 2964607997 Bacteria 7101408
983 2964618293 2964615318 Bacteria 6809089
984 2964626550 2964621998 Bacteria 6834995
985 2964634155 2964628898 Bacteria 7083044
986 2964639970 2964636051 Bacteria 7091832
987 2964645026 2964643177 Bacteria 6820887
988 2964650011 2964649959 Bacteria 6675118
989 2964659545 2964656573 Bacteria 7100150
990 2964670283 2964663802 Bacteria 7019362
991 2964676780 2964670856 Bacteria 6851364
992 2964678858 2964678106 Bacteria 6792020
993 2964685282 2964685014 Bacteria 6839111
994 2964696237 2964691889 Bacteria 6802758
995 2964699271 2964698721 Bacteria 6765331
996 2964708231 2964705432 Bacteria 7114648
997 2964712952 2964712639 Bacteria 6695970
998 2964723254 2964719344 Bacteria 7286602
999 2967668482 2967664464 Bacteria 6948836
1000 2967676347 2967671571 Bacteria 7021409
1001 2967682121 2967678726 Bacteria 7264382
1002 2967688085 2967686174 Bacteria 6678622
1003 2967695347 2967693043 Bacteria 6804451
1004 2967701098 2967699805 Bacteria 6854538
1005 2967709890 2967706974 Bacteria 7186053
1006 2967717909 2967714385 Bacteria 7000047
1007 2967723684 2967721400 Bacteria 7073753
1008 2967731095 2967728569 Bacteria 6641507
1009 2967738164 2967735183 Bacteria 6827012
1010 2967748875 2967742019 Bacteria 6794534
1011 2967749531 2967748971 Bacteria 6733771
1012 2967757281 2967755722 Bacteria 6814706
1013 2967768740 2967762386 Bacteria 6923502
1014 2967771344 2967769361 Bacteria 6587838
1015 2967781573 2967775926 Bacteria 6738189
1016 2970023028 2970019648 Bacteria 7072033
1017 2970027363 2970026789 Bacteria 6785236
1018 2970040424 2970033650 Bacteria 7118744
1019 2970046214 2970040964 Bacteria 6731123
1020 2970050901 2970047711 Bacteria 7088379
1021 2970058298 2970054988 Bacteria 6611507
1022 2970066349 2970061556 Bacteria 7099761
1023 2970072489 2970068827 Bacteria 7123112
1024 2970079348 2970076120 Bacteria 6697332
1025 2970088051 2970082768 Bacteria 6183754
1026 2970091714 2970088815 Bacteria 6933825
1027 2970099366 2970095765 Bacteria 6936963
1028 2970106120 2970102677 Bacteria 6812532
1029 2970111578 2970109326 Bacteria 6863976
1030 2970122390 2970116247 Bacteria 6501857
1031 2970126176 2970122695 Bacteria 6625855
1032 2970131264 2970129317 Bacteria 6806560
1033 2970139709 2970136068 Bacteria 7207982
1034 2970146360 2970143518 Bacteria 6446480
1035 2970151915 2970149975 Bacteria 6779706
1036 2970162564 2970156795 Bacteria 7168044
1037 2970169610 2970164137 Bacteria 6861252
1038 2970173696 2970170962 Bacteria 6876229
1039 2970179423 2970177841 Bacteria 6768001
1040 2970187781 2970184632 Bacteria 7054431
1041 2970194911 2970191845 Bacteria 7032787
1042 2977521946 2977516862 Bacteria 6940108
1043 2977528331 2977523885 Bacteria 6960446
1044 2977531056 2977530762 Bacteria 6951399
1045 2977538550 2977537788 Bacteria 6929320
1046 2977545798 2977544691 Bacteria 6875412
1047 2977554148 2977551784 Bacteria 7125765
1048 2977564088 2977558990 Bacteria 6863948
1049 2977570035 2977565890 Bacteria 6901543
1050 2977577572 2977572785 Bacteria 6763888
1051 2977584089 2977579622 Bacteria 6772100
1052 2978973022 2978969890 Bacteria 5400756
1053 2979093008 2979089926 Bacteria 5670289
1054 2979099604 2979095461 Bacteria 5669583
1055 2979104977 2979100975 Bacteria 5423623
1056 2984513220 2984509177 Bacteria 5274802
1057 2984520410 2984518228 Bacteria 5277463
1058 2984539707 2984537506 Bacteria 5277481
1059 2984591268 2984587000 Bacteria 5263363
1060 2984601932 2984601300 Bacteria 5455244
1061 2989772539 2989771324 Bacteria 5605128
1062 2996888201 2996887358 Bacteria 5795980
1063 2996897803 2996893221 Bacteria 5823108
1064 3003931630 3003930520 Bacteria 5667563
1065 3005410851 3005409236 Bacteria 7188837
1066 3005423070 3005416602 Bacteria 7064308
1067 3005445887 3005445848 Bacteria 6906074
1068 3005456577 3005452660 Bacteria 5889319
1069 639646280 639633055 Bacteria 7751309
1070 643824236 643692032 Bacteria 6891900
1071 648736739 648276728 Bacteria 6968865
1072 650738832 650716007 Bacteria 5573770
1073 8003572380 8003570095 Bacteria 5747666
1074 8003992141 8003992118 Bacteria 7266902
1075 8003999419 8003999396 Bacteria 7063185
1076 8005261247 8005258706 Bacteria 6184835
1077 8005278493 8005275841 Bacteria 6929066
1078 8005282963 8005282627 Bacteria 6675747
1079 8005291433 8005289223 Bacteria 6634003
1080 8005305675 8005301065 Bacteria 6614431
1081 8005310463 8005307578 Bacteria 7395396
1082 8005315397 8005314921 Bacteria 7072929
1083 8005322728 8005321885 Bacteria 5795980
1084 8005377807 8005376324 Bacteria 6590079
1085 8005385107 8005382845 Bacteria 6732062
1086 8005399813 8005395548 Bacteria 6806915
1087 8005432600 8005430974 Bacteria 6689030
1088 8005460626 8005460587 Bacteria 7157962
1089 8005484691 8005484373 Bacteria 6297373
1090 8005498321 8005497431 Bacteria 6477605
1091 8005543457 8005542996 Bacteria 7077758
1092 8005560243 8005556819 Bacteria 6908598
1093 8005564302 8005563573 Bacteria 7153261
1094 8005573865 8005570704 Bacteria 6957481
1095 8005619514 8005619151 Bacteria 7030230
1096 8005628081 8005626139 Bacteria 6534237
1097 8005649384 8005645114 Bacteria 6950293
1098 8005669730 8005668836 Bacteria 6953162
1099 8005685376 8005682033 Bacteria 6726518
1100 8005692571 8005688590 Bacteria 6610080
1101 8005699645 8005695170 Bacteria 6912330
1102 8018132769 8018127388 Bacteria 7351159
1103 8018150453 8018150411 Bacteria 5549903
1104 8018167378 8018163183 Bacteria 7277977
1105 8018181855 8018176218 Bacteria 6896178
1106 8023684630 8023680758 Bacteria 7729763
1107 8024479916 8024479707 Bacteria 6954785
1108 8024491665 8024486573 Bacteria 6540512
1109 8024502191 8024501048 Bacteria 6427847
1110 8046769547 8046767195 Bacteria 7547379
1111 8049293199 8049293176 Bacteria 6128433
1112 8054460926 8054460903 Bacteria 4872905
1113 8054563273 8054558443 Bacteria 5204801
1114 8056376130 8056375014 Bacteria 7006639
1115 8056384128 8056382006 Bacteria 6408074
1116 8056878810 8056875544 Bacteria 4355797
1117 8057580416 8057575449 Bacteria 7367519
1118 8057877533 8057874678 Bacteria 7494653
1119 Ga0268265_11013156
1120 JGI24740J21852_10102744
1121 JGI24738J21930_10105116
1122 JGI25156J39149_1000011
1123 JGI25154J39366_1000030
1124 JGI25158J39367_1000066
1125 JGI25158J39367_1005895
1126 JGI25157J39369_1000013
1127 JGI25152J39213_1000663
1128 JGI25152J39213_1001585
1129 JGI25152J39213_1002362
1130 JGI25152J39213_1011893
1131 JGI25150J39212_1000735
1132 JGI25150J39212_1002444
1133 JGI25150J39212_1023947
1134 JGI25159J45721_1000003
1135 JGI25159J45721_1000157
1136 JGI25159J45721_1034705
1137 JGI25151J46595_10000555
1138 JGI25151J46595_10001025
1139 JGI25151J46595_10004676
1140 JGI25151J46595_10007941
1141 JGI25151J46595_10044072
1142 JGI25165J46597_1000968
1143 JGI25165J46597_1000992
1144 JGI25165J46597_1006805
1145 JGI25153J46596_10000745
1146 JGI25153J46596_10052810
1147 JGI25153J46596_10059094
1148 rootH1_10066899
1149 rootH2_10051353
1150 rootH2_10064542
1151 rootL2_10064081
1152 rootH1_10070667
1153 JGI25160J50197_1000003
1154 JGI25160J50197_1000012
1155 JGI25160J50197_1000414
1156 JGI25160J50197_1005082
1157 JGI25160J50197_1006911
1158 JGI25161J50226_1000002
1159 JGI25161J50226_1000168
1160 JGI25161J50226_1000912
1161 JGI25161J50226_1003778
1162 Ga0055526_1001137
1163 Ga0055526_1002723
1164 Ga0055526_1005177
1165 Ga0055526_1021865
1166 Ga0055524_1002577
1167 Ga0055524_1002757
1168 Ga0055524_1003841
1169 Ga0055524_1010386
1170 Ga0055524_1017139
1171 Ga0055524_1062623
1172 Ga0055524_1073927
1173 Ga0055536_1005610
1174 Ga0055528_1000285
1175 Ga0055528_1000643
1176 Ga0055528_1003528
1177 Ga0055528_1013953
1178 Ga0055528_1019291
1179 Ga0055528_1042406
1180 Ga0055540_1000356
1181 Ga0055540_1020189
1182 Ga0055540_1023188
1183 Ga0055540_1031800
1184 Ga0055531_10004718
1185 Ga0055531_10006517
1186 Ga0055531_10055847
1187 Ga0058692_1003540
1188 Ga0058692_1009418
1189 Ga0055543_1000011
1190 Ga0055543_1000037
1191 Ga0055543_1000043
1192 Ga0055543_1000647
1193 Ga0065165_1000025
1194 Ga0065165_1003533
1195 Ga0065165_1009269
1196 Ga0065165_1010135
1197 Ga0070670_100000416
1198 Ga0070668_100183643
1199 Ga0070669_100678655
1200 Ga0070669_100795623
1201 Ga0070671_100102821
1202 Ga0070667_100193191
1203 Ga0070667_100595185
1204 Ga0070663_100216222
1205 Ga0070663_101495157
1206 Ga0070665_100014592
1207 Ga0070665_100034581
1208 Ga0070665_100274768
1209 Ga0068856_100023642
1210 Ga0068856_100207946
1211 Ga0068851_10089457
1212 Ga0075365_10005737
1213 Ga0075365_10006214
1214 Ga0075368_10000085
1215 Ga0075363_100086831
1216 Ga0075362_10001424
1217 Ga0075362_10024346
1218 Ga0075362_10104043
1219 Ga0075367_10003607
1220 Ga0075367_10076937
1221 Ga0075367_10896271
1222 Ga0075369_10003035
1223 Ga0075369_10008799
1224 Ga0075369_10141669
1225 Ga0075366_10007945
1226 Ga0075366_10018267
1227 Ga0075370_10004010
1228 Ga0079104_1000033
1229 Ga0079104_1000847
1230 Ga0079104_1002810
1231 Ga0099826_10385756
1232 Ga0105251_10004499
1233 Ga0105244_10061736
1234 Ga0105244_10254915
1235 Ga0105250_10189751
1236 Ga0105240_10000024
1237 Ga0105243_10068948
1238 Ga0105248_10157053
1239 Ga0105237_10002690
1240 Ga0105237_11617147
1241 Ga0105249_10057824
1242 Ga0123341_1000225
1243 Ga0123341_1071252
1244 Ga0123342_1006191
1245 Ga0123342_1021815
1246 Ga0105239_10004676
1247 Ga0105239_11044224
1248 Ga0105246_10164472
1249 Ga0105246_10375743
1250 Ga0157313_1002095
1251 Ga0157373_10019888
1252 Ga0157373_10044973
1253 Ga0157371_10000004
1254 Ga0157371_10007868
1255 Ga0157370_10000165
1256 Ga0157370_10000236
1257 Ga0157370_10032600
1258 Ga0157370_10380351
1259 Ga0157369_10041578
1260 Ga0157369_10187657
1261 Ga0157369_10222175
1262 Ga0171463_1001
1263 Ga0157378_10211230
1264 Ga0157372_10196262
1265 Ga0157372_10513291
1266 Ga0182008_10063065
1267 Ga0182007_10004455
1268 Ga0183363_1051
1269 Ga0214544_1000105
1270 Ga0214542_1000029
1271 Ga0214542_1029334
1272 Ga0214543_1000027
1273 Ga0214543_1000040
1274 Ga0228711_1000013
1275 Ga0228710_1000008
1276 Ga0209435_100026
1277 Ga0209436_100048
1278 Ga0209436_100220
1279 Ga0209436_111372
1280 Ga0209563_107296
1281 Ga0209437_100050
1282 Ga0209437_100056
1283 Ga0207425_1000012
1284 Ga0207425_1001222
1285 Ga0207425_1009744
1286 Ga0207425_1011616
1287 Ga0209646_1000084
1288 Ga0209646_1008688
1289 Ga0209026_1000080
1290 Ga0209677_100706
1291 Ga0209759_1000061
1292 Ga0209759_1018398
1293 Ga0209129_1000110
1294 Ga0209129_1000192
1295 Ga0209129_1001057
1296 Ga0209129_1001331
1297 Ga0209129_1001810
1298 Ga0209129_1002698
1299 Ga0209129_1006102
1300 Ga0209233_1000037
1301 Ga0209233_1000071
1302 Ga0209233_1000234
1303 Ga0209565_1042157
1304 Ga0209673_1000024
1305 Ga0209673_1000063
1306 Ga0209673_1000677
1307 Ga0209673_1002544
1308 Ga0209673_1003382
1309 Ga0209673_1003971
1310 Ga0209673_1005862
1311 Ga0209673_1008183
1312 Ga0209130_1000002
1313 Ga0209130_1000005
1314 Ga0209130_1000028
1315 Ga0209130_1003346
1316 Ga0209130_1017279
1317 Ga0209130_1041260
1318 Ga0209676_1009525
1319 Ga0209676_1016493
1320 Ga0209676_1095137
1321 Ga0209025_1000024
1322 Ga0209025_1000037
1323 Ga0209025_1000060
1324 Ga0209025_1000105
1325 Ga0209025_1000235
1326 Ga0209025_1000748
1327 Ga0209025_1015658
1328 Ga0209025_1023271
1329 Ga0209025_1027930
1330 Ga0209025_1030347
1331 Ga0209025_1136227
1332 Ga0209564_1000138
1333 Ga0209564_1000217
1334 Ga0209564_1000746
1335 Ga0209564_1001016
1336 Ga0209564_1001885
1337 Ga0209564_1059020
1338 Ga0209758_1000150
1339 Ga0209758_1000170
1340 Ga0209758_1000911
1341 Ga0209758_1003440
1342 Ga0209758_1009125
1343 Ga0209758_1013864
1344 Ga0209758_1015231
1345 Ga0209758_1022005
1346 Ga0209758_1031702
1347 Ga0209050_1002722
1348 Ga0209050_1004886
1349 Ga0209050_1045439
1350 Ga0209256_1000027
1351 Ga0209256_1000814
1352 Ga0209256_1000911
1353 Ga0209256_1002182
1354 Ga0209256_1003078
1355 Ga0209256_1012347
1356 Ga0209256_1034153
1357 Ga0207426_1000012
1358 Ga0207426_1000013
1359 Ga0207426_1000015
1360 Ga0207426_1000070
1361 Ga0207426_1001610
1362 Ga0209051_1000197
1363 Ga0209051_1001528
1364 Ga0209051_1002357
1365 Ga0209051_1010103
1366 Ga0209051_1015389
1367 Ga0209051_1019603
1368 Ga0209051_1021337
1369 Ga0209257_1000940
1370 Ga0209257_1005057
1371 Ga0209257_1021606
1372 Ga0207656_10237032
1373 Ga0207696_1088220
1374 Ga0207713_1098576
1375 Ga0207680_10215359
1376 Ga0207695_10000036
1377 Ga0207671_10000354
1378 Ga0207681_10745221
1379 Ga0207650_10001599
1380 Ga0207644_10177900
1381 Ga0207709_10158489
1382 Ga0207709_10169119
1383 Ga0207668_10016889
1384 Ga0207668_11064327
1385 Ga0207658_10159063
1386 Ga0207658_10581981
1387 Ga0207639_11001127
1388 Ga0207678_10211369
1389 Ga0207702_10069457
1390 Ga0209281_1000043
1391 Ga0209281_1000134
1392 Ga0209281_1000319
1393 Ga0209371_1000009
1394 Ga0209371_1000989
1395 Ga0209282_1000029
1396 Ga0209813_10004005
1397 Ga0209813_10139579
1398 Ga0268266_10024437
1399 Ga0268266_10084496
1400 Ga0268266_10197692
1401 Ga0307515_10004718
1402 Ga0307515_10019713
1403 Ga0268256_1000010
1404 Ga0268256_1000953
1405 Ga0316182_1363077
1406 Ga0307408_100346805
1407 Ga0307408_100363551
1408 Ga0307408_100576674
1409 Ga0307408_101108487
1410 Ga0307405_10000625
1411 Ga0307405_10276857
1412 Ga0307405_10866366
1413 Ga0307410_10211655
1414 Ga0307406_10002131
1415 Ga0307406_10196256
1416 Ga0307412_10001093
1417 Ga0307412_10218587
1418 Ga0315914_1000021
1419 Ga0307416_101600062
1420 Ga0315913_1000014
1421 Ga0315915_1000003
1422 Ga0373946_0323485
1423 Ga0439436_0004715
1424 Ga0439439_0028630
1425 Ga0439465_0003635
1426 Ga0439465_0009943
1427 Ga0439465_0090846
1428 Ga0451787_099691
1429 Ga0451795_1357312
1430 Ga0451798_0293113
1431 Ga0451833_0531636
1432 Ga0451835_0748514
1433 Ga0451837_0636364
1434 Ga0451837_0733956
1435 Ga0451839_1484877
1436 Ga0451841_0020640
1437 Ga0451841_1015729
1438 Ga0451841_1026053
1439 Ga0451845_0073539
1440 Ga0451849_1033839
1441 Ga0451851_1300213
1442 Ga0451843_1430945
1443 Ga0451855_0411571
1444 Ga0451855_1685201
1445 Ga0451853_2285167
1446 Ga0451853_2951466
1447 Ga0439431_0081136
1448 Ga0439449_0050715
1449 Ga0439462_0028235
1450 Ga0439462_0036385
1451 Ga0466965_0104356
1452 Ga0466963_0005366
1453 Ga0466968_0068276
1454 Ga0466968_0218562
1455 Ga0466970_0005392
1456 Ga0466967_0344732
1457 Ga0495617_136005
1458 Ga0495627_000976
1459 Ga0495590_0137180
1460 Ga0495590_0144343
1461 Ga0495638_0000467
1462 Ga0495638_0143609
1463 Ga0495650_0105191
1464 Ga0495605_0009076
1465 Ga0495605_0081112
1466 Ga0495662_0134855
1467 Ga0495584_0164455
1468 Ga0495585_0033364
1469 Ga0495585_0034650
1470 Ga0495596_0105702
1471 Ga0495607_0049308
1472 Ga0495607_0096366
1473 Ga0495583_0011761
1474 Ga0495583_0036746
1475 Ga0495583_0043764
1476 Ga0495606_0001911
1477 Ga0495606_0012052
1478 Ga0495606_0111411
1479 Ga0495610_0002588
1480 Ga0495610_0110716
1481 Ga0495610_0118611
1482 Ga0495616_0068866
1483 Ga0495620_0110525
1484 Ga0495631_0005728
1485 Ga0495632_0011941
1486 Ga0495632_0110687
1487 Ga0495643_0027564
1488 Ga0495643_0058364
1489 Ga0495643_0135733
1490 Ga0495643_0206558
1491 Ga0495643_0272797
1492 Ga0495648_0086268
1493 Ga0495648_0158041
1494 Ga0495648_0211278
1495 Ga0495663_0066553
1496 Ga0495652_0384774
1497 Ga0495654_0000070
1498 Ga0495587_0025222
1499 Ga0495609_0100554
1500 Ga0495622_0002942
1501 Ga0495633_0029327
1502 Ga0495633_0104809
1503 Ga0495668_0049952
1504 Ga0495668_0091137
1505 Ga0495611_0034043
1506 Ga0495611_0217061
1507 Ga0495625_0001943
1508 Ga0495661_0000064
1509 Ga0495661_0117895
1510 Ga0495588_0005508
1511 Ga0495588_0095951
1512 Ga0495671_0013457
1513 Ga0495671_0136080
1514 Ga0495649_0027242
1515 Ga0495649_0049841
1516 Ga0495600_0051042
1517 Ga0495660_0053577
1518 Ga0495604_0147382
1519 Ga0495636_0048773
1520 Ga0495636_0187038
1521 Ga0495674_0166307
1522 Ga0495672_0014128
1523 Ga0495676_0249972
1524 Ga0495683_0101732
1525 Ga0495687_061117
1526 Ga0495687_131849
1527 Ga0495679_077824
1528 Ga0495673_0184567
1529 Ga0495673_0211617
1530 Ga0495681_0001384
1531 Ga0495686_0017458
1532 Ga0495686_0089052
1533 Ga0495686_0106715
1534 Ga0495626_0058722
1535 Ga0496100_0029793
1536 Ga0496100_0138678
1537 Ga0496101_0174857
1538 Ga0496102_0017302
1539 Ga0496103_0590241
1540 Ga0496107_0340913
1541 Ga0496110_0225195
1542 Ga0496110_0354338
1543 Ga0496110_0371169
1544 Ga0496111_0034194
1545 Ga0496113_0072315
1546 Ga0496114_0070347
1547 Ga0496116_0000240
1548 Ga0496116_0027132
1549 Ga0496116_0039088
1550 Ga0496116_0062589
1551 Ga0496116_0068279
1552 Ga0496116_0153686
1553 Ga0496117_0000002
1554 Ga0496117_0001724
1555 Ga0496117_0012948
1556 Ga0496117_0014076
1557 Ga0496117_0042458
1558 Ga0496117_0154120
1559 Ga0496117_0205505
1560 Ga0496118_0000651
1561 Ga0496118_0011235
1562 Ga0496118_0014538
1563 Ga0496118_0024579
1564 Ga0496118_0033045
1565 Ga0496118_0161586
1566 Ga0496118_0242360
1567 Ga0496119_0011730
1568 Ga0496119_0052097
1569 Ga0496119_0057217
1570 Ga0496119_0070369
1571 Ga0496119_0087711
1572 Ga0496120_0000034
1573 Ga0496120_0010536
1574 Ga0496120_0013587
1575 Ga0496121_0000220
1576 Ga0496121_0003996
1577 Ga0496121_0025639
1578 Ga0496121_0034146
1579 Ga0496121_0038875
1580 Ga0496121_0042511
1581 Ga0496121_0083173
1582 Ga0496122_0000001
1583 Ga0496122_0000309
1584 Ga0496122_0003816
1585 Ga0496122_0045966
1586 Ga0496122_0068498
1587 Ga0496122_0069684
1588 Ga0496122_0091517
1589 Ga0496122_0111991
1590 Ga0496123_0000001
1591 Ga0496123_0000396
1592 Ga0496123_0009540
1593 Ga0496123_0047278
1594 Ga0496123_0054435
1595 Ga0496123_0055175
1596 Ga0496123_0059438
1597 Ga0496123_0357709
1598 Ga0496124_0000083
1599 Ga0496124_0000532
1600 Ga0496124_0009307
1601 Ga0496124_0010687
1602 Ga0496124_0062545
1603 Ga0496124_0070190
1604 Ga0496124_0077886
1605 Ga0496124_0086224
1606 Ga0496124_0125351
1607 Ga0496124_0150029
1608 Ga0496124_0231723
1609 Ga0496124_0256731
1610 Ga0496124_0270291
1611 Ga0496125_0000001
1612 Ga0496125_0022345
1613 Ga0496125_0024406
1614 Ga0496125_0026537
1615 Ga0496125_0047131
1616 Ga0496125_0104487
1617 Ga0496126_0000322
1618 Ga0496126_0000923
1619 Ga0496126_0084226
1620 Ga0496126_0147603
1621 Ga0496126_0160177
1622 Ga0496126_0263804
1623 Ga0496126_0476710
1624 Ga0495678_016827
1625 Ga0501034_0141013
1626 Ga0501034_0329515
1627 Ga0501034_0514855
1628 Ga0501037_0222720
1629 Ga0501038_0204010
1630 Ga0501038_0581849
1631 Ga0501043_0073173
1632 Ga0501047_0046402
1633 Ga0501068_0652556
1634 Ga0501238_024457
1635 Ga0501083_0046288
1636 Ga0501083_0123116
1637 Ga0501276_019614
1638 Ga0501044_0673971
1639 nmdc:mga03683_20296_c1
1640 nmdc:mga03683_67085_c1
1641 nmdc:mga00v17_100_c1
1642 nmdc:mga00v17_2996_c1
1643 nmdc:mga00v17_7106_c1
1644 nmdc:mga0yw44_42223_c1
1645 nmdc:mga0yw44_633763_c1
1646 nmdc:mga0yw44_69588_c1
1647 nmdc:mga0yw44_7601_c1
1648 nmdc:mga0k408_41179_c1
1649 nmdc:mga0k408_494227_c1
1650 nmdc:mga0k408_77511_c1
1651 nmdc:mga06z11_6107_c1
1652 nmdc:mga04h51_39039_c1
1653 nmdc:mga07m45_1262_c1
1654 nmdc:mga07m45_73203_c1
1655 nmdc:mga0sz30_1486_c1
1656 nmdc:mga0sz30_70_c1
1657 Ga0495601_0095472
1658 Ga0500610_0017984
1659 Ga0500578_0353916
1660 Ga0500643_059145
1661 Ga0500651_0210777
1662 Ga0500556_0130664
1663 Ga0500569_044792
1664 Ga0500594_0002982
1665 Ga0500594_0012681
1666 Ga0500618_000565
1667 Ga0500618_000572
1668 Ga0500618_028701
1669 Ga0500652_286741
1670 Ga0500655_022967
1671 Ga0500658_0001181
1672 Ga0500559_0002567
1673 Ga0500561_0000112
1674 Ga0500568_0008395
1675 Ga0500568_0015345
1676 Ga0500568_0108758
1677 Ga0500573_0384446
1678 Ga0500588_0004803
1679 Ga0500590_008471
1680 Ga0500616_0001070
1681 Ga0500622_0001430
1682 Ga0500634_0017980
1683 Ga0500636_0000022
1684 Ga0587098_068364
1685 Ga0501082_0073053
1686 2509108958
1687 2509375320
1688 2509388792
1689 2509444379
1690 2510307255
1691 2510897363
1692 2511134605
1693 2511171497
1694 2511181322
1695 2511499003
1696 2512531601
1697 2512973045
1698 2513570269
1699 2513574749
1700 2513586138
1701 2513595314
1702 2513604373
1703 2513616140
1704 2513633997
1705 2513707369
1706 2513866591
1707 2513882707
1708 2513906507
1709 2513911304
1710 2513924497
1711 2513983107
1712 2513996442
1713 2514007073
1714 2514022130
1715 2515109989
1716 2515607422
1717 2515633982
1718 2515641198
1719 2515659795
1720 2515740936
1721 2516204628
1722 2516895278
1723 2517038684
1724 2517078932
1725 2517097735
1726 2517409154
1727 2517568337
1728 2524450839
1729 2524458104
1730 2530648150
1731 2535514787
1732 2537873371
1733 2551679952
1734 2551683693
1735 2551694868
1736 2551698941
1737 2551709720
1738 2551716234
1739 2551724649
1740 2551735449
1741 2551741203
1742 2554246371
1743 2558866409
1744 2559293593
1745 2585201070
1746 2585223468
1747 2585229531
1748 2585256200
1749 2585264939
1750 2585273686
1751 2585279989
1752 2585330398
1753 2585386003
1754 2585398873
1755 2585523735
1756 2585533757
1757 2585541868
1758 2585545936
1759 2585553350
1760 2585559860
1761 2585819007
1762 2585840484
1763 2585843923
1764 2585900538
1765 2585905962
1766 2585994120
1767 2587978923
1768 2599419540
1769 2599605834
1770 2599718959
1771 2600195009
1772 2600376608
1773 2601609385
1774 2601746160
1775 2616293748
1776 2616309373
1777 2616556299
1778 2617380507
1779 2643805983
1780 2643812662
1781 2643857390
1782 2643920755
1783 2644004621
1784 2644066159
1785 2644103597
1786 2644144476
1787 2644196870
1788 2644207130
1789 2644237470
1790 2644306527
1791 2644330717
1792 2644377243
1793 2644417490
1794 2644450886
1795 2644495548
1796 2644519440
1797 2644542478
1798 2644612138
1799 2644650778
1800 2644671667
1801 2644692691
1802 2657682932
1803 2671113919
1804 2692317582
1805 2719179223
1806 2719383791
1807 2719663586
1808 2719729893
1809 2720490005
1810 2720611382
1811 2720618231
1812 2720629634
1813 2720773330
1814 2721145316
1815 2721156831
1816 2721162211
1817 2721397549
1818 2722838381
1819 2723025009
1820 2723558587
1821 2723565156
1822 2724036359
1823 2724042649
1824 2724087937
1825 2724102421
1826 2724108325
1827 2725950616
1828 2730105945
1829 2730162460
1830 2730296463
1831 2738804567
1832 2738948696
1833 2739036907
1834 2753459783
1835 2766063381
1836 2776911702
1837 2778177064
1838 2792583190
1839 2792621131
1840 2792625345
1841 2792637775
1842 2793282897
1843 2793296816
1844 2793314015
1845 2793322300
1846 2793328994
1847 2793336260
1848 2793343906
1849 2793349465
1850 2793352680
1851 2793358308
1852 2793365539
1853 2802718612
1854 2802724293
1855 2802730045
1856 2802737388
1857 2802742304
1858 2802748987
1859 2804750650
1860 2805928163
1861 2805935514
1862 2806046681
1863 2806051442
1864 2806059431
1865 2806066604
1866 2806073662
1867 2808986636
1868 2819556708
1869 2819608660
1870 2819640770
1871 2819685978
1872 2821123384
1873 2838020611
1874 2838026417
1875 2838029549
1876 2838039925
1877 2838048474
1878 2838053119
1879 2838065867
1880 2838070735
1881 2838075047
1882 2838664209
1883 2838674357
1884 2838677443
1885 2838680232
1886 2838689636
1887 2838695737
1888 2838706733
1889 2838709112
1890 2838716331
1891 2838719869
1892 2838727083
1893 2838731669
1894 2838739593
1895 2838744610
1896 2841844283
1897 2841846800
1898 2841853151
1899 2841860671
1900 2841868908
1901 2842079652
1902 2842112531
1903 2842120270
1904 2842127171
1905 2842132336
1906 2842144004
1907 2842151386
1908 2842152495
1909 2842160477
1910 2842165543
1911 2842172576
1912 2842176114
1913 2842183857
1914 2842189438
1915 2842198162
1916 2842202178
1917 2842211182
1918 2842213752
1919 2842219208
1920 2842224630
1921 2842231438
1922 2842238523
1923 2842246092
1924 2842256524
1925 2842260470
1926 2842268361
1927 2842273880
1928 2842284635
1929 2842286481
1930 2842293313
1931 2842299712
1932 2842308891
1933 2842312432
1934 2842322010
1935 2842344438
1936 2842359766
1937 2842367480
1938 2842370694
1939 2842379710
1940 2842386781
1941 2842401642
1942 2842403966
1943 2842410331
1944 2842416979
1945 2842424350
1946 2842432333
1947 2842438637
1948 2842445267
1949 2842452853
1950 2842466332
1951 2842473152
1952 2842476021
1953 2842486105
1954 2842494624
1955 2842499916
1956 2842503077
1957 2842512939
1958 2842517456
1959 2842521363
1960 2842923019
1961 2844170129
1962 2844456383
1963 2847417348
1964 2848992133
1965 2850079615
1966 2852388164
1967 2854897960
1968 2854919661
1969 2855827915
1970 2855839672
1971 2855875226
1972 2857521975
1973 2857533666
1974 2858803011
1975 2891375289
1976 2896384757
1977 2899794537
1978 2899845882
1979 2913298259
1980 2913311489
1981 2915986537
1982 2915990393
1983 2915997304
1984 2916004842
1985 2916008245
1986 2916021348
1987 2916028304
1988 2916032766
1989 2916038277
1990 2916044609
1991 2916053566
1992 2916057104
1993 2916067742
1994 2916075207
1995 2916077987
1996 2919101654
1997 2919116535
1998 2919166633
1999 2919172316
2000 2919408537
2001 2920763697
2002 2920823020
2003 2921204081
2004 2921214918
2005 2921242199
2006 2921248508
2007 2921252615
2008 2921259914
2009 2921267381
2010 2921284423
2011 2921292198
2012 2921296966
2013 2923556400
2014 2924146206
2015 2924156359
2016 2924164609
2017 2924171951
2018 2924177157
2019 2924184438
2020 2924190935
2021 2924200224
2022 2924202543
2023 2924209528
2024 2924215888
2025 2924227359
2026 2924230075
2027 2926754557
2028 2926761728
2029 2929142148
2030 2933007142
2031 2933015267
2032 2933018229
2033 2933575335
2034 2933588580
2035 2933594345
2036 2933601539
2037 2935896257
2038 2935902538
2039 2936369300
2040 2936377352
2041 2936385757
2042 2936998591
2043 2937006388
2044 2937011746
2045 2937018452
2046 2937023508
2047 2937031630
2048 2937037686
2049 2937045094
2050 2937054303
2051 2937062388
2052 2937066741
2053 2937072937
2054 2937081681
2055 2937089449
2056 2937097167
2057 2937104585
2058 2937108349
2059 2937116398
2060 2937121937
2061 2937129605
2062 2941501021
2063 2957377843
2064 2957384397
2065 2957393245
2066 2957400750
2067 2957403436
2068 2957413457
2069 2957417368
2070 2957429893
2071 2957434688
2072 2957443317
2073 2957446809
2074 2957452890
2075 2957463837
2076 2957467230
2077 2957476123
2078 2957481209
2079 2957486661
2080 2957492989
2081 2957503093
2082 2957510191
2083 2960587660
2084 2960593324
2085 2960600840
2086 2960604386
2087 2960613767
2088 2960620415
2089 2960627063
2090 2960637110
2091 2960642565
2092 2960652402
2093 2960657618
2094 2960660716
2095 2960670239
2096 2960676817
2097 2960684569
2098 2960693460
2099 2960697435
2100 2964613410
2101 2964618293
2102 2964626550
2103 2964634155
2104 2964639970
2105 2964645026
2106 2964650011
2107 2964659545
2108 2964670283
2109 2964676780
2110 2964678858
2111 2964685282
2112 2964696237
2113 2964699271
2114 2964708231
2115 2964712952
2116 2964723254
2117 2967668482
2118 2967676347
2119 2967682121
2120 2967688085
2121 2967695347
2122 2967701098
2123 2967709890
2124 2967717909
2125 2967723684
2126 2967731095
2127 2967738164
2128 2967748875
2129 2967749531
2130 2967757281
2131 2967768740
2132 2967771344
2133 2967781573
2134 2970023028
2135 2970027363
2136 2970040424
2137 2970046214
2138 2970050901
2139 2970058298
2140 2970066349
2141 2970072489
2142 2970079348
2143 2970088051
2144 2970091714
2145 2970099366
2146 2970106120
2147 2970111578
2148 2970122390
2149 2970126176
2150 2970131264
2151 2970139709
2152 2970146360
2153 2970151915
2154 2970162564
2155 2970169610
2156 2970173696
2157 2970179423
2158 2970187781
2159 2970194911
2160 2977521946
2161 2977528331
2162 2977531056
2163 2977538550
2164 2977545798
2165 2977554148
2166 2977564088
2167 2977570035
2168 2977577572
2169 2977584089
2170 2978973022
2171 2979093008
2172 2979099604
2173 2979104977
2174 2984513220
2175 2984520410
2176 2984539707
2177 2984591268
2178 2984601932
2179 2989772539
2180 2996888201
2181 2996897803
2182 3003931630
2183 3005410851
2184 3005423070
2185 3005445887
2186 3005456577
2187 639646280
2188 643824236
2189 648736739
2190 650738832
2191 8003572380
2192 8003992141
2193 8003999419
2194 8005261247
2195 8005278493
2196 8005282963
2197 8005291433
2198 8005305675
2199 8005310463
2200 8005315397
2201 8005322728
2202 8005377807
2203 8005385107
2204 8005399813
2205 8005432600
2206 8005460626
2207 8005484691
2208 8005498321
2209 8005543457
2210 8005560243
2211 8005564302
2212 8005573865
2213 8005619514
2214 8005628081
2215 8005649384
2216 8005669730
2217 8005685376
2218 8005692571
2219 8005699645
2220 8018132769
2221 8018150453
2222 8018167378
2223 8018181855
2224 8023684630
2225 8024479916
2226 8024491665
2227 8024502191
2228 8046769547
2229 8049293199
2230 8054460926
2231 8054563273
2232 8056376130
2233 8056384128
2234 8056878810
2235 8057580416
2236 8057877533

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01252

Peptidase_A8

Signal peptidase (SPase) II

53

184

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dir-assembly4.cif.gz_D membrane protein at 2.8 angstroms 0.863 17 157
5dir-assembly2.cif.gz_B membrane protein at 2.8 angstroms 0.851 16 156
6fms-assembly2.cif.gz_B imisx-ep of se-lspa 0.849 16 155
6ryp-assembly1.cif.gz_A bacterial membrane enzyme structure by the in meso method at 2.3 a resolution 0.8174 18 167
5dir-assembly4.cif.gz_D membrane protein at 2.8 angstroms 0.8166 17 157
ID Description Score Start End Superfamily
af_P00804_15_157_3.90.1420.10 Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain 0.8838 22 159 3.90.1420.10
af_Q2FZ79_13_152_3.90.1420.10 Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain 0.8802 22 161 3.90.1420.10
af_Q2FZ79_13_152_3.90.1420.10 Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain 0.8686 22 161 3.90.1420.10
af_P00804_15_157_3.90.1420.10 Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain 0.85 22 159 3.90.1420.10
af_P9WK99_39_178_3.90.1420.10 Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 2;Rubisco LSMT, substrate-binding domain 0.8082 22 159 3.90.1420.10
ID Description Score Start End GO Terms
AF-A0A5D4GPA9-F1-model_v4 Lipoprotein signal peptidase (EC 3.4.23.36) (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) 0.9372 18 160 GO:0004190
GO:0005886
GO:0006508
AF-A0A833G278-F1-model_v4 Lipoprotein signal peptidase (EC 3.4.23.36) (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) 0.9364 16 160 GO:0004190
GO:0005886
GO:0006508
AF-A0A529ZRF2-F1-model_v4 Lipoprotein signal peptidase (EC 3.4.23.36) 0.936 17 161 GO:0004190
GO:0005886
GO:0006508
AF-A0A7X0DE19-F1-model_v4 Lipoprotein signal peptidase (EC 3.4.23.36) (Prolipoprotein signal peptidase) (Signal peptidase II) (SPase II) 0.9357 6 160 GO:0004190
GO:0005886
GO:0006508
AF-A0A529SNK5-F1-model_v4 Lipoprotein signal peptidase (EC 3.4.23.36) 0.9338 17 139 GO:0004190
GO:0005886
GO:0006508

Map