F490372
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1119 | 393 | 1119 | 211 |
Family's Representative Sequence
| Representative Sequence | 3300046517|Ga0495630_0021716|Ga0495630_0021716_1472_2233 |
| Length | 253 |
| Sequence | VKPASGKKKDPDGNSLLFISLTRADAAEYTHGKSLSKGVPMADHELTDPGCSTSESNKISRRDVIKSVIATGVVSSTSYLFRVSKVWAQASAPGAVDRLITLNVNGQQRRVDVMKQETLVMTLRYKLGLTGTKIGCDQAECGACTVLIDDVPYYSCSVFTHTVRDKKIQTIEGLAKPDGALHPVQQGVIDEQGFQCAFCMSGFMMATVGFLKINPNPTRAELAKGISGNICRCQDYDKILTAMMRGAENLRKA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 2 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 3 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 4 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 5 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 6 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 7 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 8 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 9 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 10 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 11 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 12 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 53 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 62 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 73 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 74 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 75 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 76 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 77 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 78 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 79 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 80 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 81 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 82 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 83 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 84 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 85 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 86 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 88 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 93 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 94 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 95 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 96 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 97 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 98 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 99 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 100 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 101 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 103 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 104 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 136 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 142 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 209 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 213 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 214 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 215 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 216 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 217 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 218 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 219 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 220 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 221 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 222 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 223 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 224 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 225 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 226 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 227 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 228 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 229 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 230 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 231 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 232 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 233 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 234 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 235 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 236 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 237 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 238 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 239 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 240 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 241 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 242 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 243 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 244 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 245 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 246 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 247 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 249 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 250 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 251 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 252 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 253 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 254 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 255 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 256 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 257 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 258 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 259 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 260 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 261 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 262 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 263 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 264 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 265 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 266 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 313 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 314 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 315 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 316 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 317 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 318 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 320 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 321 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 322 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 323 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 324 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 325 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 346 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 367 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 368 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 369 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 370 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 371 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 372 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 373 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 374 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 375 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 376 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 377 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 378 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 380 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 383 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 384 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 385 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 387 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 388 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 389 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 390 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 391 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 392 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.46 |
| Metatranscriptomes | 5.54 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 3.57 |
| Rhizosphere | 95.44 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.98 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10001715 | 3300002459 | Archaea | 4505 |
| 2 | JGI24751J29686_10019096 | 3300002459 | Bacteria | 1419 |
| 3 | Ga0006759J45824_1088694 | 3300003163 | Bacteria | 1106 |
| 4 | Ga0007417J51691_1024758 | 3300003544 | Bacteria | 669 |
| 5 | Ga0007417J51691_1064518 | 3300003544 | Bacteria | 879 |
| 6 | Ga0007410J51695_1055657 | 3300003574 | Bacteria | 923 |
| 7 | Ga0007409J51694_1058321 | 3300003575 | Bacteria | 1001 |
| 8 | Ga0007429J51699_1059572 | 3300003579 | Bacteria | 875 |
| 9 | Ga0007429J51699_1063966 | 3300003579 | Archaea | 816 |
| 10 | Ga0058859_10021908 | 3300004798 | Bacteria | 1222 |
| 11 | Ga0058859_10031263 | 3300004798 | Bacteria | 1256 |
| 12 | Ga0058859_10041715 | 3300004798 | Bacteria | 1250 |
| 13 | Ga0058859_11654266 | 3300004798 | Unclassified | 1118 |
| 14 | Ga0058859_11762873 | 3300004798 | Bacteria | 881 |
| 15 | Ga0058861_10036557 | 3300004800 | Unclassified | 1455 |
| 16 | Ga0058860_10077957 | 3300004801 | Bacteria | 1077 |
| 17 | Ga0058862_10248621 | 3300004803 | Unclassified | 903 |
| 18 | Ga0065712_10011524 | 3300005290 | Bacteria | 2146 |
| 19 | Ga0065712_10154608 | 3300005290 | Bacteria | 1344 |
| 20 | Ga0065712_10164863 | 3300005290 | Unclassified | 1279 |
| 21 | Ga0065712_10217838 | 3300005290 | Bacteria | 1051 |
| 22 | Ga0065712_10241478 | 3300005290 | Bacteria | 983 |
| 23 | Ga0065715_10276677 | 3300005293 | Unclassified | 1097 |
| 24 | Ga0065715_10340354 | 3300005293 | Unclassified | 961 |
| 25 | Ga0065707_10098316 | 3300005295 | Bacteria | 3095 |
| 26 | Ga0065707_10259718 | 3300005295 | Unclassified | 1101 |
| 27 | Ga0070658_10001935 | 3300005327 | Bacteria | 17402 |
| 28 | Ga0070676_10022921 | 3300005328 | Unclassified | 3505 |
| 29 | Ga0070676_10143445 | 3300005328 | Unclassified | 1522 |
| 30 | Ga0070676_10487851 | 3300005328 | Bacteria | 873 |
| 31 | Ga0070676_10681715 | 3300005328 | Unclassified | 749 |
| 32 | Ga0070683_100200558 | 3300005329 | Unclassified | 1894 |
| 33 | Ga0070683_100242079 | 3300005329 | Bacteria | 1716 |
| 34 | Ga0070683_100275147 | 3300005329 | Bacteria | 1602 |
| 35 | Ga0070670_100096802 | 3300005331 | Bacteria | 2539 |
| 36 | Ga0070670_100100636 | 3300005331 | Unclassified | 2488 |
| 37 | Ga0070670_100133737 | 3300005331 | Bacteria | 2142 |
| 38 | Ga0070670_100444992 | 3300005331 | Bacteria | 1148 |
| 39 | Ga0070677_10043964 | 3300005333 | Bacteria | 1776 |
| 40 | Ga0070677_10064415 | 3300005333 | Unclassified | 1522 |
| 41 | Ga0068869_100013764 | 3300005334 | Bacteria | 5389 |
| 42 | Ga0068869_100083205 | 3300005334 | Unclassified | 2393 |
| 43 | Ga0068869_100303592 | 3300005334 | Bacteria | 1290 |
| 44 | Ga0070666_10003858 | 3300005335 | Bacteria | 9098 |
| 45 | Ga0070666_10070622 | 3300005335 | Bacteria | 2376 |
| 46 | Ga0070666_10151568 | 3300005335 | Unclassified | 1617 |
| 47 | Ga0070666_10212844 | 3300005335 | Unclassified | 1362 |
| 48 | Ga0070680_100327124 | 3300005336 | Unclassified | 1302 |
| 49 | Ga0070682_100080769 | 3300005337 | Unclassified | 2103 |
| 50 | Ga0070682_100102395 | 3300005337 | Bacteria | 1892 |
| 51 | Ga0068868_100008417 | 3300005338 | Bacteria | 7385 |
| 52 | Ga0068868_100031991 | 3300005338 | Bacteria | 4044 |
| 53 | Ga0068868_100050774 | 3300005338 | Bacteria | 3259 |
| 54 | Ga0068868_100058077 | 3300005338 | Unclassified | 3057 |
| 55 | Ga0068868_100493205 | 3300005338 | Bacteria | 1072 |
| 56 | Ga0070660_100029894 | 3300005339 | Bacteria | 4085 |
| 57 | Ga0070660_100051801 | 3300005339 | Bacteria | 3162 |
| 58 | Ga0070660_100411740 | 3300005339 | Bacteria | 1119 |
| 59 | Ga0070660_100475487 | 3300005339 | Unclassified | 1038 |
| 60 | Ga0070689_100047162 | 3300005340 | Bacteria | 3321 |
| 61 | Ga0070689_100301646 | 3300005340 | Unclassified | 1333 |
| 62 | Ga0070689_100305670 | 3300005340 | Bacteria | 1325 |
| 63 | Ga0070691_10064375 | 3300005341 | Bacteria | 1769 |
| 64 | Ga0070691_10099155 | 3300005341 | Bacteria | 1445 |
| 65 | Ga0070691_10358426 | 3300005341 | Unclassified | 812 |
| 66 | Ga0070687_100412345 | 3300005343 | Bacteria | 889 |
| 67 | Ga0070661_100292901 | 3300005344 | Unclassified | 1265 |
| 68 | Ga0070692_10194998 | 3300005345 | Bacteria | 1183 |
| 69 | Ga0070668_100017488 | 3300005347 | Bacteria | 5375 |
| 70 | Ga0070668_100576572 | 3300005347 | Bacteria | 982 |
| 71 | Ga0070669_100055815 | 3300005353 | Bacteria | 2894 |
| 72 | Ga0070669_100116463 | 3300005353 | Bacteria | 2034 |
| 73 | Ga0070669_100175841 | 3300005353 | Unclassified | 1672 |
| 74 | Ga0070675_100000739 | 3300005354 | Bacteria | 22817 |
| 75 | Ga0070675_100131357 | 3300005354 | Unclassified | 2134 |
| 76 | Ga0070675_100143947 | 3300005354 | Bacteria | 2039 |
| 77 | Ga0070675_100324266 | 3300005354 | Bacteria | 1361 |
| 78 | Ga0070675_100678412 | 3300005354 | Unclassified | 938 |
| 79 | Ga0070671_100038666 | 3300005355 | Unclassified | 3960 |
| 80 | Ga0070674_100021063 | 3300005356 | Bacteria | 4179 |
| 81 | Ga0070674_100042253 | 3300005356 | Bacteria | 3095 |
| 82 | Ga0070674_100138251 | 3300005356 | Bacteria | 1825 |
| 83 | Ga0070674_100185401 | 3300005356 | Bacteria | 1597 |
| 84 | Ga0070674_100207386 | 3300005356 | Bacteria | 1517 |
| 85 | Ga0070674_100526087 | 3300005356 | Unclassified | 989 |
| 86 | Ga0070674_100570608 | 3300005356 | Bacteria | 952 |
| 87 | Ga0070673_100076822 | 3300005364 | Bacteria | 2698 |
| 88 | Ga0070673_100115118 | 3300005364 | Unclassified | 2235 |
| 89 | Ga0070673_100706641 | 3300005364 | Bacteria | 926 |
| 90 | Ga0070673_100929375 | 3300005364 | Bacteria | 808 |
| 91 | Ga0070688_100191509 | 3300005365 | Unclassified | 1425 |
| 92 | Ga0070688_100231008 | 3300005365 | Bacteria | 1308 |
| 93 | Ga0070688_100440543 | 3300005365 | Archaea | 972 |
| 94 | Ga0070659_100028835 | 3300005366 | Bacteria | 4287 |
| 95 | Ga0070659_100176265 | 3300005366 | Bacteria | 1753 |
| 96 | Ga0070659_100240024 | 3300005366 | Unclassified | 1499 |
| 97 | Ga0070667_100039346 | 3300005367 | Bacteria | 3963 |
| 98 | Ga0070667_100070263 | 3300005367 | Bacteria | 2980 |
| 99 | Ga0070667_100178716 | 3300005367 | Bacteria | 1876 |
| 100 | Ga0070667_100312450 | 3300005367 | Unclassified | 1417 |
| 101 | Ga0070667_100437577 | 3300005367 | Bacteria | 1194 |
| 102 | Ga0070667_101003776 | 3300005367 | Bacteria | 779 |
| 103 | Ga0070709_10004528 | 3300005434 | Bacteria | 7501 |
| 104 | Ga0070709_10085085 | 3300005434 | Bacteria | 2073 |
| 105 | Ga0070709_10094195 | 3300005434 | Bacteria | 1981 |
| 106 | Ga0070709_10100821 | 3300005434 | Bacteria | 1923 |
| 107 | Ga0070709_10211787 | 3300005434 | Unclassified | 1378 |
| 108 | Ga0070714_100010303 | 3300005435 | Bacteria | 7386 |
| 109 | Ga0070714_100022981 | 3300005435 | Bacteria | 5117 |
| 110 | Ga0070713_100000476 | 3300005436 | Bacteria | 25546 |
| 111 | Ga0070713_100002315 | 3300005436 | Bacteria | 12404 |
| 112 | Ga0070713_100006228 | 3300005436 | Bacteria | 8257 |
| 113 | Ga0070713_100010679 | 3300005436 | Bacteria | 6648 |
| 114 | Ga0070713_100027416 | 3300005436 | Bacteria | 4485 |
| 115 | Ga0070713_100061664 | 3300005436 | Bacteria | 3138 |
| 116 | Ga0070713_100112879 | 3300005436 | Unclassified | 2372 |
| 117 | Ga0070713_100303749 | 3300005436 | Unclassified | 1470 |
| 118 | Ga0070710_10055150 | 3300005437 | Bacteria | 2245 |
| 119 | Ga0070710_10103941 | 3300005437 | Bacteria | 1696 |
| 120 | Ga0070710_10282206 | 3300005437 | Bacteria | 1078 |
| 121 | Ga0070711_100001229 | 3300005439 | Bacteria | 13841 |
| 122 | Ga0070711_100012400 | 3300005439 | Bacteria | 5324 |
| 123 | Ga0070711_100020175 | 3300005439 | Bacteria | 4291 |
| 124 | Ga0070711_100085993 | 3300005439 | Bacteria | 2254 |
| 125 | Ga0070711_100096083 | 3300005439 | Unclassified | 2146 |
| 126 | Ga0070711_100171290 | 3300005439 | Bacteria | 1655 |
| 127 | Ga0070711_100580419 | 3300005439 | Bacteria | 933 |
| 128 | Ga0070705_100025568 | 3300005440 | Bacteria | 3202 |
| 129 | Ga0070705_100838298 | 3300005440 | Bacteria | 734 |
| 130 | Ga0070700_100206395 | 3300005441 | Unclassified | 1384 |
| 131 | Ga0070694_100168163 | 3300005444 | Bacteria | 1613 |
| 132 | Ga0070694_100260297 | 3300005444 | Bacteria | 1316 |
| 133 | Ga0070708_100003651 | 3300005445 | Bacteria | 12067 |
| 134 | Ga0070708_100012948 | 3300005445 | Bacteria | 6815 |
| 135 | Ga0070708_100114524 | 3300005445 | Unclassified | 2481 |
| 136 | Ga0070708_100282380 | 3300005445 | Unclassified | 1563 |
| 137 | Ga0070708_100398888 | 3300005445 | Unclassified | 1297 |
| 138 | Ga0070708_100841812 | 3300005445 | Bacteria | 862 |
| 139 | Ga0070663_100081603 | 3300005455 | Unclassified | 2377 |
| 140 | Ga0070678_100165960 | 3300005456 | Bacteria | 1794 |
| 141 | Ga0070678_100294396 | 3300005456 | Unclassified | 1377 |
| 142 | Ga0070678_100343887 | 3300005456 | Bacteria | 1280 |
| 143 | Ga0070662_100122790 | 3300005457 | Unclassified | 1992 |
| 144 | Ga0070662_100520511 | 3300005457 | Bacteria | 994 |
| 145 | Ga0070662_100896278 | 3300005457 | Bacteria | 757 |
| 146 | Ga0070681_10001282 | 3300005458 | Bacteria | 21908 |
| 147 | Ga0070681_10021636 | 3300005458 | Bacteria | 6448 |
| 148 | Ga0070681_10229101 | 3300005458 | Bacteria | 1772 |
| 149 | Ga0070681_10461488 | 3300005458 | Unclassified | 1182 |
| 150 | Ga0070681_10595934 | 3300005458 | Bacteria | 1019 |
| 151 | Ga0068867_100016286 | 3300005459 | Bacteria | 5279 |
| 152 | Ga0068867_100115804 | 3300005459 | Bacteria | 2065 |
| 153 | Ga0068867_100371018 | 3300005459 | Bacteria | 1200 |
| 154 | Ga0068867_100496998 | 3300005459 | Bacteria | 1048 |
| 155 | Ga0070685_10151869 | 3300005466 | Bacteria | 1468 |
| 156 | Ga0070706_100000336 | 3300005467 | Bacteria | 56986 |
| 157 | Ga0070706_100002094 | 3300005467 | Bacteria | 20343 |
| 158 | Ga0070706_100011620 | 3300005467 | Bacteria | 8181 |
| 159 | Ga0070706_100154948 | 3300005467 | Bacteria | 2139 |
| 160 | Ga0070706_100700953 | 3300005467 | Bacteria | 939 |
| 161 | Ga0070707_100019771 | 3300005468 | Bacteria | 6347 |
| 162 | Ga0070707_100075730 | 3300005468 | Bacteria | 3246 |
| 163 | Ga0070707_100086910 | 3300005468 | Bacteria | 3024 |
| 164 | Ga0070707_100219762 | 3300005468 | Bacteria | 1851 |
| 165 | Ga0070707_100505722 | 3300005468 | Unclassified | 1170 |
| 166 | Ga0070698_100005969 | 3300005471 | Bacteria | 13277 |
| 167 | Ga0070698_100053205 | 3300005471 | Bacteria | 4115 |
| 168 | Ga0070698_100413945 | 3300005471 | Unclassified | 1282 |
| 169 | Ga0070698_100436850 | 3300005471 | Bacteria | 1244 |
| 170 | Ga0070698_100679082 | 3300005471 | Archaea | 972 |
| 171 | Ga0070698_101182344 | 3300005471 | Bacteria | 714 |
| 172 | Ga0070699_100016335 | 3300005518 | Bacteria | 6374 |
| 173 | Ga0070699_100116789 | 3300005518 | Bacteria | 2345 |
| 174 | Ga0070699_100548573 | 3300005518 | Unclassified | 1052 |
| 175 | Ga0070679_100192381 | 3300005530 | Unclassified | 2009 |
| 176 | Ga0070679_100821069 | 3300005530 | Bacteria | 873 |
| 177 | Ga0070684_100042934 | 3300005535 | Unclassified | 3905 |
| 178 | Ga0070684_100136934 | 3300005535 | Bacteria | 2213 |
| 179 | Ga0070684_100144776 | 3300005535 | Unclassified | 2150 |
| 180 | Ga0070684_100216622 | 3300005535 | Bacteria | 1746 |
| 181 | Ga0070684_100237953 | 3300005535 | Bacteria | 1663 |
| 182 | Ga0070697_100002395 | 3300005536 | Bacteria | 14440 |
| 183 | Ga0070697_100303155 | 3300005536 | Bacteria | 1373 |
| 184 | Ga0068853_100017653 | 3300005539 | Bacteria | 5890 |
| 185 | Ga0068853_100076896 | 3300005539 | Unclassified | 2915 |
| 186 | Ga0068853_100145598 | 3300005539 | Bacteria | 2129 |
| 187 | Ga0068853_100424039 | 3300005539 | Bacteria | 1248 |
| 188 | Ga0070672_100327674 | 3300005543 | Bacteria | 1302 |
| 189 | Ga0070686_100081065 | 3300005544 | Unclassified | 2148 |
| 190 | Ga0070686_100081297 | 3300005544 | Bacteria | 2146 |
| 191 | Ga0070695_100314543 | 3300005545 | Archaea | 1162 |
| 192 | Ga0070695_100550626 | 3300005545 | Bacteria | 899 |
| 193 | Ga0070695_100822637 | 3300005545 | Bacteria | 745 |
| 194 | Ga0070696_100247781 | 3300005546 | Bacteria | 1346 |
| 195 | Ga0070693_100117218 | 3300005547 | Bacteria | 1647 |
| 196 | Ga0070693_100170205 | 3300005547 | Bacteria | 1394 |
| 197 | Ga0070665_100010604 | 3300005548 | Bacteria | 9329 |
| 198 | Ga0070665_100072788 | 3300005548 | Unclassified | 3444 |
| 199 | Ga0070665_100093044 | 3300005548 | Unclassified | 3019 |
| 200 | Ga0070665_100192917 | 3300005548 | Bacteria | 2038 |
| 201 | Ga0070665_100674556 | 3300005548 | Bacteria | 1047 |
| 202 | Ga0070704_100142667 | 3300005549 | Unclassified | 1872 |
| 203 | Ga0068855_100000234 | 3300005563 | Bacteria | 70713 |
| 204 | Ga0068855_100002034 | 3300005563 | Bacteria | 25069 |
| 205 | Ga0068855_100056475 | 3300005563 | Unclassified | 4606 |
| 206 | Ga0068855_100069495 | 3300005563 | Bacteria | 4098 |
| 207 | Ga0068855_100179856 | 3300005563 | Unclassified | 2392 |
| 208 | Ga0068855_100253212 | 3300005563 | Bacteria | 1964 |
| 209 | Ga0068855_100296142 | 3300005563 | Bacteria | 1793 |
| 210 | Ga0068855_100772636 | 3300005563 | Bacteria | 1023 |
| 211 | Ga0070664_100067532 | 3300005564 | Bacteria | 3056 |
| 212 | Ga0070664_100236860 | 3300005564 | Unclassified | 1637 |
| 213 | Ga0070664_100289046 | 3300005564 | Bacteria | 1480 |
| 214 | Ga0070664_100443036 | 3300005564 | Bacteria | 1192 |
| 215 | Ga0070664_100588828 | 3300005564 | Archaea | 1031 |
| 216 | Ga0068857_100004869 | 3300005577 | Bacteria | 11390 |
| 217 | Ga0068857_100024993 | 3300005577 | Bacteria | 5261 |
| 218 | Ga0068857_100034785 | 3300005577 | Plasmid | 4457 |
| 219 | Ga0068857_100218410 | 3300005577 | Bacteria | 1740 |
| 220 | Ga0068857_100630244 | 3300005577 | Bacteria | 1015 |
| 221 | Ga0068854_100047266 | 3300005578 | Bacteria | 3067 |
| 222 | Ga0068854_100107675 | 3300005578 | Unclassified | 2098 |
| 223 | Ga0068854_100140500 | 3300005578 | Bacteria | 1853 |
| 224 | Ga0068856_100000062 | 3300005614 | Bacteria | 100769 |
| 225 | Ga0068856_100002175 | 3300005614 | Bacteria | 20318 |
| 226 | Ga0068856_100015026 | 3300005614 | Bacteria | 7478 |
| 227 | Ga0068856_100119422 | 3300005614 | Unclassified | 2637 |
| 228 | Ga0068856_100295053 | 3300005614 | Bacteria | 1638 |
| 229 | Ga0068856_100322867 | 3300005614 | Bacteria | 1561 |
| 230 | Ga0068856_100343939 | 3300005614 | Unclassified | 1510 |
| 231 | Ga0068856_100415250 | 3300005614 | Bacteria | 1366 |
| 232 | Ga0068856_100794215 | 3300005614 | Bacteria | 966 |
| 233 | Ga0068852_100016336 | 3300005616 | Bacteria | 5784 |
| 234 | Ga0068852_100107871 | 3300005616 | Bacteria | 2527 |
| 235 | Ga0068852_100382014 | 3300005616 | Unclassified | 1382 |
| 236 | Ga0068852_100520460 | 3300005616 | Unclassified | 1187 |
| 237 | Ga0068859_100035429 | 3300005617 | Bacteria | 5008 |
| 238 | Ga0068859_100054101 | 3300005617 | Bacteria | 4037 |
| 239 | Ga0068859_100057994 | 3300005617 | Bacteria | 3900 |
| 240 | Ga0068859_100217011 | 3300005617 | Bacteria | 2000 |
| 241 | Ga0068859_101111204 | 3300005617 | Bacteria | 870 |
| 242 | Ga0068864_100012733 | 3300005618 | Bacteria | 6954 |
| 243 | Ga0068864_100113454 | 3300005618 | Unclassified | 2416 |
| 244 | Ga0068864_100360602 | 3300005618 | Bacteria | 1373 |
| 245 | Ga0068864_100382057 | 3300005618 | Unclassified | 1335 |
| 246 | Ga0068864_101378383 | 3300005618 | Bacteria | 707 |
| 247 | Ga0068866_10024028 | 3300005718 | Unclassified | 2842 |
| 248 | Ga0068866_10266486 | 3300005718 | Bacteria | 1055 |
| 249 | Ga0068866_10538506 | 3300005718 | Unclassified | 779 |
| 250 | Ga0068861_100148732 | 3300005719 | Unclassified | 1919 |
| 251 | Ga0068851_10059333 | 3300005834 | Unclassified | 1957 |
| 252 | Ga0068851_10263551 | 3300005834 | Unclassified | 981 |
| 253 | Ga0068863_100209381 | 3300005841 | Unclassified | 1877 |
| 254 | Ga0068863_100456329 | 3300005841 | Bacteria | 1255 |
| 255 | Ga0068863_100844130 | 3300005841 | Bacteria | 915 |
| 256 | Ga0068858_100001351 | 3300005842 | Bacteria | 25297 |
| 257 | Ga0068858_100005875 | 3300005842 | Bacteria | 11983 |
| 258 | Ga0068858_100013703 | 3300005842 | Bacteria | 7652 |
| 259 | Ga0068858_100014019 | 3300005842 | Bacteria | 7563 |
| 260 | Ga0068858_100016583 | 3300005842 | Bacteria | 6919 |
| 261 | Ga0068858_100030640 | 3300005842 | Unclassified | 4996 |
| 262 | Ga0068858_100041052 | 3300005842 | Bacteria | 4291 |
| 263 | Ga0068858_100062768 | 3300005842 | Bacteria | 3436 |
| 264 | Ga0068858_100829267 | 3300005842 | Bacteria | 903 |
| 265 | Ga0068860_100080997 | 3300005843 | Unclassified | 3087 |
| 266 | Ga0068860_100098272 | 3300005843 | Bacteria | 2792 |
| 267 | Ga0068860_100187714 | 3300005843 | Bacteria | 1999 |
| 268 | Ga0068860_100263661 | 3300005843 | Bacteria | 1680 |
| 269 | Ga0068862_100173830 | 3300005844 | Unclassified | 1929 |
| 270 | Ga0068862_100633500 | 3300005844 | Bacteria | 1030 |
| 271 | Ga0068862_101074491 | 3300005844 | Bacteria | 799 |
| 272 | Ga0068862_101127237 | 3300005844 | Bacteria | 780 |
| 273 | Ga0068862_101228307 | 3300005844 | Archaea | 749 |
| 274 | Ga0081455_10299917 | 3300005937 | Bacteria | 1153 |
| 275 | Ga0081538_10004787 | 3300005981 | Bacteria | 12368 |
| 276 | Ga0081538_10111330 | 3300005981 | Unclassified | 1343 |
| 277 | Ga0070717_10049718 | 3300006028 | Bacteria | 3443 |
| 278 | Ga0070717_10274455 | 3300006028 | Unclassified | 1494 |
| 279 | Ga0070717_10661895 | 3300006028 | Bacteria | 948 |
| 280 | Ga0070717_10789133 | 3300006028 | Bacteria | 864 |
| 281 | Ga0075432_10037531 | 3300006058 | Bacteria | 1687 |
| 282 | Ga0070715_10005284 | 3300006163 | Unclassified | 4294 |
| 283 | Ga0070715_10040341 | 3300006163 | Unclassified | 1951 |
| 284 | Ga0070715_10104239 | 3300006163 | Bacteria | 1328 |
| 285 | Ga0070715_10162073 | 3300006163 | Bacteria | 1106 |
| 286 | Ga0070716_100010782 | 3300006173 | Bacteria | 4594 |
| 287 | Ga0070716_100036212 | 3300006173 | Bacteria | 2720 |
| 288 | Ga0070716_100046742 | 3300006173 | Bacteria | 2438 |
| 289 | Ga0070716_100100120 | 3300006173 | Bacteria | 1775 |
| 290 | Ga0070716_100130440 | 3300006173 | Bacteria | 1588 |
| 291 | Ga0070716_100191238 | 3300006173 | Bacteria | 1352 |
| 292 | Ga0070712_100000468 | 3300006175 | Bacteria | 23267 |
| 293 | Ga0070712_100002849 | 3300006175 | Bacteria | 10703 |
| 294 | Ga0070712_100010616 | 3300006175 | Bacteria | 5817 |
| 295 | Ga0070712_100011228 | 3300006175 | Bacteria | 5671 |
| 296 | Ga0070712_100458188 | 3300006175 | Bacteria | 1063 |
| 297 | Ga0097621_100000196 | 3300006237 | Bacteria | 39296 |
| 298 | Ga0097621_100000326 | 3300006237 | Bacteria | 32263 |
| 299 | Ga0097621_100004631 | 3300006237 | Bacteria | 9599 |
| 300 | Ga0097621_100009851 | 3300006237 | Bacteria | 6956 |
| 301 | Ga0097621_100016167 | 3300006237 | Bacteria | 5634 |
| 302 | Ga0097621_100040561 | 3300006237 | Bacteria | 3743 |
| 303 | Ga0097621_100227623 | 3300006237 | Bacteria | 1627 |
| 304 | Ga0097621_100270334 | 3300006237 | Unclassified | 1493 |
| 305 | Ga0097621_100311448 | 3300006237 | Unclassified | 1393 |
| 306 | Ga0097621_100703468 | 3300006237 | Bacteria | 930 |
| 307 | Ga0068871_100000049 | 3300006358 | Bacteria | 65954 |
| 308 | Ga0068871_100003703 | 3300006358 | Bacteria | 10510 |
| 309 | Ga0068871_100014760 | 3300006358 | Bacteria | 5830 |
| 310 | Ga0068871_100031326 | 3300006358 | Bacteria | 4193 |
| 311 | Ga0068871_100069642 | 3300006358 | Unclassified | 2890 |
| 312 | Ga0068871_100089885 | 3300006358 | Bacteria | 2557 |
| 313 | Ga0068871_100181118 | 3300006358 | Unclassified | 1811 |
| 314 | Ga0068871_100223685 | 3300006358 | Unclassified | 1631 |
| 315 | Ga0068871_100262813 | 3300006358 | Bacteria | 1506 |
| 316 | Ga0068871_100388514 | 3300006358 | Bacteria | 1241 |
| 317 | Ga0075428_100001864 | 3300006844 | Bacteria | 22582 |
| 318 | Ga0075428_100046952 | 3300006844 | Bacteria | 4743 |
| 319 | Ga0075430_100001987 | 3300006846 | Bacteria | 16844 |
| 320 | Ga0075430_100432902 | 3300006846 | Bacteria | 1086 |
| 321 | Ga0075430_100762082 | 3300006846 | Bacteria | 798 |
| 322 | Ga0075431_100002526 | 3300006847 | Bacteria | 17651 |
| 323 | Ga0075431_100021655 | 3300006847 | Bacteria | 6574 |
| 324 | Ga0075431_100535336 | 3300006847 | Archaea | 1160 |
| 325 | Ga0075431_100646080 | 3300006847 | Bacteria | 1039 |
| 326 | Ga0075431_100834282 | 3300006847 | Bacteria | 894 |
| 327 | Ga0075431_100862204 | 3300006847 | Bacteria | 876 |
| 328 | Ga0075433_10064114 | 3300006852 | Bacteria | 3220 |
| 329 | Ga0075433_10213879 | 3300006852 | Bacteria | 1713 |
| 330 | Ga0075433_10552307 | 3300006852 | Bacteria | 1012 |
| 331 | Ga0075433_10743957 | 3300006852 | Bacteria | 858 |
| 332 | Ga0075434_100127862 | 3300006871 | Unclassified | 2558 |
| 333 | Ga0075434_100140467 | 3300006871 | Unclassified | 2434 |
| 334 | Ga0075434_100315925 | 3300006871 | Bacteria | 1583 |
| 335 | Ga0075434_100326366 | 3300006871 | Bacteria | 1555 |
| 336 | Ga0075429_100001764 | 3300006880 | Bacteria | 17910 |
| 337 | Ga0075429_100292237 | 3300006880 | Bacteria | 1427 |
| 338 | Ga0068865_100005640 | 3300006881 | Bacteria | 7596 |
| 339 | Ga0068865_100096344 | 3300006881 | Unclassified | 2157 |
| 340 | Ga0075436_100086852 | 3300006914 | Bacteria | 2173 |
| 341 | Ga0075436_100089193 | 3300006914 | Unclassified | 2142 |
| 342 | Ga0075436_100150028 | 3300006914 | Unclassified | 1640 |
| 343 | Ga0097620_100035431 | 3300006931 | Bacteria | 5008 |
| 344 | Ga0097620_100054103 | 3300006931 | Bacteria | 4037 |
| 345 | Ga0097620_100057994 | 3300006931 | Bacteria | 3900 |
| 346 | Ga0097620_100216996 | 3300006931 | Bacteria | 2000 |
| 347 | Ga0097620_100657641 | 3300006931 | Bacteria | 1140 |
| 348 | Ga0097620_101111243 | 3300006931 | Bacteria | 870 |
| 349 | Ga0075435_100016798 | 3300007076 | Bacteria | 5522 |
| 350 | Ga0075435_100047716 | 3300007076 | Bacteria | 3439 |
| 351 | Ga0075435_100109848 | 3300007076 | Bacteria | 2293 |
| 352 | Ga0075435_100226805 | 3300007076 | Bacteria | 1587 |
| 353 | Ga0099794_10132741 | 3300007265 | Bacteria | 1258 |
| 354 | Ga0099794_10194871 | 3300007265 | Unclassified | 1037 |
| 355 | Ga0105240_10013638 | 3300009093 | Bacteria | 11145 |
| 356 | Ga0105240_10053160 | 3300009093 | Bacteria | 5086 |
| 357 | Ga0105240_10082073 | 3300009093 | Bacteria | 3959 |
| 358 | Ga0105240_10101427 | 3300009093 | Unclassified | 3500 |
| 359 | Ga0105240_10136198 | 3300009093 | Unclassified | 2941 |
| 360 | Ga0105240_10142109 | 3300009093 | Bacteria | 2869 |
| 361 | Ga0105240_10229600 | 3300009093 | Bacteria | 2158 |
| 362 | Ga0111539_10028455 | 3300009094 | Bacteria | 6817 |
| 363 | Ga0111539_10198586 | 3300009094 | Bacteria | 2339 |
| 364 | Ga0105245_10004807 | 3300009098 | Bacteria | 11921 |
| 365 | Ga0105245_10015180 | 3300009098 | Bacteria | 6710 |
| 366 | Ga0105245_10110472 | 3300009098 | Unclassified | 2556 |
| 367 | Ga0105245_10165092 | 3300009098 | Unclassified | 2104 |
| 368 | Ga0105245_10177367 | 3300009098 | Unclassified | 2033 |
| 369 | Ga0105245_10314329 | 3300009098 | Unclassified | 1541 |
| 370 | Ga0105245_10453835 | 3300009098 | Bacteria | 1291 |
| 371 | Ga0105245_11346697 | 3300009098 | Unclassified | 763 |
| 372 | Ga0105247_10023620 | 3300009101 | Unclassified | 3705 |
| 373 | Ga0105247_10081807 | 3300009101 | Unclassified | 2037 |
| 374 | Ga0105247_10168935 | 3300009101 | Bacteria | 1453 |
| 375 | Ga0105247_10322688 | 3300009101 | Bacteria | 1078 |
| 376 | Ga0114129_10005337 | 3300009147 | Bacteria | 18137 |
| 377 | Ga0114129_10050270 | 3300009147 | Bacteria | 5855 |
| 378 | Ga0114129_10136553 | 3300009147 | Bacteria | 3365 |
| 379 | Ga0114129_10178370 | 3300009147 | Bacteria | 2892 |
| 380 | Ga0114129_10603688 | 3300009147 | Bacteria | 1421 |
| 381 | Ga0114129_10885826 | 3300009147 | Bacteria | 1132 |
| 382 | Ga0114129_10991711 | 3300009147 | Bacteria | 1058 |
| 383 | Ga0114129_11698884 | 3300009147 | Archaea | 770 |
| 384 | Ga0105241_10006410 | 3300009174 | Bacteria | 8675 |
| 385 | Ga0105241_10007930 | 3300009174 | Bacteria | 7807 |
| 386 | Ga0105241_10032434 | 3300009174 | Bacteria | 3916 |
| 387 | Ga0105241_10071177 | 3300009174 | Bacteria | 2699 |
| 388 | Ga0105241_10862668 | 3300009174 | Unclassified | 838 |
| 389 | Ga0105242_10001360 | 3300009176 | Bacteria | 19285 |
| 390 | Ga0105242_10020549 | 3300009176 | Bacteria | 5179 |
| 391 | Ga0105242_10107701 | 3300009176 | Bacteria | 2371 |
| 392 | Ga0105242_10183038 | 3300009176 | Bacteria | 1850 |
| 393 | Ga0105242_10250564 | 3300009176 | Unclassified | 1595 |
| 394 | Ga0105242_10421949 | 3300009176 | Unclassified | 1250 |
| 395 | Ga0105242_10770472 | 3300009176 | Bacteria | 949 |
| 396 | Ga0105242_10796407 | 3300009176 | Bacteria | 935 |
| 397 | Ga0105248_10007399 | 3300009177 | Bacteria | 12048 |
| 398 | Ga0105248_10010283 | 3300009177 | Bacteria | 10301 |
| 399 | Ga0105248_10014774 | 3300009177 | Bacteria | 8597 |
| 400 | Ga0105248_10083640 | 3300009177 | Bacteria | 3590 |
| 401 | Ga0105248_10112872 | 3300009177 | Bacteria | 3065 |
| 402 | Ga0105248_10179053 | 3300009177 | Bacteria | 2389 |
| 403 | Ga0105248_10179687 | 3300009177 | Unclassified | 2384 |
| 404 | Ga0105248_10410923 | 3300009177 | Unclassified | 1524 |
| 405 | Ga0105248_11028031 | 3300009177 | Unclassified | 931 |
| 406 | Ga0105248_11092616 | 3300009177 | Bacteria | 901 |
| 407 | Ga0105237_10005536 | 3300009545 | Bacteria | 14239 |
| 408 | Ga0105237_10019805 | 3300009545 | Bacteria | 6946 |
| 409 | Ga0105237_10087881 | 3300009545 | Bacteria | 3097 |
| 410 | Ga0105237_10088398 | 3300009545 | Bacteria | 3088 |
| 411 | Ga0105237_10503999 | 3300009545 | Unclassified | 1217 |
| 412 | Ga0105237_10506995 | 3300009545 | Bacteria | 1213 |
| 413 | Ga0105238_10000609 | 3300009551 | Bacteria | 37550 |
| 414 | Ga0105238_10001919 | 3300009551 | Bacteria | 20874 |
| 415 | Ga0105238_10004737 | 3300009551 | Bacteria | 13456 |
| 416 | Ga0105238_10038817 | 3300009551 | Unclassified | 4835 |
| 417 | Ga0105238_10093868 | 3300009551 | Unclassified | 2988 |
| 418 | Ga0105238_10619547 | 3300009551 | Bacteria | 1091 |
| 419 | Ga0105238_10880803 | 3300009551 | Unclassified | 913 |
| 420 | Ga0105249_10006270 | 3300009553 | Bacteria | 10329 |
| 421 | Ga0105249_10053613 | 3300009553 | Bacteria | 3686 |
| 422 | Ga0105239_10074194 | 3300010375 | Bacteria | 3741 |
| 423 | Ga0105239_10158181 | 3300010375 | Unclassified | 2531 |
| 424 | Ga0105239_10292327 | 3300010375 | Bacteria | 1835 |
| 425 | Ga0105239_10348132 | 3300010375 | Unclassified | 1673 |
| 426 | Ga0105239_10835899 | 3300010375 | Bacteria | 1056 |
| 427 | Ga0105246_10147378 | 3300011119 | Unclassified | 1778 |
| 428 | Ga0105246_10740334 | 3300011119 | Bacteria | 866 |
| 429 | Ga0157373_10032661 | 3300013100 | Bacteria | 3745 |
| 430 | Ga0157371_10036625 | 3300013102 | Unclassified | 3513 |
| 431 | Ga0157371_10122559 | 3300013102 | Bacteria | 1849 |
| 432 | Ga0157370_10034683 | 3300013104 | Bacteria | 4910 |
| 433 | Ga0157370_10089656 | 3300013104 | Bacteria | 2889 |
| 434 | Ga0157370_10151310 | 3300013104 | Unclassified | 2159 |
| 435 | Ga0157370_10505366 | 3300013104 | Bacteria | 1110 |
| 436 | Ga0157369_10000159 | 3300013105 | Bacteria | 95759 |
| 437 | Ga0157369_10106983 | 3300013105 | Bacteria | 2976 |
| 438 | Ga0157369_10204196 | 3300013105 | Unclassified | 2073 |
| 439 | Ga0157374_10000062 | 3300013296 | Bacteria | 112028 |
| 440 | Ga0157374_10000338 | 3300013296 | Bacteria | 43326 |
| 441 | Ga0157374_10015683 | 3300013296 | Bacteria | 6652 |
| 442 | Ga0157374_10018947 | 3300013296 | Bacteria | 6086 |
| 443 | Ga0157374_10053283 | 3300013296 | Bacteria | 3771 |
| 444 | Ga0157374_10067662 | 3300013296 | Bacteria | 3359 |
| 445 | Ga0157374_10068261 | 3300013296 | Bacteria | 3345 |
| 446 | Ga0157374_10141625 | 3300013296 | Bacteria | 2334 |
| 447 | Ga0157374_10142843 | 3300013296 | Bacteria | 2324 |
| 448 | Ga0157374_10181087 | 3300013296 | Unclassified | 2058 |
| 449 | Ga0157378_10000899 | 3300013297 | Bacteria | 27398 |
| 450 | Ga0157378_10004757 | 3300013297 | Bacteria | 11898 |
| 451 | Ga0157378_10006834 | 3300013297 | Bacteria | 9951 |
| 452 | Ga0157378_10044978 | 3300013297 | Unclassified | 3922 |
| 453 | Ga0157378_10154309 | 3300013297 | Unclassified | 2142 |
| 454 | Ga0157378_10381251 | 3300013297 | Bacteria | 1385 |
| 455 | Ga0157378_10907008 | 3300013297 | Bacteria | 912 |
| 456 | Ga0157378_11844526 | 3300013297 | Bacteria | 653 |
| 457 | Ga0163162_10005046 | 3300013306 | Bacteria | 12720 |
| 458 | Ga0163162_10069684 | 3300013306 | Bacteria | 3569 |
| 459 | Ga0163162_10126568 | 3300013306 | Unclassified | 2662 |
| 460 | Ga0163162_10243305 | 3300013306 | Bacteria | 1930 |
| 461 | Ga0163162_10477774 | 3300013306 | Bacteria | 1378 |
| 462 | Ga0157372_10000845 | 3300013307 | Bacteria | 33235 |
| 463 | Ga0157372_10003611 | 3300013307 | Bacteria | 16654 |
| 464 | Ga0157372_10051671 | 3300013307 | Bacteria | 4574 |
| 465 | Ga0157372_10168063 | 3300013307 | Unclassified | 2537 |
| 466 | Ga0157372_10355799 | 3300013307 | Unclassified | 1706 |
| 467 | Ga0157375_10014565 | 3300013308 | Bacteria | 7020 |
| 468 | Ga0157375_10126187 | 3300013308 | Unclassified | 2674 |
| 469 | Ga0157375_10217189 | 3300013308 | Bacteria | 2070 |
| 470 | Ga0157375_10409442 | 3300013308 | Unclassified | 1522 |
| 471 | Ga0157375_11799490 | 3300013308 | Bacteria | 726 |
| 472 | Ga0163163_10003604 | 3300014325 | Bacteria | 13157 |
| 473 | Ga0163163_10012690 | 3300014325 | Bacteria | 7686 |
| 474 | Ga0163163_10015653 | 3300014325 | Bacteria | 7020 |
| 475 | Ga0163163_10030748 | 3300014325 | Bacteria | 5177 |
| 476 | Ga0163163_10219167 | 3300014325 | Archaea | 1951 |
| 477 | Ga0163163_10422188 | 3300014325 | Bacteria | 1392 |
| 478 | Ga0163163_10433870 | 3300014325 | Bacteria | 1373 |
| 479 | Ga0157380_10030037 | 3300014326 | Bacteria | 4159 |
| 480 | Ga0157380_10168539 | 3300014326 | Unclassified | 1911 |
| 481 | Ga0157380_10194571 | 3300014326 | Bacteria | 1793 |
| 482 | Ga0157380_10209000 | 3300014326 | Bacteria | 1738 |
| 483 | Ga0157380_10343519 | 3300014326 | Bacteria | 1393 |
| 484 | Ga0157377_10069961 | 3300014745 | Unclassified | 2026 |
| 485 | Ga0157377_10136077 | 3300014745 | Bacteria | 1505 |
| 486 | Ga0157377_10150047 | 3300014745 | Unclassified | 1440 |
| 487 | Ga0157379_10009128 | 3300014968 | Bacteria | 8635 |
| 488 | Ga0157379_10028247 | 3300014968 | Unclassified | 4993 |
| 489 | Ga0157379_10031582 | 3300014968 | Bacteria | 4719 |
| 490 | Ga0157379_10133860 | 3300014968 | Bacteria | 2233 |
| 491 | Ga0157379_10248078 | 3300014968 | Unclassified | 1616 |
| 492 | Ga0157379_10413630 | 3300014968 | Bacteria | 1241 |
| 493 | Ga0157376_10013516 | 3300014969 | Bacteria | 6094 |
| 494 | Ga0157376_10013883 | 3300014969 | Bacteria | 6023 |
| 495 | Ga0157376_10025386 | 3300014969 | Bacteria | 4666 |
| 496 | Ga0157376_10099913 | 3300014969 | Bacteria | 2532 |
| 497 | Ga0157376_10176084 | 3300014969 | Bacteria | 1951 |
| 498 | Ga0157376_10378299 | 3300014969 | Bacteria | 1363 |
| 499 | Ga0157376_10393522 | 3300014969 | Unclassified | 1338 |
| 500 | Ga0163161_10729832 | 3300017792 | Bacteria | 827 |
| 501 | Ga0197907_10251813 | 3300020069 | Bacteria | 1138 |
| 502 | Ga0197907_11172755 | 3300020069 | Unclassified | 1872 |
| 503 | Ga0206356_10151869 | 3300020070 | Bacteria | 2025 |
| 504 | Ga0206356_10692860 | 3300020070 | Unclassified | 1187 |
| 505 | Ga0206356_11883262 | 3300020070 | Bacteria | 1193 |
| 506 | Ga0206349_1564724 | 3300020075 | Bacteria | 757 |
| 507 | Ga0206349_1753059 | 3300020075 | Unclassified | 845 |
| 508 | Ga0206355_1664126 | 3300020076 | Unclassified | 955 |
| 509 | Ga0206351_10013904 | 3300020077 | Unclassified | 953 |
| 510 | Ga0206352_10544006 | 3300020078 | Unclassified | 803 |
| 511 | Ga0206352_11071978 | 3300020078 | Bacteria | 1869 |
| 512 | Ga0206352_11289791 | 3300020078 | Unclassified | 876 |
| 513 | Ga0206350_11488832 | 3300020080 | Bacteria | 1501 |
| 514 | Ga0206353_10475100 | 3300020082 | Bacteria | 700 |
| 515 | Ga0224712_10117674 | 3300022467 | Bacteria | 1147 |
| 516 | Ga0224712_10207188 | 3300022467 | Unclassified | 893 |
| 517 | Ga0228598_1002817 | 3300024227 | Unclassified | 3770 |
| 518 | Ga0207673_1016925 | 3300025290 | Bacteria | 971 |
| 519 | Ga0207697_10150692 | 3300025315 | Bacteria | 1012 |
| 520 | Ga0207682_10006285 | 3300025893 | Bacteria | 4796 |
| 521 | Ga0207692_10053074 | 3300025898 | Bacteria | 2063 |
| 522 | Ga0207642_10285751 | 3300025899 | Unclassified | 950 |
| 523 | Ga0207710_10019087 | 3300025900 | Bacteria | 2923 |
| 524 | Ga0207710_10083080 | 3300025900 | Unclassified | 1488 |
| 525 | Ga0207710_10098433 | 3300025900 | Bacteria | 1377 |
| 526 | Ga0207688_10072011 | 3300025901 | Bacteria | 1963 |
| 527 | Ga0207680_10040696 | 3300025903 | Bacteria | 2706 |
| 528 | Ga0207680_10086015 | 3300025903 | Bacteria | 1987 |
| 529 | Ga0207680_10291150 | 3300025903 | Bacteria | 1136 |
| 530 | Ga0207680_10457385 | 3300025903 | Bacteria | 906 |
| 531 | Ga0207680_10628197 | 3300025903 | Bacteria | 769 |
| 532 | Ga0207647_10209184 | 3300025904 | Unclassified | 1127 |
| 533 | Ga0207685_10007869 | 3300025905 | Bacteria | 3001 |
| 534 | Ga0207685_10057240 | 3300025905 | Unclassified | 1528 |
| 535 | Ga0207685_10193992 | 3300025905 | Bacteria | 950 |
| 536 | Ga0207699_10051787 | 3300025906 | Bacteria | 2427 |
| 537 | Ga0207699_10117753 | 3300025906 | Bacteria | 1713 |
| 538 | Ga0207699_10121136 | 3300025906 | Unclassified | 1692 |
| 539 | Ga0207699_10161406 | 3300025906 | Bacteria | 1492 |
| 540 | Ga0207699_10260390 | 3300025906 | Unclassified | 1199 |
| 541 | Ga0207699_10485290 | 3300025906 | Unclassified | 890 |
| 542 | Ga0207699_10500436 | 3300025906 | Unclassified | 877 |
| 543 | Ga0207645_10038174 | 3300025907 | Unclassified | 3080 |
| 544 | Ga0207645_10051956 | 3300025907 | Bacteria | 2619 |
| 545 | Ga0207645_10161521 | 3300025907 | Bacteria | 1466 |
| 546 | Ga0207645_10476365 | 3300025907 | Bacteria | 844 |
| 547 | Ga0207643_10123254 | 3300025908 | Bacteria | 1537 |
| 548 | Ga0207684_10000320 | 3300025910 | Bacteria | 68296 |
| 549 | Ga0207684_10004878 | 3300025910 | Bacteria | 12535 |
| 550 | Ga0207684_10163597 | 3300025910 | Bacteria | 1917 |
| 551 | Ga0207684_10200658 | 3300025910 | Bacteria | 1721 |
| 552 | Ga0207684_10411180 | 3300025910 | Unclassified | 1163 |
| 553 | Ga0207684_10623868 | 3300025910 | Bacteria | 920 |
| 554 | Ga0207654_10004482 | 3300025911 | Bacteria | 7050 |
| 555 | Ga0207654_10011027 | 3300025911 | Unclassified | 4600 |
| 556 | Ga0207654_10011326 | 3300025911 | Bacteria | 4550 |
| 557 | Ga0207654_10048092 | 3300025911 | Unclassified | 2440 |
| 558 | Ga0207707_10001452 | 3300025912 | Bacteria | 21916 |
| 559 | Ga0207707_10022348 | 3300025912 | Bacteria | 5529 |
| 560 | Ga0207707_10029531 | 3300025912 | Unclassified | 4795 |
| 561 | Ga0207707_10070345 | 3300025912 | Unclassified | 3049 |
| 562 | Ga0207707_10176006 | 3300025912 | Unclassified | 1869 |
| 563 | Ga0207707_10268375 | 3300025912 | Bacteria | 1479 |
| 564 | Ga0207707_10361356 | 3300025912 | Bacteria | 1250 |
| 565 | Ga0207695_10036539 | 3300025913 | Bacteria | 5310 |
| 566 | Ga0207695_10189123 | 3300025913 | Bacteria | 1977 |
| 567 | Ga0207695_10222679 | 3300025913 | Unclassified | 1793 |
| 568 | Ga0207695_10335661 | 3300025913 | Unclassified | 1400 |
| 569 | Ga0207671_10025824 | 3300025914 | Bacteria | 4408 |
| 570 | Ga0207671_10031521 | 3300025914 | Bacteria | 3950 |
| 571 | Ga0207671_10091082 | 3300025914 | Bacteria | 2297 |
| 572 | Ga0207671_10120902 | 3300025914 | Unclassified | 2002 |
| 573 | Ga0207671_10160495 | 3300025914 | Unclassified | 1741 |
| 574 | Ga0207671_10363056 | 3300025914 | Unclassified | 1149 |
| 575 | Ga0207693_10000008 | 3300025915 | Bacteria | 171049 |
| 576 | Ga0207693_10001167 | 3300025915 | Bacteria | 23425 |
| 577 | Ga0207693_10014819 | 3300025915 | Bacteria | 6264 |
| 578 | Ga0207693_10017337 | 3300025915 | Bacteria | 5743 |
| 579 | Ga0207693_10529541 | 3300025915 | Bacteria | 919 |
| 580 | Ga0207663_10006731 | 3300025916 | Bacteria | 5907 |
| 581 | Ga0207663_10041868 | 3300025916 | Bacteria | 2794 |
| 582 | Ga0207663_10063738 | 3300025916 | Bacteria | 2349 |
| 583 | Ga0207663_10261780 | 3300025916 | Bacteria | 1277 |
| 584 | Ga0207660_10054783 | 3300025917 | Bacteria | 2847 |
| 585 | Ga0207660_10102627 | 3300025917 | Unclassified | 2138 |
| 586 | Ga0207660_10150531 | 3300025917 | Unclassified | 1787 |
| 587 | Ga0207662_10140899 | 3300025918 | Bacteria | 1527 |
| 588 | Ga0207662_10194591 | 3300025918 | Unclassified | 1310 |
| 589 | Ga0207657_10000386 | 3300025919 | Bacteria | 46458 |
| 590 | Ga0207657_10002009 | 3300025919 | Bacteria | 21997 |
| 591 | Ga0207657_10101401 | 3300025919 | Bacteria | 2389 |
| 592 | Ga0207657_10529757 | 3300025919 | Unclassified | 922 |
| 593 | Ga0207652_10039969 | 3300025921 | Bacteria | 3983 |
| 594 | Ga0207652_10041980 | 3300025921 | Unclassified | 3890 |
| 595 | Ga0207652_10051209 | 3300025921 | Bacteria | 3540 |
| 596 | Ga0207652_10344516 | 3300025921 | Unclassified | 1345 |
| 597 | Ga0207652_10814602 | 3300025921 | Unclassified | 828 |
| 598 | Ga0207646_10075945 | 3300025922 | Bacteria | 3003 |
| 599 | Ga0207646_10100259 | 3300025922 | Bacteria | 2596 |
| 600 | Ga0207646_10203286 | 3300025922 | Bacteria | 1789 |
| 601 | Ga0207646_10589251 | 3300025922 | Unclassified | 998 |
| 602 | Ga0207681_10185130 | 3300025923 | Bacteria | 1589 |
| 603 | Ga0207681_10225877 | 3300025923 | Bacteria | 1451 |
| 604 | Ga0207681_10252515 | 3300025923 | Bacteria | 1377 |
| 605 | Ga0207681_10347897 | 3300025923 | Bacteria | 1186 |
| 606 | Ga0207694_10003298 | 3300025924 | Bacteria | 12840 |
| 607 | Ga0207694_10004655 | 3300025924 | Bacteria | 10681 |
| 608 | Ga0207694_10037891 | 3300025924 | Bacteria | 3706 |
| 609 | Ga0207694_10097974 | 3300025924 | Unclassified | 2321 |
| 610 | Ga0207694_10115616 | 3300025924 | Bacteria | 2137 |
| 611 | Ga0207694_10463620 | 3300025924 | Unclassified | 1059 |
| 612 | Ga0207694_10859111 | 3300025924 | Unclassified | 767 |
| 613 | Ga0207650_10130016 | 3300025925 | Bacteria | 1970 |
| 614 | Ga0207650_10152616 | 3300025925 | Bacteria | 1824 |
| 615 | Ga0207650_10298109 | 3300025925 | Bacteria | 1316 |
| 616 | Ga0207650_10325940 | 3300025925 | Bacteria | 1259 |
| 617 | Ga0207659_10000642 | 3300025926 | Bacteria | 20752 |
| 618 | Ga0207659_10272297 | 3300025926 | Bacteria | 1381 |
| 619 | Ga0207687_10024093 | 3300025927 | Bacteria | 4063 |
| 620 | Ga0207687_10114092 | 3300025927 | Unclassified | 2011 |
| 621 | Ga0207687_10148704 | 3300025927 | Bacteria | 1785 |
| 622 | Ga0207687_10279221 | 3300025927 | Bacteria | 1338 |
| 623 | Ga0207700_10000107 | 3300025928 | Bacteria | 49976 |
| 624 | Ga0207700_10005218 | 3300025928 | Bacteria | 7743 |
| 625 | Ga0207700_10008994 | 3300025928 | Bacteria | 6218 |
| 626 | Ga0207700_10010119 | 3300025928 | Bacteria | 5931 |
| 627 | Ga0207700_10030141 | 3300025928 | Unclassified | 3838 |
| 628 | Ga0207700_10049225 | 3300025928 | Bacteria | 3134 |
| 629 | Ga0207700_10260313 | 3300025928 | Unclassified | 1485 |
| 630 | Ga0207664_10009130 | 3300025929 | Bacteria | 6946 |
| 631 | Ga0207664_10294572 | 3300025929 | Bacteria | 1426 |
| 632 | Ga0207644_10076117 | 3300025931 | Bacteria | 2468 |
| 633 | Ga0207644_10154407 | 3300025931 | Bacteria | 1779 |
| 634 | Ga0207690_10140095 | 3300025932 | Bacteria | 1781 |
| 635 | Ga0207690_10205198 | 3300025932 | Unclassified | 1499 |
| 636 | Ga0207706_10000641 | 3300025933 | Bacteria | 37090 |
| 637 | Ga0207706_10077742 | 3300025933 | Unclassified | 2918 |
| 638 | Ga0207706_10379760 | 3300025933 | Bacteria | 1226 |
| 639 | Ga0207706_10877345 | 3300025933 | Bacteria | 759 |
| 640 | Ga0207686_10009876 | 3300025934 | Bacteria | 5187 |
| 641 | Ga0207686_10156132 | 3300025934 | Bacteria | 1594 |
| 642 | Ga0207686_10802835 | 3300025934 | Bacteria | 754 |
| 643 | Ga0207709_10027612 | 3300025935 | Unclassified | 3272 |
| 644 | Ga0207709_10571983 | 3300025935 | Unclassified | 891 |
| 645 | Ga0207670_10437818 | 3300025936 | Bacteria | 1052 |
| 646 | Ga0207669_10033461 | 3300025937 | Bacteria | 2901 |
| 647 | Ga0207669_10083316 | 3300025937 | Bacteria | 2056 |
| 648 | Ga0207669_10125100 | 3300025937 | Bacteria | 1755 |
| 649 | Ga0207669_10452917 | 3300025937 | Bacteria | 1017 |
| 650 | Ga0207669_10588358 | 3300025937 | Bacteria | 903 |
| 651 | Ga0207704_10005907 | 3300025938 | Bacteria | 5669 |
| 652 | Ga0207704_10007997 | 3300025938 | Bacteria | 5029 |
| 653 | Ga0207704_10064155 | 3300025938 | Unclassified | 2293 |
| 654 | Ga0207704_10184611 | 3300025938 | Bacteria | 1511 |
| 655 | Ga0207704_10307898 | 3300025938 | Unclassified | 1216 |
| 656 | Ga0207665_10018351 | 3300025939 | Bacteria | 4598 |
| 657 | Ga0207665_10065776 | 3300025939 | Bacteria | 2466 |
| 658 | Ga0207665_10094235 | 3300025939 | Bacteria | 2079 |
| 659 | Ga0207665_10155863 | 3300025939 | Bacteria | 1639 |
| 660 | Ga0207665_10236107 | 3300025939 | Bacteria | 1345 |
| 661 | Ga0207665_10299409 | 3300025939 | Bacteria | 1202 |
| 662 | Ga0207665_10754075 | 3300025939 | Bacteria | 767 |
| 663 | Ga0207691_10047180 | 3300025940 | Bacteria | 3954 |
| 664 | Ga0207691_10309053 | 3300025940 | Bacteria | 1357 |
| 665 | Ga0207711_10006123 | 3300025941 | Bacteria | 10160 |
| 666 | Ga0207711_10015924 | 3300025941 | Bacteria | 6236 |
| 667 | Ga0207711_10072201 | 3300025941 | Unclassified | 2998 |
| 668 | Ga0207711_10131330 | 3300025941 | Bacteria | 2246 |
| 669 | Ga0207711_10166401 | 3300025941 | Unclassified | 1999 |
| 670 | Ga0207711_10191235 | 3300025941 | Bacteria | 1865 |
| 671 | Ga0207711_10207145 | 3300025941 | Bacteria | 1791 |
| 672 | Ga0207711_10221846 | 3300025941 | Unclassified | 1729 |
| 673 | Ga0207711_10329016 | 3300025941 | Bacteria | 1413 |
| 674 | Ga0207711_10401447 | 3300025941 | Unclassified | 1274 |
| 675 | Ga0207711_10703336 | 3300025941 | Bacteria | 943 |
| 676 | Ga0207711_11100190 | 3300025941 | Unclassified | 735 |
| 677 | Ga0207689_10003694 | 3300025942 | Bacteria | 13950 |
| 678 | Ga0207689_10037080 | 3300025942 | Unclassified | 4046 |
| 679 | Ga0207689_10105715 | 3300025942 | Unclassified | 2312 |
| 680 | Ga0207689_10298462 | 3300025942 | Bacteria | 1335 |
| 681 | Ga0207661_10088081 | 3300025944 | Bacteria | 2580 |
| 682 | Ga0207661_10476152 | 3300025944 | Bacteria | 1139 |
| 683 | Ga0207679_10054394 | 3300025945 | Bacteria | 2947 |
| 684 | Ga0207679_10141110 | 3300025945 | Unclassified | 1948 |
| 685 | Ga0207679_10765210 | 3300025945 | Bacteria | 879 |
| 686 | Ga0207679_10997267 | 3300025945 | Bacteria | 768 |
| 687 | Ga0207667_10000465 | 3300025949 | Bacteria | 54509 |
| 688 | Ga0207667_10001399 | 3300025949 | Bacteria | 30243 |
| 689 | Ga0207667_10132120 | 3300025949 | Unclassified | 2571 |
| 690 | Ga0207667_10406056 | 3300025949 | Bacteria | 1387 |
| 691 | Ga0207667_10493349 | 3300025949 | Bacteria | 1242 |
| 692 | Ga0207712_10013471 | 3300025961 | Bacteria | 5243 |
| 693 | Ga0207668_10111420 | 3300025972 | Unclassified | 2054 |
| 694 | Ga0207668_10941433 | 3300025972 | Unclassified | 770 |
| 695 | Ga0207640_10113675 | 3300025981 | Bacteria | 1925 |
| 696 | Ga0207640_10169939 | 3300025981 | Unclassified | 1623 |
| 697 | Ga0207658_10037531 | 3300025986 | Unclassified | 3483 |
| 698 | Ga0207658_10165063 | 3300025986 | Unclassified | 1818 |
| 699 | Ga0207658_10790984 | 3300025986 | Bacteria | 861 |
| 700 | Ga0207677_10011565 | 3300026023 | Bacteria | 5038 |
| 701 | Ga0207677_10019086 | 3300026023 | Unclassified | 4132 |
| 702 | Ga0207677_10024214 | 3300026023 | Bacteria | 3767 |
| 703 | Ga0207677_10081192 | 3300026023 | Bacteria | 2326 |
| 704 | Ga0207677_10273243 | 3300026023 | Bacteria | 1384 |
| 705 | Ga0207703_10001790 | 3300026035 | Bacteria | 19156 |
| 706 | Ga0207703_10003748 | 3300026035 | Bacteria | 12650 |
| 707 | Ga0207703_10009661 | 3300026035 | Bacteria | 7573 |
| 708 | Ga0207703_10014533 | 3300026035 | Bacteria | 6142 |
| 709 | Ga0207703_10063124 | 3300026035 | Bacteria | 3036 |
| 710 | Ga0207703_10086076 | 3300026035 | Unclassified | 2632 |
| 711 | Ga0207703_10444826 | 3300026035 | Bacteria | 1210 |
| 712 | Ga0207703_10481222 | 3300026035 | Unclassified | 1163 |
| 713 | Ga0207703_10801665 | 3300026035 | Bacteria | 899 |
| 714 | Ga0207639_10026749 | 3300026041 | Bacteria | 4194 |
| 715 | Ga0207639_10038873 | 3300026041 | Bacteria | 3542 |
| 716 | Ga0207639_10091787 | 3300026041 | Unclassified | 2432 |
| 717 | Ga0207639_10132909 | 3300026041 | Bacteria | 2062 |
| 718 | Ga0207639_10238155 | 3300026041 | Unclassified | 1581 |
| 719 | Ga0207678_10008144 | 3300026067 | Bacteria | 9241 |
| 720 | Ga0207678_10131308 | 3300026067 | Bacteria | 2137 |
| 721 | Ga0207708_10077097 | 3300026075 | Unclassified | 2558 |
| 722 | Ga0207708_10097684 | 3300026075 | Bacteria | 2270 |
| 723 | Ga0207708_10762541 | 3300026075 | Bacteria | 831 |
| 724 | Ga0207702_10000458 | 3300026078 | Bacteria | 46107 |
| 725 | Ga0207702_10001096 | 3300026078 | Bacteria | 27672 |
| 726 | Ga0207702_10019362 | 3300026078 | Bacteria | 5633 |
| 727 | Ga0207702_10076581 | 3300026078 | Unclassified | 2891 |
| 728 | Ga0207702_10112542 | 3300026078 | Bacteria | 2422 |
| 729 | Ga0207702_10596294 | 3300026078 | Bacteria | 1084 |
| 730 | Ga0207702_10669738 | 3300026078 | Bacteria | 1021 |
| 731 | Ga0207702_10786190 | 3300026078 | Bacteria | 940 |
| 732 | Ga0207641_10155964 | 3300026088 | Unclassified | 2071 |
| 733 | Ga0207641_11402919 | 3300026088 | Bacteria | 699 |
| 734 | Ga0207648_10017102 | 3300026089 | Bacteria | 6609 |
| 735 | Ga0207648_10030982 | 3300026089 | Bacteria | 4731 |
| 736 | Ga0207648_10097212 | 3300026089 | Unclassified | 2577 |
| 737 | Ga0207648_10209028 | 3300026089 | Bacteria | 1732 |
| 738 | Ga0207648_10312881 | 3300026089 | Bacteria | 1410 |
| 739 | Ga0207648_10492278 | 3300026089 | Bacteria | 1121 |
| 740 | Ga0207676_10022322 | 3300026095 | Bacteria | 4654 |
| 741 | Ga0207676_10054554 | 3300026095 | Unclassified | 3133 |
| 742 | Ga0207676_10297396 | 3300026095 | Archaea | 1472 |
| 743 | Ga0207676_10467760 | 3300026095 | Unclassified | 1192 |
| 744 | Ga0207676_11066960 | 3300026095 | Bacteria | 798 |
| 745 | Ga0207674_10005293 | 3300026116 | Bacteria | 15350 |
| 746 | Ga0207674_10007441 | 3300026116 | Bacteria | 12762 |
| 747 | Ga0207674_10022972 | 3300026116 | Bacteria | 6689 |
| 748 | Ga0207674_10072389 | 3300026116 | Unclassified | 3463 |
| 749 | Ga0207674_10151690 | 3300026116 | Bacteria | 2274 |
| 750 | Ga0207674_10584877 | 3300026116 | Bacteria | 1078 |
| 751 | Ga0207674_11078781 | 3300026116 | Bacteria | 772 |
| 752 | Ga0207675_100039718 | 3300026118 | Bacteria | 4392 |
| 753 | Ga0207675_100628649 | 3300026118 | Bacteria | 1079 |
| 754 | Ga0207683_10038555 | 3300026121 | Bacteria | 4166 |
| 755 | Ga0207683_10092953 | 3300026121 | Bacteria | 2688 |
| 756 | Ga0207683_10240964 | 3300026121 | Unclassified | 1650 |
| 757 | Ga0207698_10079771 | 3300026142 | Bacteria | 2634 |
| 758 | Ga0207698_10283269 | 3300026142 | Unclassified | 1534 |
| 759 | Ga0209971_1040676 | 3300027682 | Bacteria | 1118 |
| 760 | Ga0209974_10023030 | 3300027876 | Bacteria | 2062 |
| 761 | Ga0207428_10042299 | 3300027907 | Bacteria | 3684 |
| 762 | Ga0207428_10131434 | 3300027907 | Bacteria | 1915 |
| 763 | Ga0268266_10010487 | 3300028379 | Bacteria | 8098 |
| 764 | Ga0268266_10053468 | 3300028379 | Unclassified | 3470 |
| 765 | Ga0268265_10399849 | 3300028380 | Unclassified | 1269 |
| 766 | Ga0268265_10644291 | 3300028380 | Bacteria | 1018 |
| 767 | Ga0268265_11027162 | 3300028380 | Unclassified | 815 |
| 768 | Ga0268264_10045705 | 3300028381 | Bacteria | 3636 |
| 769 | Ga0268264_10069183 | 3300028381 | Bacteria | 2985 |
| 770 | Ga0268264_10301438 | 3300028381 | Bacteria | 1509 |
| 771 | Ga0268264_10987778 | 3300028381 | Bacteria | 848 |
| 772 | Ga0265319_1025387 | 3300028563 | Unclassified | 2121 |
| 773 | Ga0265338_10027402 | 3300028800 | Bacteria | 5717 |
| 774 | Ga0265338_10305255 | 3300028800 | Unclassified | 1156 |
| 775 | Ga0265762_1009046 | 3300030760 | Unclassified | 1775 |
| 776 | Ga0265760_10009617 | 3300031090 | Bacteria | 2761 |
| 777 | Ga0265760_10047254 | 3300031090 | Bacteria | 1292 |
| 778 | Ga0265325_10004980 | 3300031241 | Bacteria | 8277 |
| 779 | Ga0265331_10264905 | 3300031250 | Unclassified | 770 |
| 780 | Ga0265316_10019518 | 3300031344 | Bacteria | 5795 |
| 781 | Ga0265316_10045014 | 3300031344 | Bacteria | 3506 |
| 782 | Ga0265313_10039017 | 3300031595 | Bacteria | 2360 |
| 783 | Ga0265314_10244879 | 3300031711 | Unclassified | 1032 |
| 784 | Ga0307405_10327176 | 3300031731 | Unclassified | 1173 |
| 785 | Ga0307405_10857614 | 3300031731 | Bacteria | 765 |
| 786 | Ga0307413_10691461 | 3300031824 | Unclassified | 846 |
| 787 | Ga0307410_10514380 | 3300031852 | Unclassified | 987 |
| 788 | Ga0307409_100563940 | 3300031995 | Bacteria | 1120 |
| 789 | Ga0307416_100023471 | 3300032002 | Bacteria | 4477 |
| 790 | Ga0307416_100175283 | 3300032002 | Bacteria | 2002 |
| 791 | Ga0307416_100704517 | 3300032002 | Bacteria | 1099 |
| 792 | Ga0307416_101061173 | 3300032002 | Bacteria | 914 |
| 793 | Ga0307411_10359331 | 3300032005 | Bacteria | 1190 |
| 794 | Ga0307415_100314961 | 3300032126 | Unclassified | 1302 |
| 795 | Ga0316212_1006719 | 3300033547 | Bacteria | 1665 |
| 796 | Ga0373926_0002050 | 3300035083 | Bacteria | 6338 |
| 797 | Ga0373926_0048447 | 3300035083 | Bacteria | 1528 |
| 798 | Ga0373934_0038393 | 3300035086 | Bacteria | 1886 |
| 799 | Ga0373940_0023795 | 3300035088 | Unclassified | 1584 |
| 800 | Ga0373923_0020829 | 3300035111 | Unclassified | 2553 |
| 801 | Ga0373923_0058746 | 3300035111 | Bacteria | 1629 |
| 802 | Ga0373923_0064486 | 3300035111 | Bacteria | 1562 |
| 803 | Ga0373945_0171981 | 3300035116 | Bacteria | 888 |
| 804 | Ga0373953_0067550 | 3300035117 | Bacteria | 1471 |
| 805 | Ga0373954_0019428 | 3300035118 | Bacteria | 3065 |
| 806 | Ga0373954_0044795 | 3300035118 | Bacteria | 2066 |
| 807 | Ga0373954_0098267 | 3300035118 | Bacteria | 1411 |
| 808 | Ga0373956_0039385 | 3300035119 | Bacteria | 2095 |
| 809 | Ga0373960_0087785 | 3300035121 | Bacteria | 990 |
| 810 | Ga0373960_0096923 | 3300035121 | Bacteria | 951 |
| 811 | Ga0373943_0018934 | 3300035170 | Bacteria | 3165 |
| 812 | Ga0373946_0050531 | 3300035171 | Bacteria | 1737 |
| 813 | Ga0373946_0139866 | 3300035171 | Bacteria | 1121 |
| 814 | Ga0373955_0094184 | 3300035172 | Bacteria | 1711 |
| 815 | Ga0373924_0031778 | 3300035410 | Bacteria | 2125 |
| 816 | Ga0373924_0078353 | 3300035410 | Bacteria | 1403 |
| 817 | Ga0373924_0267867 | 3300035410 | Unclassified | 757 |
| 818 | Ga0373931_0105854 | 3300035691 | Unclassified | 1589 |
| 819 | Ga0373931_0225736 | 3300035691 | Unclassified | 1129 |
| 820 | Ga0373931_0238938 | 3300035691 | Bacteria | 1101 |
| 821 | Ga0373935_0016735 | 3300035692 | Unclassified | 4438 |
| 822 | Ga0373935_0025383 | 3300035692 | Bacteria | 3652 |
| 823 | Ga0373935_0464150 | 3300035692 | Bacteria | 916 |
| 824 | Ga0373927_0009510 | 3300035695 | Bacteria | 6518 |
| 825 | Ga0373927_0049369 | 3300035695 | Bacteria | 2721 |
| 826 | Ga0373927_0086616 | 3300035695 | Bacteria | 2033 |
| 827 | Ga0373927_0094343 | 3300035695 | Unclassified | 1944 |
| 828 | Ga0373947_0010983 | 3300035725 | Bacteria | 5195 |
| 829 | Ga0373947_0034871 | 3300035725 | Bacteria | 2977 |
| 830 | Ga0373947_0114280 | 3300035725 | Bacteria | 1709 |
| 831 | Ga0373947_0291605 | 3300035725 | Unclassified | 1086 |
| 832 | Ga0373947_0486350 | 3300035725 | Bacteria | 838 |
| 833 | Ga0373937_0007134 | 3300036401 | Bacteria | 9656 |
| 834 | Ga0373937_0096269 | 3300036401 | Bacteria | 2745 |
| 835 | Ga0373937_0110939 | 3300036401 | Bacteria | 2551 |
| 836 | Ga0373937_0150648 | 3300036401 | Bacteria | 2179 |
| 837 | Ga0373937_0622646 | 3300036401 | Archaea | 1024 |
| 838 | Ga0373937_0918646 | 3300036401 | Bacteria | 824 |
| 839 | Ga0373925_0009287 | 3300037068 | Bacteria | 7157 |
| 840 | Ga0373925_0028478 | 3300037068 | Bacteria | 4093 |
| 841 | Ga0373925_0096197 | 3300037068 | Unclassified | 2269 |
| 842 | Ga0373925_0118344 | 3300037068 | Bacteria | 2054 |
| 843 | Ga0373925_0126759 | 3300037068 | Bacteria | 1987 |
| 844 | Ga0373925_0153978 | 3300037068 | Bacteria | 1807 |
| 845 | Ga0373925_0238324 | 3300037068 | Bacteria | 1456 |
| 846 | Ga0373925_0319795 | 3300037068 | Bacteria | 1256 |
| 847 | Ga0373925_0648900 | 3300037068 | Bacteria | 870 |
| 848 | Ga0373925_0888320 | 3300037068 | Unclassified | 734 |
| 849 | Ga0395898_1026711 | 3300037466 | Unclassified | 760 |
| 850 | Ga0436364_0537501 | 3300037853 | Unclassified | 808 |
| 851 | Ga0436364_0709940 | 3300037853 | Bacteria | 1804 |
| 852 | Ga0436363_0476775 | 3300039450 | Unclassified | 817 |
| 853 | Ga0436363_0658841 | 3300039450 | Bacteria | 1795 |
| 854 | Ga0439453_0026389 | 3300041408 | Unclassified | 1077 |
| 855 | Ga0451798_0802015 | 3300041458 | Unclassified | 903 |
| 856 | Ga0439443_016035 | 3300042003 | Bacteria | 1142 |
| 857 | Ga0439448_0062666 | 3300042005 | Unclassified | 1231 |
| 858 | Ga0450914_015160 | 3300042118 | Bacteria | 803 |
| 859 | Ga0450910_021672 | 3300042147 | Bacteria | 974 |
| 860 | Ga0439446_0006588 | 3300042156 | Bacteria | 3035 |
| 861 | Ga0439446_0073101 | 3300042156 | Bacteria | 1052 |
| 862 | Ga0439434_0061610 | 3300042435 | Unclassified | 1174 |
| 863 | Ga0439435_0003653 | 3300042436 | Bacteria | 3225 |
| 864 | Ga0439444_0062924 | 3300042437 | Bacteria | 779 |
| 865 | Ga0439464_0033295 | 3300042439 | Bacteria | 1451 |
| 866 | Ga0439460_0123438 | 3300042461 | Bacteria | 849 |
| 867 | Ga0450916_001967 | 3300042530 | Bacteria | 2114 |
| 868 | Ga0451576_0126510 | 3300045051 | Unclassified | 2663 |
| 869 | Ga0451576_0736789 | 3300045051 | Bacteria | 1035 |
| 870 | Ga0466967_0109298 | 3300045976 | Bacteria | 2538 |
| 871 | Ga0466967_0906179 | 3300045976 | Bacteria | 877 |
| 872 | Ga0466967_1154271 | 3300045976 | Unclassified | 772 |
| 873 | Ga0495603_0121386 | 3300046455 | Bacteria | 1523 |
| 874 | Ga0495629_0494963 | 3300046459 | Bacteria | 825 |
| 875 | Ga0495651_0001373 | 3300046462 | Bacteria | 18863 |
| 876 | Ga0495651_0032464 | 3300046462 | Bacteria | 4072 |
| 877 | Ga0495653_0005283 | 3300046463 | Bacteria | 10507 |
| 878 | Ga0495653_0247078 | 3300046463 | Bacteria | 1186 |
| 879 | Ga0495580_0002181 | 3300046472 | Bacteria | 17133 |
| 880 | Ga0495580_0002545 | 3300046472 | Bacteria | 15889 |
| 881 | Ga0495580_0008514 | 3300046472 | Bacteria | 8154 |
| 882 | Ga0495580_0023134 | 3300046472 | Bacteria | 4566 |
| 883 | Ga0495580_0087729 | 3300046472 | Unclassified | 2167 |
| 884 | Ga0495580_0196027 | 3300046472 | Bacteria | 1392 |
| 885 | Ga0495580_0472640 | 3300046472 | Bacteria | 839 |
| 886 | Ga0495580_0663384 | 3300046472 | Bacteria | 685 |
| 887 | Ga0495582_0036951 | 3300046473 | Unclassified | 2687 |
| 888 | Ga0495582_0138040 | 3300046473 | Unclassified | 1380 |
| 889 | Ga0495582_0165162 | 3300046473 | Bacteria | 1260 |
| 890 | Ga0495639_0133164 | 3300046475 | Bacteria | 1191 |
| 891 | Ga0495664_0027935 | 3300046477 | Bacteria | 3292 |
| 892 | Ga0495664_0242956 | 3300046477 | Bacteria | 1089 |
| 893 | Ga0495594_0023384 | 3300046499 | Viruses | 3311 |
| 894 | Ga0495608_0009893 | 3300046511 | Bacteria | 6656 |
| 895 | Ga0495608_0122271 | 3300046511 | Bacteria | 1669 |
| 896 | Ga0495608_0532588 | 3300046511 | Bacteria | 709 |
| 897 | Ga0495628_0043933 | 3300046516 | Bacteria | 3557 |
| 898 | Ga0495628_0090165 | 3300046516 | Unclassified | 2374 |
| 899 | Ga0495630_0021716 | 3300046517 | Bacteria | 4740 |
| 900 | Ga0495630_0022897 | 3300046517 | Unclassified | 4614 |
| 901 | Ga0495630_0048007 | 3300046517 | Bacteria | 3195 |
| 902 | Ga0495630_0557236 | 3300046517 | Bacteria | 879 |
| 903 | Ga0495663_0076347 | 3300046525 | Bacteria | 1074 |
| 904 | Ga0495666_0179491 | 3300046526 | Bacteria | 978 |
| 905 | Ga0495652_0008144 | 3300046529 | Bacteria | 9585 |
| 906 | Ga0495665_0002320 | 3300046531 | Bacteria | 10280 |
| 907 | Ga0495665_0155495 | 3300046531 | Unclassified | 1193 |
| 908 | Ga0495665_0257436 | 3300046531 | Bacteria | 898 |
| 909 | Ga0495640_0140724 | 3300046533 | Bacteria | 1556 |
| 910 | Ga0495586_0038336 | 3300046535 | Unclassified | 2573 |
| 911 | Ga0495587_0314036 | 3300046536 | Bacteria | 875 |
| 912 | Ga0495645_0101846 | 3300046543 | Unclassified | 2041 |
| 913 | Ga0495645_0361994 | 3300046543 | Unclassified | 932 |
| 914 | Ga0495622_0282322 | 3300046557 | Bacteria | 726 |
| 915 | Ga0495667_0031282 | 3300046559 | Bacteria | 3573 |
| 916 | Ga0495667_0273534 | 3300046559 | Bacteria | 1073 |
| 917 | Ga0495667_0324597 | 3300046559 | Unclassified | 974 |
| 918 | Ga0495656_0137175 | 3300046615 | Bacteria | 1170 |
| 919 | Ga0495634_0162945 | 3300046642 | Bacteria | 1405 |
| 920 | Ga0495634_0207507 | 3300046642 | Bacteria | 1214 |
| 921 | Ga0495635_0013058 | 3300046663 | Bacteria | 5816 |
| 922 | Ga0495635_0203767 | 3300046663 | Bacteria | 1341 |
| 923 | Ga0495659_0017802 | 3300046664 | Bacteria | 2360 |
| 924 | Ga0495659_0282035 | 3300046664 | Bacteria | 698 |
| 925 | Ga0495657_0009162 | 3300046675 | Bacteria | 7518 |
| 926 | Ga0495599_0277347 | 3300046678 | Bacteria | 1016 |
| 927 | Ga0495623_0008898 | 3300046679 | Bacteria | 6517 |
| 928 | Ga0495623_0140136 | 3300046679 | Bacteria | 1440 |
| 929 | Ga0495623_0183313 | 3300046679 | Bacteria | 1215 |
| 930 | Ga0495623_0267618 | 3300046679 | Bacteria | 955 |
| 931 | Ga0495646_0009519 | 3300046680 | Bacteria | 6168 |
| 932 | Ga0495647_0141426 | 3300046681 | Unclassified | 1026 |
| 933 | Ga0495669_0249648 | 3300046684 | Bacteria | 852 |
| 934 | Ga0495613_0072341 | 3300046689 | Bacteria | 2513 |
| 935 | Ga0495613_0153721 | 3300046689 | Bacteria | 1640 |
| 936 | Ga0495613_0199451 | 3300046689 | Bacteria | 1411 |
| 937 | Ga0495624_0019445 | 3300046690 | Unclassified | 4532 |
| 938 | Ga0495600_0019941 | 3300046809 | Bacteria | 4286 |
| 939 | Ga0495581_0024597 | 3300047315 | Bacteria | 3491 |
| 940 | Ga0495604_0008380 | 3300047317 | Bacteria | 8175 |
| 941 | Ga0495604_0009311 | 3300047317 | Bacteria | 7776 |
| 942 | Ga0495674_0019603 | 3300047319 | Bacteria | 6275 |
| 943 | Ga0495674_0057578 | 3300047319 | Bacteria | 3401 |
| 944 | Ga0495674_0361650 | 3300047319 | Bacteria | 1177 |
| 945 | Ga0495676_0124792 | 3300047321 | Bacteria | 1867 |
| 946 | Ga0495680_0002590 | 3300047322 | Bacteria | 18401 |
| 947 | Ga0495680_0499127 | 3300047322 | Bacteria | 826 |
| 948 | Ga0495675_0007363 | 3300047444 | Bacteria | 6780 |
| 949 | Ga0495675_0161650 | 3300047444 | Bacteria | 1379 |
| 950 | Ga0495675_0313758 | 3300047444 | Bacteria | 929 |
| 951 | Ga0495684_0027823 | 3300047471 | Unclassified | 4342 |
| 952 | Ga0495684_0471505 | 3300047471 | Unclassified | 868 |
| 953 | Ga0495593_0004135 | 3300047673 | Bacteria | 8636 |
| 954 | Ga0495593_0212607 | 3300047673 | Unclassified | 971 |
| 955 | Ga0495602_0049439 | 3300048088 | Bacteria | 3766 |
| 956 | Ga0495602_0265216 | 3300048088 | Bacteria | 1272 |
| 957 | Ga0496100_0896461 | 3300048903 | Bacteria | 696 |
| 958 | Ga0496101_0709016 | 3300048904 | Unclassified | 794 |
| 959 | Ga0496102_0202857 | 3300048905 | Unclassified | 1869 |
| 960 | Ga0496102_0595375 | 3300048905 | Bacteria | 1029 |
| 961 | Ga0496102_1045067 | 3300048905 | Bacteria | 737 |
| 962 | Ga0496103_0315480 | 3300048906 | Bacteria | 1006 |
| 963 | Ga0496104_0162806 | 3300048907 | Unclassified | 2140 |
| 964 | Ga0496104_0344773 | 3300048907 | Bacteria | 1402 |
| 965 | Ga0496104_0515543 | 3300048907 | Bacteria | 1107 |
| 966 | Ga0496105_0037794 | 3300048908 | Unclassified | 3976 |
| 967 | Ga0496105_0131836 | 3300048908 | Bacteria | 2060 |
| 968 | Ga0496105_0372092 | 3300048908 | Unclassified | 1138 |
| 969 | Ga0496105_0460130 | 3300048908 | Unclassified | 1003 |
| 970 | Ga0496106_0373819 | 3300048909 | Bacteria | 1145 |
| 971 | Ga0496107_0306033 | 3300048910 | Bacteria | 1183 |
| 972 | Ga0496107_0720109 | 3300048910 | Bacteria | 733 |
| 973 | Ga0496108_0538522 | 3300048911 | Unclassified | 1019 |
| 974 | Ga0496109_0238219 | 3300048912 | Unclassified | 1712 |
| 975 | Ga0496109_0277242 | 3300048912 | Bacteria | 1580 |
| 976 | Ga0496109_0419379 | 3300048912 | Unclassified | 1264 |
| 977 | Ga0496109_0549313 | 3300048912 | Unclassified | 1090 |
| 978 | Ga0496109_0627431 | 3300048912 | Unclassified | 1011 |
| 979 | Ga0496110_0034465 | 3300048913 | Bacteria | 4385 |
| 980 | Ga0496110_0495011 | 3300048913 | Bacteria | 1113 |
| 981 | Ga0496111_0217779 | 3300048914 | Unclassified | 1418 |
| 982 | Ga0496112_0001729 | 3300048915 | Bacteria | 17084 |
| 983 | Ga0496112_0001787 | 3300048915 | Bacteria | 16907 |
| 984 | Ga0496112_0042758 | 3300048915 | Bacteria | 4434 |
| 985 | Ga0496112_0098038 | 3300048915 | Unclassified | 2901 |
| 986 | Ga0496112_0144118 | 3300048915 | Unclassified | 2351 |
| 987 | Ga0496112_0159495 | 3300048915 | Bacteria | 2222 |
| 988 | Ga0496112_0404147 | 3300048915 | Bacteria | 1305 |
| 989 | Ga0496112_0800490 | 3300048915 | Unclassified | 867 |
| 990 | Ga0496114_0035011 | 3300048917 | Unclassified | 4146 |
| 991 | Ga0496114_0139359 | 3300048917 | Unclassified | 2099 |
| 992 | Ga0496114_0595835 | 3300048917 | Bacteria | 975 |
| 993 | Ga0496115_0002823 | 3300048918 | Bacteria | 12490 |
| 994 | Ga0496115_0118148 | 3300048918 | Bacteria | 2181 |
| 995 | Ga0496115_0739288 | 3300048918 | Bacteria | 770 |
| 996 | Ga0501031_0157044 | 3300049568 | Bacteria | 1487 |
| 997 | Ga0501031_0443195 | 3300049568 | Bacteria | 839 |
| 998 | Ga0501033_0042890 | 3300049570 | Bacteria | 3372 |
| 999 | Ga0501034_0033399 | 3300049571 | Bacteria | 5221 |
| 1000 | Ga0501036_0166457 | 3300049572 | Bacteria | 1858 |
| 1001 | Ga0501036_0494704 | 3300049572 | Bacteria | 1018 |
| 1002 | Ga0501038_0704974 | 3300049574 | Unclassified | 756 |
| 1003 | Ga0501039_0039377 | 3300049575 | Bacteria | 3651 |
| 1004 | Ga0501039_0387663 | 3300049575 | Bacteria | 1097 |
| 1005 | Ga0501040_0128382 | 3300049576 | Bacteria | 1782 |
| 1006 | Ga0501041_0408190 | 3300049577 | Bacteria | 861 |
| 1007 | Ga0501042_0005563 | 3300049578 | Bacteria | 8123 |
| 1008 | Ga0501042_0077653 | 3300049578 | Bacteria | 2378 |
| 1009 | Ga0501042_0350451 | 3300049578 | Bacteria | 1068 |
| 1010 | Ga0501046_0302295 | 3300049580 | Bacteria | 1168 |
| 1011 | Ga0501047_0116925 | 3300049581 | Bacteria | 2548 |
| 1012 | Ga0501048_0026386 | 3300049582 | Bacteria | 4230 |
| 1013 | Ga0501048_0363975 | 3300049582 | Bacteria | 1032 |
| 1014 | Ga0501068_0504755 | 3300049584 | Archaea | 785 |
| 1015 | Ga0501070_0377852 | 3300049586 | Bacteria | 1148 |
| 1016 | Ga0501070_0640837 | 3300049586 | Archaea | 844 |
| 1017 | Ga0501071_0160507 | 3300049587 | Bacteria | 1680 |
| 1018 | Ga0501071_0220594 | 3300049587 | Bacteria | 1427 |
| 1019 | Ga0501071_0243516 | 3300049587 | Bacteria | 1356 |
| 1020 | Ga0501071_0410564 | 3300049587 | Archaea | 1034 |
| 1021 | Ga0501071_0639214 | 3300049587 | Bacteria | 819 |
| 1022 | Ga0501072_0067686 | 3300049588 | Bacteria | 2818 |
| 1023 | Ga0501073_0125693 | 3300049589 | Bacteria | 1778 |
| 1024 | Ga0501073_0280179 | 3300049589 | Bacteria | 1150 |
| 1025 | Ga0501075_0050750 | 3300049591 | Bacteria | 3119 |
| 1026 | Ga0501075_0538919 | 3300049591 | Bacteria | 891 |
| 1027 | Ga0501076_0076312 | 3300049592 | Bacteria | 2688 |
| 1028 | Ga0501077_0060019 | 3300049593 | Bacteria | 2414 |
| 1029 | Ga0501077_0202698 | 3300049593 | Bacteria | 1260 |
| 1030 | Ga0501216_017845 | 3300049660 | Bacteria | 1217 |
| 1031 | Ga0501080_0335926 | 3300049742 | Unclassified | 1366 |
| 1032 | Ga0501081_0131432 | 3300049743 | Bacteria | 1789 |
| 1033 | Ga0501083_0482562 | 3300049744 | Unclassified | 807 |
| 1034 | Ga0501035_0111287 | 3300049822 | Bacteria | 2400 |
| 1035 | Ga0501035_0190900 | 3300049822 | Bacteria | 1761 |
| 1036 | Ga0501044_0069878 | 3300049823 | Bacteria | 3574 |
| 1037 | Ga0501045_0004580 | 3300049824 | Bacteria | 9545 |
| 1038 | Ga0501045_0016653 | 3300049824 | Bacteria | 5223 |
| 1039 | Ga0501045_0367901 | 3300049824 | Bacteria | 1070 |
| 1040 | Ga0501045_0641675 | 3300049824 | Bacteria | 785 |
| 1041 | nmdc:mga05p37_23464_c2 | 3300050507 | Bacteria | 6362 |
| 1042 | nmdc:mga05p37_238980_c1 | 3300050507 | Bacteria | 2185 |
| 1043 | nmdc:mga05p37_322988_c1 | 3300050507 | Bacteria | 1826 |
| 1044 | nmdc:mga05p37_37637_c1 | 3300050507 | Bacteria | 5933 |
| 1045 | nmdc:mga05p37_593396_c1 | 3300050507 | Bacteria | 1252 |
| 1046 | nmdc:mga09592_312434_c1 | 3300050508 | Bacteria | 1362 |
| 1047 | nmdc:mga09592_6865_c1 | 3300050508 | Bacteria | 9263 |
| 1048 | nmdc:mga09592_742998_c1 | 3300050508 | Bacteria | 833 |
| 1049 | nmdc:mga0qj67_3392_c1 | 3300050509 | Bacteria | 11490 |
| 1050 | nmdc:mga0qj67_708363_c1 | 3300050509 | Bacteria | 800 |
| 1051 | nmdc:mga0qj67_773867_c1 | 3300050509 | Bacteria | 761 |
| 1052 | nmdc:mga06r32_1010212_c1 | 3300050510 | Bacteria | 784 |
| 1053 | nmdc:mga06r32_1387_c1 | 3300050510 | Bacteria | 21887 |
| 1054 | nmdc:mga06r32_515034_c1 | 3300050510 | Bacteria | 1172 |
| 1055 | nmdc:mga06r32_75596_c1 | 3300050510 | Bacteria | 3269 |
| 1056 | nmdc:mga08y16_15899_c1 | 3300050511 | Bacteria | 7909 |
| 1057 | nmdc:mga08y16_194302_c1 | 3300050511 | Bacteria | 2104 |
| 1058 | nmdc:mga08y16_22738_c1 | 3300050511 | Bacteria | 6619 |
| 1059 | nmdc:mga08y16_696424_c1 | 3300050511 | Bacteria | 1016 |
| 1060 | nmdc:mga0n895_1425468_c1 | 3300050512 | Bacteria | 661 |
| 1061 | nmdc:mga0n895_281053_c1 | 3300050512 | Unclassified | 1688 |
| 1062 | nmdc:mga0n895_298035_c1 | 3300050512 | Bacteria | 1635 |
| 1063 | nmdc:mga0n895_380676_c1 | 3300050512 | Bacteria | 1428 |
| 1064 | nmdc:mga0n895_513821_c1 | 3300050512 | Bacteria | 1206 |
| 1065 | nmdc:mga0n895_656277_c1 | 3300050512 | Bacteria | 1047 |
| 1066 | nmdc:mga0rr50_167658_c1 | 3300050513 | Bacteria | 1787 |
| 1067 | nmdc:mga0rr50_242372_c1 | 3300050513 | Bacteria | 1495 |
| 1068 | nmdc:mga08x19_188298_c1 | 3300050514 | Unclassified | 1411 |
| 1069 | nmdc:mga08x19_67866_c1 | 3300050514 | Unclassified | 2320 |
| 1070 | nmdc:mga0a205_262413_c1 | 3300050515 | Bacteria | 1605 |
| 1071 | nmdc:mga0a205_309378_c1 | 3300050515 | Bacteria | 1452 |
| 1072 | nmdc:mga0a205_374386_c1 | 3300050515 | Bacteria | 1290 |
| 1073 | nmdc:mga0a205_471661_c1 | 3300050515 | Bacteria | 1114 |
| 1074 | nmdc:mga0a205_77284_c1 | 3300050515 | Bacteria | 3217 |
| 1075 | nmdc:mga0a205_836810_c1 | 3300050515 | Archaea | 768 |
| 1076 | Ga0495601_0081936 | 3300053077 | Unclassified | 2071 |
| 1077 | Ga0495612_0003688 | 3300053078 | Bacteria | 6355 |
| 1078 | Ga0495595_0051405 | 3300053084 | Bacteria | 1910 |
| 1079 | Ga0495619_0187381 | 3300053085 | Unclassified | 1432 |
| 1080 | Ga0495619_0371442 | 3300053085 | Bacteria | 989 |
| 1081 | Ga0495619_0455243 | 3300053085 | Bacteria | 882 |
| 1082 | Ga0501084_0156628 | 3300054114 | Bacteria | 1921 |
| 1083 | Ga0590071_003068 | 3300059421 | Bacteria | 4140 |
| 1084 | Ga0590075_006383 | 3300059424 | Bacteria | 2796 |
| 1085 | Ga0590077_000396 | 3300059426 | Bacteria | 12269 |
| 1086 | Ga0587084_020219 | 3300059477 | Bacteria | 988 |
| 1087 | Ga0587066_012638 | 3300059490 | Bacteria | 1264 |
| 1088 | Ga0587070_068515 | 3300059491 | Unclassified | 751 |
| 1089 | Ga0587070_076926 | 3300059491 | Bacteria | 724 |
| 1090 | Ga0587073_0032666 | 3300059492 | Unclassified | 1085 |
| 1091 | Ga0587077_068126 | 3300059493 | Unclassified | 788 |
| 1092 | Ga0587077_084522 | 3300059493 | Unclassified | 735 |
| 1093 | Ga0587082_031050 | 3300059504 | Bacteria | 931 |
| 1094 | Ga0587083_0047454 | 3300059505 | Unclassified | 924 |
| 1095 | Ga0587085_037309 | 3300059506 | Bacteria | 830 |
| 1096 | Ga0587086_024307 | 3300059507 | Bacteria | 850 |
| 1097 | Ga0587088_052433 | 3300059508 | Bacteria | 803 |
| 1098 | Ga0587090_065497 | 3300059510 | Bacteria | 699 |
| 1099 | Ga0587091_070847 | 3300059511 | Bacteria | 762 |
| 1100 | Ga0587091_092264 | 3300059511 | Bacteria | 697 |
| 1101 | Ga0587094_020989 | 3300059513 | Bacteria | 949 |
| 1102 | Ga0587094_037307 | 3300059513 | Bacteria | 778 |
| 1103 | Ga0587094_041757 | 3300059513 | Bacteria | 749 |
| 1104 | Ga0587125_024932 | 3300059607 | Bacteria | 731 |
| 1105 | Ga0587101_035568 | 3300059623 | Bacteria | 799 |
| 1106 | Ga0587117_013659 | 3300059627 | Bacteria | 1043 |
| 1107 | Ga0587069_031678 | 3300059642 | Bacteria | 859 |
| 1108 | Ga0587076_054161 | 3300059645 | Unclassified | 791 |
| 1109 | Ga0587079_077500 | 3300059647 | Bacteria | 754 |
| 1110 | Ga0587100_013011 | 3300059648 | Unclassified | 735 |
| 1111 | Ga0587124_018644 | 3300059660 | Unclassified | 693 |
| 1112 | Ga0587071_092664 | 3300060344 | Bacteria | 688 |
| 1113 | Ga0587111_0057509 | 3300060346 | Bacteria | 875 |
| 1114 | Ga0501082_0090837 | 3300060353 | Bacteria | 2637 |
| 1115 | Ga0501082_0458990 | 3300060353 | Bacteria | 1113 |
| 1116 | Ga0501082_0646760 | 3300060353 | Bacteria | 925 |
| 1117 | Ga0501082_0776756 | 3300060353 | Bacteria | 838 |
| 1118 | Ga0530510_0001309 | 3300061734 | Bacteria | 16633 |
| 1119 | Ga0530510_0295225 | 3300061734 | Bacteria | 1212 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005445 | Ga0070708_100012948 | Ga0070708_1000129483 | 194 |
| 2 | 3300031731 | Ga0307405_10857614 | Ga0307405_108576141 | 195 |
| 3 | 3300032002 | Ga0307416_100023471 | Ga0307416_1000234712 | 195 |
| 4 | 3300059421 | Ga0590071_003068 | Ga0590071_003068_257_868 | 195 |
| 5 | 3300059424 | Ga0590075_006383 | Ga0590075_006383_114_725 | 195 |
| 6 | 3300059426 | Ga0590077_000396 | Ga0590077_000396_9123_9734 | 195 |
| 7 | 3300005445 | Ga0070708_100282380 | Ga0070708_1002823802 | 196 |
| 8 | 3300005981 | Ga0081538_10004787 | Ga0081538_100047875 | 196 |
| 9 | 3300025910 | Ga0207684_10200658 | Ga0207684_102006582 | 196 |
| 10 | 3300028563 | Ga0265319_1025387 | Ga0265319_10253872 | 197 |
| 11 | 3300028800 | Ga0265338_10027402 | Ga0265338_100274025 | 197 |
| 12 | 3300031241 | Ga0265325_10004980 | Ga0265325_100049804 | 197 |
| 13 | 3300031344 | Ga0265316_10045014 | Ga0265316_100450142 | 197 |
| 14 | 3300046459 | Ga0495629_0494963 | Ga0495629_0494963_12_644 | 197 |
| 15 | 3300050507 | nmdc:mga05p37_238980_c1 | nmdc:mga05p37_238980_c1_374_988 | 197 |
| 16 | 3300049574 | Ga0501038_0704974 | Ga0501038_0704974_85_705 | 198 |
| 17 | 3300005338 | Ga0068868_100050774 | Ga0068868_1000507744 | 199 |
| 18 | 3300005341 | Ga0070691_10064375 | Ga0070691_100643752 | 199 |
| 19 | 3300005436 | Ga0070713_100010679 | Ga0070713_1000106795 | 199 |
| 20 | 3300005436 | Ga0070713_100303749 | Ga0070713_1003037492 | 199 |
| 21 | 3300005456 | Ga0070678_100294396 | Ga0070678_1002943962 | 199 |
| 22 | 3300005458 | Ga0070681_10001282 | Ga0070681_100012828 | 199 |
| 23 | 3300005471 | Ga0070698_100679082 | Ga0070698_1006790821 | 199 |
| 24 | 3300005535 | Ga0070684_100042934 | Ga0070684_1000429341 | 199 |
| 25 | 3300005539 | Ga0068853_100017653 | Ga0068853_1000176533 | 199 |
| 26 | 3300005539 | Ga0068853_100424039 | Ga0068853_1004240392 | 199 |
| 27 | 3300005545 | Ga0070695_100314543 | Ga0070695_1003145431 | 199 |
| 28 | 3300005547 | Ga0070693_100117218 | Ga0070693_1001172182 | 199 |
| 29 | 3300005563 | Ga0068855_100000234 | Ga0068855_10000023424 | 199 |
| 30 | 3300005563 | Ga0068855_100002034 | Ga0068855_10000203423 | 199 |
| 31 | 3300005577 | Ga0068857_100034785 | Ga0068857_1000347853 | 199 |
| 32 | 3300005578 | Ga0068854_100047266 | Ga0068854_1000472662 | 199 |
| 33 | 3300005614 | Ga0068856_100000062 | Ga0068856_10000006212 | 199 |
| 34 | 3300005614 | Ga0068856_100002175 | Ga0068856_10000217519 | 199 |
| 35 | 3300005616 | Ga0068852_100016336 | Ga0068852_1000163362 | 199 |
| 36 | 3300005616 | Ga0068852_100520460 | Ga0068852_1005204602 | 199 |
| 37 | 3300005618 | Ga0068864_100012733 | Ga0068864_1000127332 | 199 |
| 38 | 3300005718 | Ga0068866_10266486 | Ga0068866_102664862 | 199 |
| 39 | 3300005842 | Ga0068858_100013703 | Ga0068858_1000137034 | 199 |
| 40 | 3300006237 | Ga0097621_100000196 | Ga0097621_10000019644 | 199 |
| 41 | 3300006237 | Ga0097621_100000326 | Ga0097621_10000032636 | 199 |
| 42 | 3300006358 | Ga0068871_100000049 | Ga0068871_10000004934 | 199 |
| 43 | 3300006358 | Ga0068871_100089885 | Ga0068871_1000898851 | 199 |
| 44 | 3300006852 | Ga0075433_10213879 | Ga0075433_102138792 | 199 |
| 45 | 3300007265 | Ga0099794_10132741 | Ga0099794_101327412 | 199 |
| 46 | 3300009093 | Ga0105240_10013638 | Ga0105240_100136382 | 199 |
| 47 | 3300009093 | Ga0105240_10082073 | Ga0105240_100820731 | 199 |
| 48 | 3300009093 | Ga0105240_10136198 | Ga0105240_101361982 | 199 |
| 49 | 3300009098 | Ga0105245_11346697 | Ga0105245_113466971 | 199 |
| 50 | 3300009147 | Ga0114129_10885826 | Ga0114129_108858262 | 199 |
| 51 | 3300009174 | Ga0105241_10006410 | Ga0105241_100064108 | 199 |
| 52 | 3300009177 | Ga0105248_10010283 | Ga0105248_100102834 | 199 |
| 53 | 3300009545 | Ga0105237_10503999 | Ga0105237_105039991 | 199 |
| 54 | 3300009551 | Ga0105238_10000609 | Ga0105238_1000060919 | 199 |
| 55 | 3300013102 | Ga0157371_10122559 | Ga0157371_101225592 | 199 |
| 56 | 3300013105 | Ga0157369_10000159 | Ga0157369_1000015962 | 199 |
| 57 | 3300013296 | Ga0157374_10000062 | Ga0157374_1000006254 | 199 |
| 58 | 3300013296 | Ga0157374_10000338 | Ga0157374_1000033818 | 199 |
| 59 | 3300013296 | Ga0157374_10141625 | Ga0157374_101416252 | 199 |
| 60 | 3300013297 | Ga0157378_10000899 | Ga0157378_1000089917 | 199 |
| 61 | 3300013297 | Ga0157378_10004757 | Ga0157378_100047572 | 199 |
| 62 | 3300013306 | Ga0163162_10477774 | Ga0163162_104777742 | 199 |
| 63 | 3300013307 | Ga0157372_10000845 | Ga0157372_100008455 | 199 |
| 64 | 3300013307 | Ga0157372_10003611 | Ga0157372_1000361114 | 199 |
| 65 | 3300014969 | Ga0157376_10013516 | Ga0157376_100135167 | 199 |
| 66 | 3300014969 | Ga0157376_10025386 | Ga0157376_100253865 | 199 |
| 67 | 3300020070 | Ga0206356_10151869 | Ga0206356_101518691 | 199 |
| 68 | 3300020078 | Ga0206352_11071978 | Ga0206352_110719782 | 199 |
| 69 | 3300025906 | Ga0207699_10051787 | Ga0207699_100517872 | 199 |
| 70 | 3300025911 | Ga0207654_10011326 | Ga0207654_100113265 | 199 |
| 71 | 3300025912 | Ga0207707_10001452 | Ga0207707_1000145216 | 199 |
| 72 | 3300025913 | Ga0207695_10189123 | Ga0207695_101891232 | 199 |
| 73 | 3300025913 | Ga0207695_10222679 | Ga0207695_102226792 | 199 |
| 74 | 3300025914 | Ga0207671_10363056 | Ga0207671_103630561 | 199 |
| 75 | 3300025921 | Ga0207652_10039969 | Ga0207652_100399694 | 199 |
| 76 | 3300025921 | Ga0207652_10051209 | Ga0207652_100512092 | 199 |
| 77 | 3300025924 | Ga0207694_10003298 | Ga0207694_100032988 | 199 |
| 78 | 3300025924 | Ga0207694_10037891 | Ga0207694_100378912 | 199 |
| 79 | 3300025924 | Ga0207694_10859111 | Ga0207694_108591112 | 199 |
| 80 | 3300025928 | Ga0207700_10005218 | Ga0207700_100052183 | 199 |
| 81 | 3300025928 | Ga0207700_10260313 | Ga0207700_102603132 | 199 |
| 82 | 3300025941 | Ga0207711_10006123 | Ga0207711_100061234 | 199 |
| 83 | 3300025945 | Ga0207679_10141110 | Ga0207679_101411102 | 199 |
| 84 | 3300025949 | Ga0207667_10000465 | Ga0207667_1000046522 | 199 |
| 85 | 3300025949 | Ga0207667_10001399 | Ga0207667_1000139931 | 199 |
| 86 | 3300026023 | Ga0207677_10011565 | Ga0207677_100115655 | 199 |
| 87 | 3300026035 | Ga0207703_10003748 | Ga0207703_100037484 | 199 |
| 88 | 3300026041 | Ga0207639_10026749 | Ga0207639_100267494 | 199 |
| 89 | 3300026041 | Ga0207639_10238155 | Ga0207639_102381552 | 199 |
| 90 | 3300026078 | Ga0207702_10000458 | Ga0207702_1000045830 | 199 |
| 91 | 3300026078 | Ga0207702_10001096 | Ga0207702_100010965 | 199 |
| 92 | 3300026095 | Ga0207676_10022322 | Ga0207676_100223221 | 199 |
| 93 | 3300026116 | Ga0207674_10005293 | Ga0207674_100052931 | 199 |
| 94 | 3300035691 | Ga0373931_0105854 | Ga0373931_0105854_656_1297 | 199 |
| 95 | 3300048908 | Ga0496105_0460130 | Ga0496105_0460130_263_904 | 199 |
| 96 | 3300048912 | Ga0496109_0627431 | Ga0496109_0627431_106_747 | 199 |
| 97 | 3300048915 | Ga0496112_0001729 | Ga0496112_0001729_14444_15085 | 199 |
| 98 | 3300050512 | nmdc:mga0n895_513821_c1 | nmdc:mga0n895_513821_c1_564_1178 | 199 |
| 99 | 3300050515 | nmdc:mga0a205_309378_c1 | nmdc:mga0a205_309378_c1_240_866 | 199 |
| 100 | 3300050515 | nmdc:mga0a205_836810_c1 | nmdc:mga0a205_836810_c1_78_704 | 199 |
| 101 | 3300005435 | Ga0070714_100022981 | Ga0070714_1000229814 | 200 |
| 102 | 3300005436 | Ga0070713_100002315 | Ga0070713_1000023152 | 200 |
| 103 | 3300005436 | Ga0070713_100112879 | Ga0070713_1001128792 | 200 |
| 104 | 3300005439 | Ga0070711_100012400 | Ga0070711_1000124002 | 200 |
| 105 | 3300005439 | Ga0070711_100096083 | Ga0070711_1000960832 | 200 |
| 106 | 3300005458 | Ga0070681_10595934 | Ga0070681_105959342 | 200 |
| 107 | 3300005467 | Ga0070706_100154948 | Ga0070706_1001549484 | 200 |
| 108 | 3300005564 | Ga0070664_100067532 | Ga0070664_1000675322 | 200 |
| 109 | 3300005578 | Ga0068854_100140500 | Ga0068854_1001405002 | 200 |
| 110 | 3300005614 | Ga0068856_100295053 | Ga0068856_1002950532 | 200 |
| 111 | 3300006028 | Ga0070717_10049718 | Ga0070717_100497182 | 200 |
| 112 | 3300006163 | Ga0070715_10162073 | Ga0070715_101620732 | 200 |
| 113 | 3300006173 | Ga0070716_100046742 | Ga0070716_1000467422 | 200 |
| 114 | 3300009174 | Ga0105241_10032434 | Ga0105241_100324343 | 200 |
| 115 | 3300009545 | Ga0105237_10088398 | Ga0105237_100883982 | 200 |
| 116 | 3300013100 | Ga0157373_10032661 | Ga0157373_100326613 | 200 |
| 117 | 3300013104 | Ga0157370_10089656 | Ga0157370_100896562 | 200 |
| 118 | 3300013104 | Ga0157370_10505366 | Ga0157370_105053661 | 200 |
| 119 | 3300013105 | Ga0157369_10106983 | Ga0157369_101069832 | 200 |
| 120 | 3300013296 | Ga0157374_10018947 | Ga0157374_100189472 | 200 |
| 121 | 3300013307 | Ga0157372_10051671 | Ga0157372_100516713 | 200 |
| 122 | 3300013308 | Ga0157375_10409442 | Ga0157375_104094422 | 200 |
| 123 | 3300025906 | Ga0207699_10121136 | Ga0207699_101211361 | 200 |
| 124 | 3300025910 | Ga0207684_10623868 | Ga0207684_106238682 | 200 |
| 125 | 3300025912 | Ga0207707_10361356 | Ga0207707_103613561 | 200 |
| 126 | 3300025914 | Ga0207671_10091082 | Ga0207671_100910822 | 200 |
| 127 | 3300025916 | Ga0207663_10041868 | Ga0207663_100418682 | 200 |
| 128 | 3300025928 | Ga0207700_10008994 | Ga0207700_100089942 | 200 |
| 129 | 3300025928 | Ga0207700_10030141 | Ga0207700_100301412 | 200 |
| 130 | 3300025929 | Ga0207664_10294572 | Ga0207664_102945722 | 200 |
| 131 | 3300025939 | Ga0207665_10236107 | Ga0207665_102361071 | 200 |
| 132 | 3300025945 | Ga0207679_10054394 | Ga0207679_100543942 | 200 |
| 133 | 3300025981 | Ga0207640_10113675 | Ga0207640_101136752 | 200 |
| 134 | 3300026035 | Ga0207703_10444826 | Ga0207703_104448261 | 200 |
| 135 | 3300026078 | Ga0207702_10112542 | Ga0207702_101125422 | 200 |
| 136 | 3300026116 | Ga0207674_11078781 | Ga0207674_110787811 | 200 |
| 137 | 3300028800 | Ga0265338_10305255 | Ga0265338_103052551 | 200 |
| 138 | 3300031250 | Ga0265331_10264905 | Ga0265331_102649052 | 200 |
| 139 | 3300031595 | Ga0265313_10039017 | Ga0265313_100390172 | 200 |
| 140 | 3300031711 | Ga0265314_10244879 | Ga0265314_102448792 | 200 |
| 141 | 3300035083 | Ga0373926_0048447 | Ga0373926_0048447_612_1241 | 200 |
| 142 | 3300035086 | Ga0373934_0038393 | Ga0373934_0038393_1162_1791 | 200 |
| 143 | 3300035111 | Ga0373923_0058746 | Ga0373923_0058746_711_1349 | 200 |
| 144 | 3300035111 | Ga0373923_0064486 | Ga0373923_0064486_415_1044 | 200 |
| 145 | 3300035116 | Ga0373945_0171981 | Ga0373945_0171981_114_749 | 200 |
| 146 | 3300035118 | Ga0373954_0019428 | Ga0373954_0019428_2121_2756 | 200 |
| 147 | 3300035119 | Ga0373956_0039385 | Ga0373956_0039385_1077_1712 | 200 |
| 148 | 3300035692 | Ga0373935_0025383 | Ga0373935_0025383_2279_2908 | 200 |
| 149 | 3300035695 | Ga0373927_0049369 | Ga0373927_0049369_1166_1804 | 200 |
| 150 | 3300036401 | Ga0373937_0096269 | Ga0373937_0096269_509_1147 | 200 |
| 151 | 3300036401 | Ga0373937_0110939 | Ga0373937_0110939_1839_2468 | 200 |
| 152 | 3300037068 | Ga0373925_0096197 | Ga0373925_0096197_597_1226 | 200 |
| 153 | 3300037068 | Ga0373925_0153978 | Ga0373925_0153978_856_1494 | 200 |
| 154 | 3300037068 | Ga0373925_0319795 | Ga0373925_0319795_75_716 | 200 |
| 155 | 3300045051 | Ga0451576_0736789 | Ga0451576_0736789_153_785 | 200 |
| 156 | 3300046472 | Ga0495580_0472640 | Ga0495580_0472640_132_773 | 200 |
| 157 | 3300046473 | Ga0495582_0165162 | Ga0495582_0165162_318_953 | 200 |
| 158 | 3300046679 | Ga0495623_0140136 | Ga0495623_0140136_459_1088 | 200 |
| 159 | 3300046679 | Ga0495623_0183313 | Ga0495623_0183313_545_1174 | 200 |
| 160 | 3300047319 | Ga0495674_0057578 | Ga0495674_0057578_128_763 | 200 |
| 161 | 3300047444 | Ga0495675_0161650 | Ga0495675_0161650_136_765 | 200 |
| 162 | 3300048088 | Ga0495602_0265216 | Ga0495602_0265216_207_836 | 200 |
| 163 | 3300048905 | Ga0496102_0595375 | Ga0496102_0595375_186_827 | 200 |
| 164 | 3300048915 | Ga0496112_0404147 | Ga0496112_0404147_343_984 | 200 |
| 165 | 3300005290 | Ga0065712_10154608 | Ga0065712_101546082 | 201 |
| 166 | 3300005338 | Ga0068868_100493205 | Ga0068868_1004932052 | 201 |
| 167 | 3300005434 | Ga0070709_10094195 | Ga0070709_100941952 | 201 |
| 168 | 3300005439 | Ga0070711_100171290 | Ga0070711_1001712902 | 201 |
| 169 | 3300005445 | Ga0070708_100841812 | Ga0070708_1008418122 | 201 |
| 170 | 3300005459 | Ga0068867_100115804 | Ga0068867_1001158043 | 201 |
| 171 | 3300005466 | Ga0070685_10151869 | Ga0070685_101518692 | 201 |
| 172 | 3300005467 | Ga0070706_100700953 | Ga0070706_1007009531 | 201 |
| 173 | 3300005518 | Ga0070699_100548573 | Ga0070699_1005485731 | 201 |
| 174 | 3300005548 | Ga0070665_100192917 | Ga0070665_1001929173 | 201 |
| 175 | 3300005563 | Ga0068855_100772636 | Ga0068855_1007726362 | 201 |
| 176 | 3300005616 | Ga0068852_100107871 | Ga0068852_1001078713 | 201 |
| 177 | 3300005617 | Ga0068859_100035429 | Ga0068859_1000354294 | 201 |
| 178 | 3300005842 | Ga0068858_100014019 | Ga0068858_1000140194 | 201 |
| 179 | 3300005937 | Ga0081455_10299917 | Ga0081455_102999172 | 201 |
| 180 | 3300006028 | Ga0070717_10274455 | Ga0070717_102744552 | 201 |
| 181 | 3300006173 | Ga0070716_100100120 | Ga0070716_1001001202 | 201 |
| 182 | 3300006175 | Ga0070712_100010616 | Ga0070712_1000106162 | 201 |
| 183 | 3300006237 | Ga0097621_100227623 | Ga0097621_1002276232 | 201 |
| 184 | 3300006237 | Ga0097621_100311448 | Ga0097621_1003114482 | 201 |
| 185 | 3300006846 | Ga0075430_100432902 | Ga0075430_1004329022 | 201 |
| 186 | 3300006931 | Ga0097620_100035431 | Ga0097620_1000354314 | 201 |
| 187 | 3300009098 | Ga0105245_10177367 | Ga0105245_101773672 | 201 |
| 188 | 3300009101 | Ga0105247_10322688 | Ga0105247_103226882 | 201 |
| 189 | 3300009176 | Ga0105242_10796407 | Ga0105242_107964071 | 201 |
| 190 | 3300009545 | Ga0105237_10087881 | Ga0105237_100878814 | 201 |
| 191 | 3300010375 | Ga0105239_10292327 | Ga0105239_102923272 | 201 |
| 192 | 3300013296 | Ga0157374_10053283 | Ga0157374_100532833 | 201 |
| 193 | 3300013296 | Ga0157374_10068261 | Ga0157374_100682612 | 201 |
| 194 | 3300013297 | Ga0157378_10006834 | Ga0157378_100068349 | 201 |
| 195 | 3300013306 | Ga0163162_10069684 | Ga0163162_100696842 | 201 |
| 196 | 3300013308 | Ga0157375_10014565 | Ga0157375_100145654 | 201 |
| 197 | 3300013308 | Ga0157375_10217189 | Ga0157375_102171892 | 201 |
| 198 | 3300014745 | Ga0157377_10150047 | Ga0157377_101500472 | 201 |
| 199 | 3300025904 | Ga0207647_10209184 | Ga0207647_102091842 | 201 |
| 200 | 3300025906 | Ga0207699_10500436 | Ga0207699_105004361 | 201 |
| 201 | 3300025910 | Ga0207684_10411180 | Ga0207684_104111802 | 201 |
| 202 | 3300025914 | Ga0207671_10031521 | Ga0207671_100315215 | 201 |
| 203 | 3300025915 | Ga0207693_10017337 | Ga0207693_100173372 | 201 |
| 204 | 3300025916 | Ga0207663_10261780 | Ga0207663_102617801 | 201 |
| 205 | 3300025938 | Ga0207704_10005907 | Ga0207704_100059072 | 201 |
| 206 | 3300025939 | Ga0207665_10065776 | Ga0207665_100657762 | 201 |
| 207 | 3300025942 | Ga0207689_10003694 | Ga0207689_100036946 | 201 |
| 208 | 3300025949 | Ga0207667_10406056 | Ga0207667_104060562 | 201 |
| 209 | 3300026023 | Ga0207677_10273243 | Ga0207677_102732432 | 201 |
| 210 | 3300026035 | Ga0207703_10063124 | Ga0207703_100631242 | 201 |
| 211 | 3300026089 | Ga0207648_10097212 | Ga0207648_100972122 | 201 |
| 212 | 3300026142 | Ga0207698_10079771 | Ga0207698_100797713 | 201 |
| 213 | 3300035692 | Ga0373935_0016735 | Ga0373935_0016735_3718_4356 | 201 |
| 214 | 3300037068 | Ga0373925_0028478 | Ga0373925_0028478_2408_3046 | 201 |
| 215 | 3300042147 | Ga0450910_021672 | Ga0450910_021672_259_903 | 201 |
| 216 | 3300045976 | Ga0466967_0109298 | Ga0466967_0109298_1585_2220 | 201 |
| 217 | 3300046472 | Ga0495580_0008514 | Ga0495580_0008514_4981_5619 | 201 |
| 218 | 3300046472 | Ga0495580_0196027 | Ga0495580_0196027_198_836 | 201 |
| 219 | 3300046472 | Ga0495580_0663384 | Ga0495580_0663384_19_657 | 201 |
| 220 | 3300046473 | Ga0495582_0138040 | Ga0495582_0138040_243_881 | 201 |
| 221 | 3300046517 | Ga0495630_0021716 | Ga0495630_0021716_1472_2233 | 201 |
| 222 | 3300046531 | Ga0495665_0257436 | Ga0495665_0257436_161_802 | 201 |
| 223 | 3300046533 | Ga0495640_0140724 | Ga0495640_0140724_388_1026 | 201 |
| 224 | 3300046543 | Ga0495645_0361994 | Ga0495645_0361994_35_673 | 201 |
| 225 | 3300046557 | Ga0495622_0282322 | Ga0495622_0282322_34_675 | 201 |
| 226 | 3300046559 | Ga0495667_0324597 | Ga0495667_0324597_55_696 | 201 |
| 227 | 3300046615 | Ga0495656_0137175 | Ga0495656_0137175_153_779 | 201 |
| 228 | 3300046642 | Ga0495634_0207507 | Ga0495634_0207507_463_1104 | 201 |
| 229 | 3300046689 | Ga0495613_0072341 | Ga0495613_0072341_757_1518 | 201 |
| 230 | 3300047673 | Ga0495593_0212607 | Ga0495593_0212607_34_672 | 201 |
| 231 | 3300048907 | Ga0496104_0515543 | Ga0496104_0515543_455_1096 | 201 |
| 232 | 3300048915 | Ga0496112_0001787 | Ga0496112_0001787_12215_12853 | 201 |
| 233 | 3300053085 | Ga0495619_0455243 | Ga0495619_0455243_70_831 | 201 |
| 234 | 3300005290 | Ga0065712_10217838 | Ga0065712_102178382 | 202 |
| 235 | 3300005293 | Ga0065715_10340354 | Ga0065715_103403541 | 202 |
| 236 | 3300005328 | Ga0070676_10022921 | Ga0070676_100229212 | 202 |
| 237 | 3300005329 | Ga0070683_100200558 | Ga0070683_1002005582 | 202 |
| 238 | 3300005333 | Ga0070677_10064415 | Ga0070677_100644152 | 202 |
| 239 | 3300005334 | Ga0068869_100013764 | Ga0068869_1000137643 | 202 |
| 240 | 3300005335 | Ga0070666_10151568 | Ga0070666_101515682 | 202 |
| 241 | 3300005337 | Ga0070682_100080769 | Ga0070682_1000807692 | 202 |
| 242 | 3300005338 | Ga0068868_100058077 | Ga0068868_1000580772 | 202 |
| 243 | 3300005339 | Ga0070660_100051801 | Ga0070660_1000518012 | 202 |
| 244 | 3300005347 | Ga0070668_100017488 | Ga0070668_1000174884 | 202 |
| 245 | 3300005353 | Ga0070669_100175841 | Ga0070669_1001758412 | 202 |
| 246 | 3300005365 | Ga0070688_100191509 | Ga0070688_1001915092 | 202 |
| 247 | 3300005366 | Ga0070659_100240024 | Ga0070659_1002400242 | 202 |
| 248 | 3300005367 | Ga0070667_100039346 | Ga0070667_1000393463 | 202 |
| 249 | 3300005434 | Ga0070709_10004528 | Ga0070709_100045283 | 202 |
| 250 | 3300005434 | Ga0070709_10085085 | Ga0070709_100850852 | 202 |
| 251 | 3300005434 | Ga0070709_10100821 | Ga0070709_101008212 | 202 |
| 252 | 3300005435 | Ga0070714_100010303 | Ga0070714_1000103032 | 202 |
| 253 | 3300005436 | Ga0070713_100000476 | Ga0070713_1000004768 | 202 |
| 254 | 3300005436 | Ga0070713_100006228 | Ga0070713_1000062283 | 202 |
| 255 | 3300005436 | Ga0070713_100027416 | Ga0070713_1000274164 | 202 |
| 256 | 3300005436 | Ga0070713_100061664 | Ga0070713_1000616642 | 202 |
| 257 | 3300005437 | Ga0070710_10055150 | Ga0070710_100551502 | 202 |
| 258 | 3300005437 | Ga0070710_10282206 | Ga0070710_102822061 | 202 |
| 259 | 3300005439 | Ga0070711_100001229 | Ga0070711_1000012298 | 202 |
| 260 | 3300005439 | Ga0070711_100020175 | Ga0070711_1000201754 | 202 |
| 261 | 3300005439 | Ga0070711_100085993 | Ga0070711_1000859932 | 202 |
| 262 | 3300005445 | Ga0070708_100114524 | Ga0070708_1001145242 | 202 |
| 263 | 3300005445 | Ga0070708_100398888 | Ga0070708_1003988882 | 202 |
| 264 | 3300005455 | Ga0070663_100081603 | Ga0070663_1000816032 | 202 |
| 265 | 3300005457 | Ga0070662_100122790 | Ga0070662_1001227902 | 202 |
| 266 | 3300005459 | Ga0068867_100016286 | Ga0068867_1000162864 | 202 |
| 267 | 3300005467 | Ga0070706_100002094 | Ga0070706_1000020948 | 202 |
| 268 | 3300005468 | Ga0070707_100086910 | Ga0070707_1000869102 | 202 |
| 269 | 3300005468 | Ga0070707_100505722 | Ga0070707_1005057222 | 202 |
| 270 | 3300005471 | Ga0070698_100413945 | Ga0070698_1004139451 | 202 |
| 271 | 3300005518 | Ga0070699_100016335 | Ga0070699_1000163356 | 202 |
| 272 | 3300005535 | Ga0070684_100144776 | Ga0070684_1001447762 | 202 |
| 273 | 3300005536 | Ga0070697_100002395 | Ga0070697_1000023957 | 202 |
| 274 | 3300005539 | Ga0068853_100076896 | Ga0068853_1000768962 | 202 |
| 275 | 3300005544 | Ga0070686_100081065 | Ga0070686_1000810652 | 202 |
| 276 | 3300005545 | Ga0070695_100822637 | Ga0070695_1008226371 | 202 |
| 277 | 3300005546 | Ga0070696_100247781 | Ga0070696_1002477811 | 202 |
| 278 | 3300005548 | Ga0070665_100072788 | Ga0070665_1000727882 | 202 |
| 279 | 3300005564 | Ga0070664_100236860 | Ga0070664_1002368602 | 202 |
| 280 | 3300005578 | Ga0068854_100107675 | Ga0068854_1001076752 | 202 |
| 281 | 3300005614 | Ga0068856_100119422 | Ga0068856_1001194222 | 202 |
| 282 | 3300005616 | Ga0068852_100382014 | Ga0068852_1003820142 | 202 |
| 283 | 3300005618 | Ga0068864_100382057 | Ga0068864_1003820571 | 202 |
| 284 | 3300005718 | Ga0068866_10024028 | Ga0068866_100240282 | 202 |
| 285 | 3300005719 | Ga0068861_100148732 | Ga0068861_1001487322 | 202 |
| 286 | 3300005834 | Ga0068851_10059333 | Ga0068851_100593332 | 202 |
| 287 | 3300005842 | Ga0068858_100016583 | Ga0068858_1000165832 | 202 |
| 288 | 3300005843 | Ga0068860_100080997 | Ga0068860_1000809972 | 202 |
| 289 | 3300005844 | Ga0068862_100173830 | Ga0068862_1001738302 | 202 |
| 290 | 3300005981 | Ga0081538_10111330 | Ga0081538_101113302 | 202 |
| 291 | 3300006058 | Ga0075432_10037531 | Ga0075432_100375312 | 202 |
| 292 | 3300006163 | Ga0070715_10005284 | Ga0070715_100052843 | 202 |
| 293 | 3300006163 | Ga0070715_10040341 | Ga0070715_100403412 | 202 |
| 294 | 3300006163 | Ga0070715_10104239 | Ga0070715_101042392 | 202 |
| 295 | 3300006173 | Ga0070716_100010782 | Ga0070716_1000107822 | 202 |
| 296 | 3300006173 | Ga0070716_100036212 | Ga0070716_1000362122 | 202 |
| 297 | 3300006173 | Ga0070716_100130440 | Ga0070716_1001304402 | 202 |
| 298 | 3300006175 | Ga0070712_100000468 | Ga0070712_10000046816 | 202 |
| 299 | 3300006175 | Ga0070712_100002849 | Ga0070712_1000028492 | 202 |
| 300 | 3300006175 | Ga0070712_100011228 | Ga0070712_1000112285 | 202 |
| 301 | 3300006237 | Ga0097621_100270334 | Ga0097621_1002703342 | 202 |
| 302 | 3300006358 | Ga0068871_100181118 | Ga0068871_1001811182 | 202 |
| 303 | 3300006847 | Ga0075431_100535336 | Ga0075431_1005353362 | 202 |
| 304 | 3300006871 | Ga0075434_100127862 | Ga0075434_1001278622 | 202 |
| 305 | 3300006871 | Ga0075434_100315925 | Ga0075434_1003159252 | 202 |
| 306 | 3300006871 | Ga0075434_100326366 | Ga0075434_1003263662 | 202 |
| 307 | 3300006881 | Ga0068865_100096344 | Ga0068865_1000963442 | 202 |
| 308 | 3300006914 | Ga0075436_100086852 | Ga0075436_1000868522 | 202 |
| 309 | 3300006914 | Ga0075436_100089193 | Ga0075436_1000891932 | 202 |
| 310 | 3300006914 | Ga0075436_100150028 | Ga0075436_1001500282 | 202 |
| 311 | 3300007076 | Ga0075435_100016798 | Ga0075435_1000167982 | 202 |
| 312 | 3300007076 | Ga0075435_100047716 | Ga0075435_1000477163 | 202 |
| 313 | 3300007076 | Ga0075435_100109848 | Ga0075435_1001098482 | 202 |
| 314 | 3300007265 | Ga0099794_10194871 | Ga0099794_101948712 | 202 |
| 315 | 3300009093 | Ga0105240_10053160 | Ga0105240_100531602 | 202 |
| 316 | 3300009098 | Ga0105245_10314329 | Ga0105245_103143292 | 202 |
| 317 | 3300009101 | Ga0105247_10023620 | Ga0105247_100236202 | 202 |
| 318 | 3300009147 | Ga0114129_10136553 | Ga0114129_101365534 | 202 |
| 319 | 3300009147 | Ga0114129_10603688 | Ga0114129_106036882 | 202 |
| 320 | 3300009176 | Ga0105242_10250564 | Ga0105242_102505642 | 202 |
| 321 | 3300009177 | Ga0105248_10410923 | Ga0105248_104109232 | 202 |
| 322 | 3300009551 | Ga0105238_10880803 | Ga0105238_108808031 | 202 |
| 323 | 3300009553 | Ga0105249_10006270 | Ga0105249_100062704 | 202 |
| 324 | 3300010375 | Ga0105239_10348132 | Ga0105239_103481322 | 202 |
| 325 | 3300010375 | Ga0105239_10835899 | Ga0105239_108358991 | 202 |
| 326 | 3300011119 | Ga0105246_10147378 | Ga0105246_101473782 | 202 |
| 327 | 3300013102 | Ga0157371_10036625 | Ga0157371_100366252 | 202 |
| 328 | 3300013104 | Ga0157370_10151310 | Ga0157370_101513102 | 202 |
| 329 | 3300013105 | Ga0157369_10204196 | Ga0157369_102041962 | 202 |
| 330 | 3300013296 | Ga0157374_10181087 | Ga0157374_101810872 | 202 |
| 331 | 3300013297 | Ga0157378_10154309 | Ga0157378_101543092 | 202 |
| 332 | 3300013306 | Ga0163162_10126568 | Ga0163162_101265683 | 202 |
| 333 | 3300013307 | Ga0157372_10168063 | Ga0157372_101680631 | 202 |
| 334 | 3300013308 | Ga0157375_10126187 | Ga0157375_101261872 | 202 |
| 335 | 3300014325 | Ga0163163_10030748 | Ga0163163_100307482 | 202 |
| 336 | 3300014745 | Ga0157377_10136077 | Ga0157377_101360772 | 202 |
| 337 | 3300014968 | Ga0157379_10031582 | Ga0157379_100315823 | 202 |
| 338 | 3300014969 | Ga0157376_10099913 | Ga0157376_100999133 | 202 |
| 339 | 3300025898 | Ga0207692_10053074 | Ga0207692_100530741 | 202 |
| 340 | 3300025899 | Ga0207642_10285751 | Ga0207642_102857511 | 202 |
| 341 | 3300025905 | Ga0207685_10007869 | Ga0207685_100078692 | 202 |
| 342 | 3300025905 | Ga0207685_10057240 | Ga0207685_100572401 | 202 |
| 343 | 3300025906 | Ga0207699_10117753 | Ga0207699_101177532 | 202 |
| 344 | 3300025906 | Ga0207699_10161406 | Ga0207699_101614062 | 202 |
| 345 | 3300025906 | Ga0207699_10485290 | Ga0207699_104852901 | 202 |
| 346 | 3300025907 | Ga0207645_10038174 | Ga0207645_100381742 | 202 |
| 347 | 3300025910 | Ga0207684_10004878 | Ga0207684_100048786 | 202 |
| 348 | 3300025911 | Ga0207654_10004482 | Ga0207654_100044824 | 202 |
| 349 | 3300025912 | Ga0207707_10029531 | Ga0207707_100295312 | 202 |
| 350 | 3300025913 | Ga0207695_10335661 | Ga0207695_103356612 | 202 |
| 351 | 3300025914 | Ga0207671_10120902 | Ga0207671_101209022 | 202 |
| 352 | 3300025915 | Ga0207693_10000008 | Ga0207693_1000000821 | 202 |
| 353 | 3300025915 | Ga0207693_10001167 | Ga0207693_1000116716 | 202 |
| 354 | 3300025915 | Ga0207693_10014819 | Ga0207693_100148192 | 202 |
| 355 | 3300025916 | Ga0207663_10006731 | Ga0207663_100067312 | 202 |
| 356 | 3300025916 | Ga0207663_10063738 | Ga0207663_100637382 | 202 |
| 357 | 3300025917 | Ga0207660_10102627 | Ga0207660_101026272 | 202 |
| 358 | 3300025919 | Ga0207657_10002009 | Ga0207657_100020094 | 202 |
| 359 | 3300025921 | Ga0207652_10041980 | Ga0207652_100419802 | 202 |
| 360 | 3300025921 | Ga0207652_10344516 | Ga0207652_103445161 | 202 |
| 361 | 3300025922 | Ga0207646_10075945 | Ga0207646_100759452 | 202 |
| 362 | 3300025922 | Ga0207646_10589251 | Ga0207646_105892511 | 202 |
| 363 | 3300025923 | Ga0207681_10225877 | Ga0207681_102258772 | 202 |
| 364 | 3300025924 | Ga0207694_10097974 | Ga0207694_100979742 | 202 |
| 365 | 3300025927 | Ga0207687_10114092 | Ga0207687_101140922 | 202 |
| 366 | 3300025928 | Ga0207700_10000107 | Ga0207700_1000010716 | 202 |
| 367 | 3300025928 | Ga0207700_10010119 | Ga0207700_100101193 | 202 |
| 368 | 3300025929 | Ga0207664_10009130 | Ga0207664_100091304 | 202 |
| 369 | 3300025932 | Ga0207690_10205198 | Ga0207690_102051981 | 202 |
| 370 | 3300025933 | Ga0207706_10000641 | Ga0207706_1000064117 | 202 |
| 371 | 3300025938 | Ga0207704_10064155 | Ga0207704_100641552 | 202 |
| 372 | 3300025939 | Ga0207665_10018351 | Ga0207665_100183512 | 202 |
| 373 | 3300025939 | Ga0207665_10094235 | Ga0207665_100942352 | 202 |
| 374 | 3300025939 | Ga0207665_10754075 | Ga0207665_107540751 | 202 |
| 375 | 3300025941 | Ga0207711_10072201 | Ga0207711_100722012 | 202 |
| 376 | 3300025942 | Ga0207689_10037080 | Ga0207689_100370802 | 202 |
| 377 | 3300025949 | Ga0207667_10132120 | Ga0207667_101321202 | 202 |
| 378 | 3300025961 | Ga0207712_10013471 | Ga0207712_100134713 | 202 |
| 379 | 3300025972 | Ga0207668_10111420 | Ga0207668_101114202 | 202 |
| 380 | 3300025981 | Ga0207640_10169939 | Ga0207640_101699392 | 202 |
| 381 | 3300025986 | Ga0207658_10165063 | Ga0207658_101650632 | 202 |
| 382 | 3300026023 | Ga0207677_10019086 | Ga0207677_100190862 | 202 |
| 383 | 3300026035 | Ga0207703_10481222 | Ga0207703_104812221 | 202 |
| 384 | 3300026067 | Ga0207678_10008144 | Ga0207678_100081443 | 202 |
| 385 | 3300026078 | Ga0207702_10076581 | Ga0207702_100765812 | 202 |
| 386 | 3300026078 | Ga0207702_10596294 | Ga0207702_105962942 | 202 |
| 387 | 3300026088 | Ga0207641_11402919 | Ga0207641_114029191 | 202 |
| 388 | 3300026089 | Ga0207648_10017102 | Ga0207648_100171027 | 202 |
| 389 | 3300026095 | Ga0207676_10467760 | Ga0207676_104677602 | 202 |
| 390 | 3300026116 | Ga0207674_10022972 | Ga0207674_100229723 | 202 |
| 391 | 3300026116 | Ga0207674_10072389 | Ga0207674_100723892 | 202 |
| 392 | 3300026118 | Ga0207675_100039718 | Ga0207675_1000397183 | 202 |
| 393 | 3300026121 | Ga0207683_10240964 | Ga0207683_102409642 | 202 |
| 394 | 3300026142 | Ga0207698_10283269 | Ga0207698_102832692 | 202 |
| 395 | 3300027907 | Ga0207428_10131434 | Ga0207428_101314342 | 202 |
| 396 | 3300028380 | Ga0268265_10399849 | Ga0268265_103998492 | 202 |
| 397 | 3300028380 | Ga0268265_11027162 | Ga0268265_110271621 | 202 |
| 398 | 3300031090 | Ga0265760_10047254 | Ga0265760_100472541 | 202 |
| 399 | 3300035083 | Ga0373926_0002050 | Ga0373926_0002050_5239_5883 | 202 |
| 400 | 3300035088 | Ga0373940_0023795 | Ga0373940_0023795_211_876 | 202 |
| 401 | 3300035111 | Ga0373923_0020829 | Ga0373923_0020829_621_1265 | 202 |
| 402 | 3300035118 | Ga0373954_0044795 | Ga0373954_0044795_333_977 | 202 |
| 403 | 3300035121 | Ga0373960_0096923 | Ga0373960_0096923_14_655 | 202 |
| 404 | 3300035410 | Ga0373924_0078353 | Ga0373924_0078353_92_736 | 202 |
| 405 | 3300035691 | Ga0373931_0225736 | Ga0373931_0225736_67_732 | 202 |
| 406 | 3300035695 | Ga0373927_0009510 | Ga0373927_0009510_1150_1794 | 202 |
| 407 | 3300035725 | Ga0373947_0010983 | Ga0373947_0010983_3193_3837 | 202 |
| 408 | 3300035725 | Ga0373947_0291605 | Ga0373947_0291605_405_1049 | 202 |
| 409 | 3300036401 | Ga0373937_0007134 | Ga0373937_0007134_1913_2557 | 202 |
| 410 | 3300037853 | Ga0436364_0709940 | Ga0436364_0709940_225_899 | 202 |
| 411 | 3300039450 | Ga0436363_0658841 | Ga0436363_0658841_757_1401 | 202 |
| 412 | 3300042005 | Ga0439448_0062666 | Ga0439448_0062666_106_771 | 202 |
| 413 | 3300042156 | Ga0439446_0006588 | Ga0439446_0006588_596_1243 | 202 |
| 414 | 3300045051 | Ga0451576_0126510 | Ga0451576_0126510_1199_1864 | 202 |
| 415 | 3300045976 | Ga0466967_1154271 | Ga0466967_1154271_27_638 | 202 |
| 416 | 3300046462 | Ga0495651_0001373 | Ga0495651_0001373_4182_4826 | 202 |
| 417 | 3300046462 | Ga0495651_0032464 | Ga0495651_0032464_632_1276 | 202 |
| 418 | 3300046463 | Ga0495653_0005283 | Ga0495653_0005283_7981_8625 | 202 |
| 419 | 3300046463 | Ga0495653_0247078 | Ga0495653_0247078_490_1134 | 202 |
| 420 | 3300046472 | Ga0495580_0002181 | Ga0495580_0002181_5925_6566 | 202 |
| 421 | 3300046472 | Ga0495580_0002545 | Ga0495580_0002545_3194_3838 | 202 |
| 422 | 3300046472 | Ga0495580_0023134 | Ga0495580_0023134_3907_4551 | 202 |
| 423 | 3300046473 | Ga0495582_0036951 | Ga0495582_0036951_542_1186 | 202 |
| 424 | 3300046477 | Ga0495664_0027935 | Ga0495664_0027935_2543_3187 | 202 |
| 425 | 3300046511 | Ga0495608_0009893 | Ga0495608_0009893_4382_5026 | 202 |
| 426 | 3300046511 | Ga0495608_0532588 | Ga0495608_0532588_43_687 | 202 |
| 427 | 3300046516 | Ga0495628_0043933 | Ga0495628_0043933_226_870 | 202 |
| 428 | 3300046516 | Ga0495628_0090165 | Ga0495628_0090165_749_1393 | 202 |
| 429 | 3300046517 | Ga0495630_0022897 | Ga0495630_0022897_3194_3838 | 202 |
| 430 | 3300046517 | Ga0495630_0048007 | Ga0495630_0048007_133_777 | 202 |
| 431 | 3300046526 | Ga0495666_0179491 | Ga0495666_0179491_160_804 | 202 |
| 432 | 3300046529 | Ga0495652_0008144 | Ga0495652_0008144_4052_4696 | 202 |
| 433 | 3300046531 | Ga0495665_0002320 | Ga0495665_0002320_8110_8754 | 202 |
| 434 | 3300046531 | Ga0495665_0155495 | Ga0495665_0155495_44_688 | 202 |
| 435 | 3300046535 | Ga0495586_0038336 | Ga0495586_0038336_1527_2171 | 202 |
| 436 | 3300046536 | Ga0495587_0314036 | Ga0495587_0314036_196_840 | 202 |
| 437 | 3300046543 | Ga0495645_0101846 | Ga0495645_0101846_381_1025 | 202 |
| 438 | 3300046559 | Ga0495667_0031282 | Ga0495667_0031282_717_1361 | 202 |
| 439 | 3300046559 | Ga0495667_0273534 | Ga0495667_0273534_204_848 | 202 |
| 440 | 3300046663 | Ga0495635_0013058 | Ga0495635_0013058_5055_5699 | 202 |
| 441 | 3300046675 | Ga0495657_0009162 | Ga0495657_0009162_3235_3879 | 202 |
| 442 | 3300046678 | Ga0495599_0277347 | Ga0495599_0277347_183_827 | 202 |
| 443 | 3300046679 | Ga0495623_0008898 | Ga0495623_0008898_5084_5728 | 202 |
| 444 | 3300046680 | Ga0495646_0009519 | Ga0495646_0009519_158_802 | 202 |
| 445 | 3300046689 | Ga0495613_0153721 | Ga0495613_0153721_737_1381 | 202 |
| 446 | 3300046689 | Ga0495613_0199451 | Ga0495613_0199451_117_761 | 202 |
| 447 | 3300046690 | Ga0495624_0019445 | Ga0495624_0019445_3363_4007 | 202 |
| 448 | 3300046809 | Ga0495600_0019941 | Ga0495600_0019941_534_1178 | 202 |
| 449 | 3300047317 | Ga0495604_0008380 | Ga0495604_0008380_5952_6596 | 202 |
| 450 | 3300047317 | Ga0495604_0009311 | Ga0495604_0009311_1527_2171 | 202 |
| 451 | 3300047319 | Ga0495674_0019603 | Ga0495674_0019603_5164_5808 | 202 |
| 452 | 3300047321 | Ga0495676_0124792 | Ga0495676_0124792_281_925 | 202 |
| 453 | 3300047322 | Ga0495680_0002590 | Ga0495680_0002590_14665_15309 | 202 |
| 454 | 3300047444 | Ga0495675_0007363 | Ga0495675_0007363_1101_1745 | 202 |
| 455 | 3300047471 | Ga0495684_0027823 | Ga0495684_0027823_3066_3710 | 202 |
| 456 | 3300047673 | Ga0495593_0004135 | Ga0495593_0004135_5163_5807 | 202 |
| 457 | 3300048088 | Ga0495602_0049439 | Ga0495602_0049439_2661_3305 | 202 |
| 458 | 3300048905 | Ga0496102_0202857 | Ga0496102_0202857_855_1520 | 202 |
| 459 | 3300048907 | Ga0496104_0162806 | Ga0496104_0162806_358_1023 | 202 |
| 460 | 3300048908 | Ga0496105_0372092 | Ga0496105_0372092_132_767 | 202 |
| 461 | 3300048911 | Ga0496108_0538522 | Ga0496108_0538522_170_817 | 202 |
| 462 | 3300048912 | Ga0496109_0238219 | Ga0496109_0238219_887_1534 | 202 |
| 463 | 3300048912 | Ga0496109_0419379 | Ga0496109_0419379_449_1114 | 202 |
| 464 | 3300048913 | Ga0496110_0034465 | Ga0496110_0034465_3495_4124 | 202 |
| 465 | 3300048914 | Ga0496111_0217779 | Ga0496111_0217779_640_1269 | 202 |
| 466 | 3300048915 | Ga0496112_0098038 | Ga0496112_0098038_590_1255 | 202 |
| 467 | 3300048915 | Ga0496112_0800490 | Ga0496112_0800490_144_773 | 202 |
| 468 | 3300048917 | Ga0496114_0139359 | Ga0496114_0139359_1103_1738 | 202 |
| 469 | 3300049568 | Ga0501031_0443195 | Ga0501031_0443195_54_701 | 202 |
| 470 | 3300049575 | Ga0501039_0039377 | Ga0501039_0039377_2766_3413 | 202 |
| 471 | 3300049577 | Ga0501041_0408190 | Ga0501041_0408190_209_835 | 202 |
| 472 | 3300049578 | Ga0501042_0077653 | Ga0501042_0077653_489_1136 | 202 |
| 473 | 3300049578 | Ga0501042_0350451 | Ga0501042_0350451_241_885 | 202 |
| 474 | 3300049582 | Ga0501048_0026386 | Ga0501048_0026386_1093_1740 | 202 |
| 475 | 3300049587 | Ga0501071_0220594 | Ga0501071_0220594_339_986 | 202 |
| 476 | 3300049588 | Ga0501072_0067686 | Ga0501072_0067686_1908_2555 | 202 |
| 477 | 3300049592 | Ga0501076_0076312 | Ga0501076_0076312_348_992 | 202 |
| 478 | 3300049824 | Ga0501045_0016653 | Ga0501045_0016653_636_1283 | 202 |
| 479 | 3300049824 | Ga0501045_0367901 | Ga0501045_0367901_108_752 | 202 |
| 480 | 3300050507 | nmdc:mga05p37_593396_c1 | nmdc:mga05p37_593396_c1_400_1020 | 202 |
| 481 | 3300050509 | nmdc:mga0qj67_708363_c1 | nmdc:mga0qj67_708363_c1_11_658 | 202 |
| 482 | 3300050510 | nmdc:mga06r32_515034_c1 | nmdc:mga06r32_515034_c1_179_826 | 202 |
| 483 | 3300050512 | nmdc:mga0n895_298035_c1 | nmdc:mga0n895_298035_c1_665_1294 | 202 |
| 484 | 3300050512 | nmdc:mga0n895_380676_c1 | nmdc:mga0n895_380676_c1_206_835 | 202 |
| 485 | 3300050513 | nmdc:mga0rr50_242372_c1 | nmdc:mga0rr50_242372_c1_609_1238 | 202 |
| 486 | 3300050514 | nmdc:mga08x19_188298_c1 | nmdc:mga08x19_188298_c1_365_1030 | 202 |
| 487 | 3300050514 | nmdc:mga08x19_67866_c1 | nmdc:mga08x19_67866_c1_946_1575 | 202 |
| 488 | 3300050515 | nmdc:mga0a205_77284_c1 | nmdc:mga0a205_77284_c1_2494_3108 | 202 |
| 489 | 3300053078 | Ga0495612_0003688 | Ga0495612_0003688_4796_5440 | 202 |
| 490 | 3300060353 | Ga0501082_0090837 | Ga0501082_0090837_698_1345 | 202 |
| 491 | 3300061734 | Ga0530510_0295225 | Ga0530510_0295225_444_1091 | 202 |
| 492 | 3300004800 | Ga0058861_10036557 | Ga0058861_100365571 | 203 |
| 493 | 3300004803 | Ga0058862_10248621 | Ga0058862_102486211 | 203 |
| 494 | 3300005290 | Ga0065712_10011524 | Ga0065712_100115242 | 203 |
| 495 | 3300005293 | Ga0065715_10276677 | Ga0065715_102766772 | 203 |
| 496 | 3300005295 | Ga0065707_10259718 | Ga0065707_102597181 | 203 |
| 497 | 3300005327 | Ga0070658_10001935 | Ga0070658_1000193515 | 203 |
| 498 | 3300005328 | Ga0070676_10487851 | Ga0070676_104878511 | 203 |
| 499 | 3300005328 | Ga0070676_10681715 | Ga0070676_106817151 | 203 |
| 500 | 3300005329 | Ga0070683_100242079 | Ga0070683_1002420791 | 203 |
| 501 | 3300005334 | Ga0068869_100303592 | Ga0068869_1003035922 | 203 |
| 502 | 3300005335 | Ga0070666_10003858 | Ga0070666_100038588 | 203 |
| 503 | 3300005338 | Ga0068868_100008417 | Ga0068868_1000084172 | 203 |
| 504 | 3300005338 | Ga0068868_100031991 | Ga0068868_1000319911 | 203 |
| 505 | 3300005339 | Ga0070660_100029894 | Ga0070660_1000298943 | 203 |
| 506 | 3300005339 | Ga0070660_100475487 | Ga0070660_1004754872 | 203 |
| 507 | 3300005340 | Ga0070689_100305670 | Ga0070689_1003056702 | 203 |
| 508 | 3300005341 | Ga0070691_10099155 | Ga0070691_100991552 | 203 |
| 509 | 3300005341 | Ga0070691_10358426 | Ga0070691_103584261 | 203 |
| 510 | 3300005344 | Ga0070661_100292901 | Ga0070661_1002929011 | 203 |
| 511 | 3300005345 | Ga0070692_10194998 | Ga0070692_101949982 | 203 |
| 512 | 3300005355 | Ga0070671_100038666 | Ga0070671_1000386664 | 203 |
| 513 | 3300005356 | Ga0070674_100138251 | Ga0070674_1001382512 | 203 |
| 514 | 3300005356 | Ga0070674_100570608 | Ga0070674_1005706081 | 203 |
| 515 | 3300005364 | Ga0070673_100076822 | Ga0070673_1000768224 | 203 |
| 516 | 3300005366 | Ga0070659_100176265 | Ga0070659_1001762652 | 203 |
| 517 | 3300005367 | Ga0070667_100178716 | Ga0070667_1001787162 | 203 |
| 518 | 3300005367 | Ga0070667_100437577 | Ga0070667_1004375771 | 203 |
| 519 | 3300005434 | Ga0070709_10211787 | Ga0070709_102117871 | 203 |
| 520 | 3300005437 | Ga0070710_10103941 | Ga0070710_101039412 | 203 |
| 521 | 3300005439 | Ga0070711_100580419 | Ga0070711_1005804192 | 203 |
| 522 | 3300005441 | Ga0070700_100206395 | Ga0070700_1002063951 | 203 |
| 523 | 3300005444 | Ga0070694_100260297 | Ga0070694_1002602972 | 203 |
| 524 | 3300005445 | Ga0070708_100003651 | Ga0070708_1000036512 | 203 |
| 525 | 3300005457 | Ga0070662_100896278 | Ga0070662_1008962781 | 203 |
| 526 | 3300005458 | Ga0070681_10021636 | Ga0070681_100216365 | 203 |
| 527 | 3300005458 | Ga0070681_10229101 | Ga0070681_102291013 | 203 |
| 528 | 3300005458 | Ga0070681_10461488 | Ga0070681_104614882 | 203 |
| 529 | 3300005459 | Ga0068867_100371018 | Ga0068867_1003710181 | 203 |
| 530 | 3300005467 | Ga0070706_100000336 | Ga0070706_10000033619 | 203 |
| 531 | 3300005467 | Ga0070706_100011620 | Ga0070706_1000116202 | 203 |
| 532 | 3300005468 | Ga0070707_100019771 | Ga0070707_1000197711 | 203 |
| 533 | 3300005468 | Ga0070707_100075730 | Ga0070707_1000757302 | 203 |
| 534 | 3300005471 | Ga0070698_100005969 | Ga0070698_10000596913 | 203 |
| 535 | 3300005471 | Ga0070698_100436850 | Ga0070698_1004368502 | 203 |
| 536 | 3300005518 | Ga0070699_100116789 | Ga0070699_1001167892 | 203 |
| 537 | 3300005530 | Ga0070679_100192381 | Ga0070679_1001923812 | 203 |
| 538 | 3300005530 | Ga0070679_100821069 | Ga0070679_1008210691 | 203 |
| 539 | 3300005535 | Ga0070684_100216622 | Ga0070684_1002166222 | 203 |
| 540 | 3300005535 | Ga0070684_100237953 | Ga0070684_1002379533 | 203 |
| 541 | 3300005536 | Ga0070697_100303155 | Ga0070697_1003031552 | 203 |
| 542 | 3300005548 | Ga0070665_100010604 | Ga0070665_1000106042 | 203 |
| 543 | 3300005549 | Ga0070704_100142667 | Ga0070704_1001426672 | 203 |
| 544 | 3300005563 | Ga0068855_100056475 | Ga0068855_1000564752 | 203 |
| 545 | 3300005563 | Ga0068855_100069495 | Ga0068855_1000694953 | 203 |
| 546 | 3300005563 | Ga0068855_100179856 | Ga0068855_1001798563 | 203 |
| 547 | 3300005577 | Ga0068857_100004869 | Ga0068857_1000048696 | 203 |
| 548 | 3300005577 | Ga0068857_100630244 | Ga0068857_1006302442 | 203 |
| 549 | 3300005614 | Ga0068856_100015026 | Ga0068856_1000150262 | 203 |
| 550 | 3300005614 | Ga0068856_100343939 | Ga0068856_1003439391 | 203 |
| 551 | 3300005614 | Ga0068856_100415250 | Ga0068856_1004152502 | 203 |
| 552 | 3300005614 | Ga0068856_100794215 | Ga0068856_1007942152 | 203 |
| 553 | 3300005617 | Ga0068859_100054101 | Ga0068859_1000541014 | 203 |
| 554 | 3300005617 | Ga0068859_100057994 | Ga0068859_1000579942 | 203 |
| 555 | 3300005618 | Ga0068864_100113454 | Ga0068864_1001134542 | 203 |
| 556 | 3300005718 | Ga0068866_10538506 | Ga0068866_105385061 | 203 |
| 557 | 3300005834 | Ga0068851_10263551 | Ga0068851_102635512 | 203 |
| 558 | 3300005841 | Ga0068863_100209381 | Ga0068863_1002093812 | 203 |
| 559 | 3300005842 | Ga0068858_100005875 | Ga0068858_1000058759 | 203 |
| 560 | 3300005842 | Ga0068858_100030640 | Ga0068858_1000306405 | 203 |
| 561 | 3300005844 | Ga0068862_101074491 | Ga0068862_1010744911 | 203 |
| 562 | 3300005844 | Ga0068862_101127237 | Ga0068862_1011272371 | 203 |
| 563 | 3300006028 | Ga0070717_10661895 | Ga0070717_106618951 | 203 |
| 564 | 3300006237 | Ga0097621_100004631 | Ga0097621_1000046314 | 203 |
| 565 | 3300006237 | Ga0097621_100009851 | Ga0097621_1000098512 | 203 |
| 566 | 3300006237 | Ga0097621_100016167 | Ga0097621_1000161674 | 203 |
| 567 | 3300006237 | Ga0097621_100040561 | Ga0097621_1000405612 | 203 |
| 568 | 3300006358 | Ga0068871_100003703 | Ga0068871_1000037032 | 203 |
| 569 | 3300006358 | Ga0068871_100014760 | Ga0068871_1000147606 | 203 |
| 570 | 3300006358 | Ga0068871_100031326 | Ga0068871_1000313262 | 203 |
| 571 | 3300006358 | Ga0068871_100223685 | Ga0068871_1002236852 | 203 |
| 572 | 3300006847 | Ga0075431_100021655 | Ga0075431_1000216552 | 203 |
| 573 | 3300006847 | Ga0075431_100646080 | Ga0075431_1006460802 | 203 |
| 574 | 3300006852 | Ga0075433_10552307 | Ga0075433_105523071 | 203 |
| 575 | 3300006871 | Ga0075434_100140467 | Ga0075434_1001404672 | 203 |
| 576 | 3300006880 | Ga0075429_100292237 | Ga0075429_1002922372 | 203 |
| 577 | 3300006881 | Ga0068865_100005640 | Ga0068865_1000056407 | 203 |
| 578 | 3300006931 | Ga0097620_100054103 | Ga0097620_1000541034 | 203 |
| 579 | 3300006931 | Ga0097620_100057994 | Ga0097620_1000579942 | 203 |
| 580 | 3300007076 | Ga0075435_100226805 | Ga0075435_1002268052 | 203 |
| 581 | 3300009093 | Ga0105240_10101427 | Ga0105240_101014272 | 203 |
| 582 | 3300009093 | Ga0105240_10142109 | Ga0105240_101421091 | 203 |
| 583 | 3300009093 | Ga0105240_10229600 | Ga0105240_102296002 | 203 |
| 584 | 3300009094 | Ga0111539_10198586 | Ga0111539_101985863 | 203 |
| 585 | 3300009098 | Ga0105245_10004807 | Ga0105245_100048072 | 203 |
| 586 | 3300009098 | Ga0105245_10015180 | Ga0105245_100151807 | 203 |
| 587 | 3300009098 | Ga0105245_10110472 | Ga0105245_101104722 | 203 |
| 588 | 3300009147 | Ga0114129_10005337 | Ga0114129_100053379 | 203 |
| 589 | 3300009147 | Ga0114129_11698884 | Ga0114129_116988841 | 203 |
| 590 | 3300009174 | Ga0105241_10007930 | Ga0105241_100079303 | 203 |
| 591 | 3300009174 | Ga0105241_10071177 | Ga0105241_100711772 | 203 |
| 592 | 3300009174 | Ga0105241_10862668 | Ga0105241_108626682 | 203 |
| 593 | 3300009176 | Ga0105242_10001360 | Ga0105242_100013602 | 203 |
| 594 | 3300009176 | Ga0105242_10020549 | Ga0105242_100205495 | 203 |
| 595 | 3300009176 | Ga0105242_10107701 | Ga0105242_101077012 | 203 |
| 596 | 3300009176 | Ga0105242_10183038 | Ga0105242_101830383 | 203 |
| 597 | 3300009176 | Ga0105242_10770472 | Ga0105242_107704722 | 203 |
| 598 | 3300009177 | Ga0105248_10007399 | Ga0105248_1000739914 | 203 |
| 599 | 3300009177 | Ga0105248_10014774 | Ga0105248_100147742 | 203 |
| 600 | 3300009177 | Ga0105248_10112872 | Ga0105248_101128723 | 203 |
| 601 | 3300009177 | Ga0105248_10179687 | Ga0105248_101796872 | 203 |
| 602 | 3300009177 | Ga0105248_11092616 | Ga0105248_110926161 | 203 |
| 603 | 3300009545 | Ga0105237_10005536 | Ga0105237_100055363 | 203 |
| 604 | 3300009545 | Ga0105237_10019805 | Ga0105237_100198057 | 203 |
| 605 | 3300009545 | Ga0105237_10506995 | Ga0105237_105069951 | 203 |
| 606 | 3300009551 | Ga0105238_10001919 | Ga0105238_1000191917 | 203 |
| 607 | 3300009551 | Ga0105238_10004737 | Ga0105238_100047375 | 203 |
| 608 | 3300009551 | Ga0105238_10038817 | Ga0105238_100388172 | 203 |
| 609 | 3300009551 | Ga0105238_10093868 | Ga0105238_100938683 | 203 |
| 610 | 3300010375 | Ga0105239_10074194 | Ga0105239_100741942 | 203 |
| 611 | 3300010375 | Ga0105239_10158181 | Ga0105239_101581812 | 203 |
| 612 | 3300011119 | Ga0105246_10740334 | Ga0105246_107403341 | 203 |
| 613 | 3300013104 | Ga0157370_10034683 | Ga0157370_100346833 | 203 |
| 614 | 3300013296 | Ga0157374_10015683 | Ga0157374_100156836 | 203 |
| 615 | 3300013296 | Ga0157374_10067662 | Ga0157374_100676623 | 203 |
| 616 | 3300013296 | Ga0157374_10142843 | Ga0157374_101428433 | 203 |
| 617 | 3300013297 | Ga0157378_10044978 | Ga0157378_100449782 | 203 |
| 618 | 3300013297 | Ga0157378_10381251 | Ga0157378_103812511 | 203 |
| 619 | 3300013297 | Ga0157378_11844526 | Ga0157378_118445261 | 203 |
| 620 | 3300013306 | Ga0163162_10005046 | Ga0163162_100050462 | 203 |
| 621 | 3300013307 | Ga0157372_10355799 | Ga0157372_103557992 | 203 |
| 622 | 3300014325 | Ga0163163_10003604 | Ga0163163_100036042 | 203 |
| 623 | 3300014325 | Ga0163163_10015653 | Ga0163163_100156534 | 203 |
| 624 | 3300014325 | Ga0163163_10433870 | Ga0163163_104338702 | 203 |
| 625 | 3300014326 | Ga0157380_10030037 | Ga0157380_100300372 | 203 |
| 626 | 3300014326 | Ga0157380_10343519 | Ga0157380_103435191 | 203 |
| 627 | 3300014968 | Ga0157379_10009128 | Ga0157379_100091288 | 203 |
| 628 | 3300014968 | Ga0157379_10133860 | Ga0157379_101338603 | 203 |
| 629 | 3300014969 | Ga0157376_10013883 | Ga0157376_100138832 | 203 |
| 630 | 3300014969 | Ga0157376_10176084 | Ga0157376_101760841 | 203 |
| 631 | 3300014969 | Ga0157376_10393522 | Ga0157376_103935221 | 203 |
| 632 | 3300020069 | Ga0197907_11172755 | Ga0197907_111727552 | 203 |
| 633 | 3300020070 | Ga0206356_10692860 | Ga0206356_106928602 | 203 |
| 634 | 3300020075 | Ga0206349_1753059 | Ga0206349_17530591 | 203 |
| 635 | 3300020076 | Ga0206355_1664126 | Ga0206355_16641262 | 203 |
| 636 | 3300020077 | Ga0206351_10013904 | Ga0206351_100139042 | 203 |
| 637 | 3300020078 | Ga0206352_11289791 | Ga0206352_112897911 | 203 |
| 638 | 3300020080 | Ga0206350_11488832 | Ga0206350_114888322 | 203 |
| 639 | 3300022467 | Ga0224712_10207188 | Ga0224712_102071881 | 203 |
| 640 | 3300024227 | Ga0228598_1002817 | Ga0228598_10028172 | 203 |
| 641 | 3300025900 | Ga0207710_10098433 | Ga0207710_100984332 | 203 |
| 642 | 3300025903 | Ga0207680_10040696 | Ga0207680_100406963 | 203 |
| 643 | 3300025906 | Ga0207699_10260390 | Ga0207699_102603902 | 203 |
| 644 | 3300025907 | Ga0207645_10051956 | Ga0207645_100519562 | 203 |
| 645 | 3300025908 | Ga0207643_10123254 | Ga0207643_101232542 | 203 |
| 646 | 3300025910 | Ga0207684_10000320 | Ga0207684_1000032029 | 203 |
| 647 | 3300025910 | Ga0207684_10163597 | Ga0207684_101635972 | 203 |
| 648 | 3300025911 | Ga0207654_10011027 | Ga0207654_100110272 | 203 |
| 649 | 3300025911 | Ga0207654_10048092 | Ga0207654_100480923 | 203 |
| 650 | 3300025912 | Ga0207707_10070345 | Ga0207707_100703452 | 203 |
| 651 | 3300025912 | Ga0207707_10176006 | Ga0207707_101760062 | 203 |
| 652 | 3300025912 | Ga0207707_10268375 | Ga0207707_102683752 | 203 |
| 653 | 3300025913 | Ga0207695_10036539 | Ga0207695_100365393 | 203 |
| 654 | 3300025914 | Ga0207671_10025824 | Ga0207671_100258242 | 203 |
| 655 | 3300025914 | Ga0207671_10160495 | Ga0207671_101604952 | 203 |
| 656 | 3300025917 | Ga0207660_10150531 | Ga0207660_101505312 | 203 |
| 657 | 3300025919 | Ga0207657_10000386 | Ga0207657_1000038617 | 203 |
| 658 | 3300025921 | Ga0207652_10814602 | Ga0207652_108146021 | 203 |
| 659 | 3300025922 | Ga0207646_10100259 | Ga0207646_101002592 | 203 |
| 660 | 3300025923 | Ga0207681_10347897 | Ga0207681_103478972 | 203 |
| 661 | 3300025924 | Ga0207694_10004655 | Ga0207694_100046555 | 203 |
| 662 | 3300025924 | Ga0207694_10115616 | Ga0207694_101156162 | 203 |
| 663 | 3300025927 | Ga0207687_10024093 | Ga0207687_100240935 | 203 |
| 664 | 3300025927 | Ga0207687_10148704 | Ga0207687_101487042 | 203 |
| 665 | 3300025927 | Ga0207687_10279221 | Ga0207687_102792211 | 203 |
| 666 | 3300025928 | Ga0207700_10049225 | Ga0207700_100492252 | 203 |
| 667 | 3300025931 | Ga0207644_10076117 | Ga0207644_100761174 | 203 |
| 668 | 3300025932 | Ga0207690_10140095 | Ga0207690_101400953 | 203 |
| 669 | 3300025934 | Ga0207686_10009876 | Ga0207686_100098766 | 203 |
| 670 | 3300025934 | Ga0207686_10156132 | Ga0207686_101561322 | 203 |
| 671 | 3300025935 | Ga0207709_10027612 | Ga0207709_100276121 | 203 |
| 672 | 3300025937 | Ga0207669_10452917 | Ga0207669_104529171 | 203 |
| 673 | 3300025938 | Ga0207704_10007997 | Ga0207704_100079973 | 203 |
| 674 | 3300025939 | Ga0207665_10299409 | Ga0207665_102994092 | 203 |
| 675 | 3300025941 | Ga0207711_10015924 | Ga0207711_100159243 | 203 |
| 676 | 3300025941 | Ga0207711_10131330 | Ga0207711_101313301 | 203 |
| 677 | 3300025941 | Ga0207711_10207145 | Ga0207711_102071452 | 203 |
| 678 | 3300025941 | Ga0207711_10401447 | Ga0207711_104014472 | 203 |
| 679 | 3300025942 | Ga0207689_10298462 | Ga0207689_102984622 | 203 |
| 680 | 3300025944 | Ga0207661_10088081 | Ga0207661_100880812 | 203 |
| 681 | 3300025972 | Ga0207668_10941433 | Ga0207668_109414332 | 203 |
| 682 | 3300025986 | Ga0207658_10037531 | Ga0207658_100375312 | 203 |
| 683 | 3300026023 | Ga0207677_10024214 | Ga0207677_100242143 | 203 |
| 684 | 3300026023 | Ga0207677_10081192 | Ga0207677_100811922 | 203 |
| 685 | 3300026035 | Ga0207703_10001790 | Ga0207703_100017903 | 203 |
| 686 | 3300026035 | Ga0207703_10014533 | Ga0207703_100145334 | 203 |
| 687 | 3300026041 | Ga0207639_10038873 | Ga0207639_100388735 | 203 |
| 688 | 3300026041 | Ga0207639_10091787 | Ga0207639_100917871 | 203 |
| 689 | 3300026075 | Ga0207708_10077097 | Ga0207708_100770972 | 203 |
| 690 | 3300026075 | Ga0207708_10097684 | Ga0207708_100976843 | 203 |
| 691 | 3300026078 | Ga0207702_10019362 | Ga0207702_100193625 | 203 |
| 692 | 3300026078 | Ga0207702_10669738 | Ga0207702_106697382 | 203 |
| 693 | 3300026078 | Ga0207702_10786190 | Ga0207702_107861901 | 203 |
| 694 | 3300026088 | Ga0207641_10155964 | Ga0207641_101559642 | 203 |
| 695 | 3300026089 | Ga0207648_10030982 | Ga0207648_100309827 | 203 |
| 696 | 3300026095 | Ga0207676_10054554 | Ga0207676_100545543 | 203 |
| 697 | 3300026116 | Ga0207674_10007441 | Ga0207674_1000744111 | 203 |
| 698 | 3300026116 | Ga0207674_10584877 | Ga0207674_105848772 | 203 |
| 699 | 3300027907 | Ga0207428_10042299 | Ga0207428_100422992 | 203 |
| 700 | 3300028379 | Ga0268266_10010487 | Ga0268266_100104876 | 203 |
| 701 | 3300028381 | Ga0268264_10069183 | Ga0268264_100691833 | 203 |
| 702 | 3300030760 | Ga0265762_1009046 | Ga0265762_10090462 | 203 |
| 703 | 3300031090 | Ga0265760_10009617 | Ga0265760_100096172 | 203 |
| 704 | 3300031344 | Ga0265316_10019518 | Ga0265316_100195182 | 203 |
| 705 | 3300031852 | Ga0307410_10514380 | Ga0307410_105143801 | 203 |
| 706 | 3300032002 | Ga0307416_100704517 | Ga0307416_1007045172 | 203 |
| 707 | 3300032002 | Ga0307416_101061173 | Ga0307416_1010611732 | 203 |
| 708 | 3300033547 | Ga0316212_1006719 | Ga0316212_10067192 | 203 |
| 709 | 3300035118 | Ga0373954_0098267 | Ga0373954_0098267_220_849 | 203 |
| 710 | 3300035121 | Ga0373960_0087785 | Ga0373960_0087785_333_944 | 203 |
| 711 | 3300035171 | Ga0373946_0050531 | Ga0373946_0050531_39_665 | 203 |
| 712 | 3300035692 | Ga0373935_0464150 | Ga0373935_0464150_66_713 | 203 |
| 713 | 3300035695 | Ga0373927_0086616 | Ga0373927_0086616_792_1418 | 203 |
| 714 | 3300035725 | Ga0373947_0034871 | Ga0373947_0034871_815_1441 | 203 |
| 715 | 3300035725 | Ga0373947_0486350 | Ga0373947_0486350_178_825 | 203 |
| 716 | 3300037068 | Ga0373925_0009287 | Ga0373925_0009287_3783_4409 | 203 |
| 717 | 3300037068 | Ga0373925_0118344 | Ga0373925_0118344_1044_1691 | 203 |
| 718 | 3300037068 | Ga0373925_0126759 | Ga0373925_0126759_457_1089 | 203 |
| 719 | 3300037466 | Ga0395898_1026711 | Ga0395898_1026711_54_701 | 203 |
| 720 | 3300037853 | Ga0436364_0537501 | Ga0436364_0537501_114_785 | 203 |
| 721 | 3300042003 | Ga0439443_016035 | Ga0439443_016035_465_1079 | 203 |
| 722 | 3300042437 | Ga0439444_0062924 | Ga0439444_0062924_29_667 | 203 |
| 723 | 3300042439 | Ga0439464_0033295 | Ga0439464_0033295_197_826 | 203 |
| 724 | 3300046472 | Ga0495580_0087729 | Ga0495580_0087729_500_1132 | 203 |
| 725 | 3300046499 | Ga0495594_0023384 | Ga0495594_0023384_2591_3223 | 203 |
| 726 | 3300046517 | Ga0495630_0557236 | Ga0495630_0557236_203_829 | 203 |
| 727 | 3300046663 | Ga0495635_0203767 | Ga0495635_0203767_574_1200 | 203 |
| 728 | 3300047315 | Ga0495581_0024597 | Ga0495581_0024597_1812_2438 | 203 |
| 729 | 3300048905 | Ga0496102_1045067 | Ga0496102_1045067_19_666 | 203 |
| 730 | 3300048907 | Ga0496104_0344773 | Ga0496104_0344773_582_1229 | 203 |
| 731 | 3300048908 | Ga0496105_0037794 | Ga0496105_0037794_2981_3628 | 203 |
| 732 | 3300048910 | Ga0496107_0720109 | Ga0496107_0720109_28_675 | 203 |
| 733 | 3300048912 | Ga0496109_0549313 | Ga0496109_0549313_123_749 | 203 |
| 734 | 3300048915 | Ga0496112_0144118 | Ga0496112_0144118_161_778 | 203 |
| 735 | 3300048915 | Ga0496112_0159495 | Ga0496112_0159495_202_849 | 203 |
| 736 | 3300048917 | Ga0496114_0035011 | Ga0496114_0035011_757_1404 | 203 |
| 737 | 3300048918 | Ga0496115_0002823 | Ga0496115_0002823_11060_11707 | 203 |
| 738 | 3300048918 | Ga0496115_0118148 | Ga0496115_0118148_500_1126 | 203 |
| 739 | 3300049576 | Ga0501040_0128382 | Ga0501040_0128382_881_1495 | 203 |
| 740 | 3300049584 | Ga0501068_0504755 | Ga0501068_0504755_47_679 | 203 |
| 741 | 3300049586 | Ga0501070_0377852 | Ga0501070_0377852_473_1114 | 203 |
| 742 | 3300049587 | Ga0501071_0243516 | Ga0501071_0243516_546_1181 | 203 |
| 743 | 3300049587 | Ga0501071_0410564 | Ga0501071_0410564_18_650 | 203 |
| 744 | 3300049587 | Ga0501071_0639214 | Ga0501071_0639214_182_796 | 203 |
| 745 | 3300049593 | Ga0501077_0060019 | Ga0501077_0060019_1326_1940 | 203 |
| 746 | 3300049593 | Ga0501077_0202698 | Ga0501077_0202698_527_1162 | 203 |
| 747 | 3300049742 | Ga0501080_0335926 | Ga0501080_0335926_109_741 | 203 |
| 748 | 3300049743 | Ga0501081_0131432 | Ga0501081_0131432_562_1197 | 203 |
| 749 | 3300049824 | Ga0501045_0641675 | Ga0501045_0641675_52_693 | 203 |
| 750 | 3300050507 | nmdc:mga05p37_37637_c1 | nmdc:mga05p37_37637_c1_2636_3265 | 203 |
| 751 | 3300050508 | nmdc:mga09592_312434_c1 | nmdc:mga09592_312434_c1_372_1001 | 203 |
| 752 | 3300050509 | nmdc:mga0qj67_773867_c1 | nmdc:mga0qj67_773867_c1_28_663 | 203 |
| 753 | 3300050510 | nmdc:mga06r32_75596_c1 | nmdc:mga06r32_75596_c1_2003_2632 | 203 |
| 754 | 3300050511 | nmdc:mga08y16_22738_c1 | nmdc:mga08y16_22738_c1_2888_3523 | 203 |
| 755 | 3300050511 | nmdc:mga08y16_696424_c1 | nmdc:mga08y16_696424_c1_310_924 | 203 |
| 756 | 3300050512 | nmdc:mga0n895_1425468_c1 | nmdc:mga0n895_1425468_c1_35_649 | 203 |
| 757 | 3300050512 | nmdc:mga0n895_281053_c1 | nmdc:mga0n895_281053_c1_180_797 | 203 |
| 758 | 3300050513 | nmdc:mga0rr50_167658_c1 | nmdc:mga0rr50_167658_c1_714_1361 | 203 |
| 759 | 3300050515 | nmdc:mga0a205_374386_c1 | nmdc:mga0a205_374386_c1_306_920 | 203 |
| 760 | 3300053085 | Ga0495619_0371442 | Ga0495619_0371442_256_882 | 203 |
| 761 | 3300059491 | Ga0587070_068515 | Ga0587070_068515_52_687 | 203 |
| 762 | 3300059492 | Ga0587073_0032666 | Ga0587073_0032666_386_1021 | 203 |
| 763 | 3300059493 | Ga0587077_068126 | Ga0587077_068126_36_668 | 203 |
| 764 | 3300059493 | Ga0587077_084522 | Ga0587077_084522_66_701 | 203 |
| 765 | 3300059505 | Ga0587083_0047454 | Ga0587083_0047454_65_700 | 203 |
| 766 | 3300059513 | Ga0587094_020989 | Ga0587094_020989_116_748 | 203 |
| 767 | 3300059513 | Ga0587094_037307 | Ga0587094_037307_85_711 | 203 |
| 768 | 3300059513 | Ga0587094_041757 | Ga0587094_041757_61_693 | 203 |
| 769 | 3300059645 | Ga0587076_054161 | Ga0587076_054161_66_701 | 203 |
| 770 | 3300059648 | Ga0587100_013011 | Ga0587100_013011_45_671 | 203 |
| 771 | 3300059660 | Ga0587124_018644 | Ga0587124_018644_50_676 | 203 |
| 772 | 3300060353 | Ga0501082_0458990 | Ga0501082_0458990_47_688 | 203 |
| 773 | 3300060353 | Ga0501082_0646760 | Ga0501082_0646760_108_731 | 203 |
| 774 | 3300002459 | JGI24751J29686_10001715 | JGI24751J29686_100017153 | 204 |
| 775 | 3300002459 | JGI24751J29686_10019096 | JGI24751J29686_100190962 | 204 |
| 776 | 3300003163 | Ga0006759J45824_1088694 | Ga0006759J45824_10886941 | 204 |
| 777 | 3300003544 | Ga0007417J51691_1024758 | Ga0007417J51691_10247581 | 204 |
| 778 | 3300003544 | Ga0007417J51691_1064518 | Ga0007417J51691_10645181 | 204 |
| 779 | 3300003574 | Ga0007410J51695_1055657 | Ga0007410J51695_10556571 | 204 |
| 780 | 3300003575 | Ga0007409J51694_1058321 | Ga0007409J51694_10583211 | 204 |
| 781 | 3300003579 | Ga0007429J51699_1059572 | Ga0007429J51699_10595721 | 204 |
| 782 | 3300003579 | Ga0007429J51699_1063966 | Ga0007429J51699_10639661 | 204 |
| 783 | 3300004798 | Ga0058859_10021908 | Ga0058859_100219082 | 204 |
| 784 | 3300004798 | Ga0058859_10031263 | Ga0058859_100312631 | 204 |
| 785 | 3300004798 | Ga0058859_10041715 | Ga0058859_100417152 | 204 |
| 786 | 3300004798 | Ga0058859_11654266 | Ga0058859_116542662 | 204 |
| 787 | 3300004798 | Ga0058859_11762873 | Ga0058859_117628731 | 204 |
| 788 | 3300004801 | Ga0058860_10077957 | Ga0058860_100779572 | 204 |
| 789 | 3300005290 | Ga0065712_10164863 | Ga0065712_101648631 | 204 |
| 790 | 3300005290 | Ga0065712_10241478 | Ga0065712_102414782 | 204 |
| 791 | 3300005295 | Ga0065707_10098316 | Ga0065707_100983162 | 204 |
| 792 | 3300005328 | Ga0070676_10143445 | Ga0070676_101434452 | 204 |
| 793 | 3300005329 | Ga0070683_100275147 | Ga0070683_1002751472 | 204 |
| 794 | 3300005331 | Ga0070670_100096802 | Ga0070670_1000968022 | 204 |
| 795 | 3300005331 | Ga0070670_100100636 | Ga0070670_1001006362 | 204 |
| 796 | 3300005331 | Ga0070670_100133737 | Ga0070670_1001337372 | 204 |
| 797 | 3300005331 | Ga0070670_100444992 | Ga0070670_1004449922 | 204 |
| 798 | 3300005333 | Ga0070677_10043964 | Ga0070677_100439642 | 204 |
| 799 | 3300005334 | Ga0068869_100083205 | Ga0068869_1000832052 | 204 |
| 800 | 3300005335 | Ga0070666_10070622 | Ga0070666_100706222 | 204 |
| 801 | 3300005335 | Ga0070666_10212844 | Ga0070666_102128442 | 204 |
| 802 | 3300005336 | Ga0070680_100327124 | Ga0070680_1003271242 | 204 |
| 803 | 3300005337 | Ga0070682_100102395 | Ga0070682_1001023952 | 204 |
| 804 | 3300005339 | Ga0070660_100411740 | Ga0070660_1004117402 | 204 |
| 805 | 3300005340 | Ga0070689_100047162 | Ga0070689_1000471622 | 204 |
| 806 | 3300005340 | Ga0070689_100301646 | Ga0070689_1003016462 | 204 |
| 807 | 3300005343 | Ga0070687_100412345 | Ga0070687_1004123451 | 204 |
| 808 | 3300005347 | Ga0070668_100576572 | Ga0070668_1005765721 | 204 |
| 809 | 3300005353 | Ga0070669_100055815 | Ga0070669_1000558151 | 204 |
| 810 | 3300005353 | Ga0070669_100116463 | Ga0070669_1001164632 | 204 |
| 811 | 3300005354 | Ga0070675_100000739 | Ga0070675_1000007392 | 204 |
| 812 | 3300005354 | Ga0070675_100131357 | Ga0070675_1001313572 | 204 |
| 813 | 3300005354 | Ga0070675_100143947 | Ga0070675_1001439472 | 204 |
| 814 | 3300005354 | Ga0070675_100324266 | Ga0070675_1003242662 | 204 |
| 815 | 3300005354 | Ga0070675_100678412 | Ga0070675_1006784121 | 204 |
| 816 | 3300005356 | Ga0070674_100021063 | Ga0070674_1000210632 | 204 |
| 817 | 3300005356 | Ga0070674_100042253 | Ga0070674_1000422532 | 204 |
| 818 | 3300005356 | Ga0070674_100185401 | Ga0070674_1001854012 | 204 |
| 819 | 3300005356 | Ga0070674_100207386 | Ga0070674_1002073861 | 204 |
| 820 | 3300005356 | Ga0070674_100526087 | Ga0070674_1005260872 | 204 |
| 821 | 3300005364 | Ga0070673_100115118 | Ga0070673_1001151181 | 204 |
| 822 | 3300005364 | Ga0070673_100706641 | Ga0070673_1007066411 | 204 |
| 823 | 3300005364 | Ga0070673_100929375 | Ga0070673_1009293752 | 204 |
| 824 | 3300005365 | Ga0070688_100231008 | Ga0070688_1002310081 | 204 |
| 825 | 3300005365 | Ga0070688_100440543 | Ga0070688_1004405431 | 204 |
| 826 | 3300005366 | Ga0070659_100028835 | Ga0070659_1000288352 | 204 |
| 827 | 3300005367 | Ga0070667_100070263 | Ga0070667_1000702631 | 204 |
| 828 | 3300005367 | Ga0070667_100312450 | Ga0070667_1003124502 | 204 |
| 829 | 3300005367 | Ga0070667_101003776 | Ga0070667_1010037761 | 204 |
| 830 | 3300005440 | Ga0070705_100025568 | Ga0070705_1000255682 | 204 |
| 831 | 3300005440 | Ga0070705_100838298 | Ga0070705_1008382981 | 204 |
| 832 | 3300005444 | Ga0070694_100168163 | Ga0070694_1001681632 | 204 |
| 833 | 3300005456 | Ga0070678_100165960 | Ga0070678_1001659602 | 204 |
| 834 | 3300005456 | Ga0070678_100343887 | Ga0070678_1003438872 | 204 |
| 835 | 3300005457 | Ga0070662_100520511 | Ga0070662_1005205112 | 204 |
| 836 | 3300005459 | Ga0068867_100496998 | Ga0068867_1004969981 | 204 |
| 837 | 3300005468 | Ga0070707_100219762 | Ga0070707_1002197622 | 204 |
| 838 | 3300005471 | Ga0070698_100053205 | Ga0070698_1000532052 | 204 |
| 839 | 3300005471 | Ga0070698_101182344 | Ga0070698_1011823441 | 204 |
| 840 | 3300005535 | Ga0070684_100136934 | Ga0070684_1001369341 | 204 |
| 841 | 3300005539 | Ga0068853_100145598 | Ga0068853_1001455982 | 204 |
| 842 | 3300005543 | Ga0070672_100327674 | Ga0070672_1003276741 | 204 |
| 843 | 3300005544 | Ga0070686_100081297 | Ga0070686_1000812972 | 204 |
| 844 | 3300005545 | Ga0070695_100550626 | Ga0070695_1005506261 | 204 |
| 845 | 3300005547 | Ga0070693_100170205 | Ga0070693_1001702052 | 204 |
| 846 | 3300005548 | Ga0070665_100093044 | Ga0070665_1000930441 | 204 |
| 847 | 3300005548 | Ga0070665_100674556 | Ga0070665_1006745562 | 204 |
| 848 | 3300005563 | Ga0068855_100253212 | Ga0068855_1002532122 | 204 |
| 849 | 3300005563 | Ga0068855_100296142 | Ga0068855_1002961422 | 204 |
| 850 | 3300005564 | Ga0070664_100289046 | Ga0070664_1002890462 | 204 |
| 851 | 3300005564 | Ga0070664_100443036 | Ga0070664_1004430361 | 204 |
| 852 | 3300005564 | Ga0070664_100588828 | Ga0070664_1005888282 | 204 |
| 853 | 3300005577 | Ga0068857_100024993 | Ga0068857_1000249933 | 204 |
| 854 | 3300005577 | Ga0068857_100218410 | Ga0068857_1002184102 | 204 |
| 855 | 3300005614 | Ga0068856_100322867 | Ga0068856_1003228672 | 204 |
| 856 | 3300005617 | Ga0068859_100217011 | Ga0068859_1002170112 | 204 |
| 857 | 3300005617 | Ga0068859_101111204 | Ga0068859_1011112042 | 204 |
| 858 | 3300005618 | Ga0068864_100360602 | Ga0068864_1003606022 | 204 |
| 859 | 3300005618 | Ga0068864_101378383 | Ga0068864_1013783831 | 204 |
| 860 | 3300005841 | Ga0068863_100456329 | Ga0068863_1004563292 | 204 |
| 861 | 3300005841 | Ga0068863_100844130 | Ga0068863_1008441302 | 204 |
| 862 | 3300005842 | Ga0068858_100001351 | Ga0068858_1000013518 | 204 |
| 863 | 3300005842 | Ga0068858_100041052 | Ga0068858_1000410526 | 204 |
| 864 | 3300005842 | Ga0068858_100062768 | Ga0068858_1000627682 | 204 |
| 865 | 3300005842 | Ga0068858_100829267 | Ga0068858_1008292672 | 204 |
| 866 | 3300005843 | Ga0068860_100098272 | Ga0068860_1000982722 | 204 |
| 867 | 3300005843 | Ga0068860_100187714 | Ga0068860_1001877141 | 204 |
| 868 | 3300005843 | Ga0068860_100263661 | Ga0068860_1002636611 | 204 |
| 869 | 3300005844 | Ga0068862_100633500 | Ga0068862_1006335002 | 204 |
| 870 | 3300005844 | Ga0068862_101228307 | Ga0068862_1012283071 | 204 |
| 871 | 3300006028 | Ga0070717_10789133 | Ga0070717_107891331 | 204 |
| 872 | 3300006173 | Ga0070716_100191238 | Ga0070716_1001912382 | 204 |
| 873 | 3300006175 | Ga0070712_100458188 | Ga0070712_1004581882 | 204 |
| 874 | 3300006237 | Ga0097621_100703468 | Ga0097621_1007034682 | 204 |
| 875 | 3300006358 | Ga0068871_100069642 | Ga0068871_1000696422 | 204 |
| 876 | 3300006358 | Ga0068871_100262813 | Ga0068871_1002628132 | 204 |
| 877 | 3300006358 | Ga0068871_100388514 | Ga0068871_1003885142 | 204 |
| 878 | 3300006844 | Ga0075428_100001864 | Ga0075428_10000186412 | 204 |
| 879 | 3300006844 | Ga0075428_100046952 | Ga0075428_1000469522 | 204 |
| 880 | 3300006846 | Ga0075430_100001987 | Ga0075430_10000198710 | 204 |
| 881 | 3300006846 | Ga0075430_100762082 | Ga0075430_1007620822 | 204 |
| 882 | 3300006847 | Ga0075431_100002526 | Ga0075431_1000025266 | 204 |
| 883 | 3300006847 | Ga0075431_100834282 | Ga0075431_1008342822 | 204 |
| 884 | 3300006847 | Ga0075431_100862204 | Ga0075431_1008622041 | 204 |
| 885 | 3300006852 | Ga0075433_10064114 | Ga0075433_100641144 | 204 |
| 886 | 3300006852 | Ga0075433_10743957 | Ga0075433_107439571 | 204 |
| 887 | 3300006880 | Ga0075429_100001764 | Ga0075429_10000176410 | 204 |
| 888 | 3300006931 | Ga0097620_100216996 | Ga0097620_1002169962 | 204 |
| 889 | 3300006931 | Ga0097620_100657641 | Ga0097620_1006576412 | 204 |
| 890 | 3300006931 | Ga0097620_101111243 | Ga0097620_1011112432 | 204 |
| 891 | 3300009094 | Ga0111539_10028455 | Ga0111539_100284552 | 204 |
| 892 | 3300009098 | Ga0105245_10165092 | Ga0105245_101650922 | 204 |
| 893 | 3300009098 | Ga0105245_10453835 | Ga0105245_104538352 | 204 |
| 894 | 3300009101 | Ga0105247_10081807 | Ga0105247_100818071 | 204 |
| 895 | 3300009101 | Ga0105247_10168935 | Ga0105247_101689352 | 204 |
| 896 | 3300009147 | Ga0114129_10050270 | Ga0114129_100502706 | 204 |
| 897 | 3300009147 | Ga0114129_10178370 | Ga0114129_101783702 | 204 |
| 898 | 3300009147 | Ga0114129_10991711 | Ga0114129_109917111 | 204 |
| 899 | 3300009176 | Ga0105242_10421949 | Ga0105242_104219492 | 204 |
| 900 | 3300009177 | Ga0105248_10083640 | Ga0105248_100836402 | 204 |
| 901 | 3300009177 | Ga0105248_10179053 | Ga0105248_101790532 | 204 |
| 902 | 3300009177 | Ga0105248_11028031 | Ga0105248_110280311 | 204 |
| 903 | 3300009551 | Ga0105238_10619547 | Ga0105238_106195472 | 204 |
| 904 | 3300009553 | Ga0105249_10053613 | Ga0105249_100536132 | 204 |
| 905 | 3300013297 | Ga0157378_10907008 | Ga0157378_109070082 | 204 |
| 906 | 3300013306 | Ga0163162_10243305 | Ga0163162_102433052 | 204 |
| 907 | 3300013308 | Ga0157375_11799490 | Ga0157375_117994901 | 204 |
| 908 | 3300014325 | Ga0163163_10012690 | Ga0163163_100126902 | 204 |
| 909 | 3300014325 | Ga0163163_10219167 | Ga0163163_102191672 | 204 |
| 910 | 3300014325 | Ga0163163_10422188 | Ga0163163_104221882 | 204 |
| 911 | 3300014326 | Ga0157380_10168539 | Ga0157380_101685392 | 204 |
| 912 | 3300014326 | Ga0157380_10194571 | Ga0157380_101945712 | 204 |
| 913 | 3300014326 | Ga0157380_10209000 | Ga0157380_102090002 | 204 |
| 914 | 3300014745 | Ga0157377_10069961 | Ga0157377_100699612 | 204 |
| 915 | 3300014968 | Ga0157379_10028247 | Ga0157379_100282473 | 204 |
| 916 | 3300014968 | Ga0157379_10248078 | Ga0157379_102480782 | 204 |
| 917 | 3300014968 | Ga0157379_10413630 | Ga0157379_104136302 | 204 |
| 918 | 3300014969 | Ga0157376_10378299 | Ga0157376_103782992 | 204 |
| 919 | 3300017792 | Ga0163161_10729832 | Ga0163161_107298321 | 204 |
| 920 | 3300020069 | Ga0197907_10251813 | Ga0197907_102518131 | 204 |
| 921 | 3300020070 | Ga0206356_11883262 | Ga0206356_118832622 | 204 |
| 922 | 3300020075 | Ga0206349_1564724 | Ga0206349_15647242 | 204 |
| 923 | 3300020078 | Ga0206352_10544006 | Ga0206352_105440062 | 204 |
| 924 | 3300020082 | Ga0206353_10475100 | Ga0206353_104751001 | 204 |
| 925 | 3300022467 | Ga0224712_10117674 | Ga0224712_101176742 | 204 |
| 926 | 3300025290 | Ga0207673_1016925 | Ga0207673_10169251 | 204 |
| 927 | 3300025315 | Ga0207697_10150692 | Ga0207697_101506921 | 204 |
| 928 | 3300025893 | Ga0207682_10006285 | Ga0207682_100062852 | 204 |
| 929 | 3300025900 | Ga0207710_10019087 | Ga0207710_100190873 | 204 |
| 930 | 3300025900 | Ga0207710_10083080 | Ga0207710_100830801 | 204 |
| 931 | 3300025901 | Ga0207688_10072011 | Ga0207688_100720112 | 204 |
| 932 | 3300025903 | Ga0207680_10086015 | Ga0207680_100860152 | 204 |
| 933 | 3300025903 | Ga0207680_10291150 | Ga0207680_102911502 | 204 |
| 934 | 3300025903 | Ga0207680_10457385 | Ga0207680_104573852 | 204 |
| 935 | 3300025903 | Ga0207680_10628197 | Ga0207680_106281971 | 204 |
| 936 | 3300025905 | Ga0207685_10193992 | Ga0207685_101939922 | 204 |
| 937 | 3300025907 | Ga0207645_10161521 | Ga0207645_101615212 | 204 |
| 938 | 3300025907 | Ga0207645_10476365 | Ga0207645_104763652 | 204 |
| 939 | 3300025912 | Ga0207707_10022348 | Ga0207707_100223486 | 204 |
| 940 | 3300025915 | Ga0207693_10529541 | Ga0207693_105295411 | 204 |
| 941 | 3300025917 | Ga0207660_10054783 | Ga0207660_100547832 | 204 |
| 942 | 3300025918 | Ga0207662_10140899 | Ga0207662_101408991 | 204 |
| 943 | 3300025918 | Ga0207662_10194591 | Ga0207662_101945911 | 204 |
| 944 | 3300025919 | Ga0207657_10101401 | Ga0207657_101014013 | 204 |
| 945 | 3300025919 | Ga0207657_10529757 | Ga0207657_105297572 | 204 |
| 946 | 3300025922 | Ga0207646_10203286 | Ga0207646_102032862 | 204 |
| 947 | 3300025923 | Ga0207681_10185130 | Ga0207681_101851302 | 204 |
| 948 | 3300025923 | Ga0207681_10252515 | Ga0207681_102525152 | 204 |
| 949 | 3300025924 | Ga0207694_10463620 | Ga0207694_104636202 | 204 |
| 950 | 3300025925 | Ga0207650_10130016 | Ga0207650_101300162 | 204 |
| 951 | 3300025925 | Ga0207650_10152616 | Ga0207650_101526162 | 204 |
| 952 | 3300025925 | Ga0207650_10298109 | Ga0207650_102981092 | 204 |
| 953 | 3300025925 | Ga0207650_10325940 | Ga0207650_103259402 | 204 |
| 954 | 3300025926 | Ga0207659_10000642 | Ga0207659_100006422 | 204 |
| 955 | 3300025926 | Ga0207659_10272297 | Ga0207659_102722972 | 204 |
| 956 | 3300025931 | Ga0207644_10154407 | Ga0207644_101544072 | 204 |
| 957 | 3300025933 | Ga0207706_10077742 | Ga0207706_100777422 | 204 |
| 958 | 3300025933 | Ga0207706_10379760 | Ga0207706_103797602 | 204 |
| 959 | 3300025933 | Ga0207706_10877345 | Ga0207706_108773451 | 204 |
| 960 | 3300025934 | Ga0207686_10802835 | Ga0207686_108028352 | 204 |
| 961 | 3300025935 | Ga0207709_10571983 | Ga0207709_105719831 | 204 |
| 962 | 3300025936 | Ga0207670_10437818 | Ga0207670_104378181 | 204 |
| 963 | 3300025937 | Ga0207669_10033461 | Ga0207669_100334612 | 204 |
| 964 | 3300025937 | Ga0207669_10083316 | Ga0207669_100833162 | 204 |
| 965 | 3300025937 | Ga0207669_10125100 | Ga0207669_101251001 | 204 |
| 966 | 3300025937 | Ga0207669_10588358 | Ga0207669_105883581 | 204 |
| 967 | 3300025938 | Ga0207704_10184611 | Ga0207704_101846112 | 204 |
| 968 | 3300025938 | Ga0207704_10307898 | Ga0207704_103078982 | 204 |
| 969 | 3300025939 | Ga0207665_10155863 | Ga0207665_101558631 | 204 |
| 970 | 3300025940 | Ga0207691_10047180 | Ga0207691_100471802 | 204 |
| 971 | 3300025940 | Ga0207691_10309053 | Ga0207691_103090532 | 204 |
| 972 | 3300025941 | Ga0207711_10166401 | Ga0207711_101664013 | 204 |
| 973 | 3300025941 | Ga0207711_10191235 | Ga0207711_101912352 | 204 |
| 974 | 3300025941 | Ga0207711_10221846 | Ga0207711_102218462 | 204 |
| 975 | 3300025941 | Ga0207711_10329016 | Ga0207711_103290162 | 204 |
| 976 | 3300025941 | Ga0207711_10703336 | Ga0207711_107033361 | 204 |
| 977 | 3300025941 | Ga0207711_11100190 | Ga0207711_111001901 | 204 |
| 978 | 3300025942 | Ga0207689_10105715 | Ga0207689_101057153 | 204 |
| 979 | 3300025944 | Ga0207661_10476152 | Ga0207661_104761522 | 204 |
| 980 | 3300025945 | Ga0207679_10765210 | Ga0207679_107652101 | 204 |
| 981 | 3300025945 | Ga0207679_10997267 | Ga0207679_109972671 | 204 |
| 982 | 3300025949 | Ga0207667_10493349 | Ga0207667_104933491 | 204 |
| 983 | 3300025986 | Ga0207658_10790984 | Ga0207658_107909842 | 204 |
| 984 | 3300026035 | Ga0207703_10009661 | Ga0207703_100096613 | 204 |
| 985 | 3300026035 | Ga0207703_10086076 | Ga0207703_100860762 | 204 |
| 986 | 3300026035 | Ga0207703_10801665 | Ga0207703_108016652 | 204 |
| 987 | 3300026041 | Ga0207639_10132909 | Ga0207639_101329092 | 204 |
| 988 | 3300026067 | Ga0207678_10131308 | Ga0207678_101313081 | 204 |
| 989 | 3300026075 | Ga0207708_10762541 | Ga0207708_107625411 | 204 |
| 990 | 3300026089 | Ga0207648_10209028 | Ga0207648_102090282 | 204 |
| 991 | 3300026089 | Ga0207648_10312881 | Ga0207648_103128811 | 204 |
| 992 | 3300026089 | Ga0207648_10492278 | Ga0207648_104922781 | 204 |
| 993 | 3300026095 | Ga0207676_10297396 | Ga0207676_102973962 | 204 |
| 994 | 3300026095 | Ga0207676_11066960 | Ga0207676_110669602 | 204 |
| 995 | 3300026116 | Ga0207674_10151690 | Ga0207674_101516902 | 204 |
| 996 | 3300026118 | Ga0207675_100628649 | Ga0207675_1006286492 | 204 |
| 997 | 3300026121 | Ga0207683_10038555 | Ga0207683_100385552 | 204 |
| 998 | 3300026121 | Ga0207683_10092953 | Ga0207683_100929532 | 204 |
| 999 | 3300027682 | Ga0209971_1040676 | Ga0209971_10406761 | 204 |
| 1000 | 3300027876 | Ga0209974_10023030 | Ga0209974_100230302 | 204 |
| 1001 | 3300028379 | Ga0268266_10053468 | Ga0268266_100534682 | 204 |
| 1002 | 3300028380 | Ga0268265_10644291 | Ga0268265_106442912 | 204 |
| 1003 | 3300028381 | Ga0268264_10045705 | Ga0268264_100457053 | 204 |
| 1004 | 3300028381 | Ga0268264_10301438 | Ga0268264_103014382 | 204 |
| 1005 | 3300028381 | Ga0268264_10987778 | Ga0268264_109877781 | 204 |
| 1006 | 3300031731 | Ga0307405_10327176 | Ga0307405_103271762 | 204 |
| 1007 | 3300031824 | Ga0307413_10691461 | Ga0307413_106914611 | 204 |
| 1008 | 3300031995 | Ga0307409_100563940 | Ga0307409_1005639401 | 204 |
| 1009 | 3300032002 | Ga0307416_100175283 | Ga0307416_1001752832 | 204 |
| 1010 | 3300032005 | Ga0307411_10359331 | Ga0307411_103593312 | 204 |
| 1011 | 3300032126 | Ga0307415_100314961 | Ga0307415_1003149612 | 204 |
| 1012 | 3300035117 | Ga0373953_0067550 | Ga0373953_0067550_92_727 | 204 |
| 1013 | 3300035170 | Ga0373943_0018934 | Ga0373943_0018934_136_771 | 204 |
| 1014 | 3300035171 | Ga0373946_0139866 | Ga0373946_0139866_450_1085 | 204 |
| 1015 | 3300035172 | Ga0373955_0094184 | Ga0373955_0094184_598_1233 | 204 |
| 1016 | 3300035410 | Ga0373924_0031778 | Ga0373924_0031778_786_1421 | 204 |
| 1017 | 3300035410 | Ga0373924_0267867 | Ga0373924_0267867_70_705 | 204 |
| 1018 | 3300035691 | Ga0373931_0238938 | Ga0373931_0238938_154_792 | 204 |
| 1019 | 3300035695 | Ga0373927_0094343 | Ga0373927_0094343_394_1029 | 204 |
| 1020 | 3300035725 | Ga0373947_0114280 | Ga0373947_0114280_521_1156 | 204 |
| 1021 | 3300036401 | Ga0373937_0150648 | Ga0373937_0150648_755_1390 | 204 |
| 1022 | 3300036401 | Ga0373937_0622646 | Ga0373937_0622646_344_973 | 204 |
| 1023 | 3300036401 | Ga0373937_0918646 | Ga0373937_0918646_40_675 | 204 |
| 1024 | 3300037068 | Ga0373925_0238324 | Ga0373925_0238324_122_757 | 204 |
| 1025 | 3300037068 | Ga0373925_0648900 | Ga0373925_0648900_97_714 | 204 |
| 1026 | 3300037068 | Ga0373925_0888320 | Ga0373925_0888320_62_697 | 204 |
| 1027 | 3300039450 | Ga0436363_0476775 | Ga0436363_0476775_51_680 | 204 |
| 1028 | 3300041408 | Ga0439453_0026389 | Ga0439453_0026389_21_653 | 204 |
| 1029 | 3300041458 | Ga0451798_0802015 | Ga0451798_0802015_260_889 | 204 |
| 1030 | 3300042118 | Ga0450914_015160 | Ga0450914_015160_152_784 | 204 |
| 1031 | 3300042156 | Ga0439446_0073101 | Ga0439446_0073101_135_773 | 204 |
| 1032 | 3300042435 | Ga0439434_0061610 | Ga0439434_0061610_262_879 | 204 |
| 1033 | 3300042436 | Ga0439435_0003653 | Ga0439435_0003653_2073_2705 | 204 |
| 1034 | 3300042461 | Ga0439460_0123438 | Ga0439460_0123438_138_770 | 204 |
| 1035 | 3300042530 | Ga0450916_001967 | Ga0450916_001967_455_1087 | 204 |
| 1036 | 3300045976 | Ga0466967_0906179 | Ga0466967_0906179_126_815 | 204 |
| 1037 | 3300046455 | Ga0495603_0121386 | Ga0495603_0121386_271_900 | 204 |
| 1038 | 3300046475 | Ga0495639_0133164 | Ga0495639_0133164_371_1000 | 204 |
| 1039 | 3300046477 | Ga0495664_0242956 | Ga0495664_0242956_122_757 | 204 |
| 1040 | 3300046511 | Ga0495608_0122271 | Ga0495608_0122271_333_968 | 204 |
| 1041 | 3300046525 | Ga0495663_0076347 | Ga0495663_0076347_41_673 | 204 |
| 1042 | 3300046642 | Ga0495634_0162945 | Ga0495634_0162945_62_697 | 204 |
| 1043 | 3300046664 | Ga0495659_0017802 | Ga0495659_0017802_1579_2211 | 204 |
| 1044 | 3300046664 | Ga0495659_0282035 | Ga0495659_0282035_25_642 | 204 |
| 1045 | 3300046679 | Ga0495623_0267618 | Ga0495623_0267618_262_897 | 204 |
| 1046 | 3300046681 | Ga0495647_0141426 | Ga0495647_0141426_233_868 | 204 |
| 1047 | 3300046684 | Ga0495669_0249648 | Ga0495669_0249648_49_681 | 204 |
| 1048 | 3300047319 | Ga0495674_0361650 | Ga0495674_0361650_364_999 | 204 |
| 1049 | 3300047322 | Ga0495680_0499127 | Ga0495680_0499127_115_750 | 204 |
| 1050 | 3300047444 | Ga0495675_0313758 | Ga0495675_0313758_122_757 | 204 |
| 1051 | 3300047471 | Ga0495684_0471505 | Ga0495684_0471505_46_681 | 204 |
| 1052 | 3300048903 | Ga0496100_0896461 | Ga0496100_0896461_50_685 | 204 |
| 1053 | 3300048904 | Ga0496101_0709016 | Ga0496101_0709016_11_640 | 204 |
| 1054 | 3300048906 | Ga0496103_0315480 | Ga0496103_0315480_134_769 | 204 |
| 1055 | 3300048908 | Ga0496105_0131836 | Ga0496105_0131836_772_1407 | 204 |
| 1056 | 3300048909 | Ga0496106_0373819 | Ga0496106_0373819_243_878 | 204 |
| 1057 | 3300048910 | Ga0496107_0306033 | Ga0496107_0306033_259_894 | 204 |
| 1058 | 3300048912 | Ga0496109_0277242 | Ga0496109_0277242_565_1200 | 204 |
| 1059 | 3300048913 | Ga0496110_0495011 | Ga0496110_0495011_240_869 | 204 |
| 1060 | 3300048915 | Ga0496112_0042758 | Ga0496112_0042758_2936_3571 | 204 |
| 1061 | 3300048917 | Ga0496114_0595835 | Ga0496114_0595835_83_712 | 204 |
| 1062 | 3300048918 | Ga0496115_0739288 | Ga0496115_0739288_78_716 | 204 |
| 1063 | 3300049568 | Ga0501031_0157044 | Ga0501031_0157044_579_1196 | 204 |
| 1064 | 3300049570 | Ga0501033_0042890 | Ga0501033_0042890_1298_1915 | 204 |
| 1065 | 3300049571 | Ga0501034_0033399 | Ga0501034_0033399_1626_2255 | 204 |
| 1066 | 3300049572 | Ga0501036_0166457 | Ga0501036_0166457_543_1160 | 204 |
| 1067 | 3300049572 | Ga0501036_0494704 | Ga0501036_0494704_284_913 | 204 |
| 1068 | 3300049575 | Ga0501039_0387663 | Ga0501039_0387663_229_846 | 204 |
| 1069 | 3300049578 | Ga0501042_0005563 | Ga0501042_0005563_1618_2235 | 204 |
| 1070 | 3300049580 | Ga0501046_0302295 | Ga0501046_0302295_160_789 | 204 |
| 1071 | 3300049581 | Ga0501047_0116925 | Ga0501047_0116925_373_1002 | 204 |
| 1072 | 3300049582 | Ga0501048_0363975 | Ga0501048_0363975_207_836 | 204 |
| 1073 | 3300049586 | Ga0501070_0640837 | Ga0501070_0640837_167_796 | 204 |
| 1074 | 3300049587 | Ga0501071_0160507 | Ga0501071_0160507_682_1299 | 204 |
| 1075 | 3300049589 | Ga0501073_0125693 | Ga0501073_0125693_334_963 | 204 |
| 1076 | 3300049589 | Ga0501073_0280179 | Ga0501073_0280179_398_1027 | 204 |
| 1077 | 3300049591 | Ga0501075_0050750 | Ga0501075_0050750_2244_2876 | 204 |
| 1078 | 3300049591 | Ga0501075_0538919 | Ga0501075_0538919_40_678 | 204 |
| 1079 | 3300049660 | Ga0501216_017845 | Ga0501216_017845_386_1015 | 204 |
| 1080 | 3300049744 | Ga0501083_0482562 | Ga0501083_0482562_15_647 | 204 |
| 1081 | 3300049822 | Ga0501035_0111287 | Ga0501035_0111287_1189_1806 | 204 |
| 1082 | 3300049822 | Ga0501035_0190900 | Ga0501035_0190900_673_1302 | 204 |
| 1083 | 3300049823 | Ga0501044_0069878 | Ga0501044_0069878_2637_3266 | 204 |
| 1084 | 3300049824 | Ga0501045_0004580 | Ga0501045_0004580_3895_4512 | 204 |
| 1085 | 3300050507 | nmdc:mga05p37_23464_c2 | nmdc:mga05p37_23464_c2_2966_3598 | 204 |
| 1086 | 3300050507 | nmdc:mga05p37_322988_c1 | nmdc:mga05p37_322988_c1_646_1278 | 204 |
| 1087 | 3300050508 | nmdc:mga09592_6865_c1 | nmdc:mga09592_6865_c1_8601_9233 | 204 |
| 1088 | 3300050508 | nmdc:mga09592_742998_c1 | nmdc:mga09592_742998_c1_46_678 | 204 |
| 1089 | 3300050509 | nmdc:mga0qj67_3392_c1 | nmdc:mga0qj67_3392_c1_2106_2738 | 204 |
| 1090 | 3300050510 | nmdc:mga06r32_1010212_c1 | nmdc:mga06r32_1010212_c1_103_735 | 204 |
| 1091 | 3300050510 | nmdc:mga06r32_1387_c1 | nmdc:mga06r32_1387_c1_3658_4290 | 204 |
| 1092 | 3300050511 | nmdc:mga08y16_15899_c1 | nmdc:mga08y16_15899_c1_2479_3111 | 204 |
| 1093 | 3300050511 | nmdc:mga08y16_194302_c1 | nmdc:mga08y16_194302_c1_346_978 | 204 |
| 1094 | 3300050512 | nmdc:mga0n895_656277_c1 | nmdc:mga0n895_656277_c1_402_1031 | 204 |
| 1095 | 3300050515 | nmdc:mga0a205_262413_c1 | nmdc:mga0a205_262413_c1_639_1262 | 204 |
| 1096 | 3300050515 | nmdc:mga0a205_471661_c1 | nmdc:mga0a205_471661_c1_394_1029 | 204 |
| 1097 | 3300053077 | Ga0495601_0081936 | Ga0495601_0081936_1053_1688 | 204 |
| 1098 | 3300053084 | Ga0495595_0051405 | Ga0495595_0051405_795_1430 | 204 |
| 1099 | 3300053085 | Ga0495619_0187381 | Ga0495619_0187381_681_1316 | 204 |
| 1100 | 3300054114 | Ga0501084_0156628 | Ga0501084_0156628_615_1232 | 204 |
| 1101 | 3300059477 | Ga0587084_020219 | Ga0587084_020219_92_721 | 204 |
| 1102 | 3300059490 | Ga0587066_012638 | Ga0587066_012638_526_1164 | 204 |
| 1103 | 3300059491 | Ga0587070_076926 | Ga0587070_076926_51_680 | 204 |
| 1104 | 3300059504 | Ga0587082_031050 | Ga0587082_031050_117_746 | 204 |
| 1105 | 3300059506 | Ga0587085_037309 | Ga0587085_037309_98_727 | 204 |
| 1106 | 3300059507 | Ga0587086_024307 | Ga0587086_024307_194_814 | 204 |
| 1107 | 3300059508 | Ga0587088_052433 | Ga0587088_052433_49_684 | 204 |
| 1108 | 3300059510 | Ga0587090_065497 | Ga0587090_065497_40_669 | 204 |
| 1109 | 3300059511 | Ga0587091_070847 | Ga0587091_070847_92_721 | 204 |
| 1110 | 3300059511 | Ga0587091_092264 | Ga0587091_092264_40_669 | 204 |
| 1111 | 3300059607 | Ga0587125_024932 | Ga0587125_024932_86_715 | 204 |
| 1112 | 3300059623 | Ga0587101_035568 | Ga0587101_035568_115_750 | 204 |
| 1113 | 3300059627 | Ga0587117_013659 | Ga0587117_013659_115_750 | 204 |
| 1114 | 3300059642 | Ga0587069_031678 | Ga0587069_031678_70_702 | 204 |
| 1115 | 3300059647 | Ga0587079_077500 | Ga0587079_077500_97_726 | 204 |
| 1116 | 3300060344 | Ga0587071_092664 | Ga0587071_092664_33_662 | 204 |
| 1117 | 3300060346 | Ga0587111_0057509 | Ga0587111_0057509_166_795 | 204 |
| 1118 | 3300060353 | Ga0501082_0776756 | Ga0501082_0776756_31_660 | 204 |
| 1119 | 3300061734 | Ga0530510_0001309 | Ga0530510_0001309_7598_8215 | 204 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1n5w-assembly1.cif.gz_D | crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form | 0.9566 | 50 | 204 |
| 1ffv-assembly1.cif.gz_A | carbon monoxide dehydrogenase from hydrogenophaga pseudoflava | 0.9565 | 48 | 202 |
| 4zoh-assembly1.cif.gz_C-2 | crystal structure of glyceraldehyde oxidoreductase | 0.9556 | 50 | 201 |
| 1rm6-assembly1.cif.gz_C | structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica | 0.9533 | 50 | 204 |
| 1ffv-assembly1.cif.gz_A | carbon monoxide dehydrogenase from hydrogenophaga pseudoflava | 0.9446 | 48 | 202 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4zohC02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.952 | 125 | 201 | 1.10.150.120 |
| 1sb3C02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.9428 | 125 | 199 | 1.10.150.120 |
| 1ffuD02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.9404 | 127 | 201 | 1.10.150.120 |
| 1n60A02 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain | 0.9389 | 126 | 204 | 1.10.150.120 |
| af_Q46801_1_79_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9314 | 50 | 121 | 3.10.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A411YD34-F1-model_v4 | (2Fe-2S)-binding protein | 0.9665 | 50 | 203 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A1H2JUI1-F1-model_v4 | Carbon-monoxide dehydrogenase small subunit | 0.9654 | 50 | 202 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A2A4PBP6-F1-model_v4 | Carbon monoxide dehydrogenase | 0.9651 | 50 | 203 |
GO:0016491
GO:0046872 GO:0051537 |
| AF-A0A7W9ILB0-F1-model_v4 | Carbon-monoxide dehydrogenase small subunit (EC 1.2.7.4) | 0.9648 | 50 | 203 |
GO:0043885
GO:0046872 GO:0051537 |
| AF-A0A7C7CII0-F1-model_v4 | (2Fe-2S)-binding protein | 0.9643 | 50 | 187 |
GO:0016491
GO:0046872 GO:0051537 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar