F490372

General Info

Members Datasets Scaffolds Average Seq Length
1119 393 1119 211

Family's Representative Sequence

Representative Sequence 3300046517|Ga0495630_0021716|Ga0495630_0021716_1472_2233
Length 253
Sequence VKPASGKKKDPDGNSLLFISLTRADAAEYTHGKSLSKGVPMADHELTDPGCSTSESNKISRRDVIKSVIATGVVSSTSYLFRVSKVWAQASAPGAVDRLITLNVNGQQRRVDVMKQETLVMTLRYKLGLTGTKIGCDQAECGACTVLIDDVPYYSCSVFTHTVRDKKIQTIEGLAKPDGALHPVQQGVIDEQGFQCAFCMSGFMMATVGFLKINPNPTRAELAKGISGNICRCQDYDKILTAMMRGAENLRKA

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
10 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
55 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
56 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
57 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
78 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
79 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
85 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
86 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
87 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
88 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
89 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
90 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
94 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
95 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
96 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
97 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
98 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
103 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
104 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
105 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
107 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
108 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
118 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
119 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
120 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
121 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
122 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
123 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
124 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
132 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
136 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
142 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
143 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
209 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
213 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
214 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
217 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
218 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
219 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
220 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
221 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
222 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
223 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
224 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
225 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
226 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
227 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
228 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
229 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
230 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
231 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
232 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
233 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
234 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
235 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
236 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
237 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
238 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
239 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
240 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
241 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
242 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
243 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
244 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
245 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
246 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
247 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
248 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
249 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
250 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
251 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
252 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
253 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
254 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
255 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
256 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
257 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
258 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
259 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
260 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
261 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
262 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
263 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
264 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
265 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
266 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
267 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
268 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
269 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
270 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
271 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
272 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
273 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
274 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
275 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
276 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
277 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
278 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
279 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
280 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
281 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
282 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
283 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
284 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
285 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
286 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
287 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
288 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
289 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
290 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
291 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
292 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
293 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
294 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
295 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
296 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
297 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
298 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
299 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
300 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
301 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
302 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
303 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
304 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
305 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
306 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
307 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
308 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
309 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
310 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
311 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
312 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
313 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
314 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
315 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
316 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
317 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
318 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
319 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
320 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
321 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
322 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
323 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
324 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
325 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
338 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
339 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
340 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
341 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
342 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
343 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
344 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
345 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
346 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
347 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
348 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
349 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
352 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
353 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
354 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
355 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
356 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
357 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
358 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
359 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
360 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
361 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
362 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
363 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
364 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
365 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
366 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
367 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
368 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
369 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
370 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
375 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
390 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
391 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
392 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
393 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.46
Metatranscriptomes 5.54
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.57
Rhizosphere 95.44
Stem 0
Stem Tuber 0
Unclassified 0.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10001715 3300002459 Archaea 4505
2 JGI24751J29686_10019096 3300002459 Bacteria 1419
3 Ga0006759J45824_1088694 3300003163 Bacteria 1106
4 Ga0007417J51691_1024758 3300003544 Bacteria 669
5 Ga0007417J51691_1064518 3300003544 Bacteria 879
6 Ga0007410J51695_1055657 3300003574 Bacteria 923
7 Ga0007409J51694_1058321 3300003575 Bacteria 1001
8 Ga0007429J51699_1059572 3300003579 Bacteria 875
9 Ga0007429J51699_1063966 3300003579 Archaea 816
10 Ga0058859_10021908 3300004798 Bacteria 1222
11 Ga0058859_10031263 3300004798 Bacteria 1256
12 Ga0058859_10041715 3300004798 Bacteria 1250
13 Ga0058859_11654266 3300004798 Unclassified 1118
14 Ga0058859_11762873 3300004798 Bacteria 881
15 Ga0058861_10036557 3300004800 Unclassified 1455
16 Ga0058860_10077957 3300004801 Bacteria 1077
17 Ga0058862_10248621 3300004803 Unclassified 903
18 Ga0065712_10011524 3300005290 Bacteria 2146
19 Ga0065712_10154608 3300005290 Bacteria 1344
20 Ga0065712_10164863 3300005290 Unclassified 1279
21 Ga0065712_10217838 3300005290 Bacteria 1051
22 Ga0065712_10241478 3300005290 Bacteria 983
23 Ga0065715_10276677 3300005293 Unclassified 1097
24 Ga0065715_10340354 3300005293 Unclassified 961
25 Ga0065707_10098316 3300005295 Bacteria 3095
26 Ga0065707_10259718 3300005295 Unclassified 1101
27 Ga0070658_10001935 3300005327 Bacteria 17402
28 Ga0070676_10022921 3300005328 Unclassified 3505
29 Ga0070676_10143445 3300005328 Unclassified 1522
30 Ga0070676_10487851 3300005328 Bacteria 873
31 Ga0070676_10681715 3300005328 Unclassified 749
32 Ga0070683_100200558 3300005329 Unclassified 1894
33 Ga0070683_100242079 3300005329 Bacteria 1716
34 Ga0070683_100275147 3300005329 Bacteria 1602
35 Ga0070670_100096802 3300005331 Bacteria 2539
36 Ga0070670_100100636 3300005331 Unclassified 2488
37 Ga0070670_100133737 3300005331 Bacteria 2142
38 Ga0070670_100444992 3300005331 Bacteria 1148
39 Ga0070677_10043964 3300005333 Bacteria 1776
40 Ga0070677_10064415 3300005333 Unclassified 1522
41 Ga0068869_100013764 3300005334 Bacteria 5389
42 Ga0068869_100083205 3300005334 Unclassified 2393
43 Ga0068869_100303592 3300005334 Bacteria 1290
44 Ga0070666_10003858 3300005335 Bacteria 9098
45 Ga0070666_10070622 3300005335 Bacteria 2376
46 Ga0070666_10151568 3300005335 Unclassified 1617
47 Ga0070666_10212844 3300005335 Unclassified 1362
48 Ga0070680_100327124 3300005336 Unclassified 1302
49 Ga0070682_100080769 3300005337 Unclassified 2103
50 Ga0070682_100102395 3300005337 Bacteria 1892
51 Ga0068868_100008417 3300005338 Bacteria 7385
52 Ga0068868_100031991 3300005338 Bacteria 4044
53 Ga0068868_100050774 3300005338 Bacteria 3259
54 Ga0068868_100058077 3300005338 Unclassified 3057
55 Ga0068868_100493205 3300005338 Bacteria 1072
56 Ga0070660_100029894 3300005339 Bacteria 4085
57 Ga0070660_100051801 3300005339 Bacteria 3162
58 Ga0070660_100411740 3300005339 Bacteria 1119
59 Ga0070660_100475487 3300005339 Unclassified 1038
60 Ga0070689_100047162 3300005340 Bacteria 3321
61 Ga0070689_100301646 3300005340 Unclassified 1333
62 Ga0070689_100305670 3300005340 Bacteria 1325
63 Ga0070691_10064375 3300005341 Bacteria 1769
64 Ga0070691_10099155 3300005341 Bacteria 1445
65 Ga0070691_10358426 3300005341 Unclassified 812
66 Ga0070687_100412345 3300005343 Bacteria 889
67 Ga0070661_100292901 3300005344 Unclassified 1265
68 Ga0070692_10194998 3300005345 Bacteria 1183
69 Ga0070668_100017488 3300005347 Bacteria 5375
70 Ga0070668_100576572 3300005347 Bacteria 982
71 Ga0070669_100055815 3300005353 Bacteria 2894
72 Ga0070669_100116463 3300005353 Bacteria 2034
73 Ga0070669_100175841 3300005353 Unclassified 1672
74 Ga0070675_100000739 3300005354 Bacteria 22817
75 Ga0070675_100131357 3300005354 Unclassified 2134
76 Ga0070675_100143947 3300005354 Bacteria 2039
77 Ga0070675_100324266 3300005354 Bacteria 1361
78 Ga0070675_100678412 3300005354 Unclassified 938
79 Ga0070671_100038666 3300005355 Unclassified 3960
80 Ga0070674_100021063 3300005356 Bacteria 4179
81 Ga0070674_100042253 3300005356 Bacteria 3095
82 Ga0070674_100138251 3300005356 Bacteria 1825
83 Ga0070674_100185401 3300005356 Bacteria 1597
84 Ga0070674_100207386 3300005356 Bacteria 1517
85 Ga0070674_100526087 3300005356 Unclassified 989
86 Ga0070674_100570608 3300005356 Bacteria 952
87 Ga0070673_100076822 3300005364 Bacteria 2698
88 Ga0070673_100115118 3300005364 Unclassified 2235
89 Ga0070673_100706641 3300005364 Bacteria 926
90 Ga0070673_100929375 3300005364 Bacteria 808
91 Ga0070688_100191509 3300005365 Unclassified 1425
92 Ga0070688_100231008 3300005365 Bacteria 1308
93 Ga0070688_100440543 3300005365 Archaea 972
94 Ga0070659_100028835 3300005366 Bacteria 4287
95 Ga0070659_100176265 3300005366 Bacteria 1753
96 Ga0070659_100240024 3300005366 Unclassified 1499
97 Ga0070667_100039346 3300005367 Bacteria 3963
98 Ga0070667_100070263 3300005367 Bacteria 2980
99 Ga0070667_100178716 3300005367 Bacteria 1876
100 Ga0070667_100312450 3300005367 Unclassified 1417
101 Ga0070667_100437577 3300005367 Bacteria 1194
102 Ga0070667_101003776 3300005367 Bacteria 779
103 Ga0070709_10004528 3300005434 Bacteria 7501
104 Ga0070709_10085085 3300005434 Bacteria 2073
105 Ga0070709_10094195 3300005434 Bacteria 1981
106 Ga0070709_10100821 3300005434 Bacteria 1923
107 Ga0070709_10211787 3300005434 Unclassified 1378
108 Ga0070714_100010303 3300005435 Bacteria 7386
109 Ga0070714_100022981 3300005435 Bacteria 5117
110 Ga0070713_100000476 3300005436 Bacteria 25546
111 Ga0070713_100002315 3300005436 Bacteria 12404
112 Ga0070713_100006228 3300005436 Bacteria 8257
113 Ga0070713_100010679 3300005436 Bacteria 6648
114 Ga0070713_100027416 3300005436 Bacteria 4485
115 Ga0070713_100061664 3300005436 Bacteria 3138
116 Ga0070713_100112879 3300005436 Unclassified 2372
117 Ga0070713_100303749 3300005436 Unclassified 1470
118 Ga0070710_10055150 3300005437 Bacteria 2245
119 Ga0070710_10103941 3300005437 Bacteria 1696
120 Ga0070710_10282206 3300005437 Bacteria 1078
121 Ga0070711_100001229 3300005439 Bacteria 13841
122 Ga0070711_100012400 3300005439 Bacteria 5324
123 Ga0070711_100020175 3300005439 Bacteria 4291
124 Ga0070711_100085993 3300005439 Bacteria 2254
125 Ga0070711_100096083 3300005439 Unclassified 2146
126 Ga0070711_100171290 3300005439 Bacteria 1655
127 Ga0070711_100580419 3300005439 Bacteria 933
128 Ga0070705_100025568 3300005440 Bacteria 3202
129 Ga0070705_100838298 3300005440 Bacteria 734
130 Ga0070700_100206395 3300005441 Unclassified 1384
131 Ga0070694_100168163 3300005444 Bacteria 1613
132 Ga0070694_100260297 3300005444 Bacteria 1316
133 Ga0070708_100003651 3300005445 Bacteria 12067
134 Ga0070708_100012948 3300005445 Bacteria 6815
135 Ga0070708_100114524 3300005445 Unclassified 2481
136 Ga0070708_100282380 3300005445 Unclassified 1563
137 Ga0070708_100398888 3300005445 Unclassified 1297
138 Ga0070708_100841812 3300005445 Bacteria 862
139 Ga0070663_100081603 3300005455 Unclassified 2377
140 Ga0070678_100165960 3300005456 Bacteria 1794
141 Ga0070678_100294396 3300005456 Unclassified 1377
142 Ga0070678_100343887 3300005456 Bacteria 1280
143 Ga0070662_100122790 3300005457 Unclassified 1992
144 Ga0070662_100520511 3300005457 Bacteria 994
145 Ga0070662_100896278 3300005457 Bacteria 757
146 Ga0070681_10001282 3300005458 Bacteria 21908
147 Ga0070681_10021636 3300005458 Bacteria 6448
148 Ga0070681_10229101 3300005458 Bacteria 1772
149 Ga0070681_10461488 3300005458 Unclassified 1182
150 Ga0070681_10595934 3300005458 Bacteria 1019
151 Ga0068867_100016286 3300005459 Bacteria 5279
152 Ga0068867_100115804 3300005459 Bacteria 2065
153 Ga0068867_100371018 3300005459 Bacteria 1200
154 Ga0068867_100496998 3300005459 Bacteria 1048
155 Ga0070685_10151869 3300005466 Bacteria 1468
156 Ga0070706_100000336 3300005467 Bacteria 56986
157 Ga0070706_100002094 3300005467 Bacteria 20343
158 Ga0070706_100011620 3300005467 Bacteria 8181
159 Ga0070706_100154948 3300005467 Bacteria 2139
160 Ga0070706_100700953 3300005467 Bacteria 939
161 Ga0070707_100019771 3300005468 Bacteria 6347
162 Ga0070707_100075730 3300005468 Bacteria 3246
163 Ga0070707_100086910 3300005468 Bacteria 3024
164 Ga0070707_100219762 3300005468 Bacteria 1851
165 Ga0070707_100505722 3300005468 Unclassified 1170
166 Ga0070698_100005969 3300005471 Bacteria 13277
167 Ga0070698_100053205 3300005471 Bacteria 4115
168 Ga0070698_100413945 3300005471 Unclassified 1282
169 Ga0070698_100436850 3300005471 Bacteria 1244
170 Ga0070698_100679082 3300005471 Archaea 972
171 Ga0070698_101182344 3300005471 Bacteria 714
172 Ga0070699_100016335 3300005518 Bacteria 6374
173 Ga0070699_100116789 3300005518 Bacteria 2345
174 Ga0070699_100548573 3300005518 Unclassified 1052
175 Ga0070679_100192381 3300005530 Unclassified 2009
176 Ga0070679_100821069 3300005530 Bacteria 873
177 Ga0070684_100042934 3300005535 Unclassified 3905
178 Ga0070684_100136934 3300005535 Bacteria 2213
179 Ga0070684_100144776 3300005535 Unclassified 2150
180 Ga0070684_100216622 3300005535 Bacteria 1746
181 Ga0070684_100237953 3300005535 Bacteria 1663
182 Ga0070697_100002395 3300005536 Bacteria 14440
183 Ga0070697_100303155 3300005536 Bacteria 1373
184 Ga0068853_100017653 3300005539 Bacteria 5890
185 Ga0068853_100076896 3300005539 Unclassified 2915
186 Ga0068853_100145598 3300005539 Bacteria 2129
187 Ga0068853_100424039 3300005539 Bacteria 1248
188 Ga0070672_100327674 3300005543 Bacteria 1302
189 Ga0070686_100081065 3300005544 Unclassified 2148
190 Ga0070686_100081297 3300005544 Bacteria 2146
191 Ga0070695_100314543 3300005545 Archaea 1162
192 Ga0070695_100550626 3300005545 Bacteria 899
193 Ga0070695_100822637 3300005545 Bacteria 745
194 Ga0070696_100247781 3300005546 Bacteria 1346
195 Ga0070693_100117218 3300005547 Bacteria 1647
196 Ga0070693_100170205 3300005547 Bacteria 1394
197 Ga0070665_100010604 3300005548 Bacteria 9329
198 Ga0070665_100072788 3300005548 Unclassified 3444
199 Ga0070665_100093044 3300005548 Unclassified 3019
200 Ga0070665_100192917 3300005548 Bacteria 2038
201 Ga0070665_100674556 3300005548 Bacteria 1047
202 Ga0070704_100142667 3300005549 Unclassified 1872
203 Ga0068855_100000234 3300005563 Bacteria 70713
204 Ga0068855_100002034 3300005563 Bacteria 25069
205 Ga0068855_100056475 3300005563 Unclassified 4606
206 Ga0068855_100069495 3300005563 Bacteria 4098
207 Ga0068855_100179856 3300005563 Unclassified 2392
208 Ga0068855_100253212 3300005563 Bacteria 1964
209 Ga0068855_100296142 3300005563 Bacteria 1793
210 Ga0068855_100772636 3300005563 Bacteria 1023
211 Ga0070664_100067532 3300005564 Bacteria 3056
212 Ga0070664_100236860 3300005564 Unclassified 1637
213 Ga0070664_100289046 3300005564 Bacteria 1480
214 Ga0070664_100443036 3300005564 Bacteria 1192
215 Ga0070664_100588828 3300005564 Archaea 1031
216 Ga0068857_100004869 3300005577 Bacteria 11390
217 Ga0068857_100024993 3300005577 Bacteria 5261
218 Ga0068857_100034785 3300005577 Plasmid 4457
219 Ga0068857_100218410 3300005577 Bacteria 1740
220 Ga0068857_100630244 3300005577 Bacteria 1015
221 Ga0068854_100047266 3300005578 Bacteria 3067
222 Ga0068854_100107675 3300005578 Unclassified 2098
223 Ga0068854_100140500 3300005578 Bacteria 1853
224 Ga0068856_100000062 3300005614 Bacteria 100769
225 Ga0068856_100002175 3300005614 Bacteria 20318
226 Ga0068856_100015026 3300005614 Bacteria 7478
227 Ga0068856_100119422 3300005614 Unclassified 2637
228 Ga0068856_100295053 3300005614 Bacteria 1638
229 Ga0068856_100322867 3300005614 Bacteria 1561
230 Ga0068856_100343939 3300005614 Unclassified 1510
231 Ga0068856_100415250 3300005614 Bacteria 1366
232 Ga0068856_100794215 3300005614 Bacteria 966
233 Ga0068852_100016336 3300005616 Bacteria 5784
234 Ga0068852_100107871 3300005616 Bacteria 2527
235 Ga0068852_100382014 3300005616 Unclassified 1382
236 Ga0068852_100520460 3300005616 Unclassified 1187
237 Ga0068859_100035429 3300005617 Bacteria 5008
238 Ga0068859_100054101 3300005617 Bacteria 4037
239 Ga0068859_100057994 3300005617 Bacteria 3900
240 Ga0068859_100217011 3300005617 Bacteria 2000
241 Ga0068859_101111204 3300005617 Bacteria 870
242 Ga0068864_100012733 3300005618 Bacteria 6954
243 Ga0068864_100113454 3300005618 Unclassified 2416
244 Ga0068864_100360602 3300005618 Bacteria 1373
245 Ga0068864_100382057 3300005618 Unclassified 1335
246 Ga0068864_101378383 3300005618 Bacteria 707
247 Ga0068866_10024028 3300005718 Unclassified 2842
248 Ga0068866_10266486 3300005718 Bacteria 1055
249 Ga0068866_10538506 3300005718 Unclassified 779
250 Ga0068861_100148732 3300005719 Unclassified 1919
251 Ga0068851_10059333 3300005834 Unclassified 1957
252 Ga0068851_10263551 3300005834 Unclassified 981
253 Ga0068863_100209381 3300005841 Unclassified 1877
254 Ga0068863_100456329 3300005841 Bacteria 1255
255 Ga0068863_100844130 3300005841 Bacteria 915
256 Ga0068858_100001351 3300005842 Bacteria 25297
257 Ga0068858_100005875 3300005842 Bacteria 11983
258 Ga0068858_100013703 3300005842 Bacteria 7652
259 Ga0068858_100014019 3300005842 Bacteria 7563
260 Ga0068858_100016583 3300005842 Bacteria 6919
261 Ga0068858_100030640 3300005842 Unclassified 4996
262 Ga0068858_100041052 3300005842 Bacteria 4291
263 Ga0068858_100062768 3300005842 Bacteria 3436
264 Ga0068858_100829267 3300005842 Bacteria 903
265 Ga0068860_100080997 3300005843 Unclassified 3087
266 Ga0068860_100098272 3300005843 Bacteria 2792
267 Ga0068860_100187714 3300005843 Bacteria 1999
268 Ga0068860_100263661 3300005843 Bacteria 1680
269 Ga0068862_100173830 3300005844 Unclassified 1929
270 Ga0068862_100633500 3300005844 Bacteria 1030
271 Ga0068862_101074491 3300005844 Bacteria 799
272 Ga0068862_101127237 3300005844 Bacteria 780
273 Ga0068862_101228307 3300005844 Archaea 749
274 Ga0081455_10299917 3300005937 Bacteria 1153
275 Ga0081538_10004787 3300005981 Bacteria 12368
276 Ga0081538_10111330 3300005981 Unclassified 1343
277 Ga0070717_10049718 3300006028 Bacteria 3443
278 Ga0070717_10274455 3300006028 Unclassified 1494
279 Ga0070717_10661895 3300006028 Bacteria 948
280 Ga0070717_10789133 3300006028 Bacteria 864
281 Ga0075432_10037531 3300006058 Bacteria 1687
282 Ga0070715_10005284 3300006163 Unclassified 4294
283 Ga0070715_10040341 3300006163 Unclassified 1951
284 Ga0070715_10104239 3300006163 Bacteria 1328
285 Ga0070715_10162073 3300006163 Bacteria 1106
286 Ga0070716_100010782 3300006173 Bacteria 4594
287 Ga0070716_100036212 3300006173 Bacteria 2720
288 Ga0070716_100046742 3300006173 Bacteria 2438
289 Ga0070716_100100120 3300006173 Bacteria 1775
290 Ga0070716_100130440 3300006173 Bacteria 1588
291 Ga0070716_100191238 3300006173 Bacteria 1352
292 Ga0070712_100000468 3300006175 Bacteria 23267
293 Ga0070712_100002849 3300006175 Bacteria 10703
294 Ga0070712_100010616 3300006175 Bacteria 5817
295 Ga0070712_100011228 3300006175 Bacteria 5671
296 Ga0070712_100458188 3300006175 Bacteria 1063
297 Ga0097621_100000196 3300006237 Bacteria 39296
298 Ga0097621_100000326 3300006237 Bacteria 32263
299 Ga0097621_100004631 3300006237 Bacteria 9599
300 Ga0097621_100009851 3300006237 Bacteria 6956
301 Ga0097621_100016167 3300006237 Bacteria 5634
302 Ga0097621_100040561 3300006237 Bacteria 3743
303 Ga0097621_100227623 3300006237 Bacteria 1627
304 Ga0097621_100270334 3300006237 Unclassified 1493
305 Ga0097621_100311448 3300006237 Unclassified 1393
306 Ga0097621_100703468 3300006237 Bacteria 930
307 Ga0068871_100000049 3300006358 Bacteria 65954
308 Ga0068871_100003703 3300006358 Bacteria 10510
309 Ga0068871_100014760 3300006358 Bacteria 5830
310 Ga0068871_100031326 3300006358 Bacteria 4193
311 Ga0068871_100069642 3300006358 Unclassified 2890
312 Ga0068871_100089885 3300006358 Bacteria 2557
313 Ga0068871_100181118 3300006358 Unclassified 1811
314 Ga0068871_100223685 3300006358 Unclassified 1631
315 Ga0068871_100262813 3300006358 Bacteria 1506
316 Ga0068871_100388514 3300006358 Bacteria 1241
317 Ga0075428_100001864 3300006844 Bacteria 22582
318 Ga0075428_100046952 3300006844 Bacteria 4743
319 Ga0075430_100001987 3300006846 Bacteria 16844
320 Ga0075430_100432902 3300006846 Bacteria 1086
321 Ga0075430_100762082 3300006846 Bacteria 798
322 Ga0075431_100002526 3300006847 Bacteria 17651
323 Ga0075431_100021655 3300006847 Bacteria 6574
324 Ga0075431_100535336 3300006847 Archaea 1160
325 Ga0075431_100646080 3300006847 Bacteria 1039
326 Ga0075431_100834282 3300006847 Bacteria 894
327 Ga0075431_100862204 3300006847 Bacteria 876
328 Ga0075433_10064114 3300006852 Bacteria 3220
329 Ga0075433_10213879 3300006852 Bacteria 1713
330 Ga0075433_10552307 3300006852 Bacteria 1012
331 Ga0075433_10743957 3300006852 Bacteria 858
332 Ga0075434_100127862 3300006871 Unclassified 2558
333 Ga0075434_100140467 3300006871 Unclassified 2434
334 Ga0075434_100315925 3300006871 Bacteria 1583
335 Ga0075434_100326366 3300006871 Bacteria 1555
336 Ga0075429_100001764 3300006880 Bacteria 17910
337 Ga0075429_100292237 3300006880 Bacteria 1427
338 Ga0068865_100005640 3300006881 Bacteria 7596
339 Ga0068865_100096344 3300006881 Unclassified 2157
340 Ga0075436_100086852 3300006914 Bacteria 2173
341 Ga0075436_100089193 3300006914 Unclassified 2142
342 Ga0075436_100150028 3300006914 Unclassified 1640
343 Ga0097620_100035431 3300006931 Bacteria 5008
344 Ga0097620_100054103 3300006931 Bacteria 4037
345 Ga0097620_100057994 3300006931 Bacteria 3900
346 Ga0097620_100216996 3300006931 Bacteria 2000
347 Ga0097620_100657641 3300006931 Bacteria 1140
348 Ga0097620_101111243 3300006931 Bacteria 870
349 Ga0075435_100016798 3300007076 Bacteria 5522
350 Ga0075435_100047716 3300007076 Bacteria 3439
351 Ga0075435_100109848 3300007076 Bacteria 2293
352 Ga0075435_100226805 3300007076 Bacteria 1587
353 Ga0099794_10132741 3300007265 Bacteria 1258
354 Ga0099794_10194871 3300007265 Unclassified 1037
355 Ga0105240_10013638 3300009093 Bacteria 11145
356 Ga0105240_10053160 3300009093 Bacteria 5086
357 Ga0105240_10082073 3300009093 Bacteria 3959
358 Ga0105240_10101427 3300009093 Unclassified 3500
359 Ga0105240_10136198 3300009093 Unclassified 2941
360 Ga0105240_10142109 3300009093 Bacteria 2869
361 Ga0105240_10229600 3300009093 Bacteria 2158
362 Ga0111539_10028455 3300009094 Bacteria 6817
363 Ga0111539_10198586 3300009094 Bacteria 2339
364 Ga0105245_10004807 3300009098 Bacteria 11921
365 Ga0105245_10015180 3300009098 Bacteria 6710
366 Ga0105245_10110472 3300009098 Unclassified 2556
367 Ga0105245_10165092 3300009098 Unclassified 2104
368 Ga0105245_10177367 3300009098 Unclassified 2033
369 Ga0105245_10314329 3300009098 Unclassified 1541
370 Ga0105245_10453835 3300009098 Bacteria 1291
371 Ga0105245_11346697 3300009098 Unclassified 763
372 Ga0105247_10023620 3300009101 Unclassified 3705
373 Ga0105247_10081807 3300009101 Unclassified 2037
374 Ga0105247_10168935 3300009101 Bacteria 1453
375 Ga0105247_10322688 3300009101 Bacteria 1078
376 Ga0114129_10005337 3300009147 Bacteria 18137
377 Ga0114129_10050270 3300009147 Bacteria 5855
378 Ga0114129_10136553 3300009147 Bacteria 3365
379 Ga0114129_10178370 3300009147 Bacteria 2892
380 Ga0114129_10603688 3300009147 Bacteria 1421
381 Ga0114129_10885826 3300009147 Bacteria 1132
382 Ga0114129_10991711 3300009147 Bacteria 1058
383 Ga0114129_11698884 3300009147 Archaea 770
384 Ga0105241_10006410 3300009174 Bacteria 8675
385 Ga0105241_10007930 3300009174 Bacteria 7807
386 Ga0105241_10032434 3300009174 Bacteria 3916
387 Ga0105241_10071177 3300009174 Bacteria 2699
388 Ga0105241_10862668 3300009174 Unclassified 838
389 Ga0105242_10001360 3300009176 Bacteria 19285
390 Ga0105242_10020549 3300009176 Bacteria 5179
391 Ga0105242_10107701 3300009176 Bacteria 2371
392 Ga0105242_10183038 3300009176 Bacteria 1850
393 Ga0105242_10250564 3300009176 Unclassified 1595
394 Ga0105242_10421949 3300009176 Unclassified 1250
395 Ga0105242_10770472 3300009176 Bacteria 949
396 Ga0105242_10796407 3300009176 Bacteria 935
397 Ga0105248_10007399 3300009177 Bacteria 12048
398 Ga0105248_10010283 3300009177 Bacteria 10301
399 Ga0105248_10014774 3300009177 Bacteria 8597
400 Ga0105248_10083640 3300009177 Bacteria 3590
401 Ga0105248_10112872 3300009177 Bacteria 3065
402 Ga0105248_10179053 3300009177 Bacteria 2389
403 Ga0105248_10179687 3300009177 Unclassified 2384
404 Ga0105248_10410923 3300009177 Unclassified 1524
405 Ga0105248_11028031 3300009177 Unclassified 931
406 Ga0105248_11092616 3300009177 Bacteria 901
407 Ga0105237_10005536 3300009545 Bacteria 14239
408 Ga0105237_10019805 3300009545 Bacteria 6946
409 Ga0105237_10087881 3300009545 Bacteria 3097
410 Ga0105237_10088398 3300009545 Bacteria 3088
411 Ga0105237_10503999 3300009545 Unclassified 1217
412 Ga0105237_10506995 3300009545 Bacteria 1213
413 Ga0105238_10000609 3300009551 Bacteria 37550
414 Ga0105238_10001919 3300009551 Bacteria 20874
415 Ga0105238_10004737 3300009551 Bacteria 13456
416 Ga0105238_10038817 3300009551 Unclassified 4835
417 Ga0105238_10093868 3300009551 Unclassified 2988
418 Ga0105238_10619547 3300009551 Bacteria 1091
419 Ga0105238_10880803 3300009551 Unclassified 913
420 Ga0105249_10006270 3300009553 Bacteria 10329
421 Ga0105249_10053613 3300009553 Bacteria 3686
422 Ga0105239_10074194 3300010375 Bacteria 3741
423 Ga0105239_10158181 3300010375 Unclassified 2531
424 Ga0105239_10292327 3300010375 Bacteria 1835
425 Ga0105239_10348132 3300010375 Unclassified 1673
426 Ga0105239_10835899 3300010375 Bacteria 1056
427 Ga0105246_10147378 3300011119 Unclassified 1778
428 Ga0105246_10740334 3300011119 Bacteria 866
429 Ga0157373_10032661 3300013100 Bacteria 3745
430 Ga0157371_10036625 3300013102 Unclassified 3513
431 Ga0157371_10122559 3300013102 Bacteria 1849
432 Ga0157370_10034683 3300013104 Bacteria 4910
433 Ga0157370_10089656 3300013104 Bacteria 2889
434 Ga0157370_10151310 3300013104 Unclassified 2159
435 Ga0157370_10505366 3300013104 Bacteria 1110
436 Ga0157369_10000159 3300013105 Bacteria 95759
437 Ga0157369_10106983 3300013105 Bacteria 2976
438 Ga0157369_10204196 3300013105 Unclassified 2073
439 Ga0157374_10000062 3300013296 Bacteria 112028
440 Ga0157374_10000338 3300013296 Bacteria 43326
441 Ga0157374_10015683 3300013296 Bacteria 6652
442 Ga0157374_10018947 3300013296 Bacteria 6086
443 Ga0157374_10053283 3300013296 Bacteria 3771
444 Ga0157374_10067662 3300013296 Bacteria 3359
445 Ga0157374_10068261 3300013296 Bacteria 3345
446 Ga0157374_10141625 3300013296 Bacteria 2334
447 Ga0157374_10142843 3300013296 Bacteria 2324
448 Ga0157374_10181087 3300013296 Unclassified 2058
449 Ga0157378_10000899 3300013297 Bacteria 27398
450 Ga0157378_10004757 3300013297 Bacteria 11898
451 Ga0157378_10006834 3300013297 Bacteria 9951
452 Ga0157378_10044978 3300013297 Unclassified 3922
453 Ga0157378_10154309 3300013297 Unclassified 2142
454 Ga0157378_10381251 3300013297 Bacteria 1385
455 Ga0157378_10907008 3300013297 Bacteria 912
456 Ga0157378_11844526 3300013297 Bacteria 653
457 Ga0163162_10005046 3300013306 Bacteria 12720
458 Ga0163162_10069684 3300013306 Bacteria 3569
459 Ga0163162_10126568 3300013306 Unclassified 2662
460 Ga0163162_10243305 3300013306 Bacteria 1930
461 Ga0163162_10477774 3300013306 Bacteria 1378
462 Ga0157372_10000845 3300013307 Bacteria 33235
463 Ga0157372_10003611 3300013307 Bacteria 16654
464 Ga0157372_10051671 3300013307 Bacteria 4574
465 Ga0157372_10168063 3300013307 Unclassified 2537
466 Ga0157372_10355799 3300013307 Unclassified 1706
467 Ga0157375_10014565 3300013308 Bacteria 7020
468 Ga0157375_10126187 3300013308 Unclassified 2674
469 Ga0157375_10217189 3300013308 Bacteria 2070
470 Ga0157375_10409442 3300013308 Unclassified 1522
471 Ga0157375_11799490 3300013308 Bacteria 726
472 Ga0163163_10003604 3300014325 Bacteria 13157
473 Ga0163163_10012690 3300014325 Bacteria 7686
474 Ga0163163_10015653 3300014325 Bacteria 7020
475 Ga0163163_10030748 3300014325 Bacteria 5177
476 Ga0163163_10219167 3300014325 Archaea 1951
477 Ga0163163_10422188 3300014325 Bacteria 1392
478 Ga0163163_10433870 3300014325 Bacteria 1373
479 Ga0157380_10030037 3300014326 Bacteria 4159
480 Ga0157380_10168539 3300014326 Unclassified 1911
481 Ga0157380_10194571 3300014326 Bacteria 1793
482 Ga0157380_10209000 3300014326 Bacteria 1738
483 Ga0157380_10343519 3300014326 Bacteria 1393
484 Ga0157377_10069961 3300014745 Unclassified 2026
485 Ga0157377_10136077 3300014745 Bacteria 1505
486 Ga0157377_10150047 3300014745 Unclassified 1440
487 Ga0157379_10009128 3300014968 Bacteria 8635
488 Ga0157379_10028247 3300014968 Unclassified 4993
489 Ga0157379_10031582 3300014968 Bacteria 4719
490 Ga0157379_10133860 3300014968 Bacteria 2233
491 Ga0157379_10248078 3300014968 Unclassified 1616
492 Ga0157379_10413630 3300014968 Bacteria 1241
493 Ga0157376_10013516 3300014969 Bacteria 6094
494 Ga0157376_10013883 3300014969 Bacteria 6023
495 Ga0157376_10025386 3300014969 Bacteria 4666
496 Ga0157376_10099913 3300014969 Bacteria 2532
497 Ga0157376_10176084 3300014969 Bacteria 1951
498 Ga0157376_10378299 3300014969 Bacteria 1363
499 Ga0157376_10393522 3300014969 Unclassified 1338
500 Ga0163161_10729832 3300017792 Bacteria 827
501 Ga0197907_10251813 3300020069 Bacteria 1138
502 Ga0197907_11172755 3300020069 Unclassified 1872
503 Ga0206356_10151869 3300020070 Bacteria 2025
504 Ga0206356_10692860 3300020070 Unclassified 1187
505 Ga0206356_11883262 3300020070 Bacteria 1193
506 Ga0206349_1564724 3300020075 Bacteria 757
507 Ga0206349_1753059 3300020075 Unclassified 845
508 Ga0206355_1664126 3300020076 Unclassified 955
509 Ga0206351_10013904 3300020077 Unclassified 953
510 Ga0206352_10544006 3300020078 Unclassified 803
511 Ga0206352_11071978 3300020078 Bacteria 1869
512 Ga0206352_11289791 3300020078 Unclassified 876
513 Ga0206350_11488832 3300020080 Bacteria 1501
514 Ga0206353_10475100 3300020082 Bacteria 700
515 Ga0224712_10117674 3300022467 Bacteria 1147
516 Ga0224712_10207188 3300022467 Unclassified 893
517 Ga0228598_1002817 3300024227 Unclassified 3770
518 Ga0207673_1016925 3300025290 Bacteria 971
519 Ga0207697_10150692 3300025315 Bacteria 1012
520 Ga0207682_10006285 3300025893 Bacteria 4796
521 Ga0207692_10053074 3300025898 Bacteria 2063
522 Ga0207642_10285751 3300025899 Unclassified 950
523 Ga0207710_10019087 3300025900 Bacteria 2923
524 Ga0207710_10083080 3300025900 Unclassified 1488
525 Ga0207710_10098433 3300025900 Bacteria 1377
526 Ga0207688_10072011 3300025901 Bacteria 1963
527 Ga0207680_10040696 3300025903 Bacteria 2706
528 Ga0207680_10086015 3300025903 Bacteria 1987
529 Ga0207680_10291150 3300025903 Bacteria 1136
530 Ga0207680_10457385 3300025903 Bacteria 906
531 Ga0207680_10628197 3300025903 Bacteria 769
532 Ga0207647_10209184 3300025904 Unclassified 1127
533 Ga0207685_10007869 3300025905 Bacteria 3001
534 Ga0207685_10057240 3300025905 Unclassified 1528
535 Ga0207685_10193992 3300025905 Bacteria 950
536 Ga0207699_10051787 3300025906 Bacteria 2427
537 Ga0207699_10117753 3300025906 Bacteria 1713
538 Ga0207699_10121136 3300025906 Unclassified 1692
539 Ga0207699_10161406 3300025906 Bacteria 1492
540 Ga0207699_10260390 3300025906 Unclassified 1199
541 Ga0207699_10485290 3300025906 Unclassified 890
542 Ga0207699_10500436 3300025906 Unclassified 877
543 Ga0207645_10038174 3300025907 Unclassified 3080
544 Ga0207645_10051956 3300025907 Bacteria 2619
545 Ga0207645_10161521 3300025907 Bacteria 1466
546 Ga0207645_10476365 3300025907 Bacteria 844
547 Ga0207643_10123254 3300025908 Bacteria 1537
548 Ga0207684_10000320 3300025910 Bacteria 68296
549 Ga0207684_10004878 3300025910 Bacteria 12535
550 Ga0207684_10163597 3300025910 Bacteria 1917
551 Ga0207684_10200658 3300025910 Bacteria 1721
552 Ga0207684_10411180 3300025910 Unclassified 1163
553 Ga0207684_10623868 3300025910 Bacteria 920
554 Ga0207654_10004482 3300025911 Bacteria 7050
555 Ga0207654_10011027 3300025911 Unclassified 4600
556 Ga0207654_10011326 3300025911 Bacteria 4550
557 Ga0207654_10048092 3300025911 Unclassified 2440
558 Ga0207707_10001452 3300025912 Bacteria 21916
559 Ga0207707_10022348 3300025912 Bacteria 5529
560 Ga0207707_10029531 3300025912 Unclassified 4795
561 Ga0207707_10070345 3300025912 Unclassified 3049
562 Ga0207707_10176006 3300025912 Unclassified 1869
563 Ga0207707_10268375 3300025912 Bacteria 1479
564 Ga0207707_10361356 3300025912 Bacteria 1250
565 Ga0207695_10036539 3300025913 Bacteria 5310
566 Ga0207695_10189123 3300025913 Bacteria 1977
567 Ga0207695_10222679 3300025913 Unclassified 1793
568 Ga0207695_10335661 3300025913 Unclassified 1400
569 Ga0207671_10025824 3300025914 Bacteria 4408
570 Ga0207671_10031521 3300025914 Bacteria 3950
571 Ga0207671_10091082 3300025914 Bacteria 2297
572 Ga0207671_10120902 3300025914 Unclassified 2002
573 Ga0207671_10160495 3300025914 Unclassified 1741
574 Ga0207671_10363056 3300025914 Unclassified 1149
575 Ga0207693_10000008 3300025915 Bacteria 171049
576 Ga0207693_10001167 3300025915 Bacteria 23425
577 Ga0207693_10014819 3300025915 Bacteria 6264
578 Ga0207693_10017337 3300025915 Bacteria 5743
579 Ga0207693_10529541 3300025915 Bacteria 919
580 Ga0207663_10006731 3300025916 Bacteria 5907
581 Ga0207663_10041868 3300025916 Bacteria 2794
582 Ga0207663_10063738 3300025916 Bacteria 2349
583 Ga0207663_10261780 3300025916 Bacteria 1277
584 Ga0207660_10054783 3300025917 Bacteria 2847
585 Ga0207660_10102627 3300025917 Unclassified 2138
586 Ga0207660_10150531 3300025917 Unclassified 1787
587 Ga0207662_10140899 3300025918 Bacteria 1527
588 Ga0207662_10194591 3300025918 Unclassified 1310
589 Ga0207657_10000386 3300025919 Bacteria 46458
590 Ga0207657_10002009 3300025919 Bacteria 21997
591 Ga0207657_10101401 3300025919 Bacteria 2389
592 Ga0207657_10529757 3300025919 Unclassified 922
593 Ga0207652_10039969 3300025921 Bacteria 3983
594 Ga0207652_10041980 3300025921 Unclassified 3890
595 Ga0207652_10051209 3300025921 Bacteria 3540
596 Ga0207652_10344516 3300025921 Unclassified 1345
597 Ga0207652_10814602 3300025921 Unclassified 828
598 Ga0207646_10075945 3300025922 Bacteria 3003
599 Ga0207646_10100259 3300025922 Bacteria 2596
600 Ga0207646_10203286 3300025922 Bacteria 1789
601 Ga0207646_10589251 3300025922 Unclassified 998
602 Ga0207681_10185130 3300025923 Bacteria 1589
603 Ga0207681_10225877 3300025923 Bacteria 1451
604 Ga0207681_10252515 3300025923 Bacteria 1377
605 Ga0207681_10347897 3300025923 Bacteria 1186
606 Ga0207694_10003298 3300025924 Bacteria 12840
607 Ga0207694_10004655 3300025924 Bacteria 10681
608 Ga0207694_10037891 3300025924 Bacteria 3706
609 Ga0207694_10097974 3300025924 Unclassified 2321
610 Ga0207694_10115616 3300025924 Bacteria 2137
611 Ga0207694_10463620 3300025924 Unclassified 1059
612 Ga0207694_10859111 3300025924 Unclassified 767
613 Ga0207650_10130016 3300025925 Bacteria 1970
614 Ga0207650_10152616 3300025925 Bacteria 1824
615 Ga0207650_10298109 3300025925 Bacteria 1316
616 Ga0207650_10325940 3300025925 Bacteria 1259
617 Ga0207659_10000642 3300025926 Bacteria 20752
618 Ga0207659_10272297 3300025926 Bacteria 1381
619 Ga0207687_10024093 3300025927 Bacteria 4063
620 Ga0207687_10114092 3300025927 Unclassified 2011
621 Ga0207687_10148704 3300025927 Bacteria 1785
622 Ga0207687_10279221 3300025927 Bacteria 1338
623 Ga0207700_10000107 3300025928 Bacteria 49976
624 Ga0207700_10005218 3300025928 Bacteria 7743
625 Ga0207700_10008994 3300025928 Bacteria 6218
626 Ga0207700_10010119 3300025928 Bacteria 5931
627 Ga0207700_10030141 3300025928 Unclassified 3838
628 Ga0207700_10049225 3300025928 Bacteria 3134
629 Ga0207700_10260313 3300025928 Unclassified 1485
630 Ga0207664_10009130 3300025929 Bacteria 6946
631 Ga0207664_10294572 3300025929 Bacteria 1426
632 Ga0207644_10076117 3300025931 Bacteria 2468
633 Ga0207644_10154407 3300025931 Bacteria 1779
634 Ga0207690_10140095 3300025932 Bacteria 1781
635 Ga0207690_10205198 3300025932 Unclassified 1499
636 Ga0207706_10000641 3300025933 Bacteria 37090
637 Ga0207706_10077742 3300025933 Unclassified 2918
638 Ga0207706_10379760 3300025933 Bacteria 1226
639 Ga0207706_10877345 3300025933 Bacteria 759
640 Ga0207686_10009876 3300025934 Bacteria 5187
641 Ga0207686_10156132 3300025934 Bacteria 1594
642 Ga0207686_10802835 3300025934 Bacteria 754
643 Ga0207709_10027612 3300025935 Unclassified 3272
644 Ga0207709_10571983 3300025935 Unclassified 891
645 Ga0207670_10437818 3300025936 Bacteria 1052
646 Ga0207669_10033461 3300025937 Bacteria 2901
647 Ga0207669_10083316 3300025937 Bacteria 2056
648 Ga0207669_10125100 3300025937 Bacteria 1755
649 Ga0207669_10452917 3300025937 Bacteria 1017
650 Ga0207669_10588358 3300025937 Bacteria 903
651 Ga0207704_10005907 3300025938 Bacteria 5669
652 Ga0207704_10007997 3300025938 Bacteria 5029
653 Ga0207704_10064155 3300025938 Unclassified 2293
654 Ga0207704_10184611 3300025938 Bacteria 1511
655 Ga0207704_10307898 3300025938 Unclassified 1216
656 Ga0207665_10018351 3300025939 Bacteria 4598
657 Ga0207665_10065776 3300025939 Bacteria 2466
658 Ga0207665_10094235 3300025939 Bacteria 2079
659 Ga0207665_10155863 3300025939 Bacteria 1639
660 Ga0207665_10236107 3300025939 Bacteria 1345
661 Ga0207665_10299409 3300025939 Bacteria 1202
662 Ga0207665_10754075 3300025939 Bacteria 767
663 Ga0207691_10047180 3300025940 Bacteria 3954
664 Ga0207691_10309053 3300025940 Bacteria 1357
665 Ga0207711_10006123 3300025941 Bacteria 10160
666 Ga0207711_10015924 3300025941 Bacteria 6236
667 Ga0207711_10072201 3300025941 Unclassified 2998
668 Ga0207711_10131330 3300025941 Bacteria 2246
669 Ga0207711_10166401 3300025941 Unclassified 1999
670 Ga0207711_10191235 3300025941 Bacteria 1865
671 Ga0207711_10207145 3300025941 Bacteria 1791
672 Ga0207711_10221846 3300025941 Unclassified 1729
673 Ga0207711_10329016 3300025941 Bacteria 1413
674 Ga0207711_10401447 3300025941 Unclassified 1274
675 Ga0207711_10703336 3300025941 Bacteria 943
676 Ga0207711_11100190 3300025941 Unclassified 735
677 Ga0207689_10003694 3300025942 Bacteria 13950
678 Ga0207689_10037080 3300025942 Unclassified 4046
679 Ga0207689_10105715 3300025942 Unclassified 2312
680 Ga0207689_10298462 3300025942 Bacteria 1335
681 Ga0207661_10088081 3300025944 Bacteria 2580
682 Ga0207661_10476152 3300025944 Bacteria 1139
683 Ga0207679_10054394 3300025945 Bacteria 2947
684 Ga0207679_10141110 3300025945 Unclassified 1948
685 Ga0207679_10765210 3300025945 Bacteria 879
686 Ga0207679_10997267 3300025945 Bacteria 768
687 Ga0207667_10000465 3300025949 Bacteria 54509
688 Ga0207667_10001399 3300025949 Bacteria 30243
689 Ga0207667_10132120 3300025949 Unclassified 2571
690 Ga0207667_10406056 3300025949 Bacteria 1387
691 Ga0207667_10493349 3300025949 Bacteria 1242
692 Ga0207712_10013471 3300025961 Bacteria 5243
693 Ga0207668_10111420 3300025972 Unclassified 2054
694 Ga0207668_10941433 3300025972 Unclassified 770
695 Ga0207640_10113675 3300025981 Bacteria 1925
696 Ga0207640_10169939 3300025981 Unclassified 1623
697 Ga0207658_10037531 3300025986 Unclassified 3483
698 Ga0207658_10165063 3300025986 Unclassified 1818
699 Ga0207658_10790984 3300025986 Bacteria 861
700 Ga0207677_10011565 3300026023 Bacteria 5038
701 Ga0207677_10019086 3300026023 Unclassified 4132
702 Ga0207677_10024214 3300026023 Bacteria 3767
703 Ga0207677_10081192 3300026023 Bacteria 2326
704 Ga0207677_10273243 3300026023 Bacteria 1384
705 Ga0207703_10001790 3300026035 Bacteria 19156
706 Ga0207703_10003748 3300026035 Bacteria 12650
707 Ga0207703_10009661 3300026035 Bacteria 7573
708 Ga0207703_10014533 3300026035 Bacteria 6142
709 Ga0207703_10063124 3300026035 Bacteria 3036
710 Ga0207703_10086076 3300026035 Unclassified 2632
711 Ga0207703_10444826 3300026035 Bacteria 1210
712 Ga0207703_10481222 3300026035 Unclassified 1163
713 Ga0207703_10801665 3300026035 Bacteria 899
714 Ga0207639_10026749 3300026041 Bacteria 4194
715 Ga0207639_10038873 3300026041 Bacteria 3542
716 Ga0207639_10091787 3300026041 Unclassified 2432
717 Ga0207639_10132909 3300026041 Bacteria 2062
718 Ga0207639_10238155 3300026041 Unclassified 1581
719 Ga0207678_10008144 3300026067 Bacteria 9241
720 Ga0207678_10131308 3300026067 Bacteria 2137
721 Ga0207708_10077097 3300026075 Unclassified 2558
722 Ga0207708_10097684 3300026075 Bacteria 2270
723 Ga0207708_10762541 3300026075 Bacteria 831
724 Ga0207702_10000458 3300026078 Bacteria 46107
725 Ga0207702_10001096 3300026078 Bacteria 27672
726 Ga0207702_10019362 3300026078 Bacteria 5633
727 Ga0207702_10076581 3300026078 Unclassified 2891
728 Ga0207702_10112542 3300026078 Bacteria 2422
729 Ga0207702_10596294 3300026078 Bacteria 1084
730 Ga0207702_10669738 3300026078 Bacteria 1021
731 Ga0207702_10786190 3300026078 Bacteria 940
732 Ga0207641_10155964 3300026088 Unclassified 2071
733 Ga0207641_11402919 3300026088 Bacteria 699
734 Ga0207648_10017102 3300026089 Bacteria 6609
735 Ga0207648_10030982 3300026089 Bacteria 4731
736 Ga0207648_10097212 3300026089 Unclassified 2577
737 Ga0207648_10209028 3300026089 Bacteria 1732
738 Ga0207648_10312881 3300026089 Bacteria 1410
739 Ga0207648_10492278 3300026089 Bacteria 1121
740 Ga0207676_10022322 3300026095 Bacteria 4654
741 Ga0207676_10054554 3300026095 Unclassified 3133
742 Ga0207676_10297396 3300026095 Archaea 1472
743 Ga0207676_10467760 3300026095 Unclassified 1192
744 Ga0207676_11066960 3300026095 Bacteria 798
745 Ga0207674_10005293 3300026116 Bacteria 15350
746 Ga0207674_10007441 3300026116 Bacteria 12762
747 Ga0207674_10022972 3300026116 Bacteria 6689
748 Ga0207674_10072389 3300026116 Unclassified 3463
749 Ga0207674_10151690 3300026116 Bacteria 2274
750 Ga0207674_10584877 3300026116 Bacteria 1078
751 Ga0207674_11078781 3300026116 Bacteria 772
752 Ga0207675_100039718 3300026118 Bacteria 4392
753 Ga0207675_100628649 3300026118 Bacteria 1079
754 Ga0207683_10038555 3300026121 Bacteria 4166
755 Ga0207683_10092953 3300026121 Bacteria 2688
756 Ga0207683_10240964 3300026121 Unclassified 1650
757 Ga0207698_10079771 3300026142 Bacteria 2634
758 Ga0207698_10283269 3300026142 Unclassified 1534
759 Ga0209971_1040676 3300027682 Bacteria 1118
760 Ga0209974_10023030 3300027876 Bacteria 2062
761 Ga0207428_10042299 3300027907 Bacteria 3684
762 Ga0207428_10131434 3300027907 Bacteria 1915
763 Ga0268266_10010487 3300028379 Bacteria 8098
764 Ga0268266_10053468 3300028379 Unclassified 3470
765 Ga0268265_10399849 3300028380 Unclassified 1269
766 Ga0268265_10644291 3300028380 Bacteria 1018
767 Ga0268265_11027162 3300028380 Unclassified 815
768 Ga0268264_10045705 3300028381 Bacteria 3636
769 Ga0268264_10069183 3300028381 Bacteria 2985
770 Ga0268264_10301438 3300028381 Bacteria 1509
771 Ga0268264_10987778 3300028381 Bacteria 848
772 Ga0265319_1025387 3300028563 Unclassified 2121
773 Ga0265338_10027402 3300028800 Bacteria 5717
774 Ga0265338_10305255 3300028800 Unclassified 1156
775 Ga0265762_1009046 3300030760 Unclassified 1775
776 Ga0265760_10009617 3300031090 Bacteria 2761
777 Ga0265760_10047254 3300031090 Bacteria 1292
778 Ga0265325_10004980 3300031241 Bacteria 8277
779 Ga0265331_10264905 3300031250 Unclassified 770
780 Ga0265316_10019518 3300031344 Bacteria 5795
781 Ga0265316_10045014 3300031344 Bacteria 3506
782 Ga0265313_10039017 3300031595 Bacteria 2360
783 Ga0265314_10244879 3300031711 Unclassified 1032
784 Ga0307405_10327176 3300031731 Unclassified 1173
785 Ga0307405_10857614 3300031731 Bacteria 765
786 Ga0307413_10691461 3300031824 Unclassified 846
787 Ga0307410_10514380 3300031852 Unclassified 987
788 Ga0307409_100563940 3300031995 Bacteria 1120
789 Ga0307416_100023471 3300032002 Bacteria 4477
790 Ga0307416_100175283 3300032002 Bacteria 2002
791 Ga0307416_100704517 3300032002 Bacteria 1099
792 Ga0307416_101061173 3300032002 Bacteria 914
793 Ga0307411_10359331 3300032005 Bacteria 1190
794 Ga0307415_100314961 3300032126 Unclassified 1302
795 Ga0316212_1006719 3300033547 Bacteria 1665
796 Ga0373926_0002050 3300035083 Bacteria 6338
797 Ga0373926_0048447 3300035083 Bacteria 1528
798 Ga0373934_0038393 3300035086 Bacteria 1886
799 Ga0373940_0023795 3300035088 Unclassified 1584
800 Ga0373923_0020829 3300035111 Unclassified 2553
801 Ga0373923_0058746 3300035111 Bacteria 1629
802 Ga0373923_0064486 3300035111 Bacteria 1562
803 Ga0373945_0171981 3300035116 Bacteria 888
804 Ga0373953_0067550 3300035117 Bacteria 1471
805 Ga0373954_0019428 3300035118 Bacteria 3065
806 Ga0373954_0044795 3300035118 Bacteria 2066
807 Ga0373954_0098267 3300035118 Bacteria 1411
808 Ga0373956_0039385 3300035119 Bacteria 2095
809 Ga0373960_0087785 3300035121 Bacteria 990
810 Ga0373960_0096923 3300035121 Bacteria 951
811 Ga0373943_0018934 3300035170 Bacteria 3165
812 Ga0373946_0050531 3300035171 Bacteria 1737
813 Ga0373946_0139866 3300035171 Bacteria 1121
814 Ga0373955_0094184 3300035172 Bacteria 1711
815 Ga0373924_0031778 3300035410 Bacteria 2125
816 Ga0373924_0078353 3300035410 Bacteria 1403
817 Ga0373924_0267867 3300035410 Unclassified 757
818 Ga0373931_0105854 3300035691 Unclassified 1589
819 Ga0373931_0225736 3300035691 Unclassified 1129
820 Ga0373931_0238938 3300035691 Bacteria 1101
821 Ga0373935_0016735 3300035692 Unclassified 4438
822 Ga0373935_0025383 3300035692 Bacteria 3652
823 Ga0373935_0464150 3300035692 Bacteria 916
824 Ga0373927_0009510 3300035695 Bacteria 6518
825 Ga0373927_0049369 3300035695 Bacteria 2721
826 Ga0373927_0086616 3300035695 Bacteria 2033
827 Ga0373927_0094343 3300035695 Unclassified 1944
828 Ga0373947_0010983 3300035725 Bacteria 5195
829 Ga0373947_0034871 3300035725 Bacteria 2977
830 Ga0373947_0114280 3300035725 Bacteria 1709
831 Ga0373947_0291605 3300035725 Unclassified 1086
832 Ga0373947_0486350 3300035725 Bacteria 838
833 Ga0373937_0007134 3300036401 Bacteria 9656
834 Ga0373937_0096269 3300036401 Bacteria 2745
835 Ga0373937_0110939 3300036401 Bacteria 2551
836 Ga0373937_0150648 3300036401 Bacteria 2179
837 Ga0373937_0622646 3300036401 Archaea 1024
838 Ga0373937_0918646 3300036401 Bacteria 824
839 Ga0373925_0009287 3300037068 Bacteria 7157
840 Ga0373925_0028478 3300037068 Bacteria 4093
841 Ga0373925_0096197 3300037068 Unclassified 2269
842 Ga0373925_0118344 3300037068 Bacteria 2054
843 Ga0373925_0126759 3300037068 Bacteria 1987
844 Ga0373925_0153978 3300037068 Bacteria 1807
845 Ga0373925_0238324 3300037068 Bacteria 1456
846 Ga0373925_0319795 3300037068 Bacteria 1256
847 Ga0373925_0648900 3300037068 Bacteria 870
848 Ga0373925_0888320 3300037068 Unclassified 734
849 Ga0395898_1026711 3300037466 Unclassified 760
850 Ga0436364_0537501 3300037853 Unclassified 808
851 Ga0436364_0709940 3300037853 Bacteria 1804
852 Ga0436363_0476775 3300039450 Unclassified 817
853 Ga0436363_0658841 3300039450 Bacteria 1795
854 Ga0439453_0026389 3300041408 Unclassified 1077
855 Ga0451798_0802015 3300041458 Unclassified 903
856 Ga0439443_016035 3300042003 Bacteria 1142
857 Ga0439448_0062666 3300042005 Unclassified 1231
858 Ga0450914_015160 3300042118 Bacteria 803
859 Ga0450910_021672 3300042147 Bacteria 974
860 Ga0439446_0006588 3300042156 Bacteria 3035
861 Ga0439446_0073101 3300042156 Bacteria 1052
862 Ga0439434_0061610 3300042435 Unclassified 1174
863 Ga0439435_0003653 3300042436 Bacteria 3225
864 Ga0439444_0062924 3300042437 Bacteria 779
865 Ga0439464_0033295 3300042439 Bacteria 1451
866 Ga0439460_0123438 3300042461 Bacteria 849
867 Ga0450916_001967 3300042530 Bacteria 2114
868 Ga0451576_0126510 3300045051 Unclassified 2663
869 Ga0451576_0736789 3300045051 Bacteria 1035
870 Ga0466967_0109298 3300045976 Bacteria 2538
871 Ga0466967_0906179 3300045976 Bacteria 877
872 Ga0466967_1154271 3300045976 Unclassified 772
873 Ga0495603_0121386 3300046455 Bacteria 1523
874 Ga0495629_0494963 3300046459 Bacteria 825
875 Ga0495651_0001373 3300046462 Bacteria 18863
876 Ga0495651_0032464 3300046462 Bacteria 4072
877 Ga0495653_0005283 3300046463 Bacteria 10507
878 Ga0495653_0247078 3300046463 Bacteria 1186
879 Ga0495580_0002181 3300046472 Bacteria 17133
880 Ga0495580_0002545 3300046472 Bacteria 15889
881 Ga0495580_0008514 3300046472 Bacteria 8154
882 Ga0495580_0023134 3300046472 Bacteria 4566
883 Ga0495580_0087729 3300046472 Unclassified 2167
884 Ga0495580_0196027 3300046472 Bacteria 1392
885 Ga0495580_0472640 3300046472 Bacteria 839
886 Ga0495580_0663384 3300046472 Bacteria 685
887 Ga0495582_0036951 3300046473 Unclassified 2687
888 Ga0495582_0138040 3300046473 Unclassified 1380
889 Ga0495582_0165162 3300046473 Bacteria 1260
890 Ga0495639_0133164 3300046475 Bacteria 1191
891 Ga0495664_0027935 3300046477 Bacteria 3292
892 Ga0495664_0242956 3300046477 Bacteria 1089
893 Ga0495594_0023384 3300046499 Viruses 3311
894 Ga0495608_0009893 3300046511 Bacteria 6656
895 Ga0495608_0122271 3300046511 Bacteria 1669
896 Ga0495608_0532588 3300046511 Bacteria 709
897 Ga0495628_0043933 3300046516 Bacteria 3557
898 Ga0495628_0090165 3300046516 Unclassified 2374
899 Ga0495630_0021716 3300046517 Bacteria 4740
900 Ga0495630_0022897 3300046517 Unclassified 4614
901 Ga0495630_0048007 3300046517 Bacteria 3195
902 Ga0495630_0557236 3300046517 Bacteria 879
903 Ga0495663_0076347 3300046525 Bacteria 1074
904 Ga0495666_0179491 3300046526 Bacteria 978
905 Ga0495652_0008144 3300046529 Bacteria 9585
906 Ga0495665_0002320 3300046531 Bacteria 10280
907 Ga0495665_0155495 3300046531 Unclassified 1193
908 Ga0495665_0257436 3300046531 Bacteria 898
909 Ga0495640_0140724 3300046533 Bacteria 1556
910 Ga0495586_0038336 3300046535 Unclassified 2573
911 Ga0495587_0314036 3300046536 Bacteria 875
912 Ga0495645_0101846 3300046543 Unclassified 2041
913 Ga0495645_0361994 3300046543 Unclassified 932
914 Ga0495622_0282322 3300046557 Bacteria 726
915 Ga0495667_0031282 3300046559 Bacteria 3573
916 Ga0495667_0273534 3300046559 Bacteria 1073
917 Ga0495667_0324597 3300046559 Unclassified 974
918 Ga0495656_0137175 3300046615 Bacteria 1170
919 Ga0495634_0162945 3300046642 Bacteria 1405
920 Ga0495634_0207507 3300046642 Bacteria 1214
921 Ga0495635_0013058 3300046663 Bacteria 5816
922 Ga0495635_0203767 3300046663 Bacteria 1341
923 Ga0495659_0017802 3300046664 Bacteria 2360
924 Ga0495659_0282035 3300046664 Bacteria 698
925 Ga0495657_0009162 3300046675 Bacteria 7518
926 Ga0495599_0277347 3300046678 Bacteria 1016
927 Ga0495623_0008898 3300046679 Bacteria 6517
928 Ga0495623_0140136 3300046679 Bacteria 1440
929 Ga0495623_0183313 3300046679 Bacteria 1215
930 Ga0495623_0267618 3300046679 Bacteria 955
931 Ga0495646_0009519 3300046680 Bacteria 6168
932 Ga0495647_0141426 3300046681 Unclassified 1026
933 Ga0495669_0249648 3300046684 Bacteria 852
934 Ga0495613_0072341 3300046689 Bacteria 2513
935 Ga0495613_0153721 3300046689 Bacteria 1640
936 Ga0495613_0199451 3300046689 Bacteria 1411
937 Ga0495624_0019445 3300046690 Unclassified 4532
938 Ga0495600_0019941 3300046809 Bacteria 4286
939 Ga0495581_0024597 3300047315 Bacteria 3491
940 Ga0495604_0008380 3300047317 Bacteria 8175
941 Ga0495604_0009311 3300047317 Bacteria 7776
942 Ga0495674_0019603 3300047319 Bacteria 6275
943 Ga0495674_0057578 3300047319 Bacteria 3401
944 Ga0495674_0361650 3300047319 Bacteria 1177
945 Ga0495676_0124792 3300047321 Bacteria 1867
946 Ga0495680_0002590 3300047322 Bacteria 18401
947 Ga0495680_0499127 3300047322 Bacteria 826
948 Ga0495675_0007363 3300047444 Bacteria 6780
949 Ga0495675_0161650 3300047444 Bacteria 1379
950 Ga0495675_0313758 3300047444 Bacteria 929
951 Ga0495684_0027823 3300047471 Unclassified 4342
952 Ga0495684_0471505 3300047471 Unclassified 868
953 Ga0495593_0004135 3300047673 Bacteria 8636
954 Ga0495593_0212607 3300047673 Unclassified 971
955 Ga0495602_0049439 3300048088 Bacteria 3766
956 Ga0495602_0265216 3300048088 Bacteria 1272
957 Ga0496100_0896461 3300048903 Bacteria 696
958 Ga0496101_0709016 3300048904 Unclassified 794
959 Ga0496102_0202857 3300048905 Unclassified 1869
960 Ga0496102_0595375 3300048905 Bacteria 1029
961 Ga0496102_1045067 3300048905 Bacteria 737
962 Ga0496103_0315480 3300048906 Bacteria 1006
963 Ga0496104_0162806 3300048907 Unclassified 2140
964 Ga0496104_0344773 3300048907 Bacteria 1402
965 Ga0496104_0515543 3300048907 Bacteria 1107
966 Ga0496105_0037794 3300048908 Unclassified 3976
967 Ga0496105_0131836 3300048908 Bacteria 2060
968 Ga0496105_0372092 3300048908 Unclassified 1138
969 Ga0496105_0460130 3300048908 Unclassified 1003
970 Ga0496106_0373819 3300048909 Bacteria 1145
971 Ga0496107_0306033 3300048910 Bacteria 1183
972 Ga0496107_0720109 3300048910 Bacteria 733
973 Ga0496108_0538522 3300048911 Unclassified 1019
974 Ga0496109_0238219 3300048912 Unclassified 1712
975 Ga0496109_0277242 3300048912 Bacteria 1580
976 Ga0496109_0419379 3300048912 Unclassified 1264
977 Ga0496109_0549313 3300048912 Unclassified 1090
978 Ga0496109_0627431 3300048912 Unclassified 1011
979 Ga0496110_0034465 3300048913 Bacteria 4385
980 Ga0496110_0495011 3300048913 Bacteria 1113
981 Ga0496111_0217779 3300048914 Unclassified 1418
982 Ga0496112_0001729 3300048915 Bacteria 17084
983 Ga0496112_0001787 3300048915 Bacteria 16907
984 Ga0496112_0042758 3300048915 Bacteria 4434
985 Ga0496112_0098038 3300048915 Unclassified 2901
986 Ga0496112_0144118 3300048915 Unclassified 2351
987 Ga0496112_0159495 3300048915 Bacteria 2222
988 Ga0496112_0404147 3300048915 Bacteria 1305
989 Ga0496112_0800490 3300048915 Unclassified 867
990 Ga0496114_0035011 3300048917 Unclassified 4146
991 Ga0496114_0139359 3300048917 Unclassified 2099
992 Ga0496114_0595835 3300048917 Bacteria 975
993 Ga0496115_0002823 3300048918 Bacteria 12490
994 Ga0496115_0118148 3300048918 Bacteria 2181
995 Ga0496115_0739288 3300048918 Bacteria 770
996 Ga0501031_0157044 3300049568 Bacteria 1487
997 Ga0501031_0443195 3300049568 Bacteria 839
998 Ga0501033_0042890 3300049570 Bacteria 3372
999 Ga0501034_0033399 3300049571 Bacteria 5221
1000 Ga0501036_0166457 3300049572 Bacteria 1858
1001 Ga0501036_0494704 3300049572 Bacteria 1018
1002 Ga0501038_0704974 3300049574 Unclassified 756
1003 Ga0501039_0039377 3300049575 Bacteria 3651
1004 Ga0501039_0387663 3300049575 Bacteria 1097
1005 Ga0501040_0128382 3300049576 Bacteria 1782
1006 Ga0501041_0408190 3300049577 Bacteria 861
1007 Ga0501042_0005563 3300049578 Bacteria 8123
1008 Ga0501042_0077653 3300049578 Bacteria 2378
1009 Ga0501042_0350451 3300049578 Bacteria 1068
1010 Ga0501046_0302295 3300049580 Bacteria 1168
1011 Ga0501047_0116925 3300049581 Bacteria 2548
1012 Ga0501048_0026386 3300049582 Bacteria 4230
1013 Ga0501048_0363975 3300049582 Bacteria 1032
1014 Ga0501068_0504755 3300049584 Archaea 785
1015 Ga0501070_0377852 3300049586 Bacteria 1148
1016 Ga0501070_0640837 3300049586 Archaea 844
1017 Ga0501071_0160507 3300049587 Bacteria 1680
1018 Ga0501071_0220594 3300049587 Bacteria 1427
1019 Ga0501071_0243516 3300049587 Bacteria 1356
1020 Ga0501071_0410564 3300049587 Archaea 1034
1021 Ga0501071_0639214 3300049587 Bacteria 819
1022 Ga0501072_0067686 3300049588 Bacteria 2818
1023 Ga0501073_0125693 3300049589 Bacteria 1778
1024 Ga0501073_0280179 3300049589 Bacteria 1150
1025 Ga0501075_0050750 3300049591 Bacteria 3119
1026 Ga0501075_0538919 3300049591 Bacteria 891
1027 Ga0501076_0076312 3300049592 Bacteria 2688
1028 Ga0501077_0060019 3300049593 Bacteria 2414
1029 Ga0501077_0202698 3300049593 Bacteria 1260
1030 Ga0501216_017845 3300049660 Bacteria 1217
1031 Ga0501080_0335926 3300049742 Unclassified 1366
1032 Ga0501081_0131432 3300049743 Bacteria 1789
1033 Ga0501083_0482562 3300049744 Unclassified 807
1034 Ga0501035_0111287 3300049822 Bacteria 2400
1035 Ga0501035_0190900 3300049822 Bacteria 1761
1036 Ga0501044_0069878 3300049823 Bacteria 3574
1037 Ga0501045_0004580 3300049824 Bacteria 9545
1038 Ga0501045_0016653 3300049824 Bacteria 5223
1039 Ga0501045_0367901 3300049824 Bacteria 1070
1040 Ga0501045_0641675 3300049824 Bacteria 785
1041 nmdc:mga05p37_23464_c2 3300050507 Bacteria 6362
1042 nmdc:mga05p37_238980_c1 3300050507 Bacteria 2185
1043 nmdc:mga05p37_322988_c1 3300050507 Bacteria 1826
1044 nmdc:mga05p37_37637_c1 3300050507 Bacteria 5933
1045 nmdc:mga05p37_593396_c1 3300050507 Bacteria 1252
1046 nmdc:mga09592_312434_c1 3300050508 Bacteria 1362
1047 nmdc:mga09592_6865_c1 3300050508 Bacteria 9263
1048 nmdc:mga09592_742998_c1 3300050508 Bacteria 833
1049 nmdc:mga0qj67_3392_c1 3300050509 Bacteria 11490
1050 nmdc:mga0qj67_708363_c1 3300050509 Bacteria 800
1051 nmdc:mga0qj67_773867_c1 3300050509 Bacteria 761
1052 nmdc:mga06r32_1010212_c1 3300050510 Bacteria 784
1053 nmdc:mga06r32_1387_c1 3300050510 Bacteria 21887
1054 nmdc:mga06r32_515034_c1 3300050510 Bacteria 1172
1055 nmdc:mga06r32_75596_c1 3300050510 Bacteria 3269
1056 nmdc:mga08y16_15899_c1 3300050511 Bacteria 7909
1057 nmdc:mga08y16_194302_c1 3300050511 Bacteria 2104
1058 nmdc:mga08y16_22738_c1 3300050511 Bacteria 6619
1059 nmdc:mga08y16_696424_c1 3300050511 Bacteria 1016
1060 nmdc:mga0n895_1425468_c1 3300050512 Bacteria 661
1061 nmdc:mga0n895_281053_c1 3300050512 Unclassified 1688
1062 nmdc:mga0n895_298035_c1 3300050512 Bacteria 1635
1063 nmdc:mga0n895_380676_c1 3300050512 Bacteria 1428
1064 nmdc:mga0n895_513821_c1 3300050512 Bacteria 1206
1065 nmdc:mga0n895_656277_c1 3300050512 Bacteria 1047
1066 nmdc:mga0rr50_167658_c1 3300050513 Bacteria 1787
1067 nmdc:mga0rr50_242372_c1 3300050513 Bacteria 1495
1068 nmdc:mga08x19_188298_c1 3300050514 Unclassified 1411
1069 nmdc:mga08x19_67866_c1 3300050514 Unclassified 2320
1070 nmdc:mga0a205_262413_c1 3300050515 Bacteria 1605
1071 nmdc:mga0a205_309378_c1 3300050515 Bacteria 1452
1072 nmdc:mga0a205_374386_c1 3300050515 Bacteria 1290
1073 nmdc:mga0a205_471661_c1 3300050515 Bacteria 1114
1074 nmdc:mga0a205_77284_c1 3300050515 Bacteria 3217
1075 nmdc:mga0a205_836810_c1 3300050515 Archaea 768
1076 Ga0495601_0081936 3300053077 Unclassified 2071
1077 Ga0495612_0003688 3300053078 Bacteria 6355
1078 Ga0495595_0051405 3300053084 Bacteria 1910
1079 Ga0495619_0187381 3300053085 Unclassified 1432
1080 Ga0495619_0371442 3300053085 Bacteria 989
1081 Ga0495619_0455243 3300053085 Bacteria 882
1082 Ga0501084_0156628 3300054114 Bacteria 1921
1083 Ga0590071_003068 3300059421 Bacteria 4140
1084 Ga0590075_006383 3300059424 Bacteria 2796
1085 Ga0590077_000396 3300059426 Bacteria 12269
1086 Ga0587084_020219 3300059477 Bacteria 988
1087 Ga0587066_012638 3300059490 Bacteria 1264
1088 Ga0587070_068515 3300059491 Unclassified 751
1089 Ga0587070_076926 3300059491 Bacteria 724
1090 Ga0587073_0032666 3300059492 Unclassified 1085
1091 Ga0587077_068126 3300059493 Unclassified 788
1092 Ga0587077_084522 3300059493 Unclassified 735
1093 Ga0587082_031050 3300059504 Bacteria 931
1094 Ga0587083_0047454 3300059505 Unclassified 924
1095 Ga0587085_037309 3300059506 Bacteria 830
1096 Ga0587086_024307 3300059507 Bacteria 850
1097 Ga0587088_052433 3300059508 Bacteria 803
1098 Ga0587090_065497 3300059510 Bacteria 699
1099 Ga0587091_070847 3300059511 Bacteria 762
1100 Ga0587091_092264 3300059511 Bacteria 697
1101 Ga0587094_020989 3300059513 Bacteria 949
1102 Ga0587094_037307 3300059513 Bacteria 778
1103 Ga0587094_041757 3300059513 Bacteria 749
1104 Ga0587125_024932 3300059607 Bacteria 731
1105 Ga0587101_035568 3300059623 Bacteria 799
1106 Ga0587117_013659 3300059627 Bacteria 1043
1107 Ga0587069_031678 3300059642 Bacteria 859
1108 Ga0587076_054161 3300059645 Unclassified 791
1109 Ga0587079_077500 3300059647 Bacteria 754
1110 Ga0587100_013011 3300059648 Unclassified 735
1111 Ga0587124_018644 3300059660 Unclassified 693
1112 Ga0587071_092664 3300060344 Bacteria 688
1113 Ga0587111_0057509 3300060346 Bacteria 875
1114 Ga0501082_0090837 3300060353 Bacteria 2637
1115 Ga0501082_0458990 3300060353 Bacteria 1113
1116 Ga0501082_0646760 3300060353 Bacteria 925
1117 Ga0501082_0776756 3300060353 Bacteria 838
1118 Ga0530510_0001309 3300061734 Bacteria 16633
1119 Ga0530510_0295225 3300061734 Bacteria 1212

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005445 Ga0070708_100012948 Ga0070708_1000129483 194
2 3300031731 Ga0307405_10857614 Ga0307405_108576141 195
3 3300032002 Ga0307416_100023471 Ga0307416_1000234712 195
4 3300059421 Ga0590071_003068 Ga0590071_003068_257_868 195
5 3300059424 Ga0590075_006383 Ga0590075_006383_114_725 195
6 3300059426 Ga0590077_000396 Ga0590077_000396_9123_9734 195
7 3300005445 Ga0070708_100282380 Ga0070708_1002823802 196
8 3300005981 Ga0081538_10004787 Ga0081538_100047875 196
9 3300025910 Ga0207684_10200658 Ga0207684_102006582 196
10 3300028563 Ga0265319_1025387 Ga0265319_10253872 197
11 3300028800 Ga0265338_10027402 Ga0265338_100274025 197
12 3300031241 Ga0265325_10004980 Ga0265325_100049804 197
13 3300031344 Ga0265316_10045014 Ga0265316_100450142 197
14 3300046459 Ga0495629_0494963 Ga0495629_0494963_12_644 197
15 3300050507 nmdc:mga05p37_238980_c1 nmdc:mga05p37_238980_c1_374_988 197
16 3300049574 Ga0501038_0704974 Ga0501038_0704974_85_705 198
17 3300005338 Ga0068868_100050774 Ga0068868_1000507744 199
18 3300005341 Ga0070691_10064375 Ga0070691_100643752 199
19 3300005436 Ga0070713_100010679 Ga0070713_1000106795 199
20 3300005436 Ga0070713_100303749 Ga0070713_1003037492 199
21 3300005456 Ga0070678_100294396 Ga0070678_1002943962 199
22 3300005458 Ga0070681_10001282 Ga0070681_100012828 199
23 3300005471 Ga0070698_100679082 Ga0070698_1006790821 199
24 3300005535 Ga0070684_100042934 Ga0070684_1000429341 199
25 3300005539 Ga0068853_100017653 Ga0068853_1000176533 199
26 3300005539 Ga0068853_100424039 Ga0068853_1004240392 199
27 3300005545 Ga0070695_100314543 Ga0070695_1003145431 199
28 3300005547 Ga0070693_100117218 Ga0070693_1001172182 199
29 3300005563 Ga0068855_100000234 Ga0068855_10000023424 199
30 3300005563 Ga0068855_100002034 Ga0068855_10000203423 199
31 3300005577 Ga0068857_100034785 Ga0068857_1000347853 199
32 3300005578 Ga0068854_100047266 Ga0068854_1000472662 199
33 3300005614 Ga0068856_100000062 Ga0068856_10000006212 199
34 3300005614 Ga0068856_100002175 Ga0068856_10000217519 199
35 3300005616 Ga0068852_100016336 Ga0068852_1000163362 199
36 3300005616 Ga0068852_100520460 Ga0068852_1005204602 199
37 3300005618 Ga0068864_100012733 Ga0068864_1000127332 199
38 3300005718 Ga0068866_10266486 Ga0068866_102664862 199
39 3300005842 Ga0068858_100013703 Ga0068858_1000137034 199
40 3300006237 Ga0097621_100000196 Ga0097621_10000019644 199
41 3300006237 Ga0097621_100000326 Ga0097621_10000032636 199
42 3300006358 Ga0068871_100000049 Ga0068871_10000004934 199
43 3300006358 Ga0068871_100089885 Ga0068871_1000898851 199
44 3300006852 Ga0075433_10213879 Ga0075433_102138792 199
45 3300007265 Ga0099794_10132741 Ga0099794_101327412 199
46 3300009093 Ga0105240_10013638 Ga0105240_100136382 199
47 3300009093 Ga0105240_10082073 Ga0105240_100820731 199
48 3300009093 Ga0105240_10136198 Ga0105240_101361982 199
49 3300009098 Ga0105245_11346697 Ga0105245_113466971 199
50 3300009147 Ga0114129_10885826 Ga0114129_108858262 199
51 3300009174 Ga0105241_10006410 Ga0105241_100064108 199
52 3300009177 Ga0105248_10010283 Ga0105248_100102834 199
53 3300009545 Ga0105237_10503999 Ga0105237_105039991 199
54 3300009551 Ga0105238_10000609 Ga0105238_1000060919 199
55 3300013102 Ga0157371_10122559 Ga0157371_101225592 199
56 3300013105 Ga0157369_10000159 Ga0157369_1000015962 199
57 3300013296 Ga0157374_10000062 Ga0157374_1000006254 199
58 3300013296 Ga0157374_10000338 Ga0157374_1000033818 199
59 3300013296 Ga0157374_10141625 Ga0157374_101416252 199
60 3300013297 Ga0157378_10000899 Ga0157378_1000089917 199
61 3300013297 Ga0157378_10004757 Ga0157378_100047572 199
62 3300013306 Ga0163162_10477774 Ga0163162_104777742 199
63 3300013307 Ga0157372_10000845 Ga0157372_100008455 199
64 3300013307 Ga0157372_10003611 Ga0157372_1000361114 199
65 3300014969 Ga0157376_10013516 Ga0157376_100135167 199
66 3300014969 Ga0157376_10025386 Ga0157376_100253865 199
67 3300020070 Ga0206356_10151869 Ga0206356_101518691 199
68 3300020078 Ga0206352_11071978 Ga0206352_110719782 199
69 3300025906 Ga0207699_10051787 Ga0207699_100517872 199
70 3300025911 Ga0207654_10011326 Ga0207654_100113265 199
71 3300025912 Ga0207707_10001452 Ga0207707_1000145216 199
72 3300025913 Ga0207695_10189123 Ga0207695_101891232 199
73 3300025913 Ga0207695_10222679 Ga0207695_102226792 199
74 3300025914 Ga0207671_10363056 Ga0207671_103630561 199
75 3300025921 Ga0207652_10039969 Ga0207652_100399694 199
76 3300025921 Ga0207652_10051209 Ga0207652_100512092 199
77 3300025924 Ga0207694_10003298 Ga0207694_100032988 199
78 3300025924 Ga0207694_10037891 Ga0207694_100378912 199
79 3300025924 Ga0207694_10859111 Ga0207694_108591112 199
80 3300025928 Ga0207700_10005218 Ga0207700_100052183 199
81 3300025928 Ga0207700_10260313 Ga0207700_102603132 199
82 3300025941 Ga0207711_10006123 Ga0207711_100061234 199
83 3300025945 Ga0207679_10141110 Ga0207679_101411102 199
84 3300025949 Ga0207667_10000465 Ga0207667_1000046522 199
85 3300025949 Ga0207667_10001399 Ga0207667_1000139931 199
86 3300026023 Ga0207677_10011565 Ga0207677_100115655 199
87 3300026035 Ga0207703_10003748 Ga0207703_100037484 199
88 3300026041 Ga0207639_10026749 Ga0207639_100267494 199
89 3300026041 Ga0207639_10238155 Ga0207639_102381552 199
90 3300026078 Ga0207702_10000458 Ga0207702_1000045830 199
91 3300026078 Ga0207702_10001096 Ga0207702_100010965 199
92 3300026095 Ga0207676_10022322 Ga0207676_100223221 199
93 3300026116 Ga0207674_10005293 Ga0207674_100052931 199
94 3300035691 Ga0373931_0105854 Ga0373931_0105854_656_1297 199
95 3300048908 Ga0496105_0460130 Ga0496105_0460130_263_904 199
96 3300048912 Ga0496109_0627431 Ga0496109_0627431_106_747 199
97 3300048915 Ga0496112_0001729 Ga0496112_0001729_14444_15085 199
98 3300050512 nmdc:mga0n895_513821_c1 nmdc:mga0n895_513821_c1_564_1178 199
99 3300050515 nmdc:mga0a205_309378_c1 nmdc:mga0a205_309378_c1_240_866 199
100 3300050515 nmdc:mga0a205_836810_c1 nmdc:mga0a205_836810_c1_78_704 199
101 3300005435 Ga0070714_100022981 Ga0070714_1000229814 200
102 3300005436 Ga0070713_100002315 Ga0070713_1000023152 200
103 3300005436 Ga0070713_100112879 Ga0070713_1001128792 200
104 3300005439 Ga0070711_100012400 Ga0070711_1000124002 200
105 3300005439 Ga0070711_100096083 Ga0070711_1000960832 200
106 3300005458 Ga0070681_10595934 Ga0070681_105959342 200
107 3300005467 Ga0070706_100154948 Ga0070706_1001549484 200
108 3300005564 Ga0070664_100067532 Ga0070664_1000675322 200
109 3300005578 Ga0068854_100140500 Ga0068854_1001405002 200
110 3300005614 Ga0068856_100295053 Ga0068856_1002950532 200
111 3300006028 Ga0070717_10049718 Ga0070717_100497182 200
112 3300006163 Ga0070715_10162073 Ga0070715_101620732 200
113 3300006173 Ga0070716_100046742 Ga0070716_1000467422 200
114 3300009174 Ga0105241_10032434 Ga0105241_100324343 200
115 3300009545 Ga0105237_10088398 Ga0105237_100883982 200
116 3300013100 Ga0157373_10032661 Ga0157373_100326613 200
117 3300013104 Ga0157370_10089656 Ga0157370_100896562 200
118 3300013104 Ga0157370_10505366 Ga0157370_105053661 200
119 3300013105 Ga0157369_10106983 Ga0157369_101069832 200
120 3300013296 Ga0157374_10018947 Ga0157374_100189472 200
121 3300013307 Ga0157372_10051671 Ga0157372_100516713 200
122 3300013308 Ga0157375_10409442 Ga0157375_104094422 200
123 3300025906 Ga0207699_10121136 Ga0207699_101211361 200
124 3300025910 Ga0207684_10623868 Ga0207684_106238682 200
125 3300025912 Ga0207707_10361356 Ga0207707_103613561 200
126 3300025914 Ga0207671_10091082 Ga0207671_100910822 200
127 3300025916 Ga0207663_10041868 Ga0207663_100418682 200
128 3300025928 Ga0207700_10008994 Ga0207700_100089942 200
129 3300025928 Ga0207700_10030141 Ga0207700_100301412 200
130 3300025929 Ga0207664_10294572 Ga0207664_102945722 200
131 3300025939 Ga0207665_10236107 Ga0207665_102361071 200
132 3300025945 Ga0207679_10054394 Ga0207679_100543942 200
133 3300025981 Ga0207640_10113675 Ga0207640_101136752 200
134 3300026035 Ga0207703_10444826 Ga0207703_104448261 200
135 3300026078 Ga0207702_10112542 Ga0207702_101125422 200
136 3300026116 Ga0207674_11078781 Ga0207674_110787811 200
137 3300028800 Ga0265338_10305255 Ga0265338_103052551 200
138 3300031250 Ga0265331_10264905 Ga0265331_102649052 200
139 3300031595 Ga0265313_10039017 Ga0265313_100390172 200
140 3300031711 Ga0265314_10244879 Ga0265314_102448792 200
141 3300035083 Ga0373926_0048447 Ga0373926_0048447_612_1241 200
142 3300035086 Ga0373934_0038393 Ga0373934_0038393_1162_1791 200
143 3300035111 Ga0373923_0058746 Ga0373923_0058746_711_1349 200
144 3300035111 Ga0373923_0064486 Ga0373923_0064486_415_1044 200
145 3300035116 Ga0373945_0171981 Ga0373945_0171981_114_749 200
146 3300035118 Ga0373954_0019428 Ga0373954_0019428_2121_2756 200
147 3300035119 Ga0373956_0039385 Ga0373956_0039385_1077_1712 200
148 3300035692 Ga0373935_0025383 Ga0373935_0025383_2279_2908 200
149 3300035695 Ga0373927_0049369 Ga0373927_0049369_1166_1804 200
150 3300036401 Ga0373937_0096269 Ga0373937_0096269_509_1147 200
151 3300036401 Ga0373937_0110939 Ga0373937_0110939_1839_2468 200
152 3300037068 Ga0373925_0096197 Ga0373925_0096197_597_1226 200
153 3300037068 Ga0373925_0153978 Ga0373925_0153978_856_1494 200
154 3300037068 Ga0373925_0319795 Ga0373925_0319795_75_716 200
155 3300045051 Ga0451576_0736789 Ga0451576_0736789_153_785 200
156 3300046472 Ga0495580_0472640 Ga0495580_0472640_132_773 200
157 3300046473 Ga0495582_0165162 Ga0495582_0165162_318_953 200
158 3300046679 Ga0495623_0140136 Ga0495623_0140136_459_1088 200
159 3300046679 Ga0495623_0183313 Ga0495623_0183313_545_1174 200
160 3300047319 Ga0495674_0057578 Ga0495674_0057578_128_763 200
161 3300047444 Ga0495675_0161650 Ga0495675_0161650_136_765 200
162 3300048088 Ga0495602_0265216 Ga0495602_0265216_207_836 200
163 3300048905 Ga0496102_0595375 Ga0496102_0595375_186_827 200
164 3300048915 Ga0496112_0404147 Ga0496112_0404147_343_984 200
165 3300005290 Ga0065712_10154608 Ga0065712_101546082 201
166 3300005338 Ga0068868_100493205 Ga0068868_1004932052 201
167 3300005434 Ga0070709_10094195 Ga0070709_100941952 201
168 3300005439 Ga0070711_100171290 Ga0070711_1001712902 201
169 3300005445 Ga0070708_100841812 Ga0070708_1008418122 201
170 3300005459 Ga0068867_100115804 Ga0068867_1001158043 201
171 3300005466 Ga0070685_10151869 Ga0070685_101518692 201
172 3300005467 Ga0070706_100700953 Ga0070706_1007009531 201
173 3300005518 Ga0070699_100548573 Ga0070699_1005485731 201
174 3300005548 Ga0070665_100192917 Ga0070665_1001929173 201
175 3300005563 Ga0068855_100772636 Ga0068855_1007726362 201
176 3300005616 Ga0068852_100107871 Ga0068852_1001078713 201
177 3300005617 Ga0068859_100035429 Ga0068859_1000354294 201
178 3300005842 Ga0068858_100014019 Ga0068858_1000140194 201
179 3300005937 Ga0081455_10299917 Ga0081455_102999172 201
180 3300006028 Ga0070717_10274455 Ga0070717_102744552 201
181 3300006173 Ga0070716_100100120 Ga0070716_1001001202 201
182 3300006175 Ga0070712_100010616 Ga0070712_1000106162 201
183 3300006237 Ga0097621_100227623 Ga0097621_1002276232 201
184 3300006237 Ga0097621_100311448 Ga0097621_1003114482 201
185 3300006846 Ga0075430_100432902 Ga0075430_1004329022 201
186 3300006931 Ga0097620_100035431 Ga0097620_1000354314 201
187 3300009098 Ga0105245_10177367 Ga0105245_101773672 201
188 3300009101 Ga0105247_10322688 Ga0105247_103226882 201
189 3300009176 Ga0105242_10796407 Ga0105242_107964071 201
190 3300009545 Ga0105237_10087881 Ga0105237_100878814 201
191 3300010375 Ga0105239_10292327 Ga0105239_102923272 201
192 3300013296 Ga0157374_10053283 Ga0157374_100532833 201
193 3300013296 Ga0157374_10068261 Ga0157374_100682612 201
194 3300013297 Ga0157378_10006834 Ga0157378_100068349 201
195 3300013306 Ga0163162_10069684 Ga0163162_100696842 201
196 3300013308 Ga0157375_10014565 Ga0157375_100145654 201
197 3300013308 Ga0157375_10217189 Ga0157375_102171892 201
198 3300014745 Ga0157377_10150047 Ga0157377_101500472 201
199 3300025904 Ga0207647_10209184 Ga0207647_102091842 201
200 3300025906 Ga0207699_10500436 Ga0207699_105004361 201
201 3300025910 Ga0207684_10411180 Ga0207684_104111802 201
202 3300025914 Ga0207671_10031521 Ga0207671_100315215 201
203 3300025915 Ga0207693_10017337 Ga0207693_100173372 201
204 3300025916 Ga0207663_10261780 Ga0207663_102617801 201
205 3300025938 Ga0207704_10005907 Ga0207704_100059072 201
206 3300025939 Ga0207665_10065776 Ga0207665_100657762 201
207 3300025942 Ga0207689_10003694 Ga0207689_100036946 201
208 3300025949 Ga0207667_10406056 Ga0207667_104060562 201
209 3300026023 Ga0207677_10273243 Ga0207677_102732432 201
210 3300026035 Ga0207703_10063124 Ga0207703_100631242 201
211 3300026089 Ga0207648_10097212 Ga0207648_100972122 201
212 3300026142 Ga0207698_10079771 Ga0207698_100797713 201
213 3300035692 Ga0373935_0016735 Ga0373935_0016735_3718_4356 201
214 3300037068 Ga0373925_0028478 Ga0373925_0028478_2408_3046 201
215 3300042147 Ga0450910_021672 Ga0450910_021672_259_903 201
216 3300045976 Ga0466967_0109298 Ga0466967_0109298_1585_2220 201
217 3300046472 Ga0495580_0008514 Ga0495580_0008514_4981_5619 201
218 3300046472 Ga0495580_0196027 Ga0495580_0196027_198_836 201
219 3300046472 Ga0495580_0663384 Ga0495580_0663384_19_657 201
220 3300046473 Ga0495582_0138040 Ga0495582_0138040_243_881 201
221 3300046517 Ga0495630_0021716 Ga0495630_0021716_1472_2233 201
222 3300046531 Ga0495665_0257436 Ga0495665_0257436_161_802 201
223 3300046533 Ga0495640_0140724 Ga0495640_0140724_388_1026 201
224 3300046543 Ga0495645_0361994 Ga0495645_0361994_35_673 201
225 3300046557 Ga0495622_0282322 Ga0495622_0282322_34_675 201
226 3300046559 Ga0495667_0324597 Ga0495667_0324597_55_696 201
227 3300046615 Ga0495656_0137175 Ga0495656_0137175_153_779 201
228 3300046642 Ga0495634_0207507 Ga0495634_0207507_463_1104 201
229 3300046689 Ga0495613_0072341 Ga0495613_0072341_757_1518 201
230 3300047673 Ga0495593_0212607 Ga0495593_0212607_34_672 201
231 3300048907 Ga0496104_0515543 Ga0496104_0515543_455_1096 201
232 3300048915 Ga0496112_0001787 Ga0496112_0001787_12215_12853 201
233 3300053085 Ga0495619_0455243 Ga0495619_0455243_70_831 201
234 3300005290 Ga0065712_10217838 Ga0065712_102178382 202
235 3300005293 Ga0065715_10340354 Ga0065715_103403541 202
236 3300005328 Ga0070676_10022921 Ga0070676_100229212 202
237 3300005329 Ga0070683_100200558 Ga0070683_1002005582 202
238 3300005333 Ga0070677_10064415 Ga0070677_100644152 202
239 3300005334 Ga0068869_100013764 Ga0068869_1000137643 202
240 3300005335 Ga0070666_10151568 Ga0070666_101515682 202
241 3300005337 Ga0070682_100080769 Ga0070682_1000807692 202
242 3300005338 Ga0068868_100058077 Ga0068868_1000580772 202
243 3300005339 Ga0070660_100051801 Ga0070660_1000518012 202
244 3300005347 Ga0070668_100017488 Ga0070668_1000174884 202
245 3300005353 Ga0070669_100175841 Ga0070669_1001758412 202
246 3300005365 Ga0070688_100191509 Ga0070688_1001915092 202
247 3300005366 Ga0070659_100240024 Ga0070659_1002400242 202
248 3300005367 Ga0070667_100039346 Ga0070667_1000393463 202
249 3300005434 Ga0070709_10004528 Ga0070709_100045283 202
250 3300005434 Ga0070709_10085085 Ga0070709_100850852 202
251 3300005434 Ga0070709_10100821 Ga0070709_101008212 202
252 3300005435 Ga0070714_100010303 Ga0070714_1000103032 202
253 3300005436 Ga0070713_100000476 Ga0070713_1000004768 202
254 3300005436 Ga0070713_100006228 Ga0070713_1000062283 202
255 3300005436 Ga0070713_100027416 Ga0070713_1000274164 202
256 3300005436 Ga0070713_100061664 Ga0070713_1000616642 202
257 3300005437 Ga0070710_10055150 Ga0070710_100551502 202
258 3300005437 Ga0070710_10282206 Ga0070710_102822061 202
259 3300005439 Ga0070711_100001229 Ga0070711_1000012298 202
260 3300005439 Ga0070711_100020175 Ga0070711_1000201754 202
261 3300005439 Ga0070711_100085993 Ga0070711_1000859932 202
262 3300005445 Ga0070708_100114524 Ga0070708_1001145242 202
263 3300005445 Ga0070708_100398888 Ga0070708_1003988882 202
264 3300005455 Ga0070663_100081603 Ga0070663_1000816032 202
265 3300005457 Ga0070662_100122790 Ga0070662_1001227902 202
266 3300005459 Ga0068867_100016286 Ga0068867_1000162864 202
267 3300005467 Ga0070706_100002094 Ga0070706_1000020948 202
268 3300005468 Ga0070707_100086910 Ga0070707_1000869102 202
269 3300005468 Ga0070707_100505722 Ga0070707_1005057222 202
270 3300005471 Ga0070698_100413945 Ga0070698_1004139451 202
271 3300005518 Ga0070699_100016335 Ga0070699_1000163356 202
272 3300005535 Ga0070684_100144776 Ga0070684_1001447762 202
273 3300005536 Ga0070697_100002395 Ga0070697_1000023957 202
274 3300005539 Ga0068853_100076896 Ga0068853_1000768962 202
275 3300005544 Ga0070686_100081065 Ga0070686_1000810652 202
276 3300005545 Ga0070695_100822637 Ga0070695_1008226371 202
277 3300005546 Ga0070696_100247781 Ga0070696_1002477811 202
278 3300005548 Ga0070665_100072788 Ga0070665_1000727882 202
279 3300005564 Ga0070664_100236860 Ga0070664_1002368602 202
280 3300005578 Ga0068854_100107675 Ga0068854_1001076752 202
281 3300005614 Ga0068856_100119422 Ga0068856_1001194222 202
282 3300005616 Ga0068852_100382014 Ga0068852_1003820142 202
283 3300005618 Ga0068864_100382057 Ga0068864_1003820571 202
284 3300005718 Ga0068866_10024028 Ga0068866_100240282 202
285 3300005719 Ga0068861_100148732 Ga0068861_1001487322 202
286 3300005834 Ga0068851_10059333 Ga0068851_100593332 202
287 3300005842 Ga0068858_100016583 Ga0068858_1000165832 202
288 3300005843 Ga0068860_100080997 Ga0068860_1000809972 202
289 3300005844 Ga0068862_100173830 Ga0068862_1001738302 202
290 3300005981 Ga0081538_10111330 Ga0081538_101113302 202
291 3300006058 Ga0075432_10037531 Ga0075432_100375312 202
292 3300006163 Ga0070715_10005284 Ga0070715_100052843 202
293 3300006163 Ga0070715_10040341 Ga0070715_100403412 202
294 3300006163 Ga0070715_10104239 Ga0070715_101042392 202
295 3300006173 Ga0070716_100010782 Ga0070716_1000107822 202
296 3300006173 Ga0070716_100036212 Ga0070716_1000362122 202
297 3300006173 Ga0070716_100130440 Ga0070716_1001304402 202
298 3300006175 Ga0070712_100000468 Ga0070712_10000046816 202
299 3300006175 Ga0070712_100002849 Ga0070712_1000028492 202
300 3300006175 Ga0070712_100011228 Ga0070712_1000112285 202
301 3300006237 Ga0097621_100270334 Ga0097621_1002703342 202
302 3300006358 Ga0068871_100181118 Ga0068871_1001811182 202
303 3300006847 Ga0075431_100535336 Ga0075431_1005353362 202
304 3300006871 Ga0075434_100127862 Ga0075434_1001278622 202
305 3300006871 Ga0075434_100315925 Ga0075434_1003159252 202
306 3300006871 Ga0075434_100326366 Ga0075434_1003263662 202
307 3300006881 Ga0068865_100096344 Ga0068865_1000963442 202
308 3300006914 Ga0075436_100086852 Ga0075436_1000868522 202
309 3300006914 Ga0075436_100089193 Ga0075436_1000891932 202
310 3300006914 Ga0075436_100150028 Ga0075436_1001500282 202
311 3300007076 Ga0075435_100016798 Ga0075435_1000167982 202
312 3300007076 Ga0075435_100047716 Ga0075435_1000477163 202
313 3300007076 Ga0075435_100109848 Ga0075435_1001098482 202
314 3300007265 Ga0099794_10194871 Ga0099794_101948712 202
315 3300009093 Ga0105240_10053160 Ga0105240_100531602 202
316 3300009098 Ga0105245_10314329 Ga0105245_103143292 202
317 3300009101 Ga0105247_10023620 Ga0105247_100236202 202
318 3300009147 Ga0114129_10136553 Ga0114129_101365534 202
319 3300009147 Ga0114129_10603688 Ga0114129_106036882 202
320 3300009176 Ga0105242_10250564 Ga0105242_102505642 202
321 3300009177 Ga0105248_10410923 Ga0105248_104109232 202
322 3300009551 Ga0105238_10880803 Ga0105238_108808031 202
323 3300009553 Ga0105249_10006270 Ga0105249_100062704 202
324 3300010375 Ga0105239_10348132 Ga0105239_103481322 202
325 3300010375 Ga0105239_10835899 Ga0105239_108358991 202
326 3300011119 Ga0105246_10147378 Ga0105246_101473782 202
327 3300013102 Ga0157371_10036625 Ga0157371_100366252 202
328 3300013104 Ga0157370_10151310 Ga0157370_101513102 202
329 3300013105 Ga0157369_10204196 Ga0157369_102041962 202
330 3300013296 Ga0157374_10181087 Ga0157374_101810872 202
331 3300013297 Ga0157378_10154309 Ga0157378_101543092 202
332 3300013306 Ga0163162_10126568 Ga0163162_101265683 202
333 3300013307 Ga0157372_10168063 Ga0157372_101680631 202
334 3300013308 Ga0157375_10126187 Ga0157375_101261872 202
335 3300014325 Ga0163163_10030748 Ga0163163_100307482 202
336 3300014745 Ga0157377_10136077 Ga0157377_101360772 202
337 3300014968 Ga0157379_10031582 Ga0157379_100315823 202
338 3300014969 Ga0157376_10099913 Ga0157376_100999133 202
339 3300025898 Ga0207692_10053074 Ga0207692_100530741 202
340 3300025899 Ga0207642_10285751 Ga0207642_102857511 202
341 3300025905 Ga0207685_10007869 Ga0207685_100078692 202
342 3300025905 Ga0207685_10057240 Ga0207685_100572401 202
343 3300025906 Ga0207699_10117753 Ga0207699_101177532 202
344 3300025906 Ga0207699_10161406 Ga0207699_101614062 202
345 3300025906 Ga0207699_10485290 Ga0207699_104852901 202
346 3300025907 Ga0207645_10038174 Ga0207645_100381742 202
347 3300025910 Ga0207684_10004878 Ga0207684_100048786 202
348 3300025911 Ga0207654_10004482 Ga0207654_100044824 202
349 3300025912 Ga0207707_10029531 Ga0207707_100295312 202
350 3300025913 Ga0207695_10335661 Ga0207695_103356612 202
351 3300025914 Ga0207671_10120902 Ga0207671_101209022 202
352 3300025915 Ga0207693_10000008 Ga0207693_1000000821 202
353 3300025915 Ga0207693_10001167 Ga0207693_1000116716 202
354 3300025915 Ga0207693_10014819 Ga0207693_100148192 202
355 3300025916 Ga0207663_10006731 Ga0207663_100067312 202
356 3300025916 Ga0207663_10063738 Ga0207663_100637382 202
357 3300025917 Ga0207660_10102627 Ga0207660_101026272 202
358 3300025919 Ga0207657_10002009 Ga0207657_100020094 202
359 3300025921 Ga0207652_10041980 Ga0207652_100419802 202
360 3300025921 Ga0207652_10344516 Ga0207652_103445161 202
361 3300025922 Ga0207646_10075945 Ga0207646_100759452 202
362 3300025922 Ga0207646_10589251 Ga0207646_105892511 202
363 3300025923 Ga0207681_10225877 Ga0207681_102258772 202
364 3300025924 Ga0207694_10097974 Ga0207694_100979742 202
365 3300025927 Ga0207687_10114092 Ga0207687_101140922 202
366 3300025928 Ga0207700_10000107 Ga0207700_1000010716 202
367 3300025928 Ga0207700_10010119 Ga0207700_100101193 202
368 3300025929 Ga0207664_10009130 Ga0207664_100091304 202
369 3300025932 Ga0207690_10205198 Ga0207690_102051981 202
370 3300025933 Ga0207706_10000641 Ga0207706_1000064117 202
371 3300025938 Ga0207704_10064155 Ga0207704_100641552 202
372 3300025939 Ga0207665_10018351 Ga0207665_100183512 202
373 3300025939 Ga0207665_10094235 Ga0207665_100942352 202
374 3300025939 Ga0207665_10754075 Ga0207665_107540751 202
375 3300025941 Ga0207711_10072201 Ga0207711_100722012 202
376 3300025942 Ga0207689_10037080 Ga0207689_100370802 202
377 3300025949 Ga0207667_10132120 Ga0207667_101321202 202
378 3300025961 Ga0207712_10013471 Ga0207712_100134713 202
379 3300025972 Ga0207668_10111420 Ga0207668_101114202 202
380 3300025981 Ga0207640_10169939 Ga0207640_101699392 202
381 3300025986 Ga0207658_10165063 Ga0207658_101650632 202
382 3300026023 Ga0207677_10019086 Ga0207677_100190862 202
383 3300026035 Ga0207703_10481222 Ga0207703_104812221 202
384 3300026067 Ga0207678_10008144 Ga0207678_100081443 202
385 3300026078 Ga0207702_10076581 Ga0207702_100765812 202
386 3300026078 Ga0207702_10596294 Ga0207702_105962942 202
387 3300026088 Ga0207641_11402919 Ga0207641_114029191 202
388 3300026089 Ga0207648_10017102 Ga0207648_100171027 202
389 3300026095 Ga0207676_10467760 Ga0207676_104677602 202
390 3300026116 Ga0207674_10022972 Ga0207674_100229723 202
391 3300026116 Ga0207674_10072389 Ga0207674_100723892 202
392 3300026118 Ga0207675_100039718 Ga0207675_1000397183 202
393 3300026121 Ga0207683_10240964 Ga0207683_102409642 202
394 3300026142 Ga0207698_10283269 Ga0207698_102832692 202
395 3300027907 Ga0207428_10131434 Ga0207428_101314342 202
396 3300028380 Ga0268265_10399849 Ga0268265_103998492 202
397 3300028380 Ga0268265_11027162 Ga0268265_110271621 202
398 3300031090 Ga0265760_10047254 Ga0265760_100472541 202
399 3300035083 Ga0373926_0002050 Ga0373926_0002050_5239_5883 202
400 3300035088 Ga0373940_0023795 Ga0373940_0023795_211_876 202
401 3300035111 Ga0373923_0020829 Ga0373923_0020829_621_1265 202
402 3300035118 Ga0373954_0044795 Ga0373954_0044795_333_977 202
403 3300035121 Ga0373960_0096923 Ga0373960_0096923_14_655 202
404 3300035410 Ga0373924_0078353 Ga0373924_0078353_92_736 202
405 3300035691 Ga0373931_0225736 Ga0373931_0225736_67_732 202
406 3300035695 Ga0373927_0009510 Ga0373927_0009510_1150_1794 202
407 3300035725 Ga0373947_0010983 Ga0373947_0010983_3193_3837 202
408 3300035725 Ga0373947_0291605 Ga0373947_0291605_405_1049 202
409 3300036401 Ga0373937_0007134 Ga0373937_0007134_1913_2557 202
410 3300037853 Ga0436364_0709940 Ga0436364_0709940_225_899 202
411 3300039450 Ga0436363_0658841 Ga0436363_0658841_757_1401 202
412 3300042005 Ga0439448_0062666 Ga0439448_0062666_106_771 202
413 3300042156 Ga0439446_0006588 Ga0439446_0006588_596_1243 202
414 3300045051 Ga0451576_0126510 Ga0451576_0126510_1199_1864 202
415 3300045976 Ga0466967_1154271 Ga0466967_1154271_27_638 202
416 3300046462 Ga0495651_0001373 Ga0495651_0001373_4182_4826 202
417 3300046462 Ga0495651_0032464 Ga0495651_0032464_632_1276 202
418 3300046463 Ga0495653_0005283 Ga0495653_0005283_7981_8625 202
419 3300046463 Ga0495653_0247078 Ga0495653_0247078_490_1134 202
420 3300046472 Ga0495580_0002181 Ga0495580_0002181_5925_6566 202
421 3300046472 Ga0495580_0002545 Ga0495580_0002545_3194_3838 202
422 3300046472 Ga0495580_0023134 Ga0495580_0023134_3907_4551 202
423 3300046473 Ga0495582_0036951 Ga0495582_0036951_542_1186 202
424 3300046477 Ga0495664_0027935 Ga0495664_0027935_2543_3187 202
425 3300046511 Ga0495608_0009893 Ga0495608_0009893_4382_5026 202
426 3300046511 Ga0495608_0532588 Ga0495608_0532588_43_687 202
427 3300046516 Ga0495628_0043933 Ga0495628_0043933_226_870 202
428 3300046516 Ga0495628_0090165 Ga0495628_0090165_749_1393 202
429 3300046517 Ga0495630_0022897 Ga0495630_0022897_3194_3838 202
430 3300046517 Ga0495630_0048007 Ga0495630_0048007_133_777 202
431 3300046526 Ga0495666_0179491 Ga0495666_0179491_160_804 202
432 3300046529 Ga0495652_0008144 Ga0495652_0008144_4052_4696 202
433 3300046531 Ga0495665_0002320 Ga0495665_0002320_8110_8754 202
434 3300046531 Ga0495665_0155495 Ga0495665_0155495_44_688 202
435 3300046535 Ga0495586_0038336 Ga0495586_0038336_1527_2171 202
436 3300046536 Ga0495587_0314036 Ga0495587_0314036_196_840 202
437 3300046543 Ga0495645_0101846 Ga0495645_0101846_381_1025 202
438 3300046559 Ga0495667_0031282 Ga0495667_0031282_717_1361 202
439 3300046559 Ga0495667_0273534 Ga0495667_0273534_204_848 202
440 3300046663 Ga0495635_0013058 Ga0495635_0013058_5055_5699 202
441 3300046675 Ga0495657_0009162 Ga0495657_0009162_3235_3879 202
442 3300046678 Ga0495599_0277347 Ga0495599_0277347_183_827 202
443 3300046679 Ga0495623_0008898 Ga0495623_0008898_5084_5728 202
444 3300046680 Ga0495646_0009519 Ga0495646_0009519_158_802 202
445 3300046689 Ga0495613_0153721 Ga0495613_0153721_737_1381 202
446 3300046689 Ga0495613_0199451 Ga0495613_0199451_117_761 202
447 3300046690 Ga0495624_0019445 Ga0495624_0019445_3363_4007 202
448 3300046809 Ga0495600_0019941 Ga0495600_0019941_534_1178 202
449 3300047317 Ga0495604_0008380 Ga0495604_0008380_5952_6596 202
450 3300047317 Ga0495604_0009311 Ga0495604_0009311_1527_2171 202
451 3300047319 Ga0495674_0019603 Ga0495674_0019603_5164_5808 202
452 3300047321 Ga0495676_0124792 Ga0495676_0124792_281_925 202
453 3300047322 Ga0495680_0002590 Ga0495680_0002590_14665_15309 202
454 3300047444 Ga0495675_0007363 Ga0495675_0007363_1101_1745 202
455 3300047471 Ga0495684_0027823 Ga0495684_0027823_3066_3710 202
456 3300047673 Ga0495593_0004135 Ga0495593_0004135_5163_5807 202
457 3300048088 Ga0495602_0049439 Ga0495602_0049439_2661_3305 202
458 3300048905 Ga0496102_0202857 Ga0496102_0202857_855_1520 202
459 3300048907 Ga0496104_0162806 Ga0496104_0162806_358_1023 202
460 3300048908 Ga0496105_0372092 Ga0496105_0372092_132_767 202
461 3300048911 Ga0496108_0538522 Ga0496108_0538522_170_817 202
462 3300048912 Ga0496109_0238219 Ga0496109_0238219_887_1534 202
463 3300048912 Ga0496109_0419379 Ga0496109_0419379_449_1114 202
464 3300048913 Ga0496110_0034465 Ga0496110_0034465_3495_4124 202
465 3300048914 Ga0496111_0217779 Ga0496111_0217779_640_1269 202
466 3300048915 Ga0496112_0098038 Ga0496112_0098038_590_1255 202
467 3300048915 Ga0496112_0800490 Ga0496112_0800490_144_773 202
468 3300048917 Ga0496114_0139359 Ga0496114_0139359_1103_1738 202
469 3300049568 Ga0501031_0443195 Ga0501031_0443195_54_701 202
470 3300049575 Ga0501039_0039377 Ga0501039_0039377_2766_3413 202
471 3300049577 Ga0501041_0408190 Ga0501041_0408190_209_835 202
472 3300049578 Ga0501042_0077653 Ga0501042_0077653_489_1136 202
473 3300049578 Ga0501042_0350451 Ga0501042_0350451_241_885 202
474 3300049582 Ga0501048_0026386 Ga0501048_0026386_1093_1740 202
475 3300049587 Ga0501071_0220594 Ga0501071_0220594_339_986 202
476 3300049588 Ga0501072_0067686 Ga0501072_0067686_1908_2555 202
477 3300049592 Ga0501076_0076312 Ga0501076_0076312_348_992 202
478 3300049824 Ga0501045_0016653 Ga0501045_0016653_636_1283 202
479 3300049824 Ga0501045_0367901 Ga0501045_0367901_108_752 202
480 3300050507 nmdc:mga05p37_593396_c1 nmdc:mga05p37_593396_c1_400_1020 202
481 3300050509 nmdc:mga0qj67_708363_c1 nmdc:mga0qj67_708363_c1_11_658 202
482 3300050510 nmdc:mga06r32_515034_c1 nmdc:mga06r32_515034_c1_179_826 202
483 3300050512 nmdc:mga0n895_298035_c1 nmdc:mga0n895_298035_c1_665_1294 202
484 3300050512 nmdc:mga0n895_380676_c1 nmdc:mga0n895_380676_c1_206_835 202
485 3300050513 nmdc:mga0rr50_242372_c1 nmdc:mga0rr50_242372_c1_609_1238 202
486 3300050514 nmdc:mga08x19_188298_c1 nmdc:mga08x19_188298_c1_365_1030 202
487 3300050514 nmdc:mga08x19_67866_c1 nmdc:mga08x19_67866_c1_946_1575 202
488 3300050515 nmdc:mga0a205_77284_c1 nmdc:mga0a205_77284_c1_2494_3108 202
489 3300053078 Ga0495612_0003688 Ga0495612_0003688_4796_5440 202
490 3300060353 Ga0501082_0090837 Ga0501082_0090837_698_1345 202
491 3300061734 Ga0530510_0295225 Ga0530510_0295225_444_1091 202
492 3300004800 Ga0058861_10036557 Ga0058861_100365571 203
493 3300004803 Ga0058862_10248621 Ga0058862_102486211 203
494 3300005290 Ga0065712_10011524 Ga0065712_100115242 203
495 3300005293 Ga0065715_10276677 Ga0065715_102766772 203
496 3300005295 Ga0065707_10259718 Ga0065707_102597181 203
497 3300005327 Ga0070658_10001935 Ga0070658_1000193515 203
498 3300005328 Ga0070676_10487851 Ga0070676_104878511 203
499 3300005328 Ga0070676_10681715 Ga0070676_106817151 203
500 3300005329 Ga0070683_100242079 Ga0070683_1002420791 203
501 3300005334 Ga0068869_100303592 Ga0068869_1003035922 203
502 3300005335 Ga0070666_10003858 Ga0070666_100038588 203
503 3300005338 Ga0068868_100008417 Ga0068868_1000084172 203
504 3300005338 Ga0068868_100031991 Ga0068868_1000319911 203
505 3300005339 Ga0070660_100029894 Ga0070660_1000298943 203
506 3300005339 Ga0070660_100475487 Ga0070660_1004754872 203
507 3300005340 Ga0070689_100305670 Ga0070689_1003056702 203
508 3300005341 Ga0070691_10099155 Ga0070691_100991552 203
509 3300005341 Ga0070691_10358426 Ga0070691_103584261 203
510 3300005344 Ga0070661_100292901 Ga0070661_1002929011 203
511 3300005345 Ga0070692_10194998 Ga0070692_101949982 203
512 3300005355 Ga0070671_100038666 Ga0070671_1000386664 203
513 3300005356 Ga0070674_100138251 Ga0070674_1001382512 203
514 3300005356 Ga0070674_100570608 Ga0070674_1005706081 203
515 3300005364 Ga0070673_100076822 Ga0070673_1000768224 203
516 3300005366 Ga0070659_100176265 Ga0070659_1001762652 203
517 3300005367 Ga0070667_100178716 Ga0070667_1001787162 203
518 3300005367 Ga0070667_100437577 Ga0070667_1004375771 203
519 3300005434 Ga0070709_10211787 Ga0070709_102117871 203
520 3300005437 Ga0070710_10103941 Ga0070710_101039412 203
521 3300005439 Ga0070711_100580419 Ga0070711_1005804192 203
522 3300005441 Ga0070700_100206395 Ga0070700_1002063951 203
523 3300005444 Ga0070694_100260297 Ga0070694_1002602972 203
524 3300005445 Ga0070708_100003651 Ga0070708_1000036512 203
525 3300005457 Ga0070662_100896278 Ga0070662_1008962781 203
526 3300005458 Ga0070681_10021636 Ga0070681_100216365 203
527 3300005458 Ga0070681_10229101 Ga0070681_102291013 203
528 3300005458 Ga0070681_10461488 Ga0070681_104614882 203
529 3300005459 Ga0068867_100371018 Ga0068867_1003710181 203
530 3300005467 Ga0070706_100000336 Ga0070706_10000033619 203
531 3300005467 Ga0070706_100011620 Ga0070706_1000116202 203
532 3300005468 Ga0070707_100019771 Ga0070707_1000197711 203
533 3300005468 Ga0070707_100075730 Ga0070707_1000757302 203
534 3300005471 Ga0070698_100005969 Ga0070698_10000596913 203
535 3300005471 Ga0070698_100436850 Ga0070698_1004368502 203
536 3300005518 Ga0070699_100116789 Ga0070699_1001167892 203
537 3300005530 Ga0070679_100192381 Ga0070679_1001923812 203
538 3300005530 Ga0070679_100821069 Ga0070679_1008210691 203
539 3300005535 Ga0070684_100216622 Ga0070684_1002166222 203
540 3300005535 Ga0070684_100237953 Ga0070684_1002379533 203
541 3300005536 Ga0070697_100303155 Ga0070697_1003031552 203
542 3300005548 Ga0070665_100010604 Ga0070665_1000106042 203
543 3300005549 Ga0070704_100142667 Ga0070704_1001426672 203
544 3300005563 Ga0068855_100056475 Ga0068855_1000564752 203
545 3300005563 Ga0068855_100069495 Ga0068855_1000694953 203
546 3300005563 Ga0068855_100179856 Ga0068855_1001798563 203
547 3300005577 Ga0068857_100004869 Ga0068857_1000048696 203
548 3300005577 Ga0068857_100630244 Ga0068857_1006302442 203
549 3300005614 Ga0068856_100015026 Ga0068856_1000150262 203
550 3300005614 Ga0068856_100343939 Ga0068856_1003439391 203
551 3300005614 Ga0068856_100415250 Ga0068856_1004152502 203
552 3300005614 Ga0068856_100794215 Ga0068856_1007942152 203
553 3300005617 Ga0068859_100054101 Ga0068859_1000541014 203
554 3300005617 Ga0068859_100057994 Ga0068859_1000579942 203
555 3300005618 Ga0068864_100113454 Ga0068864_1001134542 203
556 3300005718 Ga0068866_10538506 Ga0068866_105385061 203
557 3300005834 Ga0068851_10263551 Ga0068851_102635512 203
558 3300005841 Ga0068863_100209381 Ga0068863_1002093812 203
559 3300005842 Ga0068858_100005875 Ga0068858_1000058759 203
560 3300005842 Ga0068858_100030640 Ga0068858_1000306405 203
561 3300005844 Ga0068862_101074491 Ga0068862_1010744911 203
562 3300005844 Ga0068862_101127237 Ga0068862_1011272371 203
563 3300006028 Ga0070717_10661895 Ga0070717_106618951 203
564 3300006237 Ga0097621_100004631 Ga0097621_1000046314 203
565 3300006237 Ga0097621_100009851 Ga0097621_1000098512 203
566 3300006237 Ga0097621_100016167 Ga0097621_1000161674 203
567 3300006237 Ga0097621_100040561 Ga0097621_1000405612 203
568 3300006358 Ga0068871_100003703 Ga0068871_1000037032 203
569 3300006358 Ga0068871_100014760 Ga0068871_1000147606 203
570 3300006358 Ga0068871_100031326 Ga0068871_1000313262 203
571 3300006358 Ga0068871_100223685 Ga0068871_1002236852 203
572 3300006847 Ga0075431_100021655 Ga0075431_1000216552 203
573 3300006847 Ga0075431_100646080 Ga0075431_1006460802 203
574 3300006852 Ga0075433_10552307 Ga0075433_105523071 203
575 3300006871 Ga0075434_100140467 Ga0075434_1001404672 203
576 3300006880 Ga0075429_100292237 Ga0075429_1002922372 203
577 3300006881 Ga0068865_100005640 Ga0068865_1000056407 203
578 3300006931 Ga0097620_100054103 Ga0097620_1000541034 203
579 3300006931 Ga0097620_100057994 Ga0097620_1000579942 203
580 3300007076 Ga0075435_100226805 Ga0075435_1002268052 203
581 3300009093 Ga0105240_10101427 Ga0105240_101014272 203
582 3300009093 Ga0105240_10142109 Ga0105240_101421091 203
583 3300009093 Ga0105240_10229600 Ga0105240_102296002 203
584 3300009094 Ga0111539_10198586 Ga0111539_101985863 203
585 3300009098 Ga0105245_10004807 Ga0105245_100048072 203
586 3300009098 Ga0105245_10015180 Ga0105245_100151807 203
587 3300009098 Ga0105245_10110472 Ga0105245_101104722 203
588 3300009147 Ga0114129_10005337 Ga0114129_100053379 203
589 3300009147 Ga0114129_11698884 Ga0114129_116988841 203
590 3300009174 Ga0105241_10007930 Ga0105241_100079303 203
591 3300009174 Ga0105241_10071177 Ga0105241_100711772 203
592 3300009174 Ga0105241_10862668 Ga0105241_108626682 203
593 3300009176 Ga0105242_10001360 Ga0105242_100013602 203
594 3300009176 Ga0105242_10020549 Ga0105242_100205495 203
595 3300009176 Ga0105242_10107701 Ga0105242_101077012 203
596 3300009176 Ga0105242_10183038 Ga0105242_101830383 203
597 3300009176 Ga0105242_10770472 Ga0105242_107704722 203
598 3300009177 Ga0105248_10007399 Ga0105248_1000739914 203
599 3300009177 Ga0105248_10014774 Ga0105248_100147742 203
600 3300009177 Ga0105248_10112872 Ga0105248_101128723 203
601 3300009177 Ga0105248_10179687 Ga0105248_101796872 203
602 3300009177 Ga0105248_11092616 Ga0105248_110926161 203
603 3300009545 Ga0105237_10005536 Ga0105237_100055363 203
604 3300009545 Ga0105237_10019805 Ga0105237_100198057 203
605 3300009545 Ga0105237_10506995 Ga0105237_105069951 203
606 3300009551 Ga0105238_10001919 Ga0105238_1000191917 203
607 3300009551 Ga0105238_10004737 Ga0105238_100047375 203
608 3300009551 Ga0105238_10038817 Ga0105238_100388172 203
609 3300009551 Ga0105238_10093868 Ga0105238_100938683 203
610 3300010375 Ga0105239_10074194 Ga0105239_100741942 203
611 3300010375 Ga0105239_10158181 Ga0105239_101581812 203
612 3300011119 Ga0105246_10740334 Ga0105246_107403341 203
613 3300013104 Ga0157370_10034683 Ga0157370_100346833 203
614 3300013296 Ga0157374_10015683 Ga0157374_100156836 203
615 3300013296 Ga0157374_10067662 Ga0157374_100676623 203
616 3300013296 Ga0157374_10142843 Ga0157374_101428433 203
617 3300013297 Ga0157378_10044978 Ga0157378_100449782 203
618 3300013297 Ga0157378_10381251 Ga0157378_103812511 203
619 3300013297 Ga0157378_11844526 Ga0157378_118445261 203
620 3300013306 Ga0163162_10005046 Ga0163162_100050462 203
621 3300013307 Ga0157372_10355799 Ga0157372_103557992 203
622 3300014325 Ga0163163_10003604 Ga0163163_100036042 203
623 3300014325 Ga0163163_10015653 Ga0163163_100156534 203
624 3300014325 Ga0163163_10433870 Ga0163163_104338702 203
625 3300014326 Ga0157380_10030037 Ga0157380_100300372 203
626 3300014326 Ga0157380_10343519 Ga0157380_103435191 203
627 3300014968 Ga0157379_10009128 Ga0157379_100091288 203
628 3300014968 Ga0157379_10133860 Ga0157379_101338603 203
629 3300014969 Ga0157376_10013883 Ga0157376_100138832 203
630 3300014969 Ga0157376_10176084 Ga0157376_101760841 203
631 3300014969 Ga0157376_10393522 Ga0157376_103935221 203
632 3300020069 Ga0197907_11172755 Ga0197907_111727552 203
633 3300020070 Ga0206356_10692860 Ga0206356_106928602 203
634 3300020075 Ga0206349_1753059 Ga0206349_17530591 203
635 3300020076 Ga0206355_1664126 Ga0206355_16641262 203
636 3300020077 Ga0206351_10013904 Ga0206351_100139042 203
637 3300020078 Ga0206352_11289791 Ga0206352_112897911 203
638 3300020080 Ga0206350_11488832 Ga0206350_114888322 203
639 3300022467 Ga0224712_10207188 Ga0224712_102071881 203
640 3300024227 Ga0228598_1002817 Ga0228598_10028172 203
641 3300025900 Ga0207710_10098433 Ga0207710_100984332 203
642 3300025903 Ga0207680_10040696 Ga0207680_100406963 203
643 3300025906 Ga0207699_10260390 Ga0207699_102603902 203
644 3300025907 Ga0207645_10051956 Ga0207645_100519562 203
645 3300025908 Ga0207643_10123254 Ga0207643_101232542 203
646 3300025910 Ga0207684_10000320 Ga0207684_1000032029 203
647 3300025910 Ga0207684_10163597 Ga0207684_101635972 203
648 3300025911 Ga0207654_10011027 Ga0207654_100110272 203
649 3300025911 Ga0207654_10048092 Ga0207654_100480923 203
650 3300025912 Ga0207707_10070345 Ga0207707_100703452 203
651 3300025912 Ga0207707_10176006 Ga0207707_101760062 203
652 3300025912 Ga0207707_10268375 Ga0207707_102683752 203
653 3300025913 Ga0207695_10036539 Ga0207695_100365393 203
654 3300025914 Ga0207671_10025824 Ga0207671_100258242 203
655 3300025914 Ga0207671_10160495 Ga0207671_101604952 203
656 3300025917 Ga0207660_10150531 Ga0207660_101505312 203
657 3300025919 Ga0207657_10000386 Ga0207657_1000038617 203
658 3300025921 Ga0207652_10814602 Ga0207652_108146021 203
659 3300025922 Ga0207646_10100259 Ga0207646_101002592 203
660 3300025923 Ga0207681_10347897 Ga0207681_103478972 203
661 3300025924 Ga0207694_10004655 Ga0207694_100046555 203
662 3300025924 Ga0207694_10115616 Ga0207694_101156162 203
663 3300025927 Ga0207687_10024093 Ga0207687_100240935 203
664 3300025927 Ga0207687_10148704 Ga0207687_101487042 203
665 3300025927 Ga0207687_10279221 Ga0207687_102792211 203
666 3300025928 Ga0207700_10049225 Ga0207700_100492252 203
667 3300025931 Ga0207644_10076117 Ga0207644_100761174 203
668 3300025932 Ga0207690_10140095 Ga0207690_101400953 203
669 3300025934 Ga0207686_10009876 Ga0207686_100098766 203
670 3300025934 Ga0207686_10156132 Ga0207686_101561322 203
671 3300025935 Ga0207709_10027612 Ga0207709_100276121 203
672 3300025937 Ga0207669_10452917 Ga0207669_104529171 203
673 3300025938 Ga0207704_10007997 Ga0207704_100079973 203
674 3300025939 Ga0207665_10299409 Ga0207665_102994092 203
675 3300025941 Ga0207711_10015924 Ga0207711_100159243 203
676 3300025941 Ga0207711_10131330 Ga0207711_101313301 203
677 3300025941 Ga0207711_10207145 Ga0207711_102071452 203
678 3300025941 Ga0207711_10401447 Ga0207711_104014472 203
679 3300025942 Ga0207689_10298462 Ga0207689_102984622 203
680 3300025944 Ga0207661_10088081 Ga0207661_100880812 203
681 3300025972 Ga0207668_10941433 Ga0207668_109414332 203
682 3300025986 Ga0207658_10037531 Ga0207658_100375312 203
683 3300026023 Ga0207677_10024214 Ga0207677_100242143 203
684 3300026023 Ga0207677_10081192 Ga0207677_100811922 203
685 3300026035 Ga0207703_10001790 Ga0207703_100017903 203
686 3300026035 Ga0207703_10014533 Ga0207703_100145334 203
687 3300026041 Ga0207639_10038873 Ga0207639_100388735 203
688 3300026041 Ga0207639_10091787 Ga0207639_100917871 203
689 3300026075 Ga0207708_10077097 Ga0207708_100770972 203
690 3300026075 Ga0207708_10097684 Ga0207708_100976843 203
691 3300026078 Ga0207702_10019362 Ga0207702_100193625 203
692 3300026078 Ga0207702_10669738 Ga0207702_106697382 203
693 3300026078 Ga0207702_10786190 Ga0207702_107861901 203
694 3300026088 Ga0207641_10155964 Ga0207641_101559642 203
695 3300026089 Ga0207648_10030982 Ga0207648_100309827 203
696 3300026095 Ga0207676_10054554 Ga0207676_100545543 203
697 3300026116 Ga0207674_10007441 Ga0207674_1000744111 203
698 3300026116 Ga0207674_10584877 Ga0207674_105848772 203
699 3300027907 Ga0207428_10042299 Ga0207428_100422992 203
700 3300028379 Ga0268266_10010487 Ga0268266_100104876 203
701 3300028381 Ga0268264_10069183 Ga0268264_100691833 203
702 3300030760 Ga0265762_1009046 Ga0265762_10090462 203
703 3300031090 Ga0265760_10009617 Ga0265760_100096172 203
704 3300031344 Ga0265316_10019518 Ga0265316_100195182 203
705 3300031852 Ga0307410_10514380 Ga0307410_105143801 203
706 3300032002 Ga0307416_100704517 Ga0307416_1007045172 203
707 3300032002 Ga0307416_101061173 Ga0307416_1010611732 203
708 3300033547 Ga0316212_1006719 Ga0316212_10067192 203
709 3300035118 Ga0373954_0098267 Ga0373954_0098267_220_849 203
710 3300035121 Ga0373960_0087785 Ga0373960_0087785_333_944 203
711 3300035171 Ga0373946_0050531 Ga0373946_0050531_39_665 203
712 3300035692 Ga0373935_0464150 Ga0373935_0464150_66_713 203
713 3300035695 Ga0373927_0086616 Ga0373927_0086616_792_1418 203
714 3300035725 Ga0373947_0034871 Ga0373947_0034871_815_1441 203
715 3300035725 Ga0373947_0486350 Ga0373947_0486350_178_825 203
716 3300037068 Ga0373925_0009287 Ga0373925_0009287_3783_4409 203
717 3300037068 Ga0373925_0118344 Ga0373925_0118344_1044_1691 203
718 3300037068 Ga0373925_0126759 Ga0373925_0126759_457_1089 203
719 3300037466 Ga0395898_1026711 Ga0395898_1026711_54_701 203
720 3300037853 Ga0436364_0537501 Ga0436364_0537501_114_785 203
721 3300042003 Ga0439443_016035 Ga0439443_016035_465_1079 203
722 3300042437 Ga0439444_0062924 Ga0439444_0062924_29_667 203
723 3300042439 Ga0439464_0033295 Ga0439464_0033295_197_826 203
724 3300046472 Ga0495580_0087729 Ga0495580_0087729_500_1132 203
725 3300046499 Ga0495594_0023384 Ga0495594_0023384_2591_3223 203
726 3300046517 Ga0495630_0557236 Ga0495630_0557236_203_829 203
727 3300046663 Ga0495635_0203767 Ga0495635_0203767_574_1200 203
728 3300047315 Ga0495581_0024597 Ga0495581_0024597_1812_2438 203
729 3300048905 Ga0496102_1045067 Ga0496102_1045067_19_666 203
730 3300048907 Ga0496104_0344773 Ga0496104_0344773_582_1229 203
731 3300048908 Ga0496105_0037794 Ga0496105_0037794_2981_3628 203
732 3300048910 Ga0496107_0720109 Ga0496107_0720109_28_675 203
733 3300048912 Ga0496109_0549313 Ga0496109_0549313_123_749 203
734 3300048915 Ga0496112_0144118 Ga0496112_0144118_161_778 203
735 3300048915 Ga0496112_0159495 Ga0496112_0159495_202_849 203
736 3300048917 Ga0496114_0035011 Ga0496114_0035011_757_1404 203
737 3300048918 Ga0496115_0002823 Ga0496115_0002823_11060_11707 203
738 3300048918 Ga0496115_0118148 Ga0496115_0118148_500_1126 203
739 3300049576 Ga0501040_0128382 Ga0501040_0128382_881_1495 203
740 3300049584 Ga0501068_0504755 Ga0501068_0504755_47_679 203
741 3300049586 Ga0501070_0377852 Ga0501070_0377852_473_1114 203
742 3300049587 Ga0501071_0243516 Ga0501071_0243516_546_1181 203
743 3300049587 Ga0501071_0410564 Ga0501071_0410564_18_650 203
744 3300049587 Ga0501071_0639214 Ga0501071_0639214_182_796 203
745 3300049593 Ga0501077_0060019 Ga0501077_0060019_1326_1940 203
746 3300049593 Ga0501077_0202698 Ga0501077_0202698_527_1162 203
747 3300049742 Ga0501080_0335926 Ga0501080_0335926_109_741 203
748 3300049743 Ga0501081_0131432 Ga0501081_0131432_562_1197 203
749 3300049824 Ga0501045_0641675 Ga0501045_0641675_52_693 203
750 3300050507 nmdc:mga05p37_37637_c1 nmdc:mga05p37_37637_c1_2636_3265 203
751 3300050508 nmdc:mga09592_312434_c1 nmdc:mga09592_312434_c1_372_1001 203
752 3300050509 nmdc:mga0qj67_773867_c1 nmdc:mga0qj67_773867_c1_28_663 203
753 3300050510 nmdc:mga06r32_75596_c1 nmdc:mga06r32_75596_c1_2003_2632 203
754 3300050511 nmdc:mga08y16_22738_c1 nmdc:mga08y16_22738_c1_2888_3523 203
755 3300050511 nmdc:mga08y16_696424_c1 nmdc:mga08y16_696424_c1_310_924 203
756 3300050512 nmdc:mga0n895_1425468_c1 nmdc:mga0n895_1425468_c1_35_649 203
757 3300050512 nmdc:mga0n895_281053_c1 nmdc:mga0n895_281053_c1_180_797 203
758 3300050513 nmdc:mga0rr50_167658_c1 nmdc:mga0rr50_167658_c1_714_1361 203
759 3300050515 nmdc:mga0a205_374386_c1 nmdc:mga0a205_374386_c1_306_920 203
760 3300053085 Ga0495619_0371442 Ga0495619_0371442_256_882 203
761 3300059491 Ga0587070_068515 Ga0587070_068515_52_687 203
762 3300059492 Ga0587073_0032666 Ga0587073_0032666_386_1021 203
763 3300059493 Ga0587077_068126 Ga0587077_068126_36_668 203
764 3300059493 Ga0587077_084522 Ga0587077_084522_66_701 203
765 3300059505 Ga0587083_0047454 Ga0587083_0047454_65_700 203
766 3300059513 Ga0587094_020989 Ga0587094_020989_116_748 203
767 3300059513 Ga0587094_037307 Ga0587094_037307_85_711 203
768 3300059513 Ga0587094_041757 Ga0587094_041757_61_693 203
769 3300059645 Ga0587076_054161 Ga0587076_054161_66_701 203
770 3300059648 Ga0587100_013011 Ga0587100_013011_45_671 203
771 3300059660 Ga0587124_018644 Ga0587124_018644_50_676 203
772 3300060353 Ga0501082_0458990 Ga0501082_0458990_47_688 203
773 3300060353 Ga0501082_0646760 Ga0501082_0646760_108_731 203
774 3300002459 JGI24751J29686_10001715 JGI24751J29686_100017153 204
775 3300002459 JGI24751J29686_10019096 JGI24751J29686_100190962 204
776 3300003163 Ga0006759J45824_1088694 Ga0006759J45824_10886941 204
777 3300003544 Ga0007417J51691_1024758 Ga0007417J51691_10247581 204
778 3300003544 Ga0007417J51691_1064518 Ga0007417J51691_10645181 204
779 3300003574 Ga0007410J51695_1055657 Ga0007410J51695_10556571 204
780 3300003575 Ga0007409J51694_1058321 Ga0007409J51694_10583211 204
781 3300003579 Ga0007429J51699_1059572 Ga0007429J51699_10595721 204
782 3300003579 Ga0007429J51699_1063966 Ga0007429J51699_10639661 204
783 3300004798 Ga0058859_10021908 Ga0058859_100219082 204
784 3300004798 Ga0058859_10031263 Ga0058859_100312631 204
785 3300004798 Ga0058859_10041715 Ga0058859_100417152 204
786 3300004798 Ga0058859_11654266 Ga0058859_116542662 204
787 3300004798 Ga0058859_11762873 Ga0058859_117628731 204
788 3300004801 Ga0058860_10077957 Ga0058860_100779572 204
789 3300005290 Ga0065712_10164863 Ga0065712_101648631 204
790 3300005290 Ga0065712_10241478 Ga0065712_102414782 204
791 3300005295 Ga0065707_10098316 Ga0065707_100983162 204
792 3300005328 Ga0070676_10143445 Ga0070676_101434452 204
793 3300005329 Ga0070683_100275147 Ga0070683_1002751472 204
794 3300005331 Ga0070670_100096802 Ga0070670_1000968022 204
795 3300005331 Ga0070670_100100636 Ga0070670_1001006362 204
796 3300005331 Ga0070670_100133737 Ga0070670_1001337372 204
797 3300005331 Ga0070670_100444992 Ga0070670_1004449922 204
798 3300005333 Ga0070677_10043964 Ga0070677_100439642 204
799 3300005334 Ga0068869_100083205 Ga0068869_1000832052 204
800 3300005335 Ga0070666_10070622 Ga0070666_100706222 204
801 3300005335 Ga0070666_10212844 Ga0070666_102128442 204
802 3300005336 Ga0070680_100327124 Ga0070680_1003271242 204
803 3300005337 Ga0070682_100102395 Ga0070682_1001023952 204
804 3300005339 Ga0070660_100411740 Ga0070660_1004117402 204
805 3300005340 Ga0070689_100047162 Ga0070689_1000471622 204
806 3300005340 Ga0070689_100301646 Ga0070689_1003016462 204
807 3300005343 Ga0070687_100412345 Ga0070687_1004123451 204
808 3300005347 Ga0070668_100576572 Ga0070668_1005765721 204
809 3300005353 Ga0070669_100055815 Ga0070669_1000558151 204
810 3300005353 Ga0070669_100116463 Ga0070669_1001164632 204
811 3300005354 Ga0070675_100000739 Ga0070675_1000007392 204
812 3300005354 Ga0070675_100131357 Ga0070675_1001313572 204
813 3300005354 Ga0070675_100143947 Ga0070675_1001439472 204
814 3300005354 Ga0070675_100324266 Ga0070675_1003242662 204
815 3300005354 Ga0070675_100678412 Ga0070675_1006784121 204
816 3300005356 Ga0070674_100021063 Ga0070674_1000210632 204
817 3300005356 Ga0070674_100042253 Ga0070674_1000422532 204
818 3300005356 Ga0070674_100185401 Ga0070674_1001854012 204
819 3300005356 Ga0070674_100207386 Ga0070674_1002073861 204
820 3300005356 Ga0070674_100526087 Ga0070674_1005260872 204
821 3300005364 Ga0070673_100115118 Ga0070673_1001151181 204
822 3300005364 Ga0070673_100706641 Ga0070673_1007066411 204
823 3300005364 Ga0070673_100929375 Ga0070673_1009293752 204
824 3300005365 Ga0070688_100231008 Ga0070688_1002310081 204
825 3300005365 Ga0070688_100440543 Ga0070688_1004405431 204
826 3300005366 Ga0070659_100028835 Ga0070659_1000288352 204
827 3300005367 Ga0070667_100070263 Ga0070667_1000702631 204
828 3300005367 Ga0070667_100312450 Ga0070667_1003124502 204
829 3300005367 Ga0070667_101003776 Ga0070667_1010037761 204
830 3300005440 Ga0070705_100025568 Ga0070705_1000255682 204
831 3300005440 Ga0070705_100838298 Ga0070705_1008382981 204
832 3300005444 Ga0070694_100168163 Ga0070694_1001681632 204
833 3300005456 Ga0070678_100165960 Ga0070678_1001659602 204
834 3300005456 Ga0070678_100343887 Ga0070678_1003438872 204
835 3300005457 Ga0070662_100520511 Ga0070662_1005205112 204
836 3300005459 Ga0068867_100496998 Ga0068867_1004969981 204
837 3300005468 Ga0070707_100219762 Ga0070707_1002197622 204
838 3300005471 Ga0070698_100053205 Ga0070698_1000532052 204
839 3300005471 Ga0070698_101182344 Ga0070698_1011823441 204
840 3300005535 Ga0070684_100136934 Ga0070684_1001369341 204
841 3300005539 Ga0068853_100145598 Ga0068853_1001455982 204
842 3300005543 Ga0070672_100327674 Ga0070672_1003276741 204
843 3300005544 Ga0070686_100081297 Ga0070686_1000812972 204
844 3300005545 Ga0070695_100550626 Ga0070695_1005506261 204
845 3300005547 Ga0070693_100170205 Ga0070693_1001702052 204
846 3300005548 Ga0070665_100093044 Ga0070665_1000930441 204
847 3300005548 Ga0070665_100674556 Ga0070665_1006745562 204
848 3300005563 Ga0068855_100253212 Ga0068855_1002532122 204
849 3300005563 Ga0068855_100296142 Ga0068855_1002961422 204
850 3300005564 Ga0070664_100289046 Ga0070664_1002890462 204
851 3300005564 Ga0070664_100443036 Ga0070664_1004430361 204
852 3300005564 Ga0070664_100588828 Ga0070664_1005888282 204
853 3300005577 Ga0068857_100024993 Ga0068857_1000249933 204
854 3300005577 Ga0068857_100218410 Ga0068857_1002184102 204
855 3300005614 Ga0068856_100322867 Ga0068856_1003228672 204
856 3300005617 Ga0068859_100217011 Ga0068859_1002170112 204
857 3300005617 Ga0068859_101111204 Ga0068859_1011112042 204
858 3300005618 Ga0068864_100360602 Ga0068864_1003606022 204
859 3300005618 Ga0068864_101378383 Ga0068864_1013783831 204
860 3300005841 Ga0068863_100456329 Ga0068863_1004563292 204
861 3300005841 Ga0068863_100844130 Ga0068863_1008441302 204
862 3300005842 Ga0068858_100001351 Ga0068858_1000013518 204
863 3300005842 Ga0068858_100041052 Ga0068858_1000410526 204
864 3300005842 Ga0068858_100062768 Ga0068858_1000627682 204
865 3300005842 Ga0068858_100829267 Ga0068858_1008292672 204
866 3300005843 Ga0068860_100098272 Ga0068860_1000982722 204
867 3300005843 Ga0068860_100187714 Ga0068860_1001877141 204
868 3300005843 Ga0068860_100263661 Ga0068860_1002636611 204
869 3300005844 Ga0068862_100633500 Ga0068862_1006335002 204
870 3300005844 Ga0068862_101228307 Ga0068862_1012283071 204
871 3300006028 Ga0070717_10789133 Ga0070717_107891331 204
872 3300006173 Ga0070716_100191238 Ga0070716_1001912382 204
873 3300006175 Ga0070712_100458188 Ga0070712_1004581882 204
874 3300006237 Ga0097621_100703468 Ga0097621_1007034682 204
875 3300006358 Ga0068871_100069642 Ga0068871_1000696422 204
876 3300006358 Ga0068871_100262813 Ga0068871_1002628132 204
877 3300006358 Ga0068871_100388514 Ga0068871_1003885142 204
878 3300006844 Ga0075428_100001864 Ga0075428_10000186412 204
879 3300006844 Ga0075428_100046952 Ga0075428_1000469522 204
880 3300006846 Ga0075430_100001987 Ga0075430_10000198710 204
881 3300006846 Ga0075430_100762082 Ga0075430_1007620822 204
882 3300006847 Ga0075431_100002526 Ga0075431_1000025266 204
883 3300006847 Ga0075431_100834282 Ga0075431_1008342822 204
884 3300006847 Ga0075431_100862204 Ga0075431_1008622041 204
885 3300006852 Ga0075433_10064114 Ga0075433_100641144 204
886 3300006852 Ga0075433_10743957 Ga0075433_107439571 204
887 3300006880 Ga0075429_100001764 Ga0075429_10000176410 204
888 3300006931 Ga0097620_100216996 Ga0097620_1002169962 204
889 3300006931 Ga0097620_100657641 Ga0097620_1006576412 204
890 3300006931 Ga0097620_101111243 Ga0097620_1011112432 204
891 3300009094 Ga0111539_10028455 Ga0111539_100284552 204
892 3300009098 Ga0105245_10165092 Ga0105245_101650922 204
893 3300009098 Ga0105245_10453835 Ga0105245_104538352 204
894 3300009101 Ga0105247_10081807 Ga0105247_100818071 204
895 3300009101 Ga0105247_10168935 Ga0105247_101689352 204
896 3300009147 Ga0114129_10050270 Ga0114129_100502706 204
897 3300009147 Ga0114129_10178370 Ga0114129_101783702 204
898 3300009147 Ga0114129_10991711 Ga0114129_109917111 204
899 3300009176 Ga0105242_10421949 Ga0105242_104219492 204
900 3300009177 Ga0105248_10083640 Ga0105248_100836402 204
901 3300009177 Ga0105248_10179053 Ga0105248_101790532 204
902 3300009177 Ga0105248_11028031 Ga0105248_110280311 204
903 3300009551 Ga0105238_10619547 Ga0105238_106195472 204
904 3300009553 Ga0105249_10053613 Ga0105249_100536132 204
905 3300013297 Ga0157378_10907008 Ga0157378_109070082 204
906 3300013306 Ga0163162_10243305 Ga0163162_102433052 204
907 3300013308 Ga0157375_11799490 Ga0157375_117994901 204
908 3300014325 Ga0163163_10012690 Ga0163163_100126902 204
909 3300014325 Ga0163163_10219167 Ga0163163_102191672 204
910 3300014325 Ga0163163_10422188 Ga0163163_104221882 204
911 3300014326 Ga0157380_10168539 Ga0157380_101685392 204
912 3300014326 Ga0157380_10194571 Ga0157380_101945712 204
913 3300014326 Ga0157380_10209000 Ga0157380_102090002 204
914 3300014745 Ga0157377_10069961 Ga0157377_100699612 204
915 3300014968 Ga0157379_10028247 Ga0157379_100282473 204
916 3300014968 Ga0157379_10248078 Ga0157379_102480782 204
917 3300014968 Ga0157379_10413630 Ga0157379_104136302 204
918 3300014969 Ga0157376_10378299 Ga0157376_103782992 204
919 3300017792 Ga0163161_10729832 Ga0163161_107298321 204
920 3300020069 Ga0197907_10251813 Ga0197907_102518131 204
921 3300020070 Ga0206356_11883262 Ga0206356_118832622 204
922 3300020075 Ga0206349_1564724 Ga0206349_15647242 204
923 3300020078 Ga0206352_10544006 Ga0206352_105440062 204
924 3300020082 Ga0206353_10475100 Ga0206353_104751001 204
925 3300022467 Ga0224712_10117674 Ga0224712_101176742 204
926 3300025290 Ga0207673_1016925 Ga0207673_10169251 204
927 3300025315 Ga0207697_10150692 Ga0207697_101506921 204
928 3300025893 Ga0207682_10006285 Ga0207682_100062852 204
929 3300025900 Ga0207710_10019087 Ga0207710_100190873 204
930 3300025900 Ga0207710_10083080 Ga0207710_100830801 204
931 3300025901 Ga0207688_10072011 Ga0207688_100720112 204
932 3300025903 Ga0207680_10086015 Ga0207680_100860152 204
933 3300025903 Ga0207680_10291150 Ga0207680_102911502 204
934 3300025903 Ga0207680_10457385 Ga0207680_104573852 204
935 3300025903 Ga0207680_10628197 Ga0207680_106281971 204
936 3300025905 Ga0207685_10193992 Ga0207685_101939922 204
937 3300025907 Ga0207645_10161521 Ga0207645_101615212 204
938 3300025907 Ga0207645_10476365 Ga0207645_104763652 204
939 3300025912 Ga0207707_10022348 Ga0207707_100223486 204
940 3300025915 Ga0207693_10529541 Ga0207693_105295411 204
941 3300025917 Ga0207660_10054783 Ga0207660_100547832 204
942 3300025918 Ga0207662_10140899 Ga0207662_101408991 204
943 3300025918 Ga0207662_10194591 Ga0207662_101945911 204
944 3300025919 Ga0207657_10101401 Ga0207657_101014013 204
945 3300025919 Ga0207657_10529757 Ga0207657_105297572 204
946 3300025922 Ga0207646_10203286 Ga0207646_102032862 204
947 3300025923 Ga0207681_10185130 Ga0207681_101851302 204
948 3300025923 Ga0207681_10252515 Ga0207681_102525152 204
949 3300025924 Ga0207694_10463620 Ga0207694_104636202 204
950 3300025925 Ga0207650_10130016 Ga0207650_101300162 204
951 3300025925 Ga0207650_10152616 Ga0207650_101526162 204
952 3300025925 Ga0207650_10298109 Ga0207650_102981092 204
953 3300025925 Ga0207650_10325940 Ga0207650_103259402 204
954 3300025926 Ga0207659_10000642 Ga0207659_100006422 204
955 3300025926 Ga0207659_10272297 Ga0207659_102722972 204
956 3300025931 Ga0207644_10154407 Ga0207644_101544072 204
957 3300025933 Ga0207706_10077742 Ga0207706_100777422 204
958 3300025933 Ga0207706_10379760 Ga0207706_103797602 204
959 3300025933 Ga0207706_10877345 Ga0207706_108773451 204
960 3300025934 Ga0207686_10802835 Ga0207686_108028352 204
961 3300025935 Ga0207709_10571983 Ga0207709_105719831 204
962 3300025936 Ga0207670_10437818 Ga0207670_104378181 204
963 3300025937 Ga0207669_10033461 Ga0207669_100334612 204
964 3300025937 Ga0207669_10083316 Ga0207669_100833162 204
965 3300025937 Ga0207669_10125100 Ga0207669_101251001 204
966 3300025937 Ga0207669_10588358 Ga0207669_105883581 204
967 3300025938 Ga0207704_10184611 Ga0207704_101846112 204
968 3300025938 Ga0207704_10307898 Ga0207704_103078982 204
969 3300025939 Ga0207665_10155863 Ga0207665_101558631 204
970 3300025940 Ga0207691_10047180 Ga0207691_100471802 204
971 3300025940 Ga0207691_10309053 Ga0207691_103090532 204
972 3300025941 Ga0207711_10166401 Ga0207711_101664013 204
973 3300025941 Ga0207711_10191235 Ga0207711_101912352 204
974 3300025941 Ga0207711_10221846 Ga0207711_102218462 204
975 3300025941 Ga0207711_10329016 Ga0207711_103290162 204
976 3300025941 Ga0207711_10703336 Ga0207711_107033361 204
977 3300025941 Ga0207711_11100190 Ga0207711_111001901 204
978 3300025942 Ga0207689_10105715 Ga0207689_101057153 204
979 3300025944 Ga0207661_10476152 Ga0207661_104761522 204
980 3300025945 Ga0207679_10765210 Ga0207679_107652101 204
981 3300025945 Ga0207679_10997267 Ga0207679_109972671 204
982 3300025949 Ga0207667_10493349 Ga0207667_104933491 204
983 3300025986 Ga0207658_10790984 Ga0207658_107909842 204
984 3300026035 Ga0207703_10009661 Ga0207703_100096613 204
985 3300026035 Ga0207703_10086076 Ga0207703_100860762 204
986 3300026035 Ga0207703_10801665 Ga0207703_108016652 204
987 3300026041 Ga0207639_10132909 Ga0207639_101329092 204
988 3300026067 Ga0207678_10131308 Ga0207678_101313081 204
989 3300026075 Ga0207708_10762541 Ga0207708_107625411 204
990 3300026089 Ga0207648_10209028 Ga0207648_102090282 204
991 3300026089 Ga0207648_10312881 Ga0207648_103128811 204
992 3300026089 Ga0207648_10492278 Ga0207648_104922781 204
993 3300026095 Ga0207676_10297396 Ga0207676_102973962 204
994 3300026095 Ga0207676_11066960 Ga0207676_110669602 204
995 3300026116 Ga0207674_10151690 Ga0207674_101516902 204
996 3300026118 Ga0207675_100628649 Ga0207675_1006286492 204
997 3300026121 Ga0207683_10038555 Ga0207683_100385552 204
998 3300026121 Ga0207683_10092953 Ga0207683_100929532 204
999 3300027682 Ga0209971_1040676 Ga0209971_10406761 204
1000 3300027876 Ga0209974_10023030 Ga0209974_100230302 204
1001 3300028379 Ga0268266_10053468 Ga0268266_100534682 204
1002 3300028380 Ga0268265_10644291 Ga0268265_106442912 204
1003 3300028381 Ga0268264_10045705 Ga0268264_100457053 204
1004 3300028381 Ga0268264_10301438 Ga0268264_103014382 204
1005 3300028381 Ga0268264_10987778 Ga0268264_109877781 204
1006 3300031731 Ga0307405_10327176 Ga0307405_103271762 204
1007 3300031824 Ga0307413_10691461 Ga0307413_106914611 204
1008 3300031995 Ga0307409_100563940 Ga0307409_1005639401 204
1009 3300032002 Ga0307416_100175283 Ga0307416_1001752832 204
1010 3300032005 Ga0307411_10359331 Ga0307411_103593312 204
1011 3300032126 Ga0307415_100314961 Ga0307415_1003149612 204
1012 3300035117 Ga0373953_0067550 Ga0373953_0067550_92_727 204
1013 3300035170 Ga0373943_0018934 Ga0373943_0018934_136_771 204
1014 3300035171 Ga0373946_0139866 Ga0373946_0139866_450_1085 204
1015 3300035172 Ga0373955_0094184 Ga0373955_0094184_598_1233 204
1016 3300035410 Ga0373924_0031778 Ga0373924_0031778_786_1421 204
1017 3300035410 Ga0373924_0267867 Ga0373924_0267867_70_705 204
1018 3300035691 Ga0373931_0238938 Ga0373931_0238938_154_792 204
1019 3300035695 Ga0373927_0094343 Ga0373927_0094343_394_1029 204
1020 3300035725 Ga0373947_0114280 Ga0373947_0114280_521_1156 204
1021 3300036401 Ga0373937_0150648 Ga0373937_0150648_755_1390 204
1022 3300036401 Ga0373937_0622646 Ga0373937_0622646_344_973 204
1023 3300036401 Ga0373937_0918646 Ga0373937_0918646_40_675 204
1024 3300037068 Ga0373925_0238324 Ga0373925_0238324_122_757 204
1025 3300037068 Ga0373925_0648900 Ga0373925_0648900_97_714 204
1026 3300037068 Ga0373925_0888320 Ga0373925_0888320_62_697 204
1027 3300039450 Ga0436363_0476775 Ga0436363_0476775_51_680 204
1028 3300041408 Ga0439453_0026389 Ga0439453_0026389_21_653 204
1029 3300041458 Ga0451798_0802015 Ga0451798_0802015_260_889 204
1030 3300042118 Ga0450914_015160 Ga0450914_015160_152_784 204
1031 3300042156 Ga0439446_0073101 Ga0439446_0073101_135_773 204
1032 3300042435 Ga0439434_0061610 Ga0439434_0061610_262_879 204
1033 3300042436 Ga0439435_0003653 Ga0439435_0003653_2073_2705 204
1034 3300042461 Ga0439460_0123438 Ga0439460_0123438_138_770 204
1035 3300042530 Ga0450916_001967 Ga0450916_001967_455_1087 204
1036 3300045976 Ga0466967_0906179 Ga0466967_0906179_126_815 204
1037 3300046455 Ga0495603_0121386 Ga0495603_0121386_271_900 204
1038 3300046475 Ga0495639_0133164 Ga0495639_0133164_371_1000 204
1039 3300046477 Ga0495664_0242956 Ga0495664_0242956_122_757 204
1040 3300046511 Ga0495608_0122271 Ga0495608_0122271_333_968 204
1041 3300046525 Ga0495663_0076347 Ga0495663_0076347_41_673 204
1042 3300046642 Ga0495634_0162945 Ga0495634_0162945_62_697 204
1043 3300046664 Ga0495659_0017802 Ga0495659_0017802_1579_2211 204
1044 3300046664 Ga0495659_0282035 Ga0495659_0282035_25_642 204
1045 3300046679 Ga0495623_0267618 Ga0495623_0267618_262_897 204
1046 3300046681 Ga0495647_0141426 Ga0495647_0141426_233_868 204
1047 3300046684 Ga0495669_0249648 Ga0495669_0249648_49_681 204
1048 3300047319 Ga0495674_0361650 Ga0495674_0361650_364_999 204
1049 3300047322 Ga0495680_0499127 Ga0495680_0499127_115_750 204
1050 3300047444 Ga0495675_0313758 Ga0495675_0313758_122_757 204
1051 3300047471 Ga0495684_0471505 Ga0495684_0471505_46_681 204
1052 3300048903 Ga0496100_0896461 Ga0496100_0896461_50_685 204
1053 3300048904 Ga0496101_0709016 Ga0496101_0709016_11_640 204
1054 3300048906 Ga0496103_0315480 Ga0496103_0315480_134_769 204
1055 3300048908 Ga0496105_0131836 Ga0496105_0131836_772_1407 204
1056 3300048909 Ga0496106_0373819 Ga0496106_0373819_243_878 204
1057 3300048910 Ga0496107_0306033 Ga0496107_0306033_259_894 204
1058 3300048912 Ga0496109_0277242 Ga0496109_0277242_565_1200 204
1059 3300048913 Ga0496110_0495011 Ga0496110_0495011_240_869 204
1060 3300048915 Ga0496112_0042758 Ga0496112_0042758_2936_3571 204
1061 3300048917 Ga0496114_0595835 Ga0496114_0595835_83_712 204
1062 3300048918 Ga0496115_0739288 Ga0496115_0739288_78_716 204
1063 3300049568 Ga0501031_0157044 Ga0501031_0157044_579_1196 204
1064 3300049570 Ga0501033_0042890 Ga0501033_0042890_1298_1915 204
1065 3300049571 Ga0501034_0033399 Ga0501034_0033399_1626_2255 204
1066 3300049572 Ga0501036_0166457 Ga0501036_0166457_543_1160 204
1067 3300049572 Ga0501036_0494704 Ga0501036_0494704_284_913 204
1068 3300049575 Ga0501039_0387663 Ga0501039_0387663_229_846 204
1069 3300049578 Ga0501042_0005563 Ga0501042_0005563_1618_2235 204
1070 3300049580 Ga0501046_0302295 Ga0501046_0302295_160_789 204
1071 3300049581 Ga0501047_0116925 Ga0501047_0116925_373_1002 204
1072 3300049582 Ga0501048_0363975 Ga0501048_0363975_207_836 204
1073 3300049586 Ga0501070_0640837 Ga0501070_0640837_167_796 204
1074 3300049587 Ga0501071_0160507 Ga0501071_0160507_682_1299 204
1075 3300049589 Ga0501073_0125693 Ga0501073_0125693_334_963 204
1076 3300049589 Ga0501073_0280179 Ga0501073_0280179_398_1027 204
1077 3300049591 Ga0501075_0050750 Ga0501075_0050750_2244_2876 204
1078 3300049591 Ga0501075_0538919 Ga0501075_0538919_40_678 204
1079 3300049660 Ga0501216_017845 Ga0501216_017845_386_1015 204
1080 3300049744 Ga0501083_0482562 Ga0501083_0482562_15_647 204
1081 3300049822 Ga0501035_0111287 Ga0501035_0111287_1189_1806 204
1082 3300049822 Ga0501035_0190900 Ga0501035_0190900_673_1302 204
1083 3300049823 Ga0501044_0069878 Ga0501044_0069878_2637_3266 204
1084 3300049824 Ga0501045_0004580 Ga0501045_0004580_3895_4512 204
1085 3300050507 nmdc:mga05p37_23464_c2 nmdc:mga05p37_23464_c2_2966_3598 204
1086 3300050507 nmdc:mga05p37_322988_c1 nmdc:mga05p37_322988_c1_646_1278 204
1087 3300050508 nmdc:mga09592_6865_c1 nmdc:mga09592_6865_c1_8601_9233 204
1088 3300050508 nmdc:mga09592_742998_c1 nmdc:mga09592_742998_c1_46_678 204
1089 3300050509 nmdc:mga0qj67_3392_c1 nmdc:mga0qj67_3392_c1_2106_2738 204
1090 3300050510 nmdc:mga06r32_1010212_c1 nmdc:mga06r32_1010212_c1_103_735 204
1091 3300050510 nmdc:mga06r32_1387_c1 nmdc:mga06r32_1387_c1_3658_4290 204
1092 3300050511 nmdc:mga08y16_15899_c1 nmdc:mga08y16_15899_c1_2479_3111 204
1093 3300050511 nmdc:mga08y16_194302_c1 nmdc:mga08y16_194302_c1_346_978 204
1094 3300050512 nmdc:mga0n895_656277_c1 nmdc:mga0n895_656277_c1_402_1031 204
1095 3300050515 nmdc:mga0a205_262413_c1 nmdc:mga0a205_262413_c1_639_1262 204
1096 3300050515 nmdc:mga0a205_471661_c1 nmdc:mga0a205_471661_c1_394_1029 204
1097 3300053077 Ga0495601_0081936 Ga0495601_0081936_1053_1688 204
1098 3300053084 Ga0495595_0051405 Ga0495595_0051405_795_1430 204
1099 3300053085 Ga0495619_0187381 Ga0495619_0187381_681_1316 204
1100 3300054114 Ga0501084_0156628 Ga0501084_0156628_615_1232 204
1101 3300059477 Ga0587084_020219 Ga0587084_020219_92_721 204
1102 3300059490 Ga0587066_012638 Ga0587066_012638_526_1164 204
1103 3300059491 Ga0587070_076926 Ga0587070_076926_51_680 204
1104 3300059504 Ga0587082_031050 Ga0587082_031050_117_746 204
1105 3300059506 Ga0587085_037309 Ga0587085_037309_98_727 204
1106 3300059507 Ga0587086_024307 Ga0587086_024307_194_814 204
1107 3300059508 Ga0587088_052433 Ga0587088_052433_49_684 204
1108 3300059510 Ga0587090_065497 Ga0587090_065497_40_669 204
1109 3300059511 Ga0587091_070847 Ga0587091_070847_92_721 204
1110 3300059511 Ga0587091_092264 Ga0587091_092264_40_669 204
1111 3300059607 Ga0587125_024932 Ga0587125_024932_86_715 204
1112 3300059623 Ga0587101_035568 Ga0587101_035568_115_750 204
1113 3300059627 Ga0587117_013659 Ga0587117_013659_115_750 204
1114 3300059642 Ga0587069_031678 Ga0587069_031678_70_702 204
1115 3300059647 Ga0587079_077500 Ga0587079_077500_97_726 204
1116 3300060344 Ga0587071_092664 Ga0587071_092664_33_662 204
1117 3300060346 Ga0587111_0057509 Ga0587111_0057509_166_795 204
1118 3300060353 Ga0501082_0776756 Ga0501082_0776756_31_660 204
1119 3300061734 Ga0530510_0001309 Ga0530510_0001309_7598_8215 204

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

170

244

0.95

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

102

174

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1n5w-assembly1.cif.gz_D crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.9566 50 204
1ffv-assembly1.cif.gz_A carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.9565 48 202
4zoh-assembly1.cif.gz_C-2 crystal structure of glyceraldehyde oxidoreductase 0.9556 50 201
1rm6-assembly1.cif.gz_C structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica 0.9533 50 204
1ffv-assembly1.cif.gz_A carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.9446 48 202
ID Description Score Start End Superfamily
4zohC02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.952 125 201 1.10.150.120
1sb3C02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9428 125 199 1.10.150.120
1ffuD02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9404 127 201 1.10.150.120
1n60A02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9389 126 204 1.10.150.120
af_Q46801_1_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9314 50 121 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A411YD34-F1-model_v4 (2Fe-2S)-binding protein 0.9665 50 203 GO:0016491
GO:0046872
GO:0051537
AF-A0A1H2JUI1-F1-model_v4 Carbon-monoxide dehydrogenase small subunit 0.9654 50 202 GO:0016491
GO:0046872
GO:0051537
AF-A0A2A4PBP6-F1-model_v4 Carbon monoxide dehydrogenase 0.9651 50 203 GO:0016491
GO:0046872
GO:0051537
AF-A0A7W9ILB0-F1-model_v4 Carbon-monoxide dehydrogenase small subunit (EC 1.2.7.4) 0.9648 50 203 GO:0043885
GO:0046872
GO:0051537
AF-A0A7C7CII0-F1-model_v4 (2Fe-2S)-binding protein 0.9643 50 187 GO:0016491
GO:0046872
GO:0051537

Feature Viewer

pLDDT pTM Quality
80.37 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map