F490376

General Info

Members Datasets Scaffolds Average Seq Length
1119 912 2238 398

Family's Representative Sequence

Representative Sequence 3300050492|nmdc:mga0yw44_24573_c1|nmdc:mga0yw44_24573_c1_598_1992
Length 464
Sequence VKVNVPFPKSEQLRSDPKPRKGNFNRDIKLRFFEWRRLATLWQAPVANGTLAEQRKGGLVMLRRLEDARILMYSHDTFGLGHLRRCRTIAHSLVEDFRGLNVLIISGATIAGAFDYRARVDFVKIPSIIKLRNGEYTSMERHIDLHETLKMRQSIIRHTAETFQPDIFIVDKEPMGLRGEAEETLSYLKARGTTLILGLREVMDAPKLLDAEWKRNDVMRKIGKLYDMIWVYGPRDFYDPLTGLDVPANVRAKMQFVGFLQRSLSKNEEPDHRPKGDYILVTTGGGGDGADLIHSVIHAYQQDPTLTHRALVVLGPYMPAKKRRKLMSKGAGIPFLEMIEFDNRMEELIAGAKAVVAMGGYNTYCEILSFDKPALIVPRVAPRQEQLIRAQRASELGLIEMLLPEQAENAPRFAAALKALPDRAPPSKSNPNLRMQGLGDISQIVETWFDQRTAHYLSVVDGKL

Samples

Sample ID Description Type Environment
1 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
10 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
11 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
19 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
20 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
21 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
24 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
25 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
26 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
51 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
59 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
60 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
69 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
70 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
71 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
72 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
73 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
74 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
75 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
76 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
77 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
78 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
80 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
81 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
82 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
83 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
85 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
86 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
87 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
89 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
91 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
93 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
96 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
111 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
113 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
116 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
117 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
118 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
119 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
120 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
121 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
122 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
123 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
124 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
125 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
126 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
127 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
128 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
129 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
130 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
131 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
132 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
133 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
134 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
135 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
136 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
137 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
138 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
139 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
140 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
141 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
142 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
143 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
144 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
145 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
146 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
147 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
148 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
149 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
150 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
151 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
152 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
153 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
154 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
155 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
156 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
157 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
158 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
164 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
165 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
166 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
167 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
168 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
169 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
170 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
171 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
172 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
173 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
174 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
175 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
176 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
179 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
180 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
181 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
182 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
183 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
184 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
185 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
186 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
187 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
188 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
189 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
190 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
191 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
192 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
193 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
194 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
195 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
196 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
197 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
198 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
199 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
200 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
201 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
202 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
203 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
204 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
205 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
206 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
207 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
208 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
209 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
210 2509276019 Ensifer aridi TW10 Isolate Nodule
211 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
212 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
213 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
214 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
215 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
216 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
217 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
218 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
219 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
220 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
221 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
222 2512875024
223 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
224 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
225 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
226 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
227 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
228 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
229 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
230 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
231 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
232 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
233 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
234 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
235 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
236 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
237 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
238 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
239 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
240 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
241 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
242 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
243 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
244 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
245 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
246 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
247 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
248 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
249 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
250 2516143018 Ensifer sp. BR816 Isolate Nodule
251 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
252 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
253 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
254 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
255 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
256 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
257 2519899620 Rhizobium sp. Pop5 Isolate Nodule
258 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
259 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
260 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
261 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
262 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
263 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
264 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
265 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
266 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
267 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
268 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
269 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
270 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
271 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
272 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
273 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
274 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
275 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
276 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
277 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
278 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
279 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
280 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
281 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
282 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
283 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
284 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
285 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
286 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
287 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
288 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
289 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
290 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
291 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
292 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
293 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
294 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
295 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
296 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
297 2643221557 Ensifer sp. Root558 Isolate Unclassified
298 2643221558 Rhizobium sp. Root149 Isolate Unclassified
299 2643221568 Rhizobium sp. Root564 Isolate Unclassified
300 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
301 2643221599 Rhizobium sp. Root708 Isolate Unclassified
302 2643221607 Rhizobium sp. Root73 Isolate Unclassified
303 2643221610 Ensifer sp. Root74 Isolate Unclassified
304 2643221618 Ensifer sp. Root231 Isolate Unclassified
305 2643221626 Ensifer sp. Root31 Isolate Unclassified
306 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
307 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
308 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
309 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
310 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
311 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
312 2643221655 Ensifer sp. Root1252 Isolate Unclassified
313 2643221659 Ensifer sp. Root127 Isolate Unclassified
314 2643221668 Ensifer sp. Root423 Isolate Unclassified
315 2643221675 Ensifer sp. Root1298 Isolate Unclassified
316 2643221680 Ensifer sp. Root1312 Isolate Unclassified
317 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
318 2643221688 Rhizobium sp. Root482 Isolate Unclassified
319 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
320 2643221693 Rhizobium sp. Root491 Isolate Unclassified
321 2643221712 Ensifer sp. Root258 Isolate Unclassified
322 2643221718 Rhizobium sp. Root268 Isolate Unclassified
323 2643221719 Rhizobium sp. Root274 Isolate Unclassified
324 2643221723 Ensifer sp. Root278 Isolate Unclassified
325 2643221726 Ensifer sp. Root954 Isolate Unclassified
326 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
327 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
328 2718217882 Rhizobium sp. N741 Isolate Nodule
329 2718217927 Rhizobium sp. N324 Isolate Nodule
330 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
331 2718218009 Rhizobium sp. N561 Isolate Nodule
332 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
333 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
334 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
335 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
336 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
337 2718218363 Rhizobium sp. N113 Isolate Nodule
338 2718218365 Rhizobium sp. N731 Isolate Nodule
339 2718218366 Rhizobium sp. N621 Isolate Nodule
340 2718218423 Rhizobium sp. N941 Isolate Nodule
341 2721755514 Rhizobium sp. N6212 Isolate Nodule
342 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
343 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
344 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
345 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
346 2721755809 Rhizobium sp. N541 Isolate Nodule
347 2721755810 Rhizobium sp. N871 Isolate Nodule
348 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
349 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
350 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
351 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
352 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
353 2728369365 Rhizobium sp. N1341 Isolate Nodule
354 2728369397 Rhizobium sp. N1314 Isolate Nodule
355 2738541293 Rhizobium sp. GV031 Isolate Unclassified
356 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
357 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
358 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
359 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
360 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
361 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
362 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
363 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
364 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
365 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
366 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
367 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
368 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
369 2791355256 Rhizobium sp. M10 Isolate Nodule
370 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
371 2791355260 Rhizobium sp. L9 Isolate Nodule
372 2791355261 Rhizobium sp. J15 Isolate Nodule
373 2791355262 Rhizobium sp. M1 Isolate Nodule
374 2791355263 Rhizobium chutanense C5 Isolate Nodule
375 2791355264 Rhizobium sp. S9 Isolate Nodule
376 2791355265 Rhizobium sp. H4 Isolate Nodule
377 2791355266 Rhizobium sp. L43 Isolate Nodule
378 2791355267 Rhizobium sp. L18 Isolate Nodule
379 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
380 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
381 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
382 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
383 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
384 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
385 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
386 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
387 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
388 2802429633 Rhizobium anhuiense J3 Isolate Nodule
389 2802429634 Rhizobium anhuiense S10 Isolate Nodule
390 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
391 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
392 2802429637 Rhizobium anhuiense C15 Isolate Nodule
393 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
394 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
395 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
396 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
397 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
398 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
399 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
400 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
401 2838048938 Rhizobium pisi 27/80 Isolate Nodule
402 2838061910 Rhizobium phaseoli L15 Isolate Nodule
403 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
404 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
405 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
406 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
407 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
408 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
409 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
410 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
411 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
412 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
413 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
414 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
415 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
416 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
417 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
418 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
419 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
420 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
421 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
422 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
423 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
424 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
425 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
426 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
427 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
428 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
429 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
430 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
431 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
432 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
433 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
434 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
435 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
436 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
437 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
438 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
439 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
440 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
441 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
442 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
443 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
444 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
445 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
446 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
447 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
448 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
449 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
450 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
451 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
452 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
453 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
454 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
455 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
456 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
457 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
458 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
459 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
460 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
461 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
462 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
463 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
464 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
465 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
466 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
467 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
468 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
469 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
470 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
471 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
472 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
473 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
474 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
475 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
476 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
477 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
478 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
479 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
480 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
481 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
482 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
483 2844163670 Ensifer sp. 1H6 Isolate Unclassified
484 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
485 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
486 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
487 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
488 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
489 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
490 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
491 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
492 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
493 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
494 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
495 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
496 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
497 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
498 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
499 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
500 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
501 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
502 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
503 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
504 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
505 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
506 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
507 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
508 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
509 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
510 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
511 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
512 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
513 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
514 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
515 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
516 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
517 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
518 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
519 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
520 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
521 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
522 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
523 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
524 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
525 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
526 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
527 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
528 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
529 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
530 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
531 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
532 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
533 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
534 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
535 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
536 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
537 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
538 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
539 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
540 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
541 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
542 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
543 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
544 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
545 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
546 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
547 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
548 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
549 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
550 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
551 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
552 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
553 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
554 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
555 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
556 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
557 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
558 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
559 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
560 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
561 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
562 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
563 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
564 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
565 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
566 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
567 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
568 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
569 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
570 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
571 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
572 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
573 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
574 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
575 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
576 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
577 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
578 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
579 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
580 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
581 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
582 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
583 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
584 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
585 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
586 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
587 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
588 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
589 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
590 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
591 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
592 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
593 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
594 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
595 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
596 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
597 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
598 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
599 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
600 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
601 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
602 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
603 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
604 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
605 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
606 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
607 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
608 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
609 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
610 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
611 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
612 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
613 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
614 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
615 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
616 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
617 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
618 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
619 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
620 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
621 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
622 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
623 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
624 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
625 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
626 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
627 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
628 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
629 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
630 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
631 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
632 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
633 2933599457 Rhizobium phaseoli M3 Isolate Nodule
634 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
635 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
636 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
637 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
638 2936381700 Rhizobium chutanense C16 Isolate Unclassified
639 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
640 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
641 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
642 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
643 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
644 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
645 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
646 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
647 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
648 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
649 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
650 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
651 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
652 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
653 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
654 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
655 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
656 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
657 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
658 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
659 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
660 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
661 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
662 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
663 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
664 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
665 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
666 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
667 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
668 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
669 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
670 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
671 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
672 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
673 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
674 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
675 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
676 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
677 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
678 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
679 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
680 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
681 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
682 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
683 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
684 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
685 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
686 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
687 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
688 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
689 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
690 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
691 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
692 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
693 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
694 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
695 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
696 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
697 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
698 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
699 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
700 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
701 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
702 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
703 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
704 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
705 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
706 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
707 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
708 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
709 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
710 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
711 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
712 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
713 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
714 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
715 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
716 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
717 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
718 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
719 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
720 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
721 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
722 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
723 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
724 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
725 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
726 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
727 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
728 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
729 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
730 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
731 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
732 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
733 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
734 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
735 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
736 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
737 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
738 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
739 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
740 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
741 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
742 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
743 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
744 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
745 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
746 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
747 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
748 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
749 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
750 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
751 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
752 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
753 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
754 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
755 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
756 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
757 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
758 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
759 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
760 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
761 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
762 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
763 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
764 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
765 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
766 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
767 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
768 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
769 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
770 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
771 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
772 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
773 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
774 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
775 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
776 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
777 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
778 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
779 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
780 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
781 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
782 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
783 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
784 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
785 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
786 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
787 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
788 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
789 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
790 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
791 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
792 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
793 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
794 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
795 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
796 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
797 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
798 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
799 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
800 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
801 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
802 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
803 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
804 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
805 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
806 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
807 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
808 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
809 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
810 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
811 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
812 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
813 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
814 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
815 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
816 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
817 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
818 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
819 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
820 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
821 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
822 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
823 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
824 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
825 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
826 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
827 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
828 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
829 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
830 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
831 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
832 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
833 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
834 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
835 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
836 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
837 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
838 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
839 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
840 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
841 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
842 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
843 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
844 2996887358 Rhizobium sp. R711 Isolate Nodule
845 2996893221 Rhizobium sp. R635 Isolate Nodule
846 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
847 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
848 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
849 3004167301 Mesorhizobium loti 582 Isolate Unclassified
850 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
851 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
852 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
853 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
854 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
855 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
856 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
857 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
858 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
859 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
860 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
861 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
862 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
863 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
864 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
865 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
866 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
867 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
868 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
869 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
870 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
871 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
872 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
873 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
874 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
875 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
876 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
877 8005258706 Rhizobium sp. R693 Isolate Nodule
878 8005275841 Rhizobium sp. N4311 Isolate Nodule
879 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
880 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
881 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
882 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
883 8005321885 Rhizobium sp. R72 Isolate Nodule
884 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
885 8005382845 Rhizobium sp. R634 Isolate Nodule
886 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
887 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
888 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
889 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
890 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
891 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
892 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
893 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
894 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
895 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
896 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
897 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
898 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
899 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
900 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
901 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
902 8018176218 Rhizobium sp. N122 Isolate Nodule
903 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
904 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
905 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
906 8024501048 Rhizobium sp. H4 Isolate Nodule
907 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
908 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
909 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
910 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
911 8056382006 Rhizobium croatiense 13T Isolate Nodule
912 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 36.82
Metatranscriptomes 0
Isolates 63.18

Biome Distribution

Category Percentage (%)
Aerial Root 0.45
Bulb 0
Endosphere 15.55
Nodule 51.47
Rhizoplane 1.97
Rhizosphere 15.37
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0yw44_24573_c1 3300050492 Bacteria 3412
2 JGI24740J21852_10000443 3300001979 Bacteria 17700
3 JGI25155J39150_1000020 3300002704 Bacteria 152963
4 JGI25156J39149_1000021 3300002705 Bacteria 152968
5 JGI25162J39368_1001310 3300002737 Bacteria 13993
6 JGI25162J39368_1001352 3300002737 Bacteria 13572
7 JGI25162J39368_1001559 3300002737 Bacteria 11743
8 JGI25154J39366_1000039 3300002738 Bacteria 152972
9 JGI25158J39367_1000021 3300002739 Bacteria 39295
10 JGI25158J39367_1003597 3300002739 Bacteria 2378
11 JGI25157J39369_1000019 3300002741 Bacteria 176591
12 JGI25152J39213_1001590 3300002773 Bacteria 9530
13 JGI25152J39213_1002259 3300002773 Bacteria 7440
14 JGI25152J39213_1015384 3300002773 Bacteria 1511
15 JGI25152J39213_1015385 3300002773 Bacteria 1511
16 JGI25150J39212_1000022 3300002774 Bacteria 131963
17 JGI25150J39212_1001979 3300002774 Bacteria 5367
18 JGI25159J45721_1000037 3300002987 Bacteria 76090
19 JGI25159J45721_1000355 3300002987 Bacteria 21217
20 JGI25159J45721_1000423 3300002987 Bacteria 19499
21 JGI25151J46595_10000023 3300003187 Bacteria 221548
22 JGI25151J46595_10000274 3300003187 Bacteria 59318
23 JGI25151J46595_10006048 3300003187 Bacteria 6158
24 JGI25151J46595_10025607 3300003187 Bacteria 2397
25 JGI25151J46595_10040456 3300003187 Bacteria 1706
26 JGI25406J46586_10004119 3300003203 Bacteria 6787
27 JGI25165J46597_1000018 3300003214 Bacteria 374701
28 JGI25165J46597_1000407 3300003214 Bacteria 45582
29 JGI25153J46596_10002677 3300003215 Bacteria 10172
30 JGI25153J46596_10038349 3300003215 Bacteria 1511
31 JGI25153J46596_10038350 3300003215 Bacteria 1511
32 rootH2_10051486 3300003320 Bacteria 8910
33 rootL2_10024477 3300003322 Bacteria 14815
34 rootH1_10019293 3300003323 Bacteria 14409
35 JGI25160J50197_1000014 3300003354 Bacteria 259862
36 JGI25160J50197_1000113 3300003354 Bacteria 76090
37 JGI25160J50197_1003169 3300003354 Bacteria 7467
38 JGI25160J50197_1008334 3300003354 Bacteria 3956
39 JGI25161J50226_1000022 3300003374 Bacteria 158544
40 JGI25161J50226_1000025 3300003374 Bacteria 148471
41 JGI25161J50226_1001063 3300003374 Bacteria 9391
42 JGI25161J50226_1003751 3300003374 Bacteria 3372
43 Ga0055526_1003560 3300003771 Bacteria 9809
44 Ga0055526_1004633 3300003771 Bacteria 8187
45 Ga0055526_1011807 3300003771 Bacteria 3881
46 Ga0055526_1018430 3300003771 Bacteria 2604
47 Ga0055524_1000809 3300003775 Bacteria 20756
48 Ga0055524_1002252 3300003775 Bacteria 10093
49 Ga0055524_1002377 3300003775 Bacteria 9761
50 Ga0055524_1002795 3300003775 Bacteria 8762
51 Ga0055524_1014125 3300003775 Bacteria 2975
52 Ga0055528_1002240 3300003790 Bacteria 10534
53 Ga0055528_1003248 3300003790 Bacteria 8290
54 Ga0055528_1021841 3300003790 Bacteria 2014
55 Ga0055540_1000379 3300003792 Bacteria 37172
56 Ga0055540_1016517 3300003792 Bacteria 2098
57 Ga0058692_1001787 3300003856 Bacteria 7612
58 Ga0055543_1000005 3300004625 Bacteria 223621
59 Ga0055543_1000381 3300004625 Bacteria 28994
60 Ga0055543_1000817 3300004625 Bacteria 15293
61 Ga0065165_1000347 3300005262 Bacteria 75788
62 Ga0065165_1002002 3300005262 Bacteria 19097
63 Ga0065165_1002159 3300005262 Bacteria 17794
64 Ga0065165_1003353 3300005262 Bacteria 11384
65 Ga0065165_1011043 3300005262 Bacteria 3821
66 Ga0065165_1023268 3300005262 Bacteria 2104
67 Ga0070670_100000196 3300005331 Bacteria 56006
68 Ga0070668_100019030 3300005347 Bacteria 5161
69 Ga0070668_100042323 3300005347 Bacteria 3491
70 Ga0070669_100072607 3300005353 Bacteria 2548
71 Ga0070674_100144571 3300005356 Bacteria 1789
72 Ga0070667_100263878 3300005367 Bacteria 1543
73 Ga0070707_100126638 3300005468 Bacteria 2482
74 Ga0070699_100051187 3300005518 Bacteria 3575
75 Ga0070665_100002391 3300005548 Bacteria 20704
76 Ga0070665_100016171 3300005548 Bacteria 7487
77 Ga0070665_100112513 3300005548 Bacteria 2725
78 Ga0070665_100129080 3300005548 Bacteria 2530
79 Ga0070665_100312353 3300005548 Bacteria 1576
80 Ga0068857_100337479 3300005577 Bacteria 1394
81 Ga0068854_100046058 3300005578 Bacteria 3104
82 Ga0068856_100002393 3300005614 Bacteria 19294
83 Ga0081540_1040794 3300005983 Bacteria 2414
84 Ga0081539_10000646 3300005985 Bacteria 70179
85 Ga0075365_10002073 3300006038 Bacteria 9568
86 Ga0075365_10004110 3300006038 Bacteria 7650
87 Ga0075365_10044195 3300006038 Bacteria 2918
88 Ga0075365_10069904 3300006038 Bacteria 2360
89 Ga0075365_10111042 3300006038 Bacteria 1884
90 Ga0075364_10022777 3300006051 Bacteria 3961
91 Ga0075362_10000288 3300006177 Bacteria 14229
92 Ga0075362_10077039 3300006177 Bacteria 1531
93 Ga0075367_10000352 3300006178 Bacteria 16461
94 Ga0075367_10003994 3300006178 Bacteria 7127
95 Ga0075367_10081998 3300006178 Bacteria 1952
96 Ga0075367_10118254 3300006178 Bacteria 1631
97 Ga0075369_10010335 3300006186 Bacteria 3648
98 Ga0075369_10034297 3300006186 Bacteria 2153
99 Ga0075369_10039727 3300006186 Bacteria 2010
100 Ga0075369_10058194 3300006186 Bacteria 1683
101 Ga0075366_10001721 3300006195 Bacteria 10998
102 Ga0075366_10102839 3300006195 Bacteria 1715
103 Ga0075370_10015245 3300006353 Bacteria 4110
104 Ga0075370_10058681 3300006353 Bacteria 2189
105 Ga0075431_100036440 3300006847 Bacteria 5066
106 Ga0075429_100103600 3300006880 Bacteria 2485
107 Ga0079104_1000082 3300006946 Bacteria 137722
108 Ga0105251_10033076 3300009011 Bacteria 2571
109 Ga0105240_10000012 3300009093 Bacteria 496639
110 Ga0114129_10004566 3300009147 Bacteria 19536
111 Ga0114129_10353966 3300009147 Bacteria 1944
112 Ga0105243_10049327 3300009148 Bacteria 3321
113 Ga0105243_10108221 3300009148 Bacteria 2320
114 Ga0105248_10185998 3300009177 Bacteria 2341
115 Ga0105237_10000165 3300009545 Bacteria 93713
116 Ga0105237_10018970 3300009545 Bacteria 7107
117 Ga0105249_10142513 3300009553 Bacteria 2299
118 Ga0123340_1051603 3300009763 Bacteria 1468
119 Ga0123341_1039486 3300009765 Bacteria 3120
120 Ga0123342_1011252 3300009766 Bacteria 9867
121 Ga0105239_10000471 3300010375 Bacteria 58946
122 Ga0157373_10005480 3300013100 Bacteria 9527
123 Ga0157373_10038303 3300013100 Bacteria 3437
124 Ga0157371_10000195 3300013102 Bacteria 89727
125 Ga0157371_10019115 3300013102 Bacteria 5058
126 Ga0157370_10007276 3300013104 Bacteria 12079
127 Ga0157369_10055775 3300013105 Bacteria 4265
128 Ga0171463_1010 3300013249 Bacteria 269975
129 Ga0157374_10135163 3300013296 Bacteria 2390
130 Ga0182007_10001911 3300015262 Bacteria 10817
131 Ga0182005_1004906 3300015265 Bacteria 4243
132 Ga0183363_1207 3300015690 Bacteria 11952
133 Ga0214544_1000419 3300021320 Bacteria 76083
134 Ga0214542_1000027 3300021321 Bacteria 175107
135 Ga0214542_1019286 3300021321 Bacteria 5427
136 Ga0214543_1000005 3300021327 Bacteria 454523
137 Ga0214543_1000047 3300021327 Bacteria 150894
138 Ga0228711_1016254 3300022739 Bacteria 7822
139 Ga0228710_1003061 3300022740 Bacteria 26649
140 Ga0209435_100025 3300025206 Bacteria 198776
141 Ga0209436_100044 3300025208 Bacteria 70547
142 Ga0209436_100745 3300025208 Bacteria 13511
143 Ga0209672_103402 3300025228 Bacteria 3310
144 Ga0209437_100022 3300025233 Bacteria 625694
145 Ga0209437_100040 3300025233 Bacteria 448096
146 Ga0207425_1000038 3300025245 Bacteria 221600
147 Ga0207425_1001594 3300025245 Bacteria 9200
148 Ga0207425_1002210 3300025245 Bacteria 7066
149 Ga0209646_1000083 3300025246 Bacteria 198777
150 Ga0209646_1009483 3300025246 Bacteria 1543
151 Ga0209026_1000078 3300025250 Bacteria 198777
152 Ga0209677_101094 3300025253 Bacteria 12743
153 Ga0209759_1000060 3300025256 Bacteria 198777
154 Ga0209129_1000016 3300025258 Bacteria 485491
155 Ga0209129_1000036 3300025258 Bacteria 328331
156 Ga0209129_1001000 3300025258 Bacteria 16849
157 Ga0209129_1001274 3300025258 Bacteria 14398
158 Ga0209129_1009534 3300025258 Bacteria 2542
159 Ga0209129_1009539 3300025258 Bacteria 2542
160 Ga0209233_1000031 3300025261 Bacteria 624646
161 Ga0209233_1000051 3300025261 Bacteria 447617
162 Ga0209233_1000146 3300025261 Bacteria 187269
163 Ga0209673_1000005 3300025273 Bacteria 692788
164 Ga0209673_1000212 3300025273 Bacteria 116031
165 Ga0209673_1014367 3300025273 Bacteria 3066
166 Ga0209673_1019093 3300025273 Bacteria 2472
167 Ga0209130_1000001 3300025284 Bacteria 831557
168 Ga0209130_1000013 3300025284 Bacteria 412810
169 Ga0209130_1000074 3300025284 Bacteria 173309
170 Ga0209675_1016281 3300025291 Bacteria 2172
171 Ga0209025_1000108 3300025294 Bacteria 221600
172 Ga0209025_1000300 3300025294 Bacteria 110956
173 Ga0209025_1000593 3300025294 Bacteria 65364
174 Ga0209025_1001193 3300025294 Bacteria 36685
175 Ga0209025_1007795 3300025294 Bacteria 7876
176 Ga0209025_1010251 3300025294 Bacteria 6376
177 Ga0209025_1020001 3300025294 Bacteria 3686
178 Ga0209025_1036173 3300025294 Bacteria 2216
179 Ga0209564_1000329 3300025295 Bacteria 92271
180 Ga0209564_1000402 3300025295 Bacteria 76964
181 Ga0209564_1002621 3300025295 Bacteria 13754
182 Ga0209564_1004961 3300025295 Bacteria 7852
183 Ga0209758_1000053 3300025297 Bacteria 337751
184 Ga0209758_1000104 3300025297 Bacteria 221600
185 Ga0209758_1001035 3300025297 Bacteria 36412
186 Ga0209758_1002176 3300025297 Bacteria 20599
187 Ga0209758_1009270 3300025297 Bacteria 6158
188 Ga0209758_1025304 3300025297 Bacteria 2609
189 Ga0209050_1012725 3300025298 Bacteria 3824
190 Ga0209256_1000164 3300025299 Bacteria 135612
191 Ga0209256_1000582 3300025299 Bacteria 51562
192 Ga0209256_1001320 3300025299 Bacteria 26507
193 Ga0209256_1001362 3300025299 Bacteria 25721
194 Ga0209256_1015871 3300025299 Bacteria 2607
195 Ga0207426_1000005 3300025302 Bacteria 1037188
196 Ga0207426_1000022 3300025302 Bacteria 547377
197 Ga0207426_1000035 3300025302 Bacteria 448327
198 Ga0207426_1000165 3300025302 Bacteria 170244
199 Ga0207426_1003594 3300025302 Bacteria 8234
200 Ga0209051_1000249 3300025303 Bacteria 90988
201 Ga0209051_1001577 3300025303 Bacteria 18793
202 Ga0209051_1002800 3300025303 Bacteria 12034
203 Ga0209051_1007255 3300025303 Bacteria 6093
204 Ga0209051_1012514 3300025303 Bacteria 4099
205 Ga0209051_1033815 3300025303 Bacteria 1926
206 Ga0209257_1002528 3300025304 Bacteria 17936
207 Ga0209257_1005406 3300025304 Bacteria 8985
208 Ga0207695_10000120 3300025913 Bacteria 234247
209 Ga0207695_10204920 3300025913 Bacteria 1885
210 Ga0207671_10000513 3300025914 Bacteria 52462
211 Ga0207650_10001547 3300025925 Bacteria 16467
212 Ga0207706_10163371 3300025933 Bacteria 1957
213 Ga0207667_10078680 3300025949 Bacteria 3417
214 Ga0207712_10138573 3300025961 Bacteria 1864
215 Ga0207640_10076312 3300025981 Bacteria 2274
216 Ga0207658_10042524 3300025986 Bacteria 3297
217 Ga0207678_10105108 3300026067 Bacteria 2409
218 Ga0207702_10004200 3300026078 Bacteria 12873
219 Ga0207674_10213513 3300026116 Bacteria 1878
220 Ga0207683_10128631 3300026121 Bacteria 2277
221 Ga0209281_1000043 3300027111 Bacteria 341543
222 Ga0209281_1000087 3300027111 Bacteria 246142
223 Ga0209281_1000226 3300027111 Bacteria 119980
224 Ga0209371_1000037 3300027312 Bacteria 367074
225 Ga0209371_1000687 3300027312 Bacteria 29000
226 Ga0209282_1000008 3300027666 Bacteria 248526
227 Ga0209813_10000676 3300027866 Bacteria 7806
228 Ga0268266_10002894 3300028379 Bacteria 17796
229 Ga0268266_10021611 3300028379 Bacteria 5482
230 Ga0268266_10033187 3300028379 Bacteria 4390
231 Ga0307515_10000017 3300028794 Bacteria 550465
232 Ga0307515_10002600 3300028794 Bacteria 38893
233 Ga0307515_10016021 3300028794 Bacteria 13759
234 Ga0307515_10038197 3300028794 Bacteria 7690
235 Ga0268256_1000039 3300030500 Bacteria 354969
236 Ga0307513_10000717 3300031456 Bacteria 47556
237 Ga0307408_100025562 3300031548 Bacteria 4046
238 Ga0307406_10177699 3300031901 Bacteria 1547
239 Ga0307406_10230622 3300031901 Bacteria 1382
240 Ga0307412_10015715 3300031911 Bacteria 4493
241 Ga0315914_1000305 3300031967 Bacteria 55880
242 Ga0315913_1000064 3300033430 Bacteria 55884
243 Ga0315915_1000009 3300033464 Bacteria 252178
244 Ga0395905_0000328 3300037471 Bacteria 68234
245 Ga0395905_0011883 3300037471 Bacteria 8403
246 Ga0436364_0821647 3300037853 Bacteria 1822
247 Ga0439438_013761 3300041405 Bacteria 2429
248 Ga0439465_0007929 3300041413 Bacteria 3363
249 Ga0439465_0024274 3300041413 Bacteria 1910
250 Ga0439465_0024686 3300041413 Bacteria 1895
251 Ga0439465_0029020 3300041413 Bacteria 1757
252 Ga0439449_0005519 3300042007 Bacteria 4842
253 Ga0450920_002612 3300042122 Bacteria 3076
254 Ga0450910_001377 3300042147 Bacteria 3050
255 Ga0466963_0021163 3300044694 Bacteria 4099
256 Ga0466970_0003638 3300044765 Bacteria 7517
257 Ga0466959_0042555 3300045049 Bacteria 3350
258 Ga0495617_032064 3300046452 Bacteria 1764
259 Ga0495638_0000269 3300046460 Bacteria 70117
260 Ga0495638_0013192 3300046460 Bacteria 5637
261 Ga0495638_0042009 3300046460 Bacteria 2890
262 Ga0495605_0000841 3300046474 Bacteria 21499
263 Ga0495585_0004462 3300046492 Bacteria 9073
264 Ga0495585_0022616 3300046492 Bacteria 3609
265 Ga0495583_0011222 3300046506 Bacteria 5159
266 Ga0495610_0004590 3300046512 Bacteria 10131
267 Ga0495610_0039899 3300046512 Bacteria 2370
268 Ga0495610_0044818 3300046512 Bacteria 2193
269 Ga0495610_0048815 3300046512 Bacteria 2076
270 Ga0495610_0069825 3300046512 Bacteria 1643
271 Ga0495616_0046021 3300046513 Bacteria 2205
272 Ga0495616_0067417 3300046513 Bacteria 1740
273 Ga0495632_0007168 3300046519 Bacteria 7050
274 Ga0495632_0015129 3300046519 Bacteria 4338
275 Ga0495643_0001376 3300046522 Bacteria 22761
276 Ga0495643_0009597 3300046522 Bacteria 6002
277 Ga0495643_0033863 3300046522 Bacteria 2822
278 Ga0495654_0000305 3300046530 Bacteria 43461
279 Ga0495668_0011738 3300046616 Bacteria 5230
280 Ga0495611_0005071 3300046648 Bacteria 5647
281 Ga0495625_0003375 3300046660 Bacteria 16014
282 Ga0495625_0036637 3300046660 Bacteria 3604
283 Ga0495625_0115084 3300046660 Bacteria 1835
284 Ga0495625_0210662 3300046660 Bacteria 1278
285 Ga0495588_0000601 3300046674 Bacteria 16960
286 Ga0495588_0022710 3300046674 Bacteria 3102
287 Ga0495588_0110619 3300046674 Bacteria 1447
288 Ga0495670_0010698 3300046691 Bacteria 4511
289 Ga0495671_0038874 3300046692 Bacteria 2404
290 Ga0495600_0006330 3300046809 Bacteria 7197
291 Ga0495660_0035613 3300046810 Bacteria 2780
292 Ga0495672_0025631 3300047320 Bacteria 3769
293 Ga0495687_016218 3300047443 Bacteria 3752
294 Ga0495687_026215 3300047443 Bacteria 2748
295 Ga0495686_0033103 3300047472 Bacteria 3340
296 Ga0495686_0047552 3300047472 Bacteria 2708
297 Ga0495686_0052416 3300047472 Bacteria 2558
298 Ga0495686_0124392 3300047472 Bacteria 1534
299 Ga0496100_0095042 3300048903 Bacteria 2042
300 Ga0496102_0075309 3300048905 Bacteria 3103
301 Ga0496102_0111255 3300048905 Bacteria 2553
302 Ga0496103_0052532 3300048906 Bacteria 2524
303 Ga0496106_0000269 3300048909 Bacteria 36744
304 Ga0496106_0093331 3300048909 Bacteria 2326
305 Ga0496109_0210223 3300048912 Bacteria 1830
306 Ga0496110_0038763 3300048913 Bacteria 4148
307 Ga0496111_0011505 3300048914 Bacteria 5964
308 Ga0496111_0068754 3300048914 Bacteria 2575
309 Ga0496112_0046773 3300048915 Bacteria 4245
310 Ga0496113_0104794 3300048916 Bacteria 2195
311 Ga0496116_0000380 3300048919 Bacteria 65998
312 Ga0496116_0006551 3300048919 Bacteria 10548
313 Ga0496116_0009943 3300048919 Bacteria 8038
314 Ga0496116_0019646 3300048919 Bacteria 5164
315 Ga0496116_0036476 3300048919 Bacteria 3440
316 Ga0496116_0050617 3300048919 Bacteria 2766
317 Ga0496117_0000031 3300048920 Bacteria 381048
318 Ga0496117_0004480 3300048920 Bacteria 15367
319 Ga0496117_0006651 3300048920 Bacteria 11588
320 Ga0496117_0009144 3300048920 Bacteria 9289
321 Ga0496118_0000976 3300048921 Bacteria 44594
322 Ga0496118_0008203 3300048921 Bacteria 10854
323 Ga0496118_0008775 3300048921 Bacteria 10365
324 Ga0496119_0006855 3300048922 Bacteria 10423
325 Ga0496119_0026207 3300048922 Bacteria 4047
326 Ga0496120_0000583 3300048923 Bacteria 55408
327 Ga0496120_0005272 3300048923 Bacteria 10380
328 Ga0496120_0026171 3300048923 Bacteria 3607
329 Ga0496120_0048346 3300048923 Bacteria 2448
330 Ga0496121_0000034 3300048924 Bacteria 377095
331 Ga0496121_0006426 3300048924 Bacteria 14598
332 Ga0496121_0022949 3300048924 Bacteria 6029
333 Ga0496121_0034063 3300048924 Bacteria 4592
334 Ga0496121_0053008 3300048924 Bacteria 3400
335 Ga0496121_0055453 3300048924 Bacteria 3302
336 Ga0496121_0061575 3300048924 Bacteria 3078
337 Ga0496121_0155287 3300048924 Bacteria 1679
338 Ga0496122_0000009 3300048925 Bacteria 584024
339 Ga0496122_0000023 3300048925 Bacteria 381035
340 Ga0496122_0005813 3300048925 Bacteria 14501
341 Ga0496122_0027288 3300048925 Bacteria 4886
342 Ga0496122_0057834 3300048925 Bacteria 2875
343 Ga0496123_0000020 3300048926 Bacteria 388748
344 Ga0496123_0000447 3300048926 Bacteria 73878
345 Ga0496123_0006666 3300048926 Bacteria 11127
346 Ga0496123_0018123 3300048926 Bacteria 5623
347 Ga0496123_0029539 3300048926 Bacteria 4032
348 Ga0496123_0058464 3300048926 Bacteria 2500
349 Ga0496123_0078430 3300048926 Bacteria 2023
350 Ga0496124_0000130 3300048927 Bacteria 156467
351 Ga0496124_0000153 3300048927 Bacteria 139859
352 Ga0496124_0010057 3300048927 Bacteria 9649
353 Ga0496124_0039158 3300048927 Bacteria 4111
354 Ga0496124_0089052 3300048927 Bacteria 2521
355 Ga0496124_0199999 3300048927 Bacteria 1520
356 Ga0496124_0257388 3300048927 Bacteria 1287
357 Ga0496125_0000030 3300048928 Bacteria 375023
358 Ga0496125_0013088 3300048928 Bacteria 8181
359 Ga0496125_0050072 3300048928 Bacteria 3463
360 Ga0496125_0213046 3300048928 Bacteria 1253
361 Ga0496126_0000293 3300048929 Bacteria 106340
362 Ga0496126_0190505 3300048929 Bacteria 1737
363 Ga0495678_048241 3300049459 Bacteria 1662
364 Ga0501037_0041257 3300049573 Bacteria 3394
365 Ga0501046_0054503 3300049580 Bacteria 3145
366 Ga0501075_0048275 3300049591 Bacteria 3199
367 Ga0501076_0034899 3300049592 Bacteria 3934
368 Ga0501079_0045237 3300049741 Bacteria 3397
369 Ga0501081_0101507 3300049743 Bacteria 2034
370 Ga0501280_002037 3300049776 Bacteria 3504
371 Ga0501044_0056227 3300049823 Bacteria 4039
372 nmdc:mga03683_39394_c1 3300050489 Bacteria 1935
373 nmdc:mga03683_50363_c1 3300050489 Bacteria 1736
374 nmdc:mga00v17_139_c1 3300050491 Bacteria 42380
375 nmdc:mga00v17_16703_c1 3300050491 Bacteria 4140
376 nmdc:mga00v17_182_c1 3300050491 Bacteria 37460
377 nmdc:mga0yw44_2775_c1 3300050492 Bacteria 7586
378 nmdc:mga0yw44_59038_c1 3300050492 Bacteria 2346
379 nmdc:mga0yw44_6862_c1 3300050492 Bacteria 5542
380 nmdc:mga0yw44_70824_c1 3300050492 Bacteria 2163
381 nmdc:mga0k408_27132_c1 3300050493 Bacteria 3251
382 nmdc:mga06z11_29666_c1 3300050494 Bacteria 2637
383 nmdc:mga06z11_5567_c1 3300050494 Bacteria 5067
384 nmdc:mga04h51_642_c1 3300050495 Bacteria 8181
385 nmdc:mga07m45_6954_c1 3300050496 Bacteria 5753
386 nmdc:mga05p37_12520_c1 3300050507 Bacteria 10127
387 nmdc:mga05p37_31508_c1 3300050507 Bacteria 6476
388 nmdc:mga06r32_41556_c1 3300050510 Bacteria 4370
389 nmdc:mga0n895_48319_c1 3300050512 Bacteria 4164
390 nmdc:mga0sz30_195_c1 3300050516 Bacteria 22607
391 nmdc:mga0sz30_39036_c1 3300050516 Bacteria 1991
392 nmdc:mga0sz30_67939_c1 3300050516 Bacteria 1531
393 nmdc:mga0sz30_6882_c1 3300050516 Bacteria 4245
394 Ga0500644_0001795 3300053088 Bacteria 5546
395 Ga0500560_000096 3300053107 Bacteria 8849
396 Ga0500618_000357 3300053125 Bacteria 31733
397 Ga0500618_000850 3300053125 Bacteria 16412
398 Ga0500618_004421 3300053125 Bacteria 4512
399 Ga0500618_027798 3300053125 Bacteria 1343
400 Ga0500658_0002006 3300053134 Bacteria 7953
401 Ga0500561_0003308 3300053137 Bacteria 2808
402 Ga0500568_0000086 3300053139 Bacteria 90828
403 Ga0500568_0004546 3300053139 Bacteria 7399
404 Ga0500573_0000205 3300053140 Bacteria 24278
405 Ga0500590_005688 3300053148 Bacteria 6014
406 Ga0500604_0030694 3300053151 Bacteria 1573
407 Ga0500616_0001636 3300053153 Bacteria 20744
408 Ga0500620_000216 3300053155 Bacteria 11437
409 Ga0500622_0000375 3300053156 Bacteria 43118
410 Ga0501084_0004530 3300054114 Bacteria 11363
411 Ga0501082_0082484 3300060353 Bacteria 2774
412 Ga0501082_0121497 3300060353 Bacteria 2264
413 2509109918 2508501122 Bacteria 6292184
414 2509144579 2508501127 Bacteria 7037543
415 2509377093 2509276019 Bacteria 6802256
416 2509385824 2509276021 Bacteria 7634384
417 2509448117 2509276033 Bacteria 7180565
418 2510136803 2510065019 Bacteria 6903379
419 2510305873 2510065057 Bacteria 6649661
420 2510899916 2510461076 Bacteria 8618824
421 2510900512 2510461076 Bacteria 8618824
422 2511184181 2510917028 Bacteria 6185411
423 2511198358 2510917030 Bacteria 7460662
424 2511388380 2511231027 Bacteria 5013807
425 2511498159 2511231052 Bacteria 6974333
426 2512529316 2512047086 Bacteria 6850303
427 2512932763 2512875016 Bacteria 6529530
428 2512961088 2512875024 Bacteria 7195110
429 2512969471 2512875026 Bacteria 6861065
430 2513569785 2513237084 Bacteria 7231967
431 2513576641 2513237085 Bacteria 7695351
432 2513587795 2513237086 Bacteria 7265287
433 2513595701 2513237088 Bacteria 6927906
434 2513606374 2513237089 Bacteria 6553624
435 2513618171 2513237091 Bacteria 6900273
436 2513631688 2513237093 Bacteria 7545552
437 2513713383 2513237103 Bacteria 7647401
438 2513866436 2513237138 Bacteria 7368160
439 2513885111 2513237140 Bacteria 7076289
440 2513905613 2513237143 Bacteria 6664116
441 2513911640 2513237144 Bacteria 7530820
442 2513927736 2513237146 Bacteria 7166346
443 2513986063 2513237156 Bacteria 6402557
444 2513997453 2513237159 Bacteria 6810126
445 2514008086 2513237160 Bacteria 6650282
446 2514021377 2513237162 Bacteria 7468464
447 2514038998 2513237164 Bacteria 7563725
448 2514417244 2513237305 Bacteria 7293571
449 2514592779 2513237351 Bacteria 6968952
450 2515115388 2515075009 Bacteria 7288508
451 2515610713 2515154107 Bacteria 6795637
452 2515636117 2515154113 Bacteria 7807172
453 2515644726 2515154114 Bacteria 7848616
454 2515658022 2515154116 Bacteria 7552979
455 2515742239 2515154134 Bacteria 7220242
456 2516206669 2516143018 Bacteria 6951533
457 2516896197 2516653046 Bacteria 6989037
458 2517041611 2516653077 Bacteria 7555578
459 2517080794 2516653085 Bacteria 7346596
460 2517099079 2517093000 Bacteria 7412387
461 2517410694 2517287029 Bacteria 6905599
462 2517565649 2517487022 Bacteria 7227575
463 2520380653 2519899620 Bacteria 6499161
464 2524449631 2524023207 Bacteria 6813453
465 2530644887 2529292951 Bacteria 6916614
466 2535519947 2534681796 Bacteria 7146037
467 2551674800 2551306084 Bacteria 8942552
468 2551685014 2551306085 Bacteria 7347181
469 2551703038 2551306087 Bacteria 7351905
470 2551710268 2551306089 Bacteria 7162724
471 2551722280 2551306090 Bacteria 7953713
472 2551724249 2551306091 Bacteria 7086830
473 2551731702 2551306092 Bacteria 6992595
474 2551745023 2551306093 Bacteria 7064773
475 2554248754 2554235003 Bacteria 5877155
476 2558862384 2558860100 Bacteria 8458965
477 2559295842 2558860242 Bacteria 5568029
478 2561467963 2558860983 Bacteria 4133860
479 2585167692 2582581283 Bacteria 6030556
480 2585202836 2582581294 Bacteria 6626667
481 2585221707 2582581298 Bacteria 7315509
482 2585228115 2582581299 Bacteria 6518058
483 2585255412 2582581304 Bacteria 5831370
484 2585265950 2582581306 Bacteria 6450535
485 2585390141 2582581865 Bacteria 6644329
486 2585395296 2582581866 Bacteria 6859583
487 2585401203 2582581867 Bacteria 7184437
488 2585524474 2585427526 Bacteria 7258840
489 2585539075 2585427528 Bacteria 6842387
490 2585544123 2585427529 Bacteria 7395659
491 2585821648 2585427590 Bacteria 6824633
492 2585837025 2585427593 Bacteria 7141551
493 2585842535 2585427594 Bacteria 6180594
494 2599332177 2599185156 Bacteria 5403036
495 2599416833 2599185170 Bacteria 7295545
496 2599718649 2599185236 Bacteria 6875203
497 2599939452 2599185301 Bacteria 6161860
498 2600197714 2599185352 Bacteria 7228948
499 2600374954 2600254933 Bacteria 4750527
500 2601610727 2600255279 Bacteria 5605316
501 2601747501 2600255308 Bacteria 5611129
502 2616295071 2615840624 Bacteria 6557588
503 2643809008 2643221557 Bacteria 7184309
504 2643814393 2643221558 Bacteria 5460675
505 2643854982 2643221568 Bacteria 5187270
506 2643987860 2643221595 Bacteria 6565519
507 2644006772 2643221599 Bacteria 6292121
508 2644052186 2643221607 Bacteria 6314006
509 2644069147 2643221610 Bacteria 7480339
510 2644104784 2643221618 Bacteria 7717186
511 2644151215 2643221626 Bacteria 8069654
512 2644154197 2643221627 Bacteria 6761570
513 2644191681 2643221634 Bacteria 6705461
514 2644204980 2643221636 Bacteria 6583769
515 2644208589 2643221637 Bacteria 5345260
516 2644241148 2643221643 Bacteria 5749658
517 2644298262 2643221653 Bacteria 4569637
518 2644313203 2643221655 Bacteria 7722067
519 2644336289 2643221659 Bacteria 7890716
520 2644378601 2643221668 Bacteria 7306521
521 2644420218 2643221675 Bacteria 7473456
522 2644453625 2643221680 Bacteria 7473610
523 2644484929 2643221686 Bacteria 6310811
524 2644494123 2643221688 Bacteria 5260751
525 2644500518 2643221689 Bacteria 6042950
526 2644521420 2643221693 Bacteria 5513853
527 2644612826 2643221712 Bacteria 7729434
528 2644652119 2643221718 Bacteria 5345506
529 2644656514 2643221719 Bacteria 4568197
530 2644674282 2643221723 Bacteria 7095460
531 2644692324 2643221726 Bacteria 7455827
532 2657684312 2657244999 Bacteria 5946535
533 2692318591 2690316117 Bacteria 6800650
534 2719183542 2718217882 Bacteria 6556348
535 2719388290 2718217927 Bacteria 6972593
536 2719667908 2718217997 Bacteria 6740740
537 2719727983 2718218009 Bacteria 6478651
538 2720494671 2718218199 Bacteria 6740745
539 2720611006 2718218232 Bacteria 6720332
540 2720616174 2718218233 Bacteria 6662049
541 2720629255 2718218235 Bacteria 6630699
542 2720771827 2718218269 Bacteria 6906114
543 2721144844 2718218363 Bacteria 6524337
544 2721155583 2718218365 Bacteria 6274507
545 2721166931 2718218366 Bacteria 6425255
546 2721402913 2718218423 Bacteria 6438183
547 2722837909 2721755514 Bacteria 6424414
548 2723029230 2721755556 Bacteria 6745503
549 2723562864 2721755684 Bacteria 6859907
550 2723570854 2721755685 Bacteria 6704835
551 2723573922 2721755686 Bacteria 7343952
552 2724035270 2721755809 Bacteria 6438790
553 2724042177 2721755810 Bacteria 6479005
554 2724086647 2721755819 Bacteria 6906405
555 2724106805 2721755822 Bacteria 6726041
556 2724107605 2721755823 Bacteria 6752556
557 2725951981 2724679232 Bacteria 7646494
558 2730105544 2728369352 Bacteria 6745171
559 2730161682 2728369365 Bacteria 6555560
560 2730300690 2728369397 Bacteria 6274511
561 2738801771 2738541293 Bacteria 7065685
562 2739033533 2738541333 Bacteria 7106503
563 2753463501 2751185821 Bacteria 6189929
564 2765466951 2765235802 Bacteria 5618596
565 2766068672 2765235942 Bacteria 7445910
566 2770197147 2767802442 Bacteria 5747986
567 2776267649 2775506902 Bacteria 6208009
568 2776910393 2775507049 Bacteria 6284736
569 2792581076 2791355082 Bacteria 5973319
570 2792619545 2791355091 Bacteria 6135441
571 2792627316 2791355092 Bacteria 6248105
572 2792639786 2791355094 Bacteria 7011481
573 2792747431 2791355123 Bacteria 8049106
574 2793283411 2791355253 Bacteria 5171699
575 2793296579 2791355256 Bacteria 6798008
576 2793314887 2791355259 Bacteria 7254731
577 2793321538 2791355260 Bacteria 6598818
578 2793325912 2791355261 Bacteria 6661293
579 2793332919 2791355262 Bacteria 6774204
580 2793340285 2791355263 Bacteria 6872478
581 2793346017 2791355264 Bacteria 6429314
582 2793355240 2791355265 Bacteria 6539969
583 2793357940 2791355266 Bacteria 7116587
584 2793366700 2791355267 Bacteria 7222458
585 2802721307 2802428858 Bacteria 6636079
586 2802728249 2802428859 Bacteria 6667919
587 2802733935 2802428860 Bacteria 6525526
588 2802740671 2802428861 Bacteria 6534206
589 2802746928 2802428862 Bacteria 6633353
590 2802748683 2802428863 Bacteria 6410669
591 2804754718 2802429268 Bacteria 6094027
592 2805927919 2802429605 Bacteria 6875453
593 2805933765 2802429606 Bacteria 6346811
594 2806044970 2802429633 Bacteria 7341974
595 2806053871 2802429634 Bacteria 7083200
596 2806060037 2802429635 Bacteria 7650140
597 2806065909 2802429636 Bacteria 7597525
598 2806075439 2802429637 Bacteria 7067217
599 2808988334 2808606387 Bacteria 5697198
600 2819560852 2818991439 Bacteria 6907412
601 2819684427 2818991461 Bacteria 7026071
602 2821123202 2821123053 Bacteria 7836056
603 2838019326 2838016132 Bacteria 6577831
604 2838024862 2838022645 Bacteria 6494267
605 2838036946 2838035591 Bacteria 7166484
606 2838046476 2838042994 Bacteria 6046894
607 2838050392 2838048938 Bacteria 6044578
608 2838063095 2838061910 Bacteria 6794874
609 2838071662 2838068647 Bacteria 6208656
610 2838077660 2838074704 Bacteria 6785777
611 2838662016 2838661181 Bacteria 7385261
612 2838673723 2838668709 Bacteria 6671819
613 2838678785 2838675328 Bacteria 4909118
614 2838684250 2838680041 Bacteria 6545511
615 2838692237 2838686498 Bacteria 7807632
616 2838699741 2838694306 Bacteria 6853137
617 2838705243 2838701080 Bacteria 6669771
618 2838711974 2838707686 Bacteria 6619912
619 2838718126 2838714209 Bacteria 5525906
620 2838723082 2838719591 Bacteria 5523910
621 2838728193 2838724970 Bacteria 4908691
622 2838734540 2838729681 Bacteria 7400765
623 2838739775 2838736955 Bacteria 5760694
624 2838747722 2838742623 Bacteria 7396178
625 2839997204 2839993093 Bacteria 5512535
626 2840764568 2840764183 Bacteria 6358399
627 2841735527 2841734538 Bacteria 6784580
628 2841844101 2841840854 Bacteria 5761912
629 2841850640 2841846520 Bacteria 5345850
630 2841853487 2841851746 Bacteria 7532261
631 2841863107 2841859092 Bacteria 5436171
632 2841869128 2841864319 Bacteria 6742987
633 2842081716 2842077413 Bacteria 6508645
634 2842114585 2842110456 Bacteria 7656360
635 2842122293 2842118031 Bacteria 7033875
636 2842128850 2842124991 Bacteria 5346824
637 2842133677 2842130223 Bacteria 4909145
638 2842143822 2842140634 Bacteria 5759631
639 2842150266 2842146304 Bacteria 5957337
640 2842155411 2842152218 Bacteria 4908957
641 2842161430 2842156927 Bacteria 6894975
642 2842167366 2842163707 Bacteria 6916235
643 2842174632 2842170452 Bacteria 5525737
644 2842179291 2842175837 Bacteria 4908771
645 2842186383 2842180545 Bacteria 6888678
646 2842190550 2842187318 Bacteria 5524014
647 2842195087 2842192696 Bacteria 6147454
648 2842201947 2842198810 Bacteria 6608673
649 2842210496 2842205361 Bacteria 6340321
650 2842215126 2842211629 Bacteria 5523832
651 2842223621 2842217011 Bacteria 7497767
652 2842227847 2842224351 Bacteria 5524473
653 2842235293 2842229732 Bacteria 7475766
654 2842241386 2842237096 Bacteria 6620661
655 2842246360 2842243621 Bacteria 7421798
656 2842254952 2842250916 Bacteria 6579627
657 2842260779 2842257432 Bacteria 7401195
658 2842267856 2842264693 Bacteria 6472963
659 2842276070 2842271015 Bacteria 7807131
660 2842283950 2842278818 Bacteria 6340002
661 2842289831 2842285085 Bacteria 6011953
662 2842295372 2842291075 Bacteria 7076806
663 2842310570 2842304105 Bacteria 7023636
664 2842311939 2842311132 Bacteria 6616990
665 2842319271 2842317721 Bacteria 6793725
666 2842343861 2842341865 Bacteria 7003929
667 2842368236 2842363717 Bacteria 6844742
668 2842375916 2842370503 Bacteria 7038661
669 2842381852 2842377471 Bacteria 7140707
670 2842388841 2842384541 Bacteria 7057858
671 2842396727 2842395702 Bacteria 6780583
672 2842407028 2842402390 Bacteria 6681310
673 2842413921 2842409023 Bacteria 6687331
674 2842420562 2842415677 Bacteria 6596907
675 2842425295 2842422224 Bacteria 6239196
676 2842432019 2842428310 Bacteria 6767288
677 2842438131 2842434925 Bacteria 6502746
678 2842443827 2842441272 Bacteria 6769273
679 2842449910 2842447887 Bacteria 6754142
680 2842466117 2842462802 Bacteria 6588055
681 2842472899 2842469257 Bacteria 6752936
682 2842491717 2842489311 Bacteria 6620893
683 2842502063 2842495871 Bacteria 6820686
684 2842520155 2842515876 Bacteria 5436280
685 2842522306 2842521101 Bacteria 6569494
686 2842875512 2842871566 Bacteria 4827117
687 2842924533 2842922631 Bacteria 5824079
688 2844016186 2844009547 Bacteria 6728125
689 2844169665 2844163670 Bacteria 7266046
690 2844461354 2844454524 Bacteria 7952546
691 2847422910 2847417321 Bacteria 6913799
692 2847674753 2847670302 Bacteria 6165597
693 2847691260 2847686936 Bacteria 6278406
694 2848997685 2848992105 Bacteria 6810864
695 2850085231 2850079185 Bacteria 6848280
696 2855828978 2855825444 Bacteria 6785811
697 2855844095 2855839649 Bacteria 7135830
698 2855872592 2855872281 Bacteria 6964271
699 2856317361 2856314179 Bacteria 6477897
700 2856326843 2856320880 Bacteria 7263508
701 2856348154 2856342000 Bacteria 7176905
702 2856350268 2856349417 Bacteria 6230045
703 2856358117 2856356410 Bacteria 6297484
704 2856367076 2856364286 Bacteria 6939991
705 2857351363 2857349434 Bacteria 7926032
706 2857522288 2857516855 Bacteria 7787325
707 2857533846 2857531043 Bacteria 6754041
708 2858806655 2858800743 Bacteria 6603254
709 2869166612 2869162929 Bacteria 6399702
710 2869235792 2869234852 Bacteria 6654993
711 2869259288 2869256925 Bacteria 6981691
712 2869283606 2869278585 Bacteria 7077053
713 2869287388 2869285874 Bacteria 6901219
714 2871430480 2871429161 Bacteria 6547891
715 2871443689 2871435913 Bacteria 6880295
716 2871450528 2871444079 Bacteria 6423508
717 2871476239 2871474448 Bacteria 6806570
718 2871492438 2871488783 Bacteria 6929816
719 2871501953 2871495908 Bacteria 6935695
720 2874104315 2874102143 Bacteria 6342645
721 2874112981 2874109183 Bacteria 6517025
722 2874124725 2874123672 Bacteria 7238285
723 2874143698 2874139085 Bacteria 7021506
724 2874148967 2874146452 Bacteria 7533118
725 2874155972 2874155637 Bacteria 6724144
726 2874172246 2874168670 Bacteria 8062617
727 2876364986 2876363079 Bacteria 6544991
728 2876393815 2876392853 Bacteria 6660880
729 2876415538 2876413966 Bacteria 6831344
730 2878038399 2878035449 Bacteria 6555736
731 2878736631 2878730984 Bacteria 6380721
732 2878738963 2878738818 Bacteria 7136951
733 2878746912 2878745973 Bacteria 6867388
734 2878758319 2878753008 Bacteria 6922523
735 2878765810 2878760144 Bacteria 6823465
736 2878772484 2878767105 Bacteria 6898628
737 2878793948 2878788777 Bacteria 6567085
738 2881154778 2881147464 Bacteria 7779814
739 2881161558 2881155292 Bacteria 6461656
740 2881163737 2881161766 Bacteria 7127907
741 2881846315 2881845957 Bacteria 6611900
742 2881854654 2881853255 Bacteria 6698367
743 2881868124 2881861095 Bacteria 7128710
744 2882637639 2882632389 Bacteria 8154593
745 2882913825 2882912400 Bacteria 6801539
746 2885306045 2885305155 Bacteria 7348390
747 2885315481 2885312484 Bacteria 6415165
748 2885324581 2885318864 Bacteria 6729568
749 2885333166 2885326080 Bacteria 7134805
750 2885338048 2885334103 Bacteria 7216818
751 2885343872 2885342637 Bacteria 7011821
752 2885357779 2885350715 Bacteria 6787678
753 2888338902 2888337043 Bacteria 6629336
754 2888344574 2888343758 Bacteria 6611049
755 2888354964 2888350351 Bacteria 7372807
756 2889018389 2889016732 Bacteria 6700763
757 2896388731 2896384573 Bacteria 7700774
758 2899795208 2899792073 Bacteria 4926588
759 2899808701 2899803654 Bacteria 5577784
760 2899848232 2899845264 Bacteria 5672268
761 2903449993 2903448605 Bacteria 7357801
762 2903496831 2903492973 Bacteria 13473544
763 2903504386 2903492973 Bacteria 13473544
764 2903522279 2903521522 Bacteria 6525694
765 2903528657 2903528002 Bacteria 6586099
766 2903546756 2903540706 Bacteria 7062119
767 2904583501 2904578770 Bacteria 5302906
768 2904660540 2904659560 Bacteria 6685615
769 2906309930 2906308376 Bacteria 6841989
770 2906322361 2906321335 Bacteria 6579571
771 2906330548 2906328253 Bacteria 6585166
772 2906360644 2906354277 Bacteria 6991324
773 2906417426 2906414383 Bacteria 6580790
774 2913296799 2913295892 Bacteria 6333755
775 2915984503 2915980308 Bacteria 6624279
776 2915991394 2915986958 Bacteria 6739310
777 2915998352 2915993759 Bacteria 7016183
778 2916001628 2916000859 Bacteria 6865702
779 2916009785 2916007675 Bacteria 6898660
780 2916016694 2916014648 Bacteria 6946486
781 2916024275 2916021584 Bacteria 6854472
782 2916030382 2916028427 Bacteria 6748433
783 2916039464 2916035215 Bacteria 6755766
784 2916047575 2916041962 Bacteria 6820487
785 2916049706 2916048683 Bacteria 6543552
786 2916060941 2916055098 Bacteria 6758838
787 2916063055 2916061851 Bacteria 6737736
788 2916071780 2916068649 Bacteria 6943657
789 2916081318 2916076590 Bacteria 6596108
790 2919103340 2919100787 Bacteria 7710546
791 2919118617 2919114240 Bacteria 5700270
792 2919124578 2919119836 Bacteria 5208557
793 2919170683 2919166419 Bacteria 4952238
794 2920765092 2920760137 Bacteria 7427611
795 2920826735 2920822456 Bacteria 6897201
796 2921206965 2921201388 Bacteria 6926299
797 2921213459 2921208531 Bacteria 6745326
798 2921238190 2921237296 Bacteria 6876710
799 2921248854 2921244191 Bacteria 6568419
800 2921254789 2921250672 Bacteria 6677771
801 2921261447 2921257292 Bacteria 6808382
802 2921269044 2921263974 Bacteria 6864552
803 2921288971 2921282425 Bacteria 6826397
804 2921295590 2921289301 Bacteria 7316391
805 2921303513 2921296804 Bacteria 7176999
806 2922131923 2922130491 Bacteria 7173936
807 2922159851 2922158528 Bacteria 6573167
808 2923556646 2923556063 Bacteria 6793593
809 2924145089 2924144063 Bacteria 6883928
810 2924156844 2924150972 Bacteria 7169444
811 2924162162 2924158325 Bacteria 7188855
812 2924170015 2924165586 Bacteria 7260590
813 2924173800 2924172951 Bacteria 6749356
814 2924180672 2924179722 Bacteria 6843264
815 2924192281 2924186466 Bacteria 6876637
816 2924196210 2924193448 Bacteria 6955718
817 2924203713 2924200457 Bacteria 6757188
818 2924209614 2924207177 Bacteria 6917007
819 2924214619 2924214083 Bacteria 7080103
820 2924226602 2924221636 Bacteria 7113495
821 2924231301 2924228884 Bacteria 6633132
822 2924716258 2924710171 Bacteria 6752351
823 2924722478 2924718760 Bacteria 6331356
824 2924730370 2924726620 Bacteria 6271473
825 2924739930 2924733363 Bacteria 7574837
826 2924757530 2924754689 Bacteria 6774424
827 2924768481 2924762789 Bacteria 6561353
828 2924776325 2924776078 Bacteria 7492003
829 2924784415 2924784321 Bacteria 7416538
830 2926755146 2926754445 Bacteria 5964435
831 2926762306 2926760298 Bacteria 5505990
832 2928525898 2928521798 Bacteria 4960112
833 2929141765 2929138655 Bacteria 5810547
834 2933010739 2933006813 Bacteria 4912075
835 2933015585 2933011516 Bacteria 5439334
836 2933021346 2933016740 Bacteria 6355406
837 2933577007 2933570622 Bacteria 7023390
838 2933590559 2933586486 Bacteria 7667493
839 2933597673 2933594066 Bacteria 5594265
840 2933602458 2933599457 Bacteria 5858799
841 2935898409 2935894831 Bacteria 6620579
842 2935906850 2935901341 Bacteria 7341747
843 2936370494 2936367885 Bacteria 7324495
844 2936378154 2936375103 Bacteria 6652732
845 2936385426 2936381700 Bacteria 7006523
846 2937002301 2936996657 Bacteria 6298727
847 2937003597 2937002841 Bacteria 6934057
848 2937012109 2937009748 Bacteria 6746052
849 2937017442 2937016420 Bacteria 6782579
850 2937024951 2937023124 Bacteria 6815156
851 2937033269 2937029754 Bacteria 6424026
852 2937040619 2937036028 Bacteria 6846469
853 2937043611 2937042894 Bacteria 6741576
854 2937050765 2937049772 Bacteria 6757901
855 2937058229 2937056579 Bacteria 7107896
856 2937064711 2937063883 Bacteria 7199456
857 2937074336 2937071275 Bacteria 6984483
858 2937082721 2937078374 Bacteria 6610289
859 2937086696 2937084907 Bacteria 6618516
860 2937097569 2937091812 Bacteria 6979387
861 2937102433 2937098957 Bacteria 7249374
862 2937111070 2937106411 Bacteria 6947143
863 2937114784 2937113482 Bacteria 6505872
864 2937122897 2937119839 Bacteria 6597547
865 2937126924 2937126314 Bacteria 6771275
866 2937815127 2937813078 Bacteria 7783518
867 2937823465 2937822353 Bacteria 7290551
868 2937842341 2937836603 Bacteria 6811263
869 2937851111 2937848649 Bacteria 6983481
870 2937884217 2937877337 Bacteria 7246526
871 2937896256 2937891427 Bacteria 6357007
872 2937979680 2937972304 Bacteria 7532020
873 2938000615 2937994558 Bacteria 7036190
874 2941504420 2941499720 Bacteria 7599444
875 2954012016 2954011201 Bacteria 4762601
876 2957379165 2957375807 Bacteria 6425588
877 2957383248 2957382221 Bacteria 6737050
878 2957390545 2957388812 Bacteria 6778072
879 2957399410 2957395598 Bacteria 6822399
880 2957403518 2957402308 Bacteria 6741770
881 2957411307 2957408893 Bacteria 6558585
882 2957417777 2957415311 Bacteria 6991633
883 2957422778 2957422303 Bacteria 7172205
884 2957432646 2957430029 Bacteria 7022557
885 2957442899 2957437181 Bacteria 6568994
886 2957445141 2957443900 Bacteria 6869977
887 2957452553 2957450854 Bacteria 6765715
888 2957458817 2957457609 Bacteria 6967680
889 2957466813 2957464669 Bacteria 6568877
890 2957472654 2957471148 Bacteria 6797643
891 2957484204 2957478035 Bacteria 6756658
892 2957490317 2957484790 Bacteria 6703082
893 2957495500 2957491536 Bacteria 6695180
894 2957500815 2957498199 Bacteria 7126688
895 2957508498 2957505466 Bacteria 7253085
896 2958040118 2958034702 Bacteria 6989922
897 2958054462 2958041894 Bacteria 13082850
898 2958075476 2958071322 Bacteria 6815895
899 2958091528 2958084443 Bacteria 7312792
900 2958093616 2958092219 Bacteria 6861151
901 2958103255 2958100919 Bacteria 6800575
902 2958115648 2958115193 Bacteria 6923548
903 2958131673 2958130278 Bacteria 6897202
904 2958151005 2958144490 Bacteria 6677056
905 2958170986 2958165035 Bacteria 6906348
906 2958174859 2958172287 Bacteria 6716688
907 2958180745 2958179912 Bacteria 6874908
908 2960585065 2960584000 Bacteria 6864594
909 2960595018 2960591022 Bacteria 6622873
910 2960602422 2960597568 Bacteria 6550735
911 2960608930 2960603979 Bacteria 6898737
912 2960613069 2960610863 Bacteria 6691244
913 2960619871 2960617483 Bacteria 6727748
914 2960630302 2960624210 Bacteria 6875384
915 2960633076 2960631154 Bacteria 6732508
916 2960638314 2960637947 Bacteria 7296468
917 2960647830 2960645483 Bacteria 7211087
918 2960658846 2960652885 Bacteria 7083688
919 2960661832 2960660292 Bacteria 7041660
920 2960668628 2960667422 Bacteria 6763020
921 2960679820 2960674078 Bacteria 6609048
922 2960684365 2960680706 Bacteria 6624464
923 2960688422 2960687367 Bacteria 6535474
924 2960700438 2960693952 Bacteria 6749742
925 2961078582 2961077736 Bacteria 7079850
926 2961120861 2961114664 Bacteria 6680456
927 2961128447 2961127735 Bacteria 7196641
928 2961169430 2961163497 Bacteria 6901077
929 2961173490 2961170736 Bacteria 7072258
930 2963646441 2963644680 Bacteria 6530403
931 2964609887 2964607997 Bacteria 7101408
932 2964618486 2964615318 Bacteria 6809089
933 2964623372 2964621998 Bacteria 6834995
934 2964629206 2964628898 Bacteria 7083044
935 2964640863 2964636051 Bacteria 7091832
936 2964646514 2964643177 Bacteria 6820887
937 2964654258 2964649959 Bacteria 6675118
938 2964661471 2964656573 Bacteria 7100150
939 2964665479 2964663802 Bacteria 7019362
940 2964675684 2964670856 Bacteria 6851364
941 2964681888 2964678106 Bacteria 6792020
942 2964688893 2964685014 Bacteria 6839111
943 2964696469 2964691889 Bacteria 6802758
944 2964699604 2964698721 Bacteria 6765331
945 2964706651 2964705432 Bacteria 7114648
946 2964715560 2964712639 Bacteria 6695970
947 2964720265 2964719344 Bacteria 7286602
948 2965023682 2965018300 Bacteria 6883036
949 2965069565 2965062239 Bacteria 7412989
950 2965123565 2965119406 Bacteria 6956431
951 2967671138 2967664464 Bacteria 6948836
952 2967676191 2967671571 Bacteria 7021409
953 2967684685 2967678726 Bacteria 7264382
954 2967689197 2967686174 Bacteria 6678622
955 2967694322 2967693043 Bacteria 6804451
956 2967705940 2967699805 Bacteria 6854538
957 2967708816 2967706974 Bacteria 7186053
958 2967716186 2967714385 Bacteria 7000047
959 2967724310 2967721400 Bacteria 7073753
960 2967732091 2967728569 Bacteria 6641507
961 2967736645 2967735183 Bacteria 6827012
962 2967743471 2967742019 Bacteria 6794534
963 2967752018 2967748971 Bacteria 6733771
964 2967758532 2967755722 Bacteria 6814706
965 2967765570 2967762386 Bacteria 6923502
966 2967772534 2967769361 Bacteria 6587838
967 2967777249 2967775926 Bacteria 6738189
968 2968005916 2968003550 Bacteria 6929263
969 2968018959 2968016561 Bacteria 7022047
970 2968090759 2968083720 Bacteria 7351627
971 2968094905 2968091066 Bacteria 6052692
972 2968098415 2968097103 Bacteria 6107094
973 2968111598 2968110612 Bacteria 6814636
974 2968130465 2968128360 Bacteria 6270294
975 2968141055 2968138860 Bacteria 6605449
976 2968177820 2968171901 Bacteria 6894245
977 2970024486 2970019648 Bacteria 7072033
978 2970031531 2970026789 Bacteria 6785236
979 2970035435 2970033650 Bacteria 7118744
980 2970047025 2970040964 Bacteria 6731123
981 2970048646 2970047711 Bacteria 7088379
982 2970057325 2970054988 Bacteria 6611507
983 2970065856 2970061556 Bacteria 7099761
984 2970071754 2970068827 Bacteria 7123112
985 2970078669 2970076120 Bacteria 6697332
986 2970087147 2970082768 Bacteria 6183754
987 2970090693 2970088815 Bacteria 6933825
988 2970097175 2970095765 Bacteria 6936963
989 2970105259 2970102677 Bacteria 6812532
990 2970110090 2970109326 Bacteria 6863976
991 2970119740 2970116247 Bacteria 6501857
992 2970127315 2970122695 Bacteria 6625855
993 2970135658 2970129317 Bacteria 6806560
994 2970136616 2970136068 Bacteria 7207982
995 2970146777 2970143518 Bacteria 6446480
996 2970154260 2970149975 Bacteria 6779706
997 2970161437 2970156795 Bacteria 7168044
998 2970166660 2970164137 Bacteria 6861252
999 2970173171 2970170962 Bacteria 6876229
1000 2970180901 2970177841 Bacteria 6768001
1001 2970187517 2970184632 Bacteria 7054431
1002 2970194820 2970191845 Bacteria 7032787
1003 2970470868 2970469710 Bacteria 6969209
1004 2970490703 2970489779 Bacteria 6517260
1005 2970506082 2970503327 Bacteria 7099517
1006 2970526301 2970524798 Bacteria 6840927
1007 2970560666 2970554993 Bacteria 6814252
1008 2970597969 2970593180 Bacteria 7073582
1009 2977521846 2977516862 Bacteria 6940108
1010 2977525401 2977523885 Bacteria 6960446
1011 2977534718 2977530762 Bacteria 6951399
1012 2977539171 2977537788 Bacteria 6929320
1013 2977547506 2977544691 Bacteria 6875412
1014 2977555497 2977551784 Bacteria 7125765
1015 2977563926 2977558990 Bacteria 6863948
1016 2977568530 2977565890 Bacteria 6901543
1017 2977575227 2977572785 Bacteria 6763888
1018 2977581121 2977579622 Bacteria 6772100
1019 2977826851 2977821940 Bacteria 6906439
1020 2977829154 2977828996 Bacteria 7007971
1021 2977845728 2977843712 Bacteria 6753583
1022 2977864653 2977858184 Bacteria 6215359
1023 2977865999 2977864932 Bacteria 7534097
1024 2977905656 2977898635 Bacteria 6675551
1025 2977923447 2977922695 Bacteria 6956781
1026 2977945983 2977942078 Bacteria 7570577
1027 2977973563 2977971508 Bacteria 7472917
1028 2978972505 2978969890 Bacteria 5400756
1029 2979092424 2979089926 Bacteria 5670289
1030 2979100185 2979095461 Bacteria 5669583
1031 2979104395 2979100975 Bacteria 5423623
1032 2979712982 2979710463 Bacteria 6785254
1033 2979752143 2979742915 Bacteria 7301278
1034 2979784136 2979779861 Bacteria 6219781
1035 2979810804 2979808191 Bacteria 7179355
1036 2984513811 2984509177 Bacteria 5274802
1037 2984522612 2984518228 Bacteria 5277463
1038 2984541918 2984537506 Bacteria 5277481
1039 2984590759 2984587000 Bacteria 5263363
1040 2984601349 2984601300 Bacteria 5455244
1041 2987638547 2987636660 Bacteria 8088555
1042 2987656584 2987652177 Bacteria 6969023
1043 2987665592 2987659509 Bacteria 6966464
1044 2987670068 2987666974 Bacteria 6509233
1045 2989771894 2989771324 Bacteria 5605128
1046 2989776780 2989776772 Bacteria 4843317
1047 2996316160 2996310559 Bacteria 6357320
1048 2996346320 2996341866 Bacteria 6643098
1049 2996356596 2996348954 Bacteria 7239054
1050 2996391047 2996386984 Bacteria 6978667
1051 2996891391 2996887358 Bacteria 5795980
1052 2996896708 2996893221 Bacteria 5823108
1053 3000140887 3000135777 Bacteria 6891109
1054 3002146464 3002141150 Bacteria 5254435
1055 3003931457 3003930520 Bacteria 5667563
1056 3004171803 3004167301 Bacteria 8330599
1057 3004194618 3004188549 Bacteria 6952365
1058 3004205210 3004203850 Bacteria 7307914
1059 3004212754 3004211236 Bacteria 7417683
1060 3004221444 3004218560 Bacteria 7421728
1061 3004239072 3004232784 Bacteria 6662140
1062 3004268622 3004268573 Bacteria 7043476
1063 3004282899 3004275668 Bacteria 7114440
1064 3004291034 3004289098 Bacteria 6135450
1065 3004338584 3004334049 Bacteria 8449246
1066 3005413738 3005409236 Bacteria 7188837
1067 3005451548 3005445848 Bacteria 6906074
1068 3005458140 3005452660 Bacteria 5889319
1069 637075847 637000159 Bacteria 7596297
1070 639651398 639633055 Bacteria 7751309
1071 643823094 643692032 Bacteria 6891900
1072 648738723 648276728 Bacteria 6968865
1073 650741055 650716007 Bacteria 5573770
1074 8003996675 8003992118 Bacteria 7266902
1075 8004004130 8003999396 Bacteria 7063185
1076 8004319660 8004312739 Bacteria 7444653
1077 8004379833 8004374579 Bacteria 6898112
1078 8004389369 8004387939 Bacteria 7049250
1079 8004403788 8004395343 Bacteria 6620908
1080 8004446994 8004445564 Bacteria 6322258
1081 8004639372 8004633249 Bacteria 6723080
1082 8004711920 8004703790 Bacteria 8006957
1083 8004716076 8004714634 Bacteria 6776161
1084 8005263938 8005258706 Bacteria 6184835
1085 8005277006 8005275841 Bacteria 6929066
1086 8005287980 8005282627 Bacteria 6675747
1087 8005289470 8005289223 Bacteria 6634003
1088 8005305197 8005301065 Bacteria 6614431
1089 8005313307 8005307578 Bacteria 7395396
1090 8005325918 8005321885 Bacteria 5795980
1091 8005382164 8005376324 Bacteria 6590079
1092 8005388591 8005382845 Bacteria 6732062
1093 8005431322 8005430974 Bacteria 6689030
1094 8005466613 8005460587 Bacteria 7157962
1095 8005503319 8005497431 Bacteria 6477605
1096 8005547673 8005542996 Bacteria 7077758
1097 8005561980 8005556819 Bacteria 6908598
1098 8005567280 8005563573 Bacteria 7153261
1099 8005576169 8005570704 Bacteria 6957481
1100 8005625460 8005619151 Bacteria 7030230
1101 8005630442 8005626139 Bacteria 6534237
1102 8005661644 8005658619 Bacteria 4500593
1103 8005674837 8005668836 Bacteria 6953162
1104 8005689219 8005688590 Bacteria 6610080
1105 8005696911 8005695170 Bacteria 6912330
1106 8018127736 8018127388 Bacteria 7351159
1107 8018154812 8018150411 Bacteria 5549903
1108 8018165769 8018163183 Bacteria 7277977
1109 8018182889 8018176218 Bacteria 6896178
1110 8023688373 8023680758 Bacteria 7729763
1111 8024484010 8024479707 Bacteria 6954785
1112 8024491245 8024486573 Bacteria 6540512
1113 8024503954 8024501048 Bacteria 6427847
1114 8049298464 8049293176 Bacteria 6128433
1115 8054563370 8054558443 Bacteria 5204801
1116 8055618089 8055617313 Bacteria 7548464
1117 8056375322 8056375014 Bacteria 7006639
1118 8056383145 8056382006 Bacteria 6408074
1119 8057880777 8057874678 Bacteria 7494653
1120 nmdc:mga0yw44_24573_c1
1121 JGI24740J21852_10000443
1122 JGI25155J39150_1000020
1123 JGI25156J39149_1000021
1124 JGI25162J39368_1001310
1125 JGI25162J39368_1001352
1126 JGI25162J39368_1001559
1127 JGI25154J39366_1000039
1128 JGI25158J39367_1000021
1129 JGI25158J39367_1003597
1130 JGI25157J39369_1000019
1131 JGI25152J39213_1001590
1132 JGI25152J39213_1002259
1133 JGI25152J39213_1015384
1134 JGI25152J39213_1015385
1135 JGI25150J39212_1000022
1136 JGI25150J39212_1001979
1137 JGI25159J45721_1000037
1138 JGI25159J45721_1000355
1139 JGI25159J45721_1000423
1140 JGI25151J46595_10000023
1141 JGI25151J46595_10000274
1142 JGI25151J46595_10006048
1143 JGI25151J46595_10025607
1144 JGI25151J46595_10040456
1145 JGI25406J46586_10004119
1146 JGI25165J46597_1000018
1147 JGI25165J46597_1000407
1148 JGI25153J46596_10002677
1149 JGI25153J46596_10038349
1150 JGI25153J46596_10038350
1151 rootH2_10051486
1152 rootL2_10024477
1153 rootH1_10019293
1154 JGI25160J50197_1000014
1155 JGI25160J50197_1000113
1156 JGI25160J50197_1003169
1157 JGI25160J50197_1008334
1158 JGI25161J50226_1000022
1159 JGI25161J50226_1000025
1160 JGI25161J50226_1001063
1161 JGI25161J50226_1003751
1162 Ga0055526_1003560
1163 Ga0055526_1004633
1164 Ga0055526_1011807
1165 Ga0055526_1018430
1166 Ga0055524_1000809
1167 Ga0055524_1002252
1168 Ga0055524_1002377
1169 Ga0055524_1002795
1170 Ga0055524_1014125
1171 Ga0055528_1002240
1172 Ga0055528_1003248
1173 Ga0055528_1021841
1174 Ga0055540_1000379
1175 Ga0055540_1016517
1176 Ga0058692_1001787
1177 Ga0055543_1000005
1178 Ga0055543_1000381
1179 Ga0055543_1000817
1180 Ga0065165_1000347
1181 Ga0065165_1002002
1182 Ga0065165_1002159
1183 Ga0065165_1003353
1184 Ga0065165_1011043
1185 Ga0065165_1023268
1186 Ga0070670_100000196
1187 Ga0070668_100019030
1188 Ga0070668_100042323
1189 Ga0070669_100072607
1190 Ga0070674_100144571
1191 Ga0070667_100263878
1192 Ga0070707_100126638
1193 Ga0070699_100051187
1194 Ga0070665_100002391
1195 Ga0070665_100016171
1196 Ga0070665_100112513
1197 Ga0070665_100129080
1198 Ga0070665_100312353
1199 Ga0068857_100337479
1200 Ga0068854_100046058
1201 Ga0068856_100002393
1202 Ga0081540_1040794
1203 Ga0081539_10000646
1204 Ga0075365_10002073
1205 Ga0075365_10004110
1206 Ga0075365_10044195
1207 Ga0075365_10069904
1208 Ga0075365_10111042
1209 Ga0075364_10022777
1210 Ga0075362_10000288
1211 Ga0075362_10077039
1212 Ga0075367_10000352
1213 Ga0075367_10003994
1214 Ga0075367_10081998
1215 Ga0075367_10118254
1216 Ga0075369_10010335
1217 Ga0075369_10034297
1218 Ga0075369_10039727
1219 Ga0075369_10058194
1220 Ga0075366_10001721
1221 Ga0075366_10102839
1222 Ga0075370_10015245
1223 Ga0075370_10058681
1224 Ga0075431_100036440
1225 Ga0075429_100103600
1226 Ga0079104_1000082
1227 Ga0105251_10033076
1228 Ga0105240_10000012
1229 Ga0114129_10004566
1230 Ga0114129_10353966
1231 Ga0105243_10049327
1232 Ga0105243_10108221
1233 Ga0105248_10185998
1234 Ga0105237_10000165
1235 Ga0105237_10018970
1236 Ga0105249_10142513
1237 Ga0123340_1051603
1238 Ga0123341_1039486
1239 Ga0123342_1011252
1240 Ga0105239_10000471
1241 Ga0157373_10005480
1242 Ga0157373_10038303
1243 Ga0157371_10000195
1244 Ga0157371_10019115
1245 Ga0157370_10007276
1246 Ga0157369_10055775
1247 Ga0171463_1010
1248 Ga0157374_10135163
1249 Ga0182007_10001911
1250 Ga0182005_1004906
1251 Ga0183363_1207
1252 Ga0214544_1000419
1253 Ga0214542_1000027
1254 Ga0214542_1019286
1255 Ga0214543_1000005
1256 Ga0214543_1000047
1257 Ga0228711_1016254
1258 Ga0228710_1003061
1259 Ga0209435_100025
1260 Ga0209436_100044
1261 Ga0209436_100745
1262 Ga0209672_103402
1263 Ga0209437_100022
1264 Ga0209437_100040
1265 Ga0207425_1000038
1266 Ga0207425_1001594
1267 Ga0207425_1002210
1268 Ga0209646_1000083
1269 Ga0209646_1009483
1270 Ga0209026_1000078
1271 Ga0209677_101094
1272 Ga0209759_1000060
1273 Ga0209129_1000016
1274 Ga0209129_1000036
1275 Ga0209129_1001000
1276 Ga0209129_1001274
1277 Ga0209129_1009534
1278 Ga0209129_1009539
1279 Ga0209233_1000031
1280 Ga0209233_1000051
1281 Ga0209233_1000146
1282 Ga0209673_1000005
1283 Ga0209673_1000212
1284 Ga0209673_1014367
1285 Ga0209673_1019093
1286 Ga0209130_1000001
1287 Ga0209130_1000013
1288 Ga0209130_1000074
1289 Ga0209675_1016281
1290 Ga0209025_1000108
1291 Ga0209025_1000300
1292 Ga0209025_1000593
1293 Ga0209025_1001193
1294 Ga0209025_1007795
1295 Ga0209025_1010251
1296 Ga0209025_1020001
1297 Ga0209025_1036173
1298 Ga0209564_1000329
1299 Ga0209564_1000402
1300 Ga0209564_1002621
1301 Ga0209564_1004961
1302 Ga0209758_1000053
1303 Ga0209758_1000104
1304 Ga0209758_1001035
1305 Ga0209758_1002176
1306 Ga0209758_1009270
1307 Ga0209758_1025304
1308 Ga0209050_1012725
1309 Ga0209256_1000164
1310 Ga0209256_1000582
1311 Ga0209256_1001320
1312 Ga0209256_1001362
1313 Ga0209256_1015871
1314 Ga0207426_1000005
1315 Ga0207426_1000022
1316 Ga0207426_1000035
1317 Ga0207426_1000165
1318 Ga0207426_1003594
1319 Ga0209051_1000249
1320 Ga0209051_1001577
1321 Ga0209051_1002800
1322 Ga0209051_1007255
1323 Ga0209051_1012514
1324 Ga0209051_1033815
1325 Ga0209257_1002528
1326 Ga0209257_1005406
1327 Ga0207695_10000120
1328 Ga0207695_10204920
1329 Ga0207671_10000513
1330 Ga0207650_10001547
1331 Ga0207706_10163371
1332 Ga0207667_10078680
1333 Ga0207712_10138573
1334 Ga0207640_10076312
1335 Ga0207658_10042524
1336 Ga0207678_10105108
1337 Ga0207702_10004200
1338 Ga0207674_10213513
1339 Ga0207683_10128631
1340 Ga0209281_1000043
1341 Ga0209281_1000087
1342 Ga0209281_1000226
1343 Ga0209371_1000037
1344 Ga0209371_1000687
1345 Ga0209282_1000008
1346 Ga0209813_10000676
1347 Ga0268266_10002894
1348 Ga0268266_10021611
1349 Ga0268266_10033187
1350 Ga0307515_10000017
1351 Ga0307515_10002600
1352 Ga0307515_10016021
1353 Ga0307515_10038197
1354 Ga0268256_1000039
1355 Ga0307513_10000717
1356 Ga0307408_100025562
1357 Ga0307406_10177699
1358 Ga0307406_10230622
1359 Ga0307412_10015715
1360 Ga0315914_1000305
1361 Ga0315913_1000064
1362 Ga0315915_1000009
1363 Ga0395905_0000328
1364 Ga0395905_0011883
1365 Ga0436364_0821647
1366 Ga0439438_013761
1367 Ga0439465_0007929
1368 Ga0439465_0024274
1369 Ga0439465_0024686
1370 Ga0439465_0029020
1371 Ga0439449_0005519
1372 Ga0450920_002612
1373 Ga0450910_001377
1374 Ga0466963_0021163
1375 Ga0466970_0003638
1376 Ga0466959_0042555
1377 Ga0495617_032064
1378 Ga0495638_0000269
1379 Ga0495638_0013192
1380 Ga0495638_0042009
1381 Ga0495605_0000841
1382 Ga0495585_0004462
1383 Ga0495585_0022616
1384 Ga0495583_0011222
1385 Ga0495610_0004590
1386 Ga0495610_0039899
1387 Ga0495610_0044818
1388 Ga0495610_0048815
1389 Ga0495610_0069825
1390 Ga0495616_0046021
1391 Ga0495616_0067417
1392 Ga0495632_0007168
1393 Ga0495632_0015129
1394 Ga0495643_0001376
1395 Ga0495643_0009597
1396 Ga0495643_0033863
1397 Ga0495654_0000305
1398 Ga0495668_0011738
1399 Ga0495611_0005071
1400 Ga0495625_0003375
1401 Ga0495625_0036637
1402 Ga0495625_0115084
1403 Ga0495625_0210662
1404 Ga0495588_0000601
1405 Ga0495588_0022710
1406 Ga0495588_0110619
1407 Ga0495670_0010698
1408 Ga0495671_0038874
1409 Ga0495600_0006330
1410 Ga0495660_0035613
1411 Ga0495672_0025631
1412 Ga0495687_016218
1413 Ga0495687_026215
1414 Ga0495686_0033103
1415 Ga0495686_0047552
1416 Ga0495686_0052416
1417 Ga0495686_0124392
1418 Ga0496100_0095042
1419 Ga0496102_0075309
1420 Ga0496102_0111255
1421 Ga0496103_0052532
1422 Ga0496106_0000269
1423 Ga0496106_0093331
1424 Ga0496109_0210223
1425 Ga0496110_0038763
1426 Ga0496111_0011505
1427 Ga0496111_0068754
1428 Ga0496112_0046773
1429 Ga0496113_0104794
1430 Ga0496116_0000380
1431 Ga0496116_0006551
1432 Ga0496116_0009943
1433 Ga0496116_0019646
1434 Ga0496116_0036476
1435 Ga0496116_0050617
1436 Ga0496117_0000031
1437 Ga0496117_0004480
1438 Ga0496117_0006651
1439 Ga0496117_0009144
1440 Ga0496118_0000976
1441 Ga0496118_0008203
1442 Ga0496118_0008775
1443 Ga0496119_0006855
1444 Ga0496119_0026207
1445 Ga0496120_0000583
1446 Ga0496120_0005272
1447 Ga0496120_0026171
1448 Ga0496120_0048346
1449 Ga0496121_0000034
1450 Ga0496121_0006426
1451 Ga0496121_0022949
1452 Ga0496121_0034063
1453 Ga0496121_0053008
1454 Ga0496121_0055453
1455 Ga0496121_0061575
1456 Ga0496121_0155287
1457 Ga0496122_0000009
1458 Ga0496122_0000023
1459 Ga0496122_0005813
1460 Ga0496122_0027288
1461 Ga0496122_0057834
1462 Ga0496123_0000020
1463 Ga0496123_0000447
1464 Ga0496123_0006666
1465 Ga0496123_0018123
1466 Ga0496123_0029539
1467 Ga0496123_0058464
1468 Ga0496123_0078430
1469 Ga0496124_0000130
1470 Ga0496124_0000153
1471 Ga0496124_0010057
1472 Ga0496124_0039158
1473 Ga0496124_0089052
1474 Ga0496124_0199999
1475 Ga0496124_0257388
1476 Ga0496125_0000030
1477 Ga0496125_0013088
1478 Ga0496125_0050072
1479 Ga0496125_0213046
1480 Ga0496126_0000293
1481 Ga0496126_0190505
1482 Ga0495678_048241
1483 Ga0501037_0041257
1484 Ga0501046_0054503
1485 Ga0501075_0048275
1486 Ga0501076_0034899
1487 Ga0501079_0045237
1488 Ga0501081_0101507
1489 Ga0501280_002037
1490 Ga0501044_0056227
1491 nmdc:mga03683_39394_c1
1492 nmdc:mga03683_50363_c1
1493 nmdc:mga00v17_139_c1
1494 nmdc:mga00v17_16703_c1
1495 nmdc:mga00v17_182_c1
1496 nmdc:mga0yw44_2775_c1
1497 nmdc:mga0yw44_59038_c1
1498 nmdc:mga0yw44_6862_c1
1499 nmdc:mga0yw44_70824_c1
1500 nmdc:mga0k408_27132_c1
1501 nmdc:mga06z11_29666_c1
1502 nmdc:mga06z11_5567_c1
1503 nmdc:mga04h51_642_c1
1504 nmdc:mga07m45_6954_c1
1505 nmdc:mga05p37_12520_c1
1506 nmdc:mga05p37_31508_c1
1507 nmdc:mga06r32_41556_c1
1508 nmdc:mga0n895_48319_c1
1509 nmdc:mga0sz30_195_c1
1510 nmdc:mga0sz30_39036_c1
1511 nmdc:mga0sz30_67939_c1
1512 nmdc:mga0sz30_6882_c1
1513 Ga0500644_0001795
1514 Ga0500560_000096
1515 Ga0500618_000357
1516 Ga0500618_000850
1517 Ga0500618_004421
1518 Ga0500618_027798
1519 Ga0500658_0002006
1520 Ga0500561_0003308
1521 Ga0500568_0000086
1522 Ga0500568_0004546
1523 Ga0500573_0000205
1524 Ga0500590_005688
1525 Ga0500604_0030694
1526 Ga0500616_0001636
1527 Ga0500620_000216
1528 Ga0500622_0000375
1529 Ga0501084_0004530
1530 Ga0501082_0082484
1531 Ga0501082_0121497
1532 2509109918
1533 2509144579
1534 2509377093
1535 2509385824
1536 2509448117
1537 2510136803
1538 2510305873
1539 2510899916
1540 2510900512
1541 2511184181
1542 2511198358
1543 2511388380
1544 2511498159
1545 2512529316
1546 2512932763
1547 2512961088
1548 2512969471
1549 2513569785
1550 2513576641
1551 2513587795
1552 2513595701
1553 2513606374
1554 2513618171
1555 2513631688
1556 2513713383
1557 2513866436
1558 2513885111
1559 2513905613
1560 2513911640
1561 2513927736
1562 2513986063
1563 2513997453
1564 2514008086
1565 2514021377
1566 2514038998
1567 2514417244
1568 2514592779
1569 2515115388
1570 2515610713
1571 2515636117
1572 2515644726
1573 2515658022
1574 2515742239
1575 2516206669
1576 2516896197
1577 2517041611
1578 2517080794
1579 2517099079
1580 2517410694
1581 2517565649
1582 2520380653
1583 2524449631
1584 2530644887
1585 2535519947
1586 2551674800
1587 2551685014
1588 2551703038
1589 2551710268
1590 2551722280
1591 2551724249
1592 2551731702
1593 2551745023
1594 2554248754
1595 2558862384
1596 2559295842
1597 2561467963
1598 2585167692
1599 2585202836
1600 2585221707
1601 2585228115
1602 2585255412
1603 2585265950
1604 2585390141
1605 2585395296
1606 2585401203
1607 2585524474
1608 2585539075
1609 2585544123
1610 2585821648
1611 2585837025
1612 2585842535
1613 2599332177
1614 2599416833
1615 2599718649
1616 2599939452
1617 2600197714
1618 2600374954
1619 2601610727
1620 2601747501
1621 2616295071
1622 2643809008
1623 2643814393
1624 2643854982
1625 2643987860
1626 2644006772
1627 2644052186
1628 2644069147
1629 2644104784
1630 2644151215
1631 2644154197
1632 2644191681
1633 2644204980
1634 2644208589
1635 2644241148
1636 2644298262
1637 2644313203
1638 2644336289
1639 2644378601
1640 2644420218
1641 2644453625
1642 2644484929
1643 2644494123
1644 2644500518
1645 2644521420
1646 2644612826
1647 2644652119
1648 2644656514
1649 2644674282
1650 2644692324
1651 2657684312
1652 2692318591
1653 2719183542
1654 2719388290
1655 2719667908
1656 2719727983
1657 2720494671
1658 2720611006
1659 2720616174
1660 2720629255
1661 2720771827
1662 2721144844
1663 2721155583
1664 2721166931
1665 2721402913
1666 2722837909
1667 2723029230
1668 2723562864
1669 2723570854
1670 2723573922
1671 2724035270
1672 2724042177
1673 2724086647
1674 2724106805
1675 2724107605
1676 2725951981
1677 2730105544
1678 2730161682
1679 2730300690
1680 2738801771
1681 2739033533
1682 2753463501
1683 2765466951
1684 2766068672
1685 2770197147
1686 2776267649
1687 2776910393
1688 2792581076
1689 2792619545
1690 2792627316
1691 2792639786
1692 2792747431
1693 2793283411
1694 2793296579
1695 2793314887
1696 2793321538
1697 2793325912
1698 2793332919
1699 2793340285
1700 2793346017
1701 2793355240
1702 2793357940
1703 2793366700
1704 2802721307
1705 2802728249
1706 2802733935
1707 2802740671
1708 2802746928
1709 2802748683
1710 2804754718
1711 2805927919
1712 2805933765
1713 2806044970
1714 2806053871
1715 2806060037
1716 2806065909
1717 2806075439
1718 2808988334
1719 2819560852
1720 2819684427
1721 2821123202
1722 2838019326
1723 2838024862
1724 2838036946
1725 2838046476
1726 2838050392
1727 2838063095
1728 2838071662
1729 2838077660
1730 2838662016
1731 2838673723
1732 2838678785
1733 2838684250
1734 2838692237
1735 2838699741
1736 2838705243
1737 2838711974
1738 2838718126
1739 2838723082
1740 2838728193
1741 2838734540
1742 2838739775
1743 2838747722
1744 2839997204
1745 2840764568
1746 2841735527
1747 2841844101
1748 2841850640
1749 2841853487
1750 2841863107
1751 2841869128
1752 2842081716
1753 2842114585
1754 2842122293
1755 2842128850
1756 2842133677
1757 2842143822
1758 2842150266
1759 2842155411
1760 2842161430
1761 2842167366
1762 2842174632
1763 2842179291
1764 2842186383
1765 2842190550
1766 2842195087
1767 2842201947
1768 2842210496
1769 2842215126
1770 2842223621
1771 2842227847
1772 2842235293
1773 2842241386
1774 2842246360
1775 2842254952
1776 2842260779
1777 2842267856
1778 2842276070
1779 2842283950
1780 2842289831
1781 2842295372
1782 2842310570
1783 2842311939
1784 2842319271
1785 2842343861
1786 2842368236
1787 2842375916
1788 2842381852
1789 2842388841
1790 2842396727
1791 2842407028
1792 2842413921
1793 2842420562
1794 2842425295
1795 2842432019
1796 2842438131
1797 2842443827
1798 2842449910
1799 2842466117
1800 2842472899
1801 2842491717
1802 2842502063
1803 2842520155
1804 2842522306
1805 2842875512
1806 2842924533
1807 2844016186
1808 2844169665
1809 2844461354
1810 2847422910
1811 2847674753
1812 2847691260
1813 2848997685
1814 2850085231
1815 2855828978
1816 2855844095
1817 2855872592
1818 2856317361
1819 2856326843
1820 2856348154
1821 2856350268
1822 2856358117
1823 2856367076
1824 2857351363
1825 2857522288
1826 2857533846
1827 2858806655
1828 2869166612
1829 2869235792
1830 2869259288
1831 2869283606
1832 2869287388
1833 2871430480
1834 2871443689
1835 2871450528
1836 2871476239
1837 2871492438
1838 2871501953
1839 2874104315
1840 2874112981
1841 2874124725
1842 2874143698
1843 2874148967
1844 2874155972
1845 2874172246
1846 2876364986
1847 2876393815
1848 2876415538
1849 2878038399
1850 2878736631
1851 2878738963
1852 2878746912
1853 2878758319
1854 2878765810
1855 2878772484
1856 2878793948
1857 2881154778
1858 2881161558
1859 2881163737
1860 2881846315
1861 2881854654
1862 2881868124
1863 2882637639
1864 2882913825
1865 2885306045
1866 2885315481
1867 2885324581
1868 2885333166
1869 2885338048
1870 2885343872
1871 2885357779
1872 2888338902
1873 2888344574
1874 2888354964
1875 2889018389
1876 2896388731
1877 2899795208
1878 2899808701
1879 2899848232
1880 2903449993
1881 2903496831
1882 2903504386
1883 2903522279
1884 2903528657
1885 2903546756
1886 2904583501
1887 2904660540
1888 2906309930
1889 2906322361
1890 2906330548
1891 2906360644
1892 2906417426
1893 2913296799
1894 2915984503
1895 2915991394
1896 2915998352
1897 2916001628
1898 2916009785
1899 2916016694
1900 2916024275
1901 2916030382
1902 2916039464
1903 2916047575
1904 2916049706
1905 2916060941
1906 2916063055
1907 2916071780
1908 2916081318
1909 2919103340
1910 2919118617
1911 2919124578
1912 2919170683
1913 2920765092
1914 2920826735
1915 2921206965
1916 2921213459
1917 2921238190
1918 2921248854
1919 2921254789
1920 2921261447
1921 2921269044
1922 2921288971
1923 2921295590
1924 2921303513
1925 2922131923
1926 2922159851
1927 2923556646
1928 2924145089
1929 2924156844
1930 2924162162
1931 2924170015
1932 2924173800
1933 2924180672
1934 2924192281
1935 2924196210
1936 2924203713
1937 2924209614
1938 2924214619
1939 2924226602
1940 2924231301
1941 2924716258
1942 2924722478
1943 2924730370
1944 2924739930
1945 2924757530
1946 2924768481
1947 2924776325
1948 2924784415
1949 2926755146
1950 2926762306
1951 2928525898
1952 2929141765
1953 2933010739
1954 2933015585
1955 2933021346
1956 2933577007
1957 2933590559
1958 2933597673
1959 2933602458
1960 2935898409
1961 2935906850
1962 2936370494
1963 2936378154
1964 2936385426
1965 2937002301
1966 2937003597
1967 2937012109
1968 2937017442
1969 2937024951
1970 2937033269
1971 2937040619
1972 2937043611
1973 2937050765
1974 2937058229
1975 2937064711
1976 2937074336
1977 2937082721
1978 2937086696
1979 2937097569
1980 2937102433
1981 2937111070
1982 2937114784
1983 2937122897
1984 2937126924
1985 2937815127
1986 2937823465
1987 2937842341
1988 2937851111
1989 2937884217
1990 2937896256
1991 2937979680
1992 2938000615
1993 2941504420
1994 2954012016
1995 2957379165
1996 2957383248
1997 2957390545
1998 2957399410
1999 2957403518
2000 2957411307
2001 2957417777
2002 2957422778
2003 2957432646
2004 2957442899
2005 2957445141
2006 2957452553
2007 2957458817
2008 2957466813
2009 2957472654
2010 2957484204
2011 2957490317
2012 2957495500
2013 2957500815
2014 2957508498
2015 2958040118
2016 2958054462
2017 2958075476
2018 2958091528
2019 2958093616
2020 2958103255
2021 2958115648
2022 2958131673
2023 2958151005
2024 2958170986
2025 2958174859
2026 2958180745
2027 2960585065
2028 2960595018
2029 2960602422
2030 2960608930
2031 2960613069
2032 2960619871
2033 2960630302
2034 2960633076
2035 2960638314
2036 2960647830
2037 2960658846
2038 2960661832
2039 2960668628
2040 2960679820
2041 2960684365
2042 2960688422
2043 2960700438
2044 2961078582
2045 2961120861
2046 2961128447
2047 2961169430
2048 2961173490
2049 2963646441
2050 2964609887
2051 2964618486
2052 2964623372
2053 2964629206
2054 2964640863
2055 2964646514
2056 2964654258
2057 2964661471
2058 2964665479
2059 2964675684
2060 2964681888
2061 2964688893
2062 2964696469
2063 2964699604
2064 2964706651
2065 2964715560
2066 2964720265
2067 2965023682
2068 2965069565
2069 2965123565
2070 2967671138
2071 2967676191
2072 2967684685
2073 2967689197
2074 2967694322
2075 2967705940
2076 2967708816
2077 2967716186
2078 2967724310
2079 2967732091
2080 2967736645
2081 2967743471
2082 2967752018
2083 2967758532
2084 2967765570
2085 2967772534
2086 2967777249
2087 2968005916
2088 2968018959
2089 2968090759
2090 2968094905
2091 2968098415
2092 2968111598
2093 2968130465
2094 2968141055
2095 2968177820
2096 2970024486
2097 2970031531
2098 2970035435
2099 2970047025
2100 2970048646
2101 2970057325
2102 2970065856
2103 2970071754
2104 2970078669
2105 2970087147
2106 2970090693
2107 2970097175
2108 2970105259
2109 2970110090
2110 2970119740
2111 2970127315
2112 2970135658
2113 2970136616
2114 2970146777
2115 2970154260
2116 2970161437
2117 2970166660
2118 2970173171
2119 2970180901
2120 2970187517
2121 2970194820
2122 2970470868
2123 2970490703
2124 2970506082
2125 2970526301
2126 2970560666
2127 2970597969
2128 2977521846
2129 2977525401
2130 2977534718
2131 2977539171
2132 2977547506
2133 2977555497
2134 2977563926
2135 2977568530
2136 2977575227
2137 2977581121
2138 2977826851
2139 2977829154
2140 2977845728
2141 2977864653
2142 2977865999
2143 2977905656
2144 2977923447
2145 2977945983
2146 2977973563
2147 2978972505
2148 2979092424
2149 2979100185
2150 2979104395
2151 2979712982
2152 2979752143
2153 2979784136
2154 2979810804
2155 2984513811
2156 2984522612
2157 2984541918
2158 2984590759
2159 2984601349
2160 2987638547
2161 2987656584
2162 2987665592
2163 2987670068
2164 2989771894
2165 2989776780
2166 2996316160
2167 2996346320
2168 2996356596
2169 2996391047
2170 2996891391
2171 2996896708
2172 3000140887
2173 3002146464
2174 3003931457
2175 3004171803
2176 3004194618
2177 3004205210
2178 3004212754
2179 3004221444
2180 3004239072
2181 3004268622
2182 3004282899
2183 3004291034
2184 3004338584
2185 3005413738
2186 3005451548
2187 3005458140
2188 637075847
2189 639651398
2190 643823094
2191 648738723
2192 650741055
2193 8003996675
2194 8004004130
2195 8004319660
2196 8004379833
2197 8004389369
2198 8004403788
2199 8004446994
2200 8004639372
2201 8004711920
2202 8004716076
2203 8005263938
2204 8005277006
2205 8005287980
2206 8005289470
2207 8005305197
2208 8005313307
2209 8005325918
2210 8005382164
2211 8005388591
2212 8005431322
2213 8005466613
2214 8005503319
2215 8005547673
2216 8005561980
2217 8005567280
2218 8005576169
2219 8005625460
2220 8005630442
2221 8005661644
2222 8005674837
2223 8005689219
2224 8005696911
2225 8018127736
2226 8018154812
2227 8018165769
2228 8018182889
2229 8023688373
2230 8024484010
2231 8024491245
2232 8024503954
2233 8049298464
2234 8054563370
2235 8055618089
2236 8056375322
2237 8056383145
2238 8057880777

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04101

Glyco_tran_28_C

Glycosyltransferase family 28 C-terminal domain

278

432

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kqx-assembly1.cif.gz_A crystal structure of yijc from b. subtilis in complex with udp 0.7089 8 382
6kqx-assembly1.cif.gz_A crystal structure of yijc from b. subtilis in complex with udp 0.7032 8 382
1v4v-assembly1.cif.gz_B crystal structure of udp-n-acetylglucosamine 2-epimerase from thermus thermophilus hb8 0.6954 8 382
6kqw-assembly1.cif.gz_A crystal structure of yijc from b. subtilis 0.6865 9 383
8h5d-assembly1.cif.gz_A crystal structure of yojk mutant in complex with udp 0.679 8 386
ID Description Score Start End Superfamily
af_A0A0R0EAS2_219_318_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8014 245 330 3.40.50.2000
af_K7L509_198_322_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7413 247 377 3.40.50.2000
af_A0A2R8QIE5_80_195_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7375 284 375 3.40.50.2000
af_Q9NP73_1_149_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7317 217 337 3.40.50.2000
2iyaB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.73 215 379 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A3C0MCC4-F1-model_v4 Glycosyl transferase family 28 C-terminal domain-containing protein 0.9824 9 129
AF-A0A530H7J9-F1-model_v4 Glycosyl transferase family 28 C-terminal domain-containing protein 0.9687 1 368 GO:0016758
AF-A0A060CAV2-F1-model_v4 CAZy families GT1 protein 0.9664 3 144
AF-A0A537QKW0-F1-model_v4 Glycosyl transferase family 28 C-terminal domain-containing protein 0.9648 34 384 GO:0016758
AF-A0A522S9P9-F1-model_v4 Glycosyl transferase 0.9636 12 149

Map