F490378
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1119 | 536 | 2218 | 445 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2876392853|2876396287 |
| Length | 510 |
| Sequence | FSTSAHRWRKLRLTTTAVFSAFTMSGRSRTLPSTRACLAVVRSPNRRRNACQRRVFLMGKKQMKLGLSMRYMGYHVGAWRHPDTVKGGNSMLQSFLGVAQTAERAKFDMLFLADGIGVRLDDKPKGSLCRSHHNVELEPLTLLSALAALTRNIGLVATASTTYNEPFHIARKYGSLDQISGGRAAWNVVTSWSDQEAWNFSMSKQLDYDTRYERAAEFVDVVTGLWDSWDEDAFVIDKESGIFFDDRKMHVLDHVGKHFSVRGPLSVRRSPQGRPILVQAGVSEPGQQIAAEYCDMVFMAKNDLKSAQDYYSSVKNRLDGFGRQKTDLLMMLGLTPIVGRTREEAQEKYEELESLIDPVVGLQLLYRSFGDLSHLPLDGPVPKPDLDKVGLKSSAQMYYELAQKQNLTIRQLYKKLGMAQEHKTVVGTAKDVADEMESWFEAGAADGFNITPTHLPQGIDDFVELVLPELRRRGLFRDEYEGRTLRENLGLPLPKSRYDADASAVARLAS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 3 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 4 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 5 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 6 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 7 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 8 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 27 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 58 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 59 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 60 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 61 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 63 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 64 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 65 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 68 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 69 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 70 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 71 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 74 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 75 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 76 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 77 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 78 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 80 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 81 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 82 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 94 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 95 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 106 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 109 | 3300015684 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 | Metagenome | Unclassified |
| 110 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 111 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 112 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 114 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 115 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 116 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 124 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 125 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 127 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 171 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 172 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 175 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 176 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 177 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 178 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 179 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 180 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 181 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 182 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 183 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 184 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 185 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 186 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 187 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 188 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 189 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 190 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 191 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 192 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 193 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 194 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 195 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 196 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 197 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 198 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 200 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 201 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 202 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 203 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 204 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 205 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 206 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 207 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 208 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 210 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 211 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 212 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 213 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 214 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 215 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 217 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 218 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 219 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 220 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 221 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 222 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 223 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 224 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 225 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 226 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 227 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 228 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 229 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 230 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 231 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 232 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 233 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 234 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 235 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 236 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 237 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 238 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 239 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 240 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 241 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 242 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 243 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 244 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 245 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 246 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 247 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 248 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 249 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 250 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 338 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 340 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 341 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 342 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 343 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 344 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 345 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 346 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 347 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 348 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 349 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 350 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 351 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 352 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 353 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 354 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 355 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 356 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 357 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 358 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 359 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 360 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 361 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 362 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 363 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 364 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 388 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 389 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 390 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 391 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 392 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 400 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 404 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 405 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 406 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 407 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 408 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 409 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 410 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 411 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 412 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 413 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 414 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 415 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 416 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 417 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 418 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 419 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 420 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 421 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 422 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 423 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 424 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 425 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 426 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 427 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 428 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 429 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 430 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 431 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 432 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 433 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 434 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 435 | 2547132424 | Nocardia nova SH22a | Isolate | Unclassified |
| 436 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 437 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 438 | 2643221681 | Aeromicrobium sp. Root472D3 | Isolate | Unclassified |
| 439 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 440 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 441 | 2643221724 | Microbacterium sp. Root280D1 | Isolate | Unclassified |
| 442 | 2738541308 | Rhodococcus sp. OK551 | Isolate | Unclassified |
| 443 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 444 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 445 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 446 | 2751185725 | Microbispora sp. NRRL B-24597 | Isolate | Unclassified |
| 447 | 2751185792 | Kitasatospora arboriphila NRRL B-24581 | Isolate | Unclassified |
| 448 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 449 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 450 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 451 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 452 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 453 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 454 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 455 | 2808606306 | Microbacterium sp. SLBN-146 | Isolate | Unclassified |
| 456 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 457 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 458 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 459 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 460 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 461 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 462 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 463 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 464 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 465 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 466 | 2842775625 | Roseomonas sp. R-71825 | Isolate | Unclassified |
| 467 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 468 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 469 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 470 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 471 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 472 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 473 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 474 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 475 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 476 | 2883577096 | Roseococcus sp. SYP-B2431 | Isolate | Rhizosphere |
| 477 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 478 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 479 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 480 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 481 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 482 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 483 | 2887478801 | Catellatospora paridis NEAU-CL2 | Isolate | Rhizosphere |
| 484 | 2894772417 | Roseomonas oryzicola KCTC 22478 | Isolate | Rhizosphere |
| 485 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 486 | 2897561785 | Pseudoclavibacter endophyticus EGI 60007 | Isolate | Unclassified |
| 487 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 488 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 489 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 490 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 491 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 492 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 493 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 494 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 495 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 496 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 497 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 498 | 2908811453 | Rhodococcus sp. 1R11 | Isolate | Unclassified |
| 499 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 500 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 501 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 502 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 503 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 504 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 505 | 2919713450 | Nocardia kruczakiae 4272 | Isolate | Rhizosphere |
| 506 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 507 | 2925326138 | Paenibacillus hemerocallicola KCTC 33185 | Isolate | Unclassified |
| 508 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 509 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 510 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 511 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 512 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 513 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 514 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 515 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 516 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 517 | 2941479691 | |||
| 518 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 519 | 2946080515 | Microbacterium sp. W4I20 | Isolate | Rhizosphere |
| 520 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 521 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 522 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 523 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 524 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 525 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 526 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 527 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 528 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 529 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 530 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 531 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 532 | 8055034563 | Leucobacter allii H21R-40 | Isolate | Rhizosphere |
| 533 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 534 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
| 535 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 536 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.83 |
| Metatranscriptomes | 0 |
| Isolates | 11.17 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.18 |
| Bulb | 0 |
| Endosphere | 11.08 |
| Nodule | 2.68 |
| Rhizoplane | 5.18 |
| Rhizosphere | 65.15 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.71 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10000424 | 3300001979 | Bacteria | 18050 |
| 2 | JGI25155J39150_1000432 | 3300002704 | Bacteria | 11216 |
| 3 | JGI25155J39150_1000469 | 3300002704 | Bacteria | 10099 |
| 4 | JGI25156J39149_1000314 | 3300002705 | Bacteria | 32036 |
| 5 | JGI25156J39149_1001147 | 3300002705 | Bacteria | 11872 |
| 6 | JGI25156J39149_1001292 | 3300002705 | Bacteria | 10864 |
| 7 | JGI25154J39366_1000961 | 3300002738 | Bacteria | 11872 |
| 8 | JGI25154J39366_1001064 | 3300002738 | Bacteria | 10864 |
| 9 | JGI25157J39369_1000990 | 3300002741 | Bacteria | 13286 |
| 10 | JGI25151J46595_10000291 | 3300003187 | Bacteria | 56656 |
| 11 | JGI25406J46586_10000343 | 3300003203 | Bacteria | 21056 |
| 12 | JGI25153J46596_10006349 | 3300003215 | Bacteria | 6005 |
| 13 | JGI25153J46596_10006551 | 3300003215 | Bacteria | 5871 |
| 14 | JGI25153J46596_10028010 | 3300003215 | Bacteria | 1962 |
| 15 | rootH2_10050768 | 3300003320 | Bacteria | 14939 |
| 16 | rootL2_10133328 | 3300003322 | Bacteria | 2860 |
| 17 | rootL2_10186049 | 3300003322 | Bacteria | 2820 |
| 18 | Ga0055538_1000002 | 3300003751 | Bacteria | 999437 |
| 19 | Ga0055538_1000019 | 3300003751 | Bacteria | 282365 |
| 20 | Ga0055539_1000002 | 3300003752 | Bacteria | 999437 |
| 21 | Ga0055539_1000024 | 3300003752 | Bacteria | 282365 |
| 22 | Ga0055533_1000004 | 3300003756 | Bacteria | 999437 |
| 23 | Ga0055533_1000032 | 3300003756 | Bacteria | 282365 |
| 24 | Ga0055532_1000102 | 3300003758 | Bacteria | 91562 |
| 25 | Ga0055525_1000002 | 3300003759 | Bacteria | 999437 |
| 26 | Ga0055525_1000041 | 3300003759 | Bacteria | 282365 |
| 27 | Ga0055526_1001849 | 3300003771 | Bacteria | 14654 |
| 28 | Ga0055524_1028161 | 3300003775 | Bacteria | 1689 |
| 29 | Ga0055536_1000058 | 3300003781 | Bacteria | 104496 |
| 30 | Ga0055536_1000175 | 3300003781 | Bacteria | 53825 |
| 31 | Ga0055534_1000403 | 3300003784 | Bacteria | 26599 |
| 32 | Ga0055530_10000200 | 3300003791 | Bacteria | 53825 |
| 33 | Ga0055540_1000516 | 3300003792 | Bacteria | 29231 |
| 34 | Ga0055540_1000568 | 3300003792 | Bacteria | 27153 |
| 35 | Ga0055540_1003036 | 3300003792 | Bacteria | 8376 |
| 36 | Ga0055540_1010535 | 3300003792 | Bacteria | 3069 |
| 37 | Ga0055541_1000002 | 3300003841 | Bacteria | 896405 |
| 38 | Ga0055541_1000018 | 3300003841 | Bacteria | 282365 |
| 39 | JGI25405J52794_10002710 | 3300003911 | Bacteria | 3075 |
| 40 | Ga0070658_10020589 | 3300005327 | Bacteria | 5287 |
| 41 | Ga0070683_100026259 | 3300005329 | Bacteria | 5241 |
| 42 | Ga0070683_100104654 | 3300005329 | Bacteria | 2667 |
| 43 | Ga0068869_100204959 | 3300005334 | Bacteria | 1557 |
| 44 | Ga0070680_100026388 | 3300005336 | Bacteria | 4647 |
| 45 | Ga0068868_100049983 | 3300005338 | Bacteria | 3283 |
| 46 | Ga0070689_100006722 | 3300005340 | Bacteria | 7994 |
| 47 | Ga0070691_10028918 | 3300005341 | Bacteria | 2592 |
| 48 | Ga0070675_100025603 | 3300005354 | Bacteria | 4730 |
| 49 | Ga0070671_100016593 | 3300005355 | Bacteria | 5954 |
| 50 | Ga0070674_100036796 | 3300005356 | Bacteria | 3289 |
| 51 | Ga0070674_100060048 | 3300005356 | Bacteria | 2649 |
| 52 | Ga0070659_100093457 | 3300005366 | Bacteria | 2413 |
| 53 | Ga0070709_10015869 | 3300005434 | Bacteria | 4289 |
| 54 | Ga0070714_100013296 | 3300005435 | Bacteria | 6594 |
| 55 | Ga0070714_100142842 | 3300005435 | Bacteria | 2150 |
| 56 | Ga0070713_100133787 | 3300005436 | Bacteria | 2189 |
| 57 | Ga0070710_10088314 | 3300005437 | Bacteria | 1824 |
| 58 | Ga0070700_100008200 | 3300005441 | Bacteria | 5684 |
| 59 | Ga0070700_100075304 | 3300005441 | Bacteria | 2164 |
| 60 | Ga0070708_100024334 | 3300005445 | Bacteria | 5164 |
| 61 | Ga0070662_100169586 | 3300005457 | Bacteria | 1713 |
| 62 | Ga0070706_100008592 | 3300005467 | Bacteria | 9521 |
| 63 | Ga0070706_100031146 | 3300005467 | Bacteria | 4919 |
| 64 | Ga0070707_100014383 | 3300005468 | Bacteria | 7418 |
| 65 | Ga0070698_100007330 | 3300005471 | Bacteria | 11941 |
| 66 | Ga0070698_100152523 | 3300005471 | Bacteria | 2258 |
| 67 | Ga0070699_100014800 | 3300005518 | Bacteria | 6707 |
| 68 | Ga0070679_100026332 | 3300005530 | Bacteria | 5712 |
| 69 | Ga0070697_100014114 | 3300005536 | Bacteria | 6274 |
| 70 | Ga0070697_100027393 | 3300005536 | Bacteria | 4559 |
| 71 | Ga0068853_100034457 | 3300005539 | Bacteria | 4297 |
| 72 | Ga0070686_100002853 | 3300005544 | Bacteria | 9519 |
| 73 | Ga0070686_100068182 | 3300005544 | Bacteria | 2320 |
| 74 | Ga0068855_100005098 | 3300005563 | Bacteria | 16012 |
| 75 | Ga0068855_100010105 | 3300005563 | Bacteria | 11374 |
| 76 | Ga0068855_100038271 | 3300005563 | Bacteria | 5699 |
| 77 | Ga0070664_100128410 | 3300005564 | Bacteria | 2225 |
| 78 | Ga0068857_100160130 | 3300005577 | Bacteria | 2042 |
| 79 | Ga0068856_100032432 | 3300005614 | Bacteria | 5114 |
| 80 | Ga0068856_100112484 | 3300005614 | Bacteria | 2720 |
| 81 | Ga0068852_100032627 | 3300005616 | Bacteria | 4314 |
| 82 | Ga0068859_100093301 | 3300005617 | Bacteria | 3062 |
| 83 | Ga0068864_100152928 | 3300005618 | Bacteria | 2092 |
| 84 | Ga0068864_100153684 | 3300005618 | Bacteria | 2087 |
| 85 | Ga0081455_10000019 | 3300005937 | Bacteria | 173330 |
| 86 | Ga0081455_10003434 | 3300005937 | Bacteria | 18215 |
| 87 | Ga0081455_10012375 | 3300005937 | Bacteria | 8514 |
| 88 | Ga0081455_10047479 | 3300005937 | Bacteria | 3718 |
| 89 | Ga0081455_10093531 | 3300005937 | Bacteria | 2430 |
| 90 | Ga0081538_10021482 | 3300005981 | Bacteria | 4710 |
| 91 | Ga0081538_10088732 | 3300005981 | Bacteria | 1608 |
| 92 | Ga0081540_1000090 | 3300005983 | Bacteria | 95488 |
| 93 | Ga0081540_1008840 | 3300005983 | Bacteria | 6994 |
| 94 | Ga0081540_1009725 | 3300005983 | Bacteria | 6595 |
| 95 | Ga0081539_10000581 | 3300005985 | Bacteria | 75203 |
| 96 | Ga0081539_10024921 | 3300005985 | Bacteria | 3867 |
| 97 | Ga0070717_10000090 | 3300006028 | Bacteria | 71877 |
| 98 | Ga0070717_10003473 | 3300006028 | Bacteria | 11282 |
| 99 | Ga0070717_10003739 | 3300006028 | Bacteria | 10929 |
| 100 | Ga0070717_10006936 | 3300006028 | Bacteria | 8370 |
| 101 | Ga0075365_10002637 | 3300006038 | Bacteria | 8893 |
| 102 | Ga0075365_10023931 | 3300006038 | Bacteria | 3847 |
| 103 | Ga0075365_10061172 | 3300006038 | Bacteria | 2514 |
| 104 | Ga0075365_10075292 | 3300006038 | Bacteria | 2278 |
| 105 | Ga0075363_100036221 | 3300006048 | Bacteria | 2587 |
| 106 | Ga0075364_10031117 | 3300006051 | Bacteria | 3428 |
| 107 | Ga0075364_10034011 | 3300006051 | Bacteria | 3285 |
| 108 | Ga0075364_10088455 | 3300006051 | Bacteria | 2054 |
| 109 | Ga0075364_10117386 | 3300006051 | Bacteria | 1779 |
| 110 | Ga0070715_10081680 | 3300006163 | Bacteria | 1468 |
| 111 | Ga0070712_100000682 | 3300006175 | Bacteria | 20073 |
| 112 | Ga0075362_10002339 | 3300006177 | Bacteria | 6342 |
| 113 | Ga0075362_10002936 | 3300006177 | Bacteria | 5850 |
| 114 | Ga0075362_10024622 | 3300006177 | Bacteria | 2555 |
| 115 | Ga0075367_10009116 | 3300006178 | Bacteria | 5171 |
| 116 | Ga0075367_10022620 | 3300006178 | Bacteria | 3528 |
| 117 | Ga0075367_10034082 | 3300006178 | Bacteria | 2938 |
| 118 | Ga0075369_10001875 | 3300006186 | Bacteria | 7346 |
| 119 | Ga0075369_10010608 | 3300006186 | Bacteria | 3607 |
| 120 | Ga0075369_10024072 | 3300006186 | Bacteria | 2521 |
| 121 | Ga0075366_10016313 | 3300006195 | Bacteria | 4268 |
| 122 | Ga0075366_10064022 | 3300006195 | Bacteria | 2186 |
| 123 | Ga0075370_10005694 | 3300006353 | Bacteria | 6216 |
| 124 | Ga0075370_10102230 | 3300006353 | Bacteria | 1660 |
| 125 | Ga0068871_100095523 | 3300006358 | Bacteria | 2482 |
| 126 | Ga0075428_100000723 | 3300006844 | Bacteria | 34246 |
| 127 | Ga0075428_100012335 | 3300006844 | Bacteria | 9505 |
| 128 | Ga0075428_100150674 | 3300006844 | Bacteria | 2526 |
| 129 | Ga0075430_100000543 | 3300006846 | Bacteria | 28577 |
| 130 | Ga0075430_100018697 | 3300006846 | Bacteria | 5897 |
| 131 | Ga0075430_100021087 | 3300006846 | Bacteria | 5540 |
| 132 | Ga0075430_100037947 | 3300006846 | Bacteria | 4083 |
| 133 | Ga0075431_100010747 | 3300006847 | Bacteria | 9202 |
| 134 | Ga0075431_100011584 | 3300006847 | Bacteria | 8892 |
| 135 | Ga0075431_100067071 | 3300006847 | Bacteria | 3705 |
| 136 | Ga0075434_100002827 | 3300006871 | Bacteria | 15376 |
| 137 | Ga0075434_100052338 | 3300006871 | Bacteria | 4057 |
| 138 | Ga0075434_100104117 | 3300006871 | Bacteria | 2847 |
| 139 | Ga0075429_100008420 | 3300006880 | Bacteria | 8974 |
| 140 | Ga0075429_100076672 | 3300006880 | Bacteria | 2912 |
| 141 | Ga0097620_100093303 | 3300006931 | Bacteria | 3062 |
| 142 | Ga0099826_10000009 | 3300006948 | Bacteria | 336081 |
| 143 | Ga0075435_100095730 | 3300007076 | Bacteria | 2455 |
| 144 | Ga0099795_10007558 | 3300007788 | Bacteria | 3042 |
| 145 | Ga0105251_10000050 | 3300009011 | Bacteria | 108597 |
| 146 | Ga0105251_10001403 | 3300009011 | Bacteria | 20756 |
| 147 | Ga0105251_10006219 | 3300009011 | Bacteria | 7658 |
| 148 | Ga0105244_10021577 | 3300009036 | Bacteria | 3561 |
| 149 | Ga0105244_10032683 | 3300009036 | Bacteria | 2751 |
| 150 | Ga0105250_10006158 | 3300009092 | Bacteria | 5272 |
| 151 | Ga0105240_10001785 | 3300009093 | Bacteria | 36285 |
| 152 | Ga0105240_10003659 | 3300009093 | Bacteria | 23796 |
| 153 | Ga0105240_10006815 | 3300009093 | Bacteria | 16707 |
| 154 | Ga0105240_10045320 | 3300009093 | Bacteria | 5580 |
| 155 | Ga0105240_10235787 | 3300009093 | Bacteria | 2124 |
| 156 | Ga0105240_10331839 | 3300009093 | Unclassified | 1730 |
| 157 | Ga0105240_10383216 | 3300009093 | Bacteria | 1587 |
| 158 | Ga0111539_10022604 | 3300009094 | Bacteria | 7726 |
| 159 | Ga0111539_10029801 | 3300009094 | Bacteria | 6642 |
| 160 | Ga0111539_10096026 | 3300009094 | Bacteria | 3481 |
| 161 | Ga0111539_10128838 | 3300009094 | Bacteria | 2964 |
| 162 | Ga0114129_10004497 | 3300009147 | Bacteria | 19676 |
| 163 | Ga0114129_10038492 | 3300009147 | Bacteria | 6745 |
| 164 | Ga0105243_10069218 | 3300009148 | Bacteria | 2846 |
| 165 | Ga0105242_10291514 | 3300009176 | Bacteria | 1486 |
| 166 | Ga0105248_10001640 | 3300009177 | Bacteria | 24874 |
| 167 | Ga0105248_10096017 | 3300009177 | Bacteria | 3338 |
| 168 | Ga0105248_10362004 | 3300009177 | Bacteria | 1633 |
| 169 | Ga0105237_10035681 | 3300009545 | Bacteria | 5031 |
| 170 | Ga0105237_10112168 | 3300009545 | Bacteria | 2719 |
| 171 | Ga0105238_10028484 | 3300009551 | Bacteria | 5691 |
| 172 | Ga0123341_1008347 | 3300009765 | Bacteria | 9467 |
| 173 | Ga0123342_1017545 | 3300009766 | Bacteria | 5923 |
| 174 | Ga0099796_10000715 | 3300010159 | Bacteria | 5878 |
| 175 | Ga0105239_10171174 | 3300010375 | Bacteria | 2429 |
| 176 | Ga0105239_10293817 | 3300010375 | Bacteria | 1830 |
| 177 | Ga0105239_10338126 | 3300010375 | Bacteria | 1699 |
| 178 | Ga0105246_10047901 | 3300011119 | Bacteria | 2921 |
| 179 | Ga0157370_10000641 | 3300013104 | Bacteria | 43559 |
| 180 | Ga0157370_10000995 | 3300013104 | Bacteria | 35754 |
| 181 | Ga0157369_10064273 | 3300013105 | Bacteria | 3952 |
| 182 | Ga0157369_10116729 | 3300013105 | Bacteria | 2834 |
| 183 | Ga0157369_10186220 | 3300013105 | Bacteria | 2183 |
| 184 | Ga0171463_1002 | 3300013249 | Bacteria | 1274851 |
| 185 | Ga0157374_10015089 | 3300013296 | Bacteria | 6774 |
| 186 | Ga0157374_10160845 | 3300013296 | Unclassified | 2187 |
| 187 | Ga0163162_10005236 | 3300013306 | Bacteria | 12505 |
| 188 | Ga0163162_10007657 | 3300013306 | Bacteria | 10519 |
| 189 | Ga0163162_10154658 | 3300013306 | Bacteria | 2413 |
| 190 | Ga0163162_10268798 | 3300013306 | Bacteria | 1837 |
| 191 | Ga0157372_10115854 | 3300013307 | Bacteria | 3072 |
| 192 | Ga0163163_10037466 | 3300014325 | Bacteria | 4717 |
| 193 | Ga0163163_10084055 | 3300014325 | Unclassified | 3189 |
| 194 | Ga0163163_10101321 | 3300014325 | Bacteria | 2902 |
| 195 | Ga0163163_10105027 | 3300014325 | Bacteria | 2850 |
| 196 | Ga0182008_10000998 | 3300014497 | Bacteria | 19680 |
| 197 | Ga0182008_10071551 | 3300014497 | Bacteria | 1706 |
| 198 | Ga0157379_10006783 | 3300014968 | Bacteria | 9899 |
| 199 | Ga0157379_10258949 | 3300014968 | Bacteria | 1581 |
| 200 | Ga0157376_10035694 | 3300014969 | Bacteria | 4023 |
| 201 | Ga0182006_1005000 | 3300015261 | Bacteria | 6390 |
| 202 | Ga0182006_1036424 | 3300015261 | Bacteria | 1956 |
| 203 | Ga0183365_10036 | 3300015684 | Bacteria | 2809 |
| 204 | Ga0183363_1033 | 3300015690 | Bacteria | 47872 |
| 205 | Ga0183361_10008 | 3300016635 | Bacteria | 259171 |
| 206 | Ga0163161_10137471 | 3300017792 | Bacteria | 1848 |
| 207 | Ga0213872_10005244 | 3300021361 | Bacteria | 6704 |
| 208 | Ga0213872_10011003 | 3300021361 | Bacteria | 4292 |
| 209 | Ga0213872_10020337 | 3300021361 | Bacteria | 3058 |
| 210 | Ga0213875_10000003 | 3300021388 | Bacteria | 719367 |
| 211 | Ga0213875_10002676 | 3300021388 | Bacteria | 10519 |
| 212 | Ga0213875_10003117 | 3300021388 | Bacteria | 9544 |
| 213 | Ga0209435_100030 | 3300025206 | Bacteria | 170822 |
| 214 | Ga0209435_100134 | 3300025206 | Bacteria | 25335 |
| 215 | Ga0209784_100002 | 3300025224 | Bacteria | 1753105 |
| 216 | Ga0209784_100009 | 3300025224 | Bacteria | 688031 |
| 217 | Ga0209566_100003 | 3300025225 | Bacteria | 1753105 |
| 218 | Ga0209566_100007 | 3300025225 | Bacteria | 688031 |
| 219 | Ga0209674_100004 | 3300025226 | Bacteria | 1753105 |
| 220 | Ga0209674_100018 | 3300025226 | Bacteria | 688031 |
| 221 | Ga0209147_100159 | 3300025229 | Bacteria | 91615 |
| 222 | Ga0209563_100006 | 3300025230 | Bacteria | 1753105 |
| 223 | Ga0209563_100020 | 3300025230 | Bacteria | 688031 |
| 224 | Ga0209437_100284 | 3300025233 | Bacteria | 74641 |
| 225 | Ga0209258_100259 | 3300025242 | Bacteria | 92050 |
| 226 | Ga0209646_1000057 | 3300025246 | Bacteria | 266384 |
| 227 | Ga0209646_1000100 | 3300025246 | Bacteria | 170822 |
| 228 | Ga0209026_1000091 | 3300025250 | Bacteria | 171170 |
| 229 | Ga0209677_100003 | 3300025253 | Bacteria | 1753105 |
| 230 | Ga0209677_100010 | 3300025253 | Bacteria | 688031 |
| 231 | Ga0209759_1000084 | 3300025256 | Bacteria | 169233 |
| 232 | Ga0209759_1000123 | 3300025256 | Bacteria | 137819 |
| 233 | Ga0209759_1000141 | 3300025256 | Bacteria | 124528 |
| 234 | Ga0209455_1004064 | 3300025272 | Bacteria | 4931 |
| 235 | Ga0209675_1000147 | 3300025291 | Bacteria | 93657 |
| 236 | Ga0209675_1005918 | 3300025291 | Bacteria | 5017 |
| 237 | Ga0209676_1000003 | 3300025292 | Bacteria | 1454178 |
| 238 | Ga0209676_1000210 | 3300025292 | Bacteria | 130159 |
| 239 | Ga0209025_1000051 | 3300025294 | Bacteria | 330080 |
| 240 | Ga0209025_1025482 | 3300025294 | Bacteria | 3008 |
| 241 | Ga0209025_1035155 | 3300025294 | Bacteria | 2270 |
| 242 | Ga0209564_1000185 | 3300025295 | Bacteria | 149925 |
| 243 | Ga0209564_1000324 | 3300025295 | Bacteria | 93018 |
| 244 | Ga0209758_1000294 | 3300025297 | Bacteria | 98618 |
| 245 | Ga0209758_1000702 | 3300025297 | Bacteria | 49657 |
| 246 | Ga0209050_1000004 | 3300025298 | Bacteria | 1600040 |
| 247 | Ga0209050_1000140 | 3300025298 | Bacteria | 173241 |
| 248 | Ga0209256_1001487 | 3300025299 | Bacteria | 23902 |
| 249 | Ga0207426_1011906 | 3300025302 | Bacteria | 3291 |
| 250 | Ga0207426_1023279 | 3300025302 | Bacteria | 2115 |
| 251 | Ga0209051_1000341 | 3300025303 | Bacteria | 70054 |
| 252 | Ga0209051_1000964 | 3300025303 | Bacteria | 28187 |
| 253 | Ga0209051_1001433 | 3300025303 | Bacteria | 20390 |
| 254 | Ga0209051_1014824 | 3300025303 | Bacteria | 3620 |
| 255 | Ga0209051_1015821 | 3300025303 | Bacteria | 3454 |
| 256 | Ga0207697_10064516 | 3300025315 | Bacteria | 1527 |
| 257 | Ga0207655_1017113 | 3300025728 | Bacteria | 3926 |
| 258 | Ga0207655_1018378 | 3300025728 | Bacteria | 3711 |
| 259 | Ga0207713_1000245 | 3300025735 | Bacteria | 69586 |
| 260 | Ga0207713_1003742 | 3300025735 | Bacteria | 10215 |
| 261 | Ga0207705_10017332 | 3300025909 | Bacteria | 5157 |
| 262 | Ga0207684_10013530 | 3300025910 | Bacteria | 7055 |
| 263 | Ga0207684_10024208 | 3300025910 | Bacteria | 5177 |
| 264 | Ga0207684_10065690 | 3300025910 | Bacteria | 3080 |
| 265 | Ga0207695_10005698 | 3300025913 | Bacteria | 16426 |
| 266 | Ga0207671_10048210 | 3300025914 | Bacteria | 3153 |
| 267 | Ga0207693_10003422 | 3300025915 | Bacteria | 13542 |
| 268 | Ga0207693_10012484 | 3300025915 | Bacteria | 6861 |
| 269 | Ga0207693_10111991 | 3300025915 | Bacteria | 2141 |
| 270 | Ga0207652_10011383 | 3300025921 | Bacteria | 7169 |
| 271 | Ga0207652_10264113 | 3300025921 | Bacteria | 1553 |
| 272 | Ga0207646_10008930 | 3300025922 | Bacteria | 9981 |
| 273 | Ga0207694_10015844 | 3300025924 | Bacteria | 5686 |
| 274 | Ga0207694_10021462 | 3300025924 | Bacteria | 4893 |
| 275 | Ga0207687_10012572 | 3300025927 | Bacteria | 5529 |
| 276 | Ga0207700_10022953 | 3300025928 | Bacteria | 4290 |
| 277 | Ga0207700_10033739 | 3300025928 | Bacteria | 3665 |
| 278 | Ga0207664_10038815 | 3300025929 | Bacteria | 3694 |
| 279 | Ga0207644_10023749 | 3300025931 | Bacteria | 4203 |
| 280 | Ga0207644_10061004 | 3300025931 | Bacteria | 2730 |
| 281 | Ga0207644_10100625 | 3300025931 | Bacteria | 2170 |
| 282 | Ga0207706_10168596 | 3300025933 | Bacteria | 1924 |
| 283 | Ga0207706_10182742 | 3300025933 | Bacteria | 1842 |
| 284 | Ga0207686_10047378 | 3300025934 | Bacteria | 2657 |
| 285 | Ga0207709_10040139 | 3300025935 | Bacteria | 2800 |
| 286 | Ga0207670_10000848 | 3300025936 | Bacteria | 16042 |
| 287 | Ga0207670_10064098 | 3300025936 | Bacteria | 2517 |
| 288 | Ga0207665_10070815 | 3300025939 | Bacteria | 2380 |
| 289 | Ga0207711_10158860 | 3300025941 | Bacteria | 2045 |
| 290 | Ga0207667_10026499 | 3300025949 | Bacteria | 6333 |
| 291 | Ga0207667_10033200 | 3300025949 | Bacteria | 5552 |
| 292 | Ga0207667_10173526 | 3300025949 | Bacteria | 2216 |
| 293 | Ga0207651_10140665 | 3300025960 | Bacteria | 1864 |
| 294 | Ga0207712_10056066 | 3300025961 | Bacteria | 2775 |
| 295 | Ga0207658_10201018 | 3300025986 | Bacteria | 1664 |
| 296 | Ga0207677_10248722 | 3300026023 | Bacteria | 1443 |
| 297 | Ga0207703_10009447 | 3300026035 | Bacteria | 7660 |
| 298 | Ga0207703_10053157 | 3300026035 | Bacteria | 3292 |
| 299 | Ga0207639_10026530 | 3300026041 | Bacteria | 4211 |
| 300 | Ga0207708_10060477 | 3300026075 | Bacteria | 2891 |
| 301 | Ga0207676_10026504 | 3300026095 | Bacteria | 4312 |
| 302 | Ga0207676_10128799 | 3300026095 | Bacteria | 2148 |
| 303 | Ga0207676_10222681 | 3300026095 | Bacteria | 1681 |
| 304 | Ga0207674_10203476 | 3300026116 | Bacteria | 1929 |
| 305 | Ga0207674_10228205 | 3300026116 | Bacteria | 1810 |
| 306 | Ga0207698_10147725 | 3300026142 | Bacteria | 2035 |
| 307 | Ga0209371_1004585 | 3300027312 | Bacteria | 5914 |
| 308 | Ga0209589_1000008 | 3300027357 | Bacteria | 259970 |
| 309 | Ga0209282_1000017 | 3300027666 | Bacteria | 191482 |
| 310 | Ga0268266_10007720 | 3300028379 | Bacteria | 9655 |
| 311 | Ga0268266_10036429 | 3300028379 | Bacteria | 4188 |
| 312 | Ga0268265_10017350 | 3300028380 | Bacteria | 4965 |
| 313 | Ga0265319_1015553 | 3300028563 | Bacteria | 2947 |
| 314 | Ga0265334_10001418 | 3300028573 | Bacteria | 11534 |
| 315 | Ga0265318_10000063 | 3300028577 | Bacteria | 105280 |
| 316 | Ga0307515_10002150 | 3300028794 | Bacteria | 43260 |
| 317 | Ga0307515_10049357 | 3300028794 | Bacteria | 6335 |
| 318 | Ga0265338_10156490 | 3300028800 | Bacteria | 1765 |
| 319 | Ga0268256_1004341 | 3300030500 | Bacteria | 5914 |
| 320 | Ga0265332_10021801 | 3300031238 | Bacteria | 2828 |
| 321 | Ga0265320_10000745 | 3300031240 | Bacteria | 24975 |
| 322 | Ga0265325_10000523 | 3300031241 | Bacteria | 27679 |
| 323 | Ga0265331_10005957 | 3300031250 | Bacteria | 7277 |
| 324 | Ga0265331_10010753 | 3300031250 | Bacteria | 5036 |
| 325 | Ga0265327_10001095 | 3300031251 | Bacteria | 37570 |
| 326 | Ga0265327_10002079 | 3300031251 | Bacteria | 22367 |
| 327 | Ga0265327_10031734 | 3300031251 | Bacteria | 2965 |
| 328 | Ga0265316_10001831 | 3300031344 | Bacteria | 22378 |
| 329 | Ga0265316_10043553 | 3300031344 | Bacteria | 3576 |
| 330 | Ga0307513_10001121 | 3300031456 | Bacteria | 38802 |
| 331 | Ga0307513_10001865 | 3300031456 | Bacteria | 29946 |
| 332 | Ga0265313_10016373 | 3300031595 | Bacteria | 4263 |
| 333 | Ga0265313_10035711 | 3300031595 | Bacteria | 2501 |
| 334 | Ga0265314_10034388 | 3300031711 | Bacteria | 3704 |
| 335 | Ga0316576_10001880 | 3300031727 | Bacteria | 11675 |
| 336 | Ga0316576_10068124 | 3300031727 | Bacteria | 2621 |
| 337 | Ga0307516_10016684 | 3300031730 | Bacteria | 7668 |
| 338 | Ga0307510_10117664 | 3300033180 | Bacteria | 2374 |
| 339 | Ga0373926_0020143 | 3300035083 | Bacteria | 2303 |
| 340 | Ga0373929_0009921 | 3300035085 | Bacteria | 1771 |
| 341 | Ga0373940_0001174 | 3300035088 | Bacteria | 4600 |
| 342 | Ga0373944_0002802 | 3300035089 | Bacteria | 4458 |
| 343 | Ga0373949_0005681 | 3300035090 | Bacteria | 2777 |
| 344 | Ga0373923_0025466 | 3300035111 | Bacteria | 2345 |
| 345 | Ga0373932_0007326 | 3300035112 | Bacteria | 2627 |
| 346 | Ga0373936_0007006 | 3300035113 | Bacteria | 4242 |
| 347 | Ga0373939_0006094 | 3300035114 | Bacteria | 2897 |
| 348 | Ga0373945_0003110 | 3300035116 | Bacteria | 5209 |
| 349 | Ga0373953_0006456 | 3300035117 | Bacteria | 3863 |
| 350 | Ga0373954_0000282 | 3300035118 | Bacteria | 18420 |
| 351 | Ga0373954_0001082 | 3300035118 | Bacteria | 10898 |
| 352 | Ga0373954_0037711 | 3300035118 | Bacteria | 2246 |
| 353 | Ga0373956_0001412 | 3300035119 | Bacteria | 9939 |
| 354 | Ga0373956_0005724 | 3300035119 | Bacteria | 4969 |
| 355 | Ga0373956_0038803 | 3300035119 | Bacteria | 2108 |
| 356 | Ga0373960_0001745 | 3300035121 | Bacteria | 4868 |
| 357 | Ga0373960_0017262 | 3300035121 | Bacteria | 1868 |
| 358 | Ga0373943_0042097 | 3300035170 | Bacteria | 2212 |
| 359 | Ga0373955_0001129 | 3300035172 | Bacteria | 11337 |
| 360 | Ga0373955_0005927 | 3300035172 | Bacteria | 5532 |
| 361 | Ga0373955_0137055 | 3300035172 | Bacteria | 1432 |
| 362 | Ga0373942_0009219 | 3300035207 | Bacteria | 2307 |
| 363 | Ga0373924_0062523 | 3300035410 | Bacteria | 1560 |
| 364 | Ga0373931_0003182 | 3300035691 | Bacteria | 7324 |
| 365 | Ga0373931_0003892 | 3300035691 | Bacteria | 6753 |
| 366 | Ga0373931_0008217 | 3300035691 | Bacteria | 4944 |
| 367 | Ga0373931_0010834 | 3300035691 | Bacteria | 4388 |
| 368 | Ga0373935_0112091 | 3300035692 | Bacteria | 1811 |
| 369 | Ga0373935_0139792 | 3300035692 | Bacteria | 1635 |
| 370 | Ga0373927_0000142 | 3300035695 | Bacteria | 55761 |
| 371 | Ga0373927_0044709 | 3300035695 | Bacteria | 2865 |
| 372 | Ga0373927_0087035 | 3300035695 | Bacteria | 2028 |
| 373 | Ga0373933_0016280 | 3300035724 | Bacteria | 4155 |
| 374 | Ga0373933_0025495 | 3300035724 | Bacteria | 3391 |
| 375 | Ga0373933_0058029 | 3300035724 | Bacteria | 2327 |
| 376 | Ga0373947_0002200 | 3300035725 | Bacteria | 11814 |
| 377 | Ga0373947_0047995 | 3300035725 | Bacteria | 2561 |
| 378 | Ga0373937_0002042 | 3300036401 | Bacteria | 16867 |
| 379 | Ga0373937_0002212 | 3300036401 | Bacteria | 16254 |
| 380 | Ga0373937_0009659 | 3300036401 | Bacteria | 8401 |
| 381 | Ga0373937_0014426 | 3300036401 | Bacteria | 6978 |
| 382 | Ga0373937_0034890 | 3300036401 | Bacteria | 4576 |
| 383 | Ga0373937_0052862 | 3300036401 | Bacteria | 3726 |
| 384 | Ga0373937_0059883 | 3300036401 | Bacteria | 3499 |
| 385 | Ga0373937_0248099 | 3300036401 | Bacteria | 1678 |
| 386 | Ga0316584_0018567 | 3300036712 | Bacteria | 5019 |
| 387 | Ga0316584_0062883 | 3300036712 | Bacteria | 2779 |
| 388 | Ga0373925_0021114 | 3300037068 | Bacteria | 4744 |
| 389 | Ga0373925_0039075 | 3300037068 | Bacteria | 3511 |
| 390 | Ga0373925_0142994 | 3300037068 | Bacteria | 1873 |
| 391 | Ga0395900_0001597 | 3300037418 | Bacteria | 26744 |
| 392 | Ga0395900_0161453 | 3300037418 | Bacteria | 2285 |
| 393 | Ga0395900_0187034 | 3300037418 | Bacteria | 2102 |
| 394 | Ga0395898_0041200 | 3300037466 | Bacteria | 4562 |
| 395 | Ga0395905_0000822 | 3300037471 | Bacteria | 40715 |
| 396 | Ga0395905_0006358 | 3300037471 | Bacteria | 11907 |
| 397 | Ga0436364_0251269 | 3300037853 | Bacteria | 10233 |
| 398 | Ga0436364_0384470 | 3300037853 | Bacteria | 72384 |
| 399 | Ga0436364_0505381 | 3300037853 | Bacteria | 66783 |
| 400 | Ga0436364_0935620 | 3300037853 | Bacteria | 17749 |
| 401 | Ga0436364_1068046 | 3300037853 | Bacteria | 2333 |
| 402 | Ga0436364_1093291 | 3300037853 | Bacteria | 66156 |
| 403 | Ga0436364_1128745 | 3300037853 | Bacteria | 13611 |
| 404 | Ga0436364_1331333 | 3300037853 | Bacteria | 94585 |
| 405 | Ga0395901_0001683 | 3300038443 | Bacteria | 22824 |
| 406 | Ga0395901_0192850 | 3300038443 | Bacteria | 2136 |
| 407 | Ga0436365_0734924 | 3300039437 | Bacteria | 2430 |
| 408 | Ga0436365_1741883 | 3300039437 | Bacteria | 10749 |
| 409 | Ga0436360_0322442 | 3300039438 | Bacteria | 2441 |
| 410 | Ga0436360_0891318 | 3300039438 | Bacteria | 4655 |
| 411 | Ga0436360_1095189 | 3300039438 | Bacteria | 3335 |
| 412 | Ga0436360_1173188 | 3300039438 | Bacteria | 1801 |
| 413 | Ga0436361_0505480 | 3300039447 | Bacteria | 5357 |
| 414 | Ga0436361_0509106 | 3300039447 | Bacteria | 5828 |
| 415 | Ga0436361_0544047 | 3300039447 | Bacteria | 22237 |
| 416 | Ga0436361_0722746 | 3300039447 | Bacteria | 2087 |
| 417 | Ga0436363_1314326 | 3300039450 | Bacteria | 4906 |
| 418 | Ga0436362_0144684 | 3300039453 | Bacteria | 2374 |
| 419 | Ga0439438_000277 | 3300041405 | Bacteria | 23094 |
| 420 | Ga0439466_0003181 | 3300041411 | Bacteria | 6388 |
| 421 | Ga0439431_0001299 | 3300041997 | Bacteria | 5493 |
| 422 | Ga0439456_000129 | 3300042013 | Bacteria | 23611 |
| 423 | Ga0439463_000319 | 3300042016 | Bacteria | 13504 |
| 424 | Ga0439463_015876 | 3300042016 | Bacteria | 1862 |
| 425 | Ga0450902_000251 | 3300042137 | Bacteria | 6387 |
| 426 | Ga0450905_000059 | 3300042142 | Bacteria | 9963 |
| 427 | Ga0439434_0022437 | 3300042435 | Bacteria | 1898 |
| 428 | Ga0439435_0026989 | 3300042436 | Bacteria | 1533 |
| 429 | Ga0450901_000272 | 3300042533 | Bacteria | 6288 |
| 430 | Ga0439440_0007012 | 3300042993 | Bacteria | 2284 |
| 431 | Ga0466969_0031089 | 3300044656 | Bacteria | 2719 |
| 432 | Ga0466969_0052929 | 3300044656 | Bacteria | 1993 |
| 433 | Ga0466972_0006560 | 3300044658 | Bacteria | 5847 |
| 434 | Ga0466965_0001487 | 3300044683 | Bacteria | 9485 |
| 435 | Ga0466966_0001908 | 3300044684 | Bacteria | 13511 |
| 436 | Ga0466961_0032134 | 3300044693 | Bacteria | 3372 |
| 437 | Ga0466968_0000230 | 3300044735 | Bacteria | 17488 |
| 438 | Ga0466970_0014809 | 3300044765 | Bacteria | 4009 |
| 439 | Ga0466970_0084465 | 3300044765 | Bacteria | 1718 |
| 440 | Ga0466957_0005103 | 3300044842 | Bacteria | 7337 |
| 441 | Ga0466959_0009066 | 3300045049 | Bacteria | 7060 |
| 442 | Ga0466958_0033395 | 3300045836 | Bacteria | 3065 |
| 443 | Ga0466967_0174888 | 3300045976 | Bacteria | 2022 |
| 444 | Ga0466967_0239867 | 3300045976 | Bacteria | 1729 |
| 445 | Ga0495617_007138 | 3300046452 | Bacteria | 3893 |
| 446 | Ga0495617_007537 | 3300046452 | Bacteria | 3774 |
| 447 | Ga0495627_034703 | 3300046453 | Bacteria | 1575 |
| 448 | Ga0495592_0032137 | 3300046454 | Bacteria | 3963 |
| 449 | Ga0495592_0044915 | 3300046454 | Bacteria | 3299 |
| 450 | Ga0495603_0006045 | 3300046455 | Bacteria | 7238 |
| 451 | Ga0495603_0016306 | 3300046455 | Bacteria | 4495 |
| 452 | Ga0495590_0008537 | 3300046457 | Bacteria | 3911 |
| 453 | Ga0495590_0025248 | 3300046457 | Bacteria | 2090 |
| 454 | Ga0495591_000074 | 3300046458 | Bacteria | 114062 |
| 455 | Ga0495591_002611 | 3300046458 | Bacteria | 9890 |
| 456 | Ga0495591_003533 | 3300046458 | Bacteria | 8018 |
| 457 | Ga0495591_004766 | 3300046458 | Bacteria | 6489 |
| 458 | Ga0495591_022844 | 3300046458 | Bacteria | 2015 |
| 459 | Ga0495629_0000294 | 3300046459 | Bacteria | 42988 |
| 460 | Ga0495629_0005958 | 3300046459 | Bacteria | 9076 |
| 461 | Ga0495629_0050235 | 3300046459 | Bacteria | 2921 |
| 462 | Ga0495651_0001331 | 3300046462 | Bacteria | 19131 |
| 463 | Ga0495651_0054232 | 3300046462 | Bacteria | 3084 |
| 464 | Ga0495653_0001016 | 3300046463 | Bacteria | 21632 |
| 465 | Ga0495653_0002851 | 3300046463 | Bacteria | 13814 |
| 466 | Ga0495650_0000143 | 3300046471 | Bacteria | 168096 |
| 467 | Ga0495650_0000401 | 3300046471 | Bacteria | 72284 |
| 468 | Ga0495650_0000588 | 3300046471 | Bacteria | 50452 |
| 469 | Ga0495650_0000592 | 3300046471 | Bacteria | 50128 |
| 470 | Ga0495650_0004127 | 3300046471 | Bacteria | 10120 |
| 471 | Ga0495650_0005087 | 3300046471 | Bacteria | 8695 |
| 472 | Ga0495580_0000323 | 3300046472 | Bacteria | 39066 |
| 473 | Ga0495580_0003629 | 3300046472 | Bacteria | 13070 |
| 474 | Ga0495580_0027475 | 3300046472 | Bacteria | 4140 |
| 475 | Ga0495580_0053287 | 3300046472 | Bacteria | 2855 |
| 476 | Ga0495605_0000001 | 3300046474 | Bacteria | 614538 |
| 477 | Ga0495605_0000066 | 3300046474 | Bacteria | 139260 |
| 478 | Ga0495605_0000091 | 3300046474 | Bacteria | 115482 |
| 479 | Ga0495605_0002280 | 3300046474 | Bacteria | 11978 |
| 480 | Ga0495605_0007266 | 3300046474 | Bacteria | 6291 |
| 481 | Ga0495605_0008779 | 3300046474 | Bacteria | 5702 |
| 482 | Ga0495605_0012615 | 3300046474 | Bacteria | 4679 |
| 483 | Ga0495605_0022630 | 3300046474 | Bacteria | 3316 |
| 484 | Ga0495605_0026235 | 3300046474 | Bacteria | 3030 |
| 485 | Ga0495605_0078051 | 3300046474 | Bacteria | 1552 |
| 486 | Ga0495639_0042342 | 3300046475 | Bacteria | 2053 |
| 487 | Ga0495664_0042449 | 3300046477 | Bacteria | 2694 |
| 488 | Ga0495664_0074136 | 3300046477 | Bacteria | 2035 |
| 489 | Ga0495584_0000846 | 3300046491 | Bacteria | 19793 |
| 490 | Ga0495584_0002425 | 3300046491 | Bacteria | 10573 |
| 491 | Ga0495584_0015298 | 3300046491 | Bacteria | 3909 |
| 492 | Ga0495584_0034437 | 3300046491 | Bacteria | 2562 |
| 493 | Ga0495585_0000127 | 3300046492 | Bacteria | 82252 |
| 494 | Ga0495585_0000129 | 3300046492 | Bacteria | 81888 |
| 495 | Ga0495585_0001065 | 3300046492 | Bacteria | 22614 |
| 496 | Ga0495585_0030928 | 3300046492 | Bacteria | 3043 |
| 497 | Ga0495585_0045428 | 3300046492 | Bacteria | 2451 |
| 498 | Ga0495594_0031347 | 3300046499 | Bacteria | 2881 |
| 499 | Ga0495596_0000020 | 3300046500 | Bacteria | 113608 |
| 500 | Ga0495596_0000039 | 3300046500 | Bacteria | 94926 |
| 501 | Ga0495596_0000093 | 3300046500 | Bacteria | 63014 |
| 502 | Ga0495596_0001366 | 3300046500 | Bacteria | 14048 |
| 503 | Ga0495596_0050782 | 3300046500 | Bacteria | 1625 |
| 504 | Ga0495607_0000018 | 3300046501 | Bacteria | 167673 |
| 505 | Ga0495607_0000112 | 3300046501 | Bacteria | 85239 |
| 506 | Ga0495607_0000291 | 3300046501 | Bacteria | 52902 |
| 507 | Ga0495607_0002244 | 3300046501 | Bacteria | 15952 |
| 508 | Ga0495607_0004619 | 3300046501 | Bacteria | 10079 |
| 509 | Ga0495607_0005556 | 3300046501 | Bacteria | 8994 |
| 510 | Ga0495607_0007404 | 3300046501 | Bacteria | 7598 |
| 511 | Ga0495607_0011693 | 3300046501 | Bacteria | 5826 |
| 512 | Ga0495607_0027691 | 3300046501 | Bacteria | 3501 |
| 513 | Ga0495607_0034890 | 3300046501 | Bacteria | 3048 |
| 514 | Ga0495607_0049280 | 3300046501 | Bacteria | 2457 |
| 515 | Ga0495607_0072623 | 3300046501 | Bacteria | 1915 |
| 516 | Ga0495583_0000356 | 3300046506 | Bacteria | 71830 |
| 517 | Ga0495583_0000964 | 3300046506 | Bacteria | 33212 |
| 518 | Ga0495583_0001205 | 3300046506 | Bacteria | 27737 |
| 519 | Ga0495583_0001302 | 3300046506 | Bacteria | 25950 |
| 520 | Ga0495583_0001341 | 3300046506 | Bacteria | 25516 |
| 521 | Ga0495583_0003226 | 3300046506 | Bacteria | 12753 |
| 522 | Ga0495583_0008152 | 3300046506 | Bacteria | 6447 |
| 523 | Ga0495583_0025948 | 3300046506 | Bacteria | 2916 |
| 524 | Ga0495606_0000013 | 3300046507 | Bacteria | 292850 |
| 525 | Ga0495606_0001129 | 3300046507 | Bacteria | 38083 |
| 526 | Ga0495606_0001769 | 3300046507 | Bacteria | 27670 |
| 527 | Ga0495606_0002361 | 3300046507 | Bacteria | 22160 |
| 528 | Ga0495606_0003982 | 3300046507 | Bacteria | 15119 |
| 529 | Ga0495606_0004304 | 3300046507 | Bacteria | 14332 |
| 530 | Ga0495606_0007124 | 3300046507 | Bacteria | 10108 |
| 531 | Ga0495606_0008235 | 3300046507 | Bacteria | 9107 |
| 532 | Ga0495606_0014622 | 3300046507 | Bacteria | 6107 |
| 533 | Ga0495608_0032488 | 3300046511 | Bacteria | 3528 |
| 534 | Ga0495610_0000241 | 3300046512 | Bacteria | 57706 |
| 535 | Ga0495610_0000814 | 3300046512 | Bacteria | 29268 |
| 536 | Ga0495610_0003250 | 3300046512 | Bacteria | 12840 |
| 537 | Ga0495610_0009338 | 3300046512 | Bacteria | 6209 |
| 538 | Ga0495610_0030686 | 3300046512 | Bacteria | 2813 |
| 539 | Ga0495610_0033014 | 3300046512 | Bacteria | 2680 |
| 540 | Ga0495610_0034278 | 3300046512 | Bacteria | 2615 |
| 541 | Ga0495610_0068255 | 3300046512 | Bacteria | 1667 |
| 542 | Ga0495610_0078693 | 3300046512 | Bacteria | 1519 |
| 543 | Ga0495616_0002672 | 3300046513 | Bacteria | 11696 |
| 544 | Ga0495616_0006880 | 3300046513 | Bacteria | 6847 |
| 545 | Ga0495616_0056840 | 3300046513 | Bacteria | 1931 |
| 546 | Ga0495618_0177486 | 3300046514 | Bacteria | 1354 |
| 547 | Ga0495620_0000540 | 3300046515 | Bacteria | 24076 |
| 548 | Ga0495620_0000678 | 3300046515 | Bacteria | 21047 |
| 549 | Ga0495620_0000810 | 3300046515 | Bacteria | 19231 |
| 550 | Ga0495620_0002166 | 3300046515 | Bacteria | 11417 |
| 551 | Ga0495620_0021849 | 3300046515 | Bacteria | 3097 |
| 552 | Ga0495628_0012650 | 3300046516 | Bacteria | 7109 |
| 553 | Ga0495628_0039477 | 3300046516 | Bacteria | 3776 |
| 554 | Ga0495628_0158167 | 3300046516 | Bacteria | 1723 |
| 555 | Ga0495630_0005357 | 3300046517 | Bacteria | 9048 |
| 556 | Ga0495630_0010165 | 3300046517 | Bacteria | 6784 |
| 557 | Ga0495631_0006666 | 3300046518 | Bacteria | 5937 |
| 558 | Ga0495631_0008600 | 3300046518 | Bacteria | 5137 |
| 559 | Ga0495631_0054493 | 3300046518 | Bacteria | 1743 |
| 560 | Ga0495632_0001463 | 3300046519 | Bacteria | 19628 |
| 561 | Ga0495632_0001842 | 3300046519 | Bacteria | 17082 |
| 562 | Ga0495632_0003165 | 3300046519 | Bacteria | 11872 |
| 563 | Ga0495632_0012803 | 3300046519 | Bacteria | 4815 |
| 564 | Ga0495632_0013668 | 3300046519 | Bacteria | 4619 |
| 565 | Ga0495632_0029793 | 3300046519 | Bacteria | 2838 |
| 566 | Ga0495637_0000021 | 3300046520 | Bacteria | 179141 |
| 567 | Ga0495637_0000039 | 3300046520 | Bacteria | 117112 |
| 568 | Ga0495637_0000093 | 3300046520 | Bacteria | 70257 |
| 569 | Ga0495637_0003954 | 3300046520 | Bacteria | 7756 |
| 570 | Ga0495637_0009400 | 3300046520 | Bacteria | 4770 |
| 571 | Ga0495637_0012673 | 3300046520 | Bacteria | 4026 |
| 572 | Ga0495637_0014476 | 3300046520 | Bacteria | 3722 |
| 573 | Ga0495637_0023177 | 3300046520 | Bacteria | 2825 |
| 574 | Ga0495637_0035556 | 3300046520 | Bacteria | 2174 |
| 575 | Ga0495637_0035563 | 3300046520 | Bacteria | 2174 |
| 576 | Ga0495637_0058971 | 3300046520 | Bacteria | 1581 |
| 577 | Ga0495643_0000004 | 3300046522 | Bacteria | 519944 |
| 578 | Ga0495643_0000017 | 3300046522 | Bacteria | 313381 |
| 579 | Ga0495643_0000971 | 3300046522 | Bacteria | 29402 |
| 580 | Ga0495643_0003304 | 3300046522 | Bacteria | 11912 |
| 581 | Ga0495643_0007847 | 3300046522 | Bacteria | 6823 |
| 582 | Ga0495643_0008233 | 3300046522 | Bacteria | 6625 |
| 583 | Ga0495643_0009867 | 3300046522 | Bacteria | 5902 |
| 584 | Ga0495643_0020831 | 3300046522 | Bacteria | 3772 |
| 585 | Ga0495644_0003889 | 3300046523 | Bacteria | 5880 |
| 586 | Ga0495644_0006565 | 3300046523 | Bacteria | 4504 |
| 587 | Ga0495644_0052340 | 3300046523 | Bacteria | 1533 |
| 588 | Ga0495648_0000085 | 3300046524 | Bacteria | 119901 |
| 589 | Ga0495648_0003337 | 3300046524 | Bacteria | 14158 |
| 590 | Ga0495648_0008954 | 3300046524 | Bacteria | 7820 |
| 591 | Ga0495648_0025775 | 3300046524 | Bacteria | 3973 |
| 592 | Ga0495666_0012098 | 3300046526 | Bacteria | 4307 |
| 593 | Ga0495666_0051934 | 3300046526 | Bacteria | 1968 |
| 594 | Ga0495642_0001958 | 3300046528 | Bacteria | 8660 |
| 595 | Ga0495652_0007120 | 3300046529 | Bacteria | 10318 |
| 596 | Ga0495654_0009302 | 3300046530 | Bacteria | 5387 |
| 597 | Ga0495654_0010039 | 3300046530 | Bacteria | 5169 |
| 598 | Ga0495654_0011753 | 3300046530 | Bacteria | 4728 |
| 599 | Ga0495654_0012116 | 3300046530 | Bacteria | 4641 |
| 600 | Ga0495654_0022421 | 3300046530 | Bacteria | 3279 |
| 601 | Ga0495654_0026935 | 3300046530 | Bacteria | 2951 |
| 602 | Ga0495665_0000360 | 3300046531 | Bacteria | 22994 |
| 603 | Ga0495665_0004745 | 3300046531 | Bacteria | 7338 |
| 604 | Ga0495665_0005775 | 3300046531 | Bacteria | 6680 |
| 605 | Ga0495640_0063565 | 3300046533 | Bacteria | 2499 |
| 606 | Ga0495640_0067239 | 3300046533 | Bacteria | 2414 |
| 607 | Ga0495640_0107611 | 3300046533 | Bacteria | 1825 |
| 608 | Ga0495586_0046107 | 3300046535 | Bacteria | 2350 |
| 609 | Ga0495609_0000020 | 3300046538 | Bacteria | 294662 |
| 610 | Ga0495609_0000062 | 3300046538 | Bacteria | 138094 |
| 611 | Ga0495609_0000209 | 3300046538 | Bacteria | 58627 |
| 612 | Ga0495609_0002224 | 3300046538 | Bacteria | 12137 |
| 613 | Ga0495609_0006158 | 3300046538 | Bacteria | 6170 |
| 614 | Ga0495621_0021252 | 3300046539 | Bacteria | 2138 |
| 615 | Ga0495621_0033943 | 3300046539 | Bacteria | 1761 |
| 616 | Ga0495597_0018676 | 3300046542 | Bacteria | 3251 |
| 617 | Ga0495597_0029962 | 3300046542 | Bacteria | 2482 |
| 618 | Ga0495597_0034281 | 3300046542 | Bacteria | 2294 |
| 619 | Ga0495645_0000295 | 3300046543 | Bacteria | 36493 |
| 620 | Ga0495645_0011388 | 3300046543 | Bacteria | 6258 |
| 621 | Ga0495622_0003817 | 3300046557 | Bacteria | 7042 |
| 622 | Ga0495633_0057921 | 3300046558 | Bacteria | 1819 |
| 623 | Ga0495633_0059104 | 3300046558 | Bacteria | 1799 |
| 624 | Ga0495667_0006471 | 3300046559 | Bacteria | 7953 |
| 625 | Ga0495667_0020017 | 3300046559 | Bacteria | 4513 |
| 626 | Ga0495656_0019182 | 3300046615 | Bacteria | 2638 |
| 627 | Ga0495668_0002202 | 3300046616 | Bacteria | 16605 |
| 628 | Ga0495668_0002445 | 3300046616 | Bacteria | 15273 |
| 629 | Ga0495668_0002827 | 3300046616 | Bacteria | 13803 |
| 630 | Ga0495668_0017925 | 3300046616 | Bacteria | 4100 |
| 631 | Ga0495668_0026718 | 3300046616 | Bacteria | 3274 |
| 632 | Ga0495668_0035252 | 3300046616 | Bacteria | 2804 |
| 633 | Ga0495634_0101653 | 3300046642 | Bacteria | 1857 |
| 634 | Ga0495611_0000306 | 3300046648 | Bacteria | 33215 |
| 635 | Ga0495611_0000359 | 3300046648 | Bacteria | 29717 |
| 636 | Ga0495611_0000802 | 3300046648 | Bacteria | 17419 |
| 637 | Ga0495611_0000925 | 3300046648 | Bacteria | 15810 |
| 638 | Ga0495625_0000015 | 3300046660 | Bacteria | 317237 |
| 639 | Ga0495625_0000016 | 3300046660 | Bacteria | 311353 |
| 640 | Ga0495625_0000028 | 3300046660 | Bacteria | 256946 |
| 641 | Ga0495625_0000128 | 3300046660 | Bacteria | 118013 |
| 642 | Ga0495625_0001843 | 3300046660 | Bacteria | 24209 |
| 643 | Ga0495625_0004665 | 3300046660 | Bacteria | 12868 |
| 644 | Ga0495625_0024058 | 3300046660 | Bacteria | 4642 |
| 645 | Ga0495625_0036096 | 3300046660 | Bacteria | 3637 |
| 646 | Ga0495635_0003310 | 3300046663 | Bacteria | 11136 |
| 647 | Ga0495635_0051331 | 3300046663 | Bacteria | 2842 |
| 648 | Ga0495659_0013474 | 3300046664 | Bacteria | 2664 |
| 649 | Ga0495661_0000001 | 3300046665 | Bacteria | 898372 |
| 650 | Ga0495661_0000013 | 3300046665 | Bacteria | 259387 |
| 651 | Ga0495661_0044997 | 3300046665 | Bacteria | 2702 |
| 652 | Ga0495661_0059022 | 3300046665 | Bacteria | 2285 |
| 653 | Ga0495661_0125446 | 3300046665 | Bacteria | 1413 |
| 654 | Ga0495588_0019157 | 3300046674 | Bacteria | 3349 |
| 655 | Ga0495599_0011331 | 3300046678 | Bacteria | 5476 |
| 656 | Ga0495599_0055638 | 3300046678 | Bacteria | 2477 |
| 657 | Ga0495623_0003047 | 3300046679 | Bacteria | 11035 |
| 658 | Ga0495646_0000865 | 3300046680 | Bacteria | 17146 |
| 659 | Ga0495646_0069229 | 3300046680 | Bacteria | 2082 |
| 660 | Ga0495647_0008690 | 3300046681 | Bacteria | 3418 |
| 661 | Ga0495669_0109366 | 3300046684 | Bacteria | 1289 |
| 662 | Ga0495624_0000231 | 3300046690 | Bacteria | 43799 |
| 663 | Ga0495624_0000629 | 3300046690 | Bacteria | 27606 |
| 664 | Ga0495624_0030493 | 3300046690 | Bacteria | 3511 |
| 665 | Ga0495670_0019272 | 3300046691 | Bacteria | 3361 |
| 666 | Ga0495670_0047751 | 3300046691 | Bacteria | 2140 |
| 667 | Ga0495670_0049833 | 3300046691 | Bacteria | 2095 |
| 668 | Ga0495670_0059004 | 3300046691 | Bacteria | 1926 |
| 669 | Ga0495671_0000066 | 3300046692 | Bacteria | 105167 |
| 670 | Ga0495671_0000461 | 3300046692 | Bacteria | 31838 |
| 671 | Ga0495671_0001197 | 3300046692 | Bacteria | 17759 |
| 672 | Ga0495671_0002104 | 3300046692 | Bacteria | 12719 |
| 673 | Ga0495671_0014157 | 3300046692 | Bacteria | 4297 |
| 674 | Ga0495671_0044069 | 3300046692 | Bacteria | 2238 |
| 675 | Ga0495649_0000033 | 3300046694 | Bacteria | 136854 |
| 676 | Ga0495649_0000233 | 3300046694 | Bacteria | 48859 |
| 677 | Ga0495649_0001590 | 3300046694 | Bacteria | 16990 |
| 678 | Ga0495649_0002311 | 3300046694 | Bacteria | 13526 |
| 679 | Ga0495649_0013985 | 3300046694 | Bacteria | 4615 |
| 680 | Ga0495649_0019213 | 3300046694 | Bacteria | 3839 |
| 681 | Ga0495649_0039518 | 3300046694 | Bacteria | 2586 |
| 682 | Ga0495600_0045840 | 3300046809 | Bacteria | 2853 |
| 683 | Ga0495600_0107129 | 3300046809 | Bacteria | 1821 |
| 684 | Ga0495660_0002752 | 3300046810 | Bacteria | 11084 |
| 685 | Ga0495660_0004492 | 3300046810 | Bacteria | 8437 |
| 686 | Ga0495660_0005072 | 3300046810 | Bacteria | 7912 |
| 687 | Ga0495660_0016561 | 3300046810 | Bacteria | 4250 |
| 688 | Ga0495660_0021127 | 3300046810 | Bacteria | 3730 |
| 689 | Ga0495581_0011356 | 3300047315 | Bacteria | 5153 |
| 690 | Ga0495581_0030951 | 3300047315 | Bacteria | 3100 |
| 691 | Ga0495581_0041353 | 3300047315 | Bacteria | 2668 |
| 692 | Ga0495581_0120018 | 3300047315 | Bacteria | 1530 |
| 693 | Ga0495604_0072851 | 3300047317 | Bacteria | 2595 |
| 694 | Ga0495674_0000381 | 3300047319 | Bacteria | 39676 |
| 695 | Ga0495674_0068801 | 3300047319 | Bacteria | 3063 |
| 696 | Ga0495674_0086621 | 3300047319 | Bacteria | 2681 |
| 697 | Ga0495672_0002839 | 3300047320 | Bacteria | 15399 |
| 698 | Ga0495672_0030446 | 3300047320 | Bacteria | 3385 |
| 699 | Ga0495672_0033522 | 3300047320 | Bacteria | 3181 |
| 700 | Ga0495676_0000006 | 3300047321 | Bacteria | 280508 |
| 701 | Ga0495676_0000239 | 3300047321 | Bacteria | 44071 |
| 702 | Ga0495676_0000322 | 3300047321 | Bacteria | 38908 |
| 703 | Ga0495676_0027229 | 3300047321 | Bacteria | 4905 |
| 704 | Ga0495680_0012101 | 3300047322 | Bacteria | 7614 |
| 705 | Ga0495680_0040548 | 3300047322 | Bacteria | 3709 |
| 706 | Ga0495680_0045592 | 3300047322 | Bacteria | 3461 |
| 707 | Ga0495680_0095110 | 3300047322 | Bacteria | 2228 |
| 708 | Ga0495683_0000006 | 3300047323 | Bacteria | 272409 |
| 709 | Ga0495683_0000099 | 3300047323 | Bacteria | 88483 |
| 710 | Ga0495683_0007813 | 3300047323 | Bacteria | 5738 |
| 711 | Ga0495683_0012254 | 3300047323 | Bacteria | 4504 |
| 712 | Ga0495687_000069 | 3300047443 | Bacteria | 159852 |
| 713 | Ga0495687_016931 | 3300047443 | Bacteria | 3652 |
| 714 | Ga0495675_0058673 | 3300047444 | Bacteria | 2440 |
| 715 | Ga0495679_000150 | 3300047446 | Bacteria | 62726 |
| 716 | Ga0495679_000422 | 3300047446 | Bacteria | 31276 |
| 717 | Ga0495685_032521 | 3300047447 | Bacteria | 1792 |
| 718 | Ga0495673_0000118 | 3300047469 | Bacteria | 147670 |
| 719 | Ga0495673_0000357 | 3300047469 | Bacteria | 56583 |
| 720 | Ga0495673_0000469 | 3300047469 | Bacteria | 43875 |
| 721 | Ga0495673_0000490 | 3300047469 | Bacteria | 42198 |
| 722 | Ga0495673_0001371 | 3300047469 | Bacteria | 19679 |
| 723 | Ga0495673_0001473 | 3300047469 | Bacteria | 18636 |
| 724 | Ga0495673_0001957 | 3300047469 | Bacteria | 15285 |
| 725 | Ga0495673_0039729 | 3300047469 | Bacteria | 2133 |
| 726 | Ga0495673_0053755 | 3300047469 | Bacteria | 1754 |
| 727 | Ga0495681_0004720 | 3300047470 | Bacteria | 9239 |
| 728 | Ga0495681_0007704 | 3300047470 | Bacteria | 6831 |
| 729 | Ga0495684_0045397 | 3300047471 | Bacteria | 3363 |
| 730 | Ga0495686_0000754 | 3300047472 | Bacteria | 42714 |
| 731 | Ga0495686_0018106 | 3300047472 | Bacteria | 4733 |
| 732 | Ga0495686_0042466 | 3300047472 | Bacteria | 2891 |
| 733 | Ga0495602_0001776 | 3300048088 | Bacteria | 21588 |
| 734 | Ga0495602_0147572 | 3300048088 | Bacteria | 1853 |
| 735 | Ga0495614_0042099 | 3300048089 | Bacteria | 1958 |
| 736 | Ga0495615_0000147 | 3300048090 | Bacteria | 17724 |
| 737 | Ga0495626_0000019 | 3300048091 | Bacteria | 225494 |
| 738 | Ga0495626_0000251 | 3300048091 | Bacteria | 61550 |
| 739 | Ga0495626_0000480 | 3300048091 | Bacteria | 40334 |
| 740 | Ga0495626_0000566 | 3300048091 | Bacteria | 36732 |
| 741 | Ga0495626_0000720 | 3300048091 | Bacteria | 30946 |
| 742 | Ga0495626_0001042 | 3300048091 | Bacteria | 23731 |
| 743 | Ga0496100_0052503 | 3300048903 | Bacteria | 2650 |
| 744 | Ga0496100_0057381 | 3300048903 | Bacteria | 2550 |
| 745 | Ga0496101_0019805 | 3300048904 | Bacteria | 4600 |
| 746 | Ga0496102_0047101 | 3300048905 | Bacteria | 3917 |
| 747 | Ga0496102_0150461 | 3300048905 | Unclassified | 2187 |
| 748 | Ga0496103_0002554 | 3300048906 | Bacteria | 11407 |
| 749 | Ga0496103_0047662 | 3300048906 | Bacteria | 2648 |
| 750 | Ga0496104_0000789 | 3300048907 | Bacteria | 27145 |
| 751 | Ga0496104_0001491 | 3300048907 | Bacteria | 20201 |
| 752 | Ga0496104_0002884 | 3300048907 | Bacteria | 14818 |
| 753 | Ga0496104_0006888 | 3300048907 | Bacteria | 10024 |
| 754 | Ga0496104_0007194 | 3300048907 | Bacteria | 9813 |
| 755 | Ga0496104_0008012 | 3300048907 | Bacteria | 9368 |
| 756 | Ga0496104_0021778 | 3300048907 | Bacteria | 5887 |
| 757 | Ga0496104_0035224 | 3300048907 | Bacteria | 4674 |
| 758 | Ga0496105_0000539 | 3300048908 | Bacteria | 24970 |
| 759 | Ga0496105_0017820 | 3300048908 | Bacteria | 5698 |
| 760 | Ga0496105_0029290 | 3300048908 | Bacteria | 4506 |
| 761 | Ga0496105_0036873 | 3300048908 | Bacteria | 4029 |
| 762 | Ga0496105_0049525 | 3300048908 | Bacteria | 3469 |
| 763 | Ga0496106_0030802 | 3300048909 | Bacteria | 3999 |
| 764 | Ga0496106_0052384 | 3300048909 | Bacteria | 3079 |
| 765 | Ga0496106_0089616 | 3300048909 | Unclassified | 2372 |
| 766 | Ga0496107_0047938 | 3300048910 | Bacteria | 3077 |
| 767 | Ga0496107_0157962 | 3300048910 | Unclassified | 1679 |
| 768 | Ga0496108_0053395 | 3300048911 | Plasmid | 3389 |
| 769 | Ga0496108_0080945 | 3300048911 | Bacteria | 2752 |
| 770 | Ga0496109_0011932 | 3300048912 | Bacteria | 7483 |
| 771 | Ga0496109_0015824 | 3300048912 | Bacteria | 6586 |
| 772 | Ga0496109_0063885 | 3300048912 | Bacteria | 3367 |
| 773 | Ga0496109_0191013 | 3300048912 | Bacteria | 1924 |
| 774 | Ga0496110_0011579 | 3300048913 | Bacteria | 7230 |
| 775 | Ga0496110_0014287 | 3300048913 | Bacteria | 6588 |
| 776 | Ga0496110_0037217 | 3300048913 | Bacteria | 4229 |
| 777 | Ga0496110_0096731 | 3300048913 | Bacteria | 2646 |
| 778 | Ga0496110_0180514 | 3300048913 | Bacteria | 1917 |
| 779 | Ga0496111_0009871 | 3300048914 | Bacteria | 6381 |
| 780 | Ga0496111_0053788 | 3300048914 | Bacteria | 2909 |
| 781 | Ga0496112_0004841 | 3300048915 | Bacteria | 11496 |
| 782 | Ga0496112_0076086 | 3300048915 | Plasmid | 3320 |
| 783 | Ga0496112_0091190 | 3300048915 | Bacteria | 3016 |
| 784 | Ga0496112_0144233 | 3300048915 | Bacteria | 2350 |
| 785 | Ga0496112_0193304 | 3300048915 | Bacteria | 1996 |
| 786 | Ga0496113_0021261 | 3300048916 | Bacteria | 4574 |
| 787 | Ga0496113_0026975 | 3300048916 | Bacteria | 4113 |
| 788 | Ga0496113_0064303 | 3300048916 | Bacteria | 2774 |
| 789 | Ga0496113_0085276 | 3300048916 | Bacteria | 2426 |
| 790 | Ga0496113_0156851 | 3300048916 | Bacteria | 1798 |
| 791 | Ga0496114_0003959 | 3300048917 | Bacteria | 11431 |
| 792 | Ga0496114_0015099 | 3300048917 | Bacteria | 6210 |
| 793 | Ga0496114_0032447 | 3300048917 | Bacteria | 4299 |
| 794 | Ga0496115_0003412 | 3300048918 | Bacteria | 11410 |
| 795 | Ga0496115_0034808 | 3300048918 | Bacteria | 3980 |
| 796 | Ga0496115_0094236 | 3300048918 | Bacteria | 2449 |
| 797 | Ga0496115_0145880 | 3300048918 | Bacteria | 1953 |
| 798 | Ga0496116_0008018 | 3300048919 | Bacteria | 9242 |
| 799 | Ga0496116_0014627 | 3300048919 | Bacteria | 6254 |
| 800 | Ga0496116_0015786 | 3300048919 | Bacteria | 5949 |
| 801 | Ga0496116_0072927 | 3300048919 | Bacteria | 2167 |
| 802 | Ga0496117_0006077 | 3300048920 | Bacteria | 12382 |
| 803 | Ga0496117_0043853 | 3300048920 | Bacteria | 3247 |
| 804 | Ga0496117_0086104 | 3300048920 | Bacteria | 2043 |
| 805 | Ga0496118_0016654 | 3300048921 | Bacteria | 6735 |
| 806 | Ga0496118_0035084 | 3300048921 | Bacteria | 4080 |
| 807 | Ga0496118_0069418 | 3300048921 | Bacteria | 2552 |
| 808 | Ga0496118_0100146 | 3300048921 | Bacteria | 1961 |
| 809 | Ga0496119_0006237 | 3300048922 | Bacteria | 11138 |
| 810 | Ga0496119_0016615 | 3300048922 | Bacteria | 5587 |
| 811 | Ga0496119_0071681 | 3300048922 | Bacteria | 2027 |
| 812 | Ga0496120_0048141 | 3300048923 | Bacteria | 2454 |
| 813 | Ga0496121_0000159 | 3300048924 | Bacteria | 147049 |
| 814 | Ga0496121_0000487 | 3300048924 | Bacteria | 76772 |
| 815 | Ga0496121_0000863 | 3300048924 | Bacteria | 54797 |
| 816 | Ga0496121_0000982 | 3300048924 | Bacteria | 51074 |
| 817 | Ga0496121_0001682 | 3300048924 | Bacteria | 36372 |
| 818 | Ga0496121_0002567 | 3300048924 | Bacteria | 27494 |
| 819 | Ga0496121_0002636 | 3300048924 | Bacteria | 27038 |
| 820 | Ga0496121_0003787 | 3300048924 | Bacteria | 21107 |
| 821 | Ga0496121_0009279 | 3300048924 | Bacteria | 11348 |
| 822 | Ga0496121_0016367 | 3300048924 | Bacteria | 7662 |
| 823 | Ga0496121_0039492 | 3300048924 | Bacteria | 4157 |
| 824 | Ga0496121_0058546 | 3300048924 | Bacteria | 3184 |
| 825 | Ga0496121_0131515 | 3300048924 | Bacteria | 1872 |
| 826 | Ga0496122_0000175 | 3300048925 | Bacteria | 153295 |
| 827 | Ga0496122_0000748 | 3300048925 | Bacteria | 63291 |
| 828 | Ga0496122_0002017 | 3300048925 | Bacteria | 30174 |
| 829 | Ga0496122_0026852 | 3300048925 | Bacteria | 4946 |
| 830 | Ga0496122_0028919 | 3300048925 | Bacteria | 4687 |
| 831 | Ga0496122_0039009 | 3300048925 | Bacteria | 3794 |
| 832 | Ga0496122_0043457 | 3300048925 | Bacteria | 3520 |
| 833 | Ga0496122_0046500 | 3300048925 | Bacteria | 3360 |
| 834 | Ga0496122_0068984 | 3300048925 | Bacteria | 2535 |
| 835 | Ga0496123_0000079 | 3300048926 | Bacteria | 191201 |
| 836 | Ga0496123_0000224 | 3300048926 | Bacteria | 115362 |
| 837 | Ga0496123_0001196 | 3300048926 | Bacteria | 38152 |
| 838 | Ga0496123_0004790 | 3300048926 | Bacteria | 13963 |
| 839 | Ga0496123_0021801 | 3300048926 | Bacteria | 4964 |
| 840 | Ga0496123_0069527 | 3300048926 | Bacteria | 2210 |
| 841 | Ga0496124_0000228 | 3300048927 | Bacteria | 109927 |
| 842 | Ga0496124_0000580 | 3300048927 | Bacteria | 61729 |
| 843 | Ga0496124_0010919 | 3300048927 | Bacteria | 9137 |
| 844 | Ga0496124_0015876 | 3300048927 | Bacteria | 7193 |
| 845 | Ga0496124_0016270 | 3300048927 | Bacteria | 7082 |
| 846 | Ga0496124_0059903 | 3300048927 | Bacteria | 3196 |
| 847 | Ga0496124_0082089 | 3300048927 | Bacteria | 2647 |
| 848 | Ga0496124_0084366 | 3300048927 | Bacteria | 2605 |
| 849 | Ga0496124_0087677 | 3300048927 | Bacteria | 2545 |
| 850 | Ga0496125_0000005 | 3300048928 | Bacteria | 827598 |
| 851 | Ga0496125_0000735 | 3300048928 | Bacteria | 54271 |
| 852 | Ga0496125_0007191 | 3300048928 | Bacteria | 11869 |
| 853 | Ga0496125_0017139 | 3300048928 | Bacteria | 6923 |
| 854 | Ga0496125_0018724 | 3300048928 | Bacteria | 6565 |
| 855 | Ga0496125_0032440 | 3300048928 | Bacteria | 4640 |
| 856 | Ga0496125_0046993 | 3300048928 | Bacteria | 3615 |
| 857 | Ga0496125_0056608 | 3300048928 | Bacteria | 3183 |
| 858 | Ga0496125_0146103 | 3300048928 | Bacteria | 1634 |
| 859 | Ga0496126_0000948 | 3300048929 | Bacteria | 49780 |
| 860 | Ga0496126_0001493 | 3300048929 | Bacteria | 36283 |
| 861 | Ga0496126_0005694 | 3300048929 | Bacteria | 14118 |
| 862 | Ga0496126_0013109 | 3300048929 | Bacteria | 8455 |
| 863 | Ga0496126_0034973 | 3300048929 | Bacteria | 4712 |
| 864 | Ga0496126_0047065 | 3300048929 | Bacteria | 3951 |
| 865 | Ga0496126_0163069 | 3300048929 | Bacteria | 1903 |
| 866 | Ga0496126_0164204 | 3300048929 | Bacteria | 1896 |
| 867 | Ga0496126_0175519 | 3300048929 | Bacteria | 1823 |
| 868 | Ga0496126_0201786 | 3300048929 | Bacteria | 1679 |
| 869 | Ga0495678_000083 | 3300049459 | Bacteria | 117558 |
| 870 | Ga0495678_000119 | 3300049459 | Bacteria | 92516 |
| 871 | Ga0495678_004091 | 3300049459 | Bacteria | 8648 |
| 872 | Ga0495678_006390 | 3300049459 | Bacteria | 6279 |
| 873 | Ga0495682_0000087 | 3300049460 | Bacteria | 80534 |
| 874 | Ga0501033_0029709 | 3300049570 | Bacteria | 4108 |
| 875 | Ga0501033_0092464 | 3300049570 | Bacteria | 2212 |
| 876 | Ga0501034_0001458 | 3300049571 | Bacteria | 31321 |
| 877 | Ga0501034_0026600 | 3300049571 | Bacteria | 5890 |
| 878 | Ga0501034_0055323 | 3300049571 | Bacteria | 3993 |
| 879 | Ga0501034_0133421 | 3300049571 | Bacteria | 2465 |
| 880 | Ga0501036_0023348 | 3300049572 | Bacteria | 5209 |
| 881 | Ga0501037_0018710 | 3300049573 | Bacteria | 5105 |
| 882 | Ga0501038_0028867 | 3300049574 | Bacteria | 4924 |
| 883 | Ga0501038_0114106 | 3300049574 | Bacteria | 2235 |
| 884 | Ga0501038_0162159 | 3300049574 | Bacteria | 1816 |
| 885 | Ga0501039_0013598 | 3300049575 | Bacteria | 6224 |
| 886 | Ga0501040_0008476 | 3300049576 | Bacteria | 6677 |
| 887 | Ga0501042_0072390 | 3300049578 | Bacteria | 2466 |
| 888 | Ga0501043_0042966 | 3300049579 | Bacteria | 3553 |
| 889 | Ga0501043_0102059 | 3300049579 | Bacteria | 2255 |
| 890 | Ga0501046_0008866 | 3300049580 | Bacteria | 8739 |
| 891 | Ga0501046_0052865 | 3300049580 | Bacteria | 3200 |
| 892 | Ga0501047_0120727 | 3300049581 | Bacteria | 2503 |
| 893 | Ga0501047_0157997 | 3300049581 | Bacteria | 2140 |
| 894 | Ga0501048_0111480 | 3300049582 | Unclassified | 1932 |
| 895 | Ga0501068_0033622 | 3300049584 | Bacteria | 3053 |
| 896 | Ga0501070_0032957 | 3300049586 | Bacteria | 4333 |
| 897 | Ga0501070_0220745 | 3300049586 | Bacteria | 1555 |
| 898 | Ga0501071_0168572 | 3300049587 | Unclassified | 1639 |
| 899 | Ga0501071_0208626 | 3300049587 | Bacteria | 1469 |
| 900 | Ga0501072_0007568 | 3300049588 | Bacteria | 8242 |
| 901 | Ga0501072_0039639 | 3300049588 | Bacteria | 3698 |
| 902 | Ga0501074_0044773 | 3300049590 | Bacteria | 3202 |
| 903 | Ga0501076_0043313 | 3300049592 | Bacteria | 3546 |
| 904 | Ga0501079_0129512 | 3300049741 | Bacteria | 1963 |
| 905 | Ga0501081_0178738 | 3300049743 | Bacteria | 1534 |
| 906 | Ga0501044_0018371 | 3300049823 | Bacteria | 7492 |
| 907 | Ga0501044_0066932 | 3300049823 | Bacteria | 3661 |
| 908 | Ga0501044_0100362 | 3300049823 | Bacteria | 2913 |
| 909 | nmdc:mga03683_1577_c2 | 3300050489 | Bacteria | 5759 |
| 910 | nmdc:mga03683_8975_c1 | 3300050489 | Bacteria | 3537 |
| 911 | nmdc:mga00v17_3116_c1 | 3300050491 | Bacteria | 8528 |
| 912 | nmdc:mga0yw44_51208_c1 | 3300050492 | Bacteria | 2499 |
| 913 | nmdc:mga0yw44_95408_c1 | 3300050492 | Bacteria | 1887 |
| 914 | nmdc:mga0k408_18659_c1 | 3300050493 | Bacteria | 3874 |
| 915 | nmdc:mga04h51_33158_c1 | 3300050495 | Bacteria | 1642 |
| 916 | nmdc:mga05p37_10808_c1 | 3300050507 | Bacteria | 10837 |
| 917 | nmdc:mga05p37_359778_c1 | 3300050507 | Bacteria | 1711 |
| 918 | nmdc:mga05p37_807_c1 | 3300050507 | Bacteria | 35021 |
| 919 | nmdc:mga09592_14585_c1 | 3300050508 | Bacteria | 6415 |
| 920 | nmdc:mga09592_5262_c1 | 3300050508 | Bacteria | 10513 |
| 921 | nmdc:mga09592_70286_c1 | 3300050508 | Bacteria | 2970 |
| 922 | nmdc:mga0qj67_14_c1 | 3300050509 | Bacteria | 124768 |
| 923 | nmdc:mga0qj67_195010_c1 | 3300050509 | Bacteria | 1646 |
| 924 | nmdc:mga0qj67_205219_c1 | 3300050509 | Bacteria | 1601 |
| 925 | nmdc:mga0qj67_9662_c1 | 3300050509 | Bacteria | 7189 |
| 926 | nmdc:mga0qj67_97601_c1 | 3300050509 | Bacteria | 2366 |
| 927 | nmdc:mga06r32_11089_c1 | 3300050510 | Bacteria | 8112 |
| 928 | nmdc:mga06r32_119518_c1 | 3300050510 | Bacteria | 2598 |
| 929 | nmdc:mga06r32_21880_c1 | 3300050510 | Bacteria | 5905 |
| 930 | nmdc:mga06r32_221455_c1 | 3300050510 | Bacteria | 1880 |
| 931 | nmdc:mga06r32_31004_c1 | 3300050510 | Bacteria | 5019 |
| 932 | nmdc:mga06r32_4368_c1 | 3300050510 | Bacteria | 12643 |
| 933 | nmdc:mga08y16_186691_c1 | 3300050511 | Bacteria | 2151 |
| 934 | nmdc:mga08y16_92034_c1 | 3300050511 | Bacteria | 3160 |
| 935 | nmdc:mga0n895_18353_c1 | 3300050512 | Bacteria | 6470 |
| 936 | nmdc:mga0n895_67783_c1 | 3300050512 | Bacteria | 3534 |
| 937 | nmdc:mga0n895_80639_c1 | 3300050512 | Bacteria | 3242 |
| 938 | nmdc:mga0rr50_182285_c1 | 3300050513 | Bacteria | 1717 |
| 939 | nmdc:mga0sz30_26243_c1 | 3300050516 | Bacteria | 2387 |
| 940 | Ga0495601_0017336 | 3300053077 | Bacteria | 4369 |
| 941 | Ga0495595_0020025 | 3300053084 | Bacteria | 2908 |
| 942 | Ga0495595_0020617 | 3300053084 | Bacteria | 2870 |
| 943 | Ga0495595_0035058 | 3300053084 | Bacteria | 2272 |
| 944 | Ga0495595_0083824 | 3300053084 | Bacteria | 1522 |
| 945 | Ga0495619_0005250 | 3300053085 | Bacteria | 8211 |
| 946 | Ga0495619_0018715 | 3300053085 | Bacteria | 4396 |
| 947 | Ga0495619_0043341 | 3300053085 | Bacteria | 2949 |
| 948 | Ga0500644_0009067 | 3300053088 | Bacteria | 2650 |
| 949 | Ga0500651_0000338 | 3300053093 | Bacteria | 26429 |
| 950 | Ga0500641_0004758 | 3300053096 | Bacteria | 4804 |
| 951 | Ga0500641_0009883 | 3300053096 | Bacteria | 3437 |
| 952 | Ga0500571_000087 | 3300053110 | Bacteria | 29151 |
| 953 | Ga0500594_0026838 | 3300053118 | Bacteria | 1487 |
| 954 | Ga0500607_003436 | 3300053121 | Bacteria | 11607 |
| 955 | Ga0500618_000157 | 3300053125 | Bacteria | 56116 |
| 956 | Ga0500618_002071 | 3300053125 | Bacteria | 8049 |
| 957 | Ga0500618_003052 | 3300053125 | Bacteria | 5943 |
| 958 | Ga0500618_004735 | 3300053125 | Bacteria | 4266 |
| 959 | Ga0500618_009823 | 3300053125 | Bacteria | 2597 |
| 960 | Ga0500618_009997 | 3300053125 | Bacteria | 2563 |
| 961 | Ga0500642_0000023 | 3300053130 | Bacteria | 135152 |
| 962 | Ga0500652_000019 | 3300053131 | Bacteria | 120149 |
| 963 | Ga0500652_000802 | 3300053131 | Bacteria | 10534 |
| 964 | Ga0500655_001139 | 3300053133 | Bacteria | 5062 |
| 965 | Ga0500658_0001092 | 3300053134 | Bacteria | 11096 |
| 966 | Ga0500658_0001599 | 3300053134 | Bacteria | 9053 |
| 967 | Ga0500568_0001751 | 3300053139 | Bacteria | 13402 |
| 968 | Ga0500568_0004961 | 3300053139 | Bacteria | 6996 |
| 969 | Ga0500573_0000185 | 3300053140 | Bacteria | 25681 |
| 970 | Ga0500573_0003993 | 3300053140 | Bacteria | 7706 |
| 971 | Ga0500573_0007073 | 3300053140 | Bacteria | 6103 |
| 972 | Ga0500573_0014494 | 3300053140 | Bacteria | 4463 |
| 973 | Ga0500586_015646 | 3300053145 | Bacteria | 2284 |
| 974 | Ga0500616_0000945 | 3300053153 | Bacteria | 31641 |
| 975 | Ga0500616_0045103 | 3300053153 | Bacteria | 2350 |
| 976 | Ga0500616_0097198 | 3300053153 | Bacteria | 1446 |
| 977 | Ga0500630_035386 | 3300053159 | Bacteria | 2447 |
| 978 | Ga0500634_0053650 | 3300053161 | Bacteria | 2162 |
| 979 | Ga0500636_0004583 | 3300053177 | Bacteria | 7839 |
| 980 | Ga0500636_0020606 | 3300053177 | Bacteria | 3904 |
| 981 | Ga0500609_006374 | 3300053731 | Bacteria | 1607 |
| 982 | Ga0501084_0021672 | 3300054114 | Bacteria | 5357 |
| 983 | Ga0501082_0117574 | 3300060353 | Bacteria | 2303 |
| 984 | Ga0530510_0019075 | 3300061734 | Bacteria | 4864 |
| 985 | 2876396287 | 2876392853 | Bacteria | 6660880 |
| 986 | 2501079169 | 2501025502 | Bacteria | 9641094 |
| 987 | 2501409442 | 2501025504 | Bacteria | 8008976 |
| 988 | 2511093563 | 2510917013 | Bacteria | 9951648 |
| 989 | 2511098989 | 2510917014 | Bacteria | 8296963 |
| 990 | 2511249046 | 2511231003 | Bacteria | 5606035 |
| 991 | 2511378003 | 2511231024 | Bacteria | 5835885 |
| 992 | 2511389526 | 2511231027 | Bacteria | 5013807 |
| 993 | 2513589786 | 2513237087 | Bacteria | 5817514 |
| 994 | 2515683669 | 2515154122 | Bacteria | 8609520 |
| 995 | 2548695310 | 2547132424 | Bacteria | 8348532 |
| 996 | 2550696008 | 2548876994 | Bacteria | 4904866 |
| 997 | 2601624056 | 2600255283 | Bacteria | 6061572 |
| 998 | 2644455994 | 2643221681 | Bacteria | 3707866 |
| 999 | 2644491081 | 2643221687 | Bacteria | 6500351 |
| 1000 | 2644634505 | 2643221715 | Bacteria | 6671032 |
| 1001 | 2644680763 | 2643221724 | Bacteria | 3593515 |
| 1002 | 2738891516 | 2738541308 | Bacteria | 7020677 |
| 1003 | 2739285452 | 2738543020 | Bacteria | 5718238 |
| 1004 | 2739290765 | 2738543021 | Bacteria | 5718241 |
| 1005 | 2739364421 | 2738543034 | Bacteria | 6084756 |
| 1006 | 2739366344 | 2738543034 | Bacteria | 6084756 |
| 1007 | 2753038002 | 2751185725 | Bacteria | 5740550 |
| 1008 | 2753325870 | 2751185792 | Bacteria | 5739090 |
| 1009 | 2765468668 | 2765235802 | Bacteria | 5618596 |
| 1010 | 2765584519 | 2765235841 | Bacteria | 6137024 |
| 1011 | 2770198442 | 2767802442 | Bacteria | 5747986 |
| 1012 | 2776269234 | 2775506902 | Bacteria | 6208009 |
| 1013 | 2776283627 | 2775506904 | Bacteria | 5954060 |
| 1014 | 2807408471 | 2806310737 | Bacteria | 5751088 |
| 1015 | 2807456786 | 2806310745 | Bacteria | 5742165 |
| 1016 | 2808629025 | 2808606306 | Bacteria | 3608896 |
| 1017 | 2812366704 | 2811994881 | Bacteria | 6298475 |
| 1018 | 2819554196 | 2818991438 | Bacteria | 5793701 |
| 1019 | 2819593507 | 2818991445 | Bacteria | 4955017 |
| 1020 | 2819616205 | 2818991449 | Bacteria | 5518009 |
| 1021 | 2839997095 | 2839993093 | Bacteria | 5512535 |
| 1022 | 2840770152 | 2840764183 | Bacteria | 6358399 |
| 1023 | 2841915200 | 2841911363 | Bacteria | 6173697 |
| 1024 | 2841922097 | 2841917233 | Bacteria | 6173500 |
| 1025 | 2842695217 | 2842694124 | Bacteria | 4063419 |
| 1026 | 2842734878 | 2842733646 | Bacteria | 5716726 |
| 1027 | 2842776414 | 2842775625 | Bacteria | 5587290 |
| 1028 | 2842806454 | 2842805378 | Bacteria | 5385175 |
| 1029 | 2842872658 | 2842871566 | Bacteria | 4827117 |
| 1030 | 2847931728 | 2847930680 | Bacteria | 9342022 |
| 1031 | 2856314272 | 2856314179 | Bacteria | 6477897 |
| 1032 | 2856367928 | 2856364286 | Bacteria | 6939991 |
| 1033 | 2874152705 | 2874146452 | Bacteria | 7533118 |
| 1034 | 2876418620 | 2876413966 | Bacteria | 6831344 |
| 1035 | 2881152962 | 2881147464 | Bacteria | 7779814 |
| 1036 | 2881155283 | 2881147464 | Bacteria | 7779814 |
| 1037 | 2881166182 | 2881161766 | Bacteria | 7127907 |
| 1038 | 2883577453 | 2883577096 | Bacteria | 4709178 |
| 1039 | 2884816516 | 2884811622 | Bacteria | 5552861 |
| 1040 | 2884837736 | 2884836552 | Bacteria | 5219991 |
| 1041 | 2884854028 | 2884852848 | Bacteria | 5221161 |
| 1042 | 2885306002 | 2885305155 | Bacteria | 7348390 |
| 1043 | 2885330136 | 2885326080 | Bacteria | 7134805 |
| 1044 | 2885338085 | 2885334103 | Bacteria | 7216818 |
| 1045 | 2887479675 | 2887478801 | Bacteria | 8972725 |
| 1046 | 2894776894 | 2894772417 | Bacteria | 5305674 |
| 1047 | 2896154855 | 2896154374 | Bacteria | 5221518 |
| 1048 | 2897564634 | 2897561785 | Bacteria | 3256946 |
| 1049 | 2902688580 | 2902682994 | Bacteria | 8951596 |
| 1050 | 2902816775 | 2902810491 | Bacteria | 6794147 |
| 1051 | 2902843769 | 2902837492 | Bacteria | 6697721 |
| 1052 | 2904482252 | 2904479285 | Bacteria | 5073931 |
| 1053 | 2904482286 | 2904479285 | Bacteria | 5073931 |
| 1054 | 2904532907 | 2904530477 | Bacteria | 5876334 |
| 1055 | 2904534072 | 2904530477 | Bacteria | 5876334 |
| 1056 | 2904580517 | 2904578770 | Bacteria | 5302906 |
| 1057 | 2904585459 | 2904584206 | Bacteria | 6028872 |
| 1058 | 2904589087 | 2904584206 | Bacteria | 6028872 |
| 1059 | 2904590431 | 2904589729 | Bacteria | 6113573 |
| 1060 | 2904593808 | 2904589729 | Bacteria | 6113573 |
| 1061 | 2904603700 | 2904601388 | Bacteria | 5884906 |
| 1062 | 2904604042 | 2904601388 | Bacteria | 5884906 |
| 1063 | 2904663063 | 2904659560 | Bacteria | 6685615 |
| 1064 | 2906414694 | 2906414383 | Bacteria | 6580790 |
| 1065 | 2908815495 | 2908811453 | Bacteria | 5478616 |
| 1066 | 2912967088 | 2912963787 | Bacteria | 5646108 |
| 1067 | 2919046793 | 2919046199 | Bacteria | 5567169 |
| 1068 | 2919080294 | 2919079590 | Bacteria | 5946433 |
| 1069 | 2919081724 | 2919079590 | Bacteria | 5946433 |
| 1070 | 2919121738 | 2919119836 | Bacteria | 5208557 |
| 1071 | 2919126843 | 2919125081 | Bacteria | 5385106 |
| 1072 | 2919126905 | 2919125081 | Bacteria | 5385106 |
| 1073 | 2919453617 | 2919450847 | Bacteria | 5631160 |
| 1074 | 2919719880 | 2919713450 | Bacteria | 7431245 |
| 1075 | 2923520736 | 2923519811 | Bacteria | 6298479 |
| 1076 | 2925333218 | 2925326138 | Bacteria | 9652120 |
| 1077 | 2925333446 | 2925326138 | Bacteria | 9652120 |
| 1078 | 2928029250 | 2928027323 | Bacteria | 4382488 |
| 1079 | 2928084310 | 2928084124 | Bacteria | 7159212 |
| 1080 | 2928119492 | 2928115317 | Bacteria | 6477646 |
| 1081 | 2928131474 | 2928130867 | Bacteria | 5467269 |
| 1082 | 2928526068 | 2928521798 | Bacteria | 4960112 |
| 1083 | 2929203983 | 2929199973 | Bacteria | 7260745 |
| 1084 | 2929205905 | 2929199973 | Bacteria | 7260745 |
| 1085 | 2929216989 | 2929212328 | Bacteria | 7708288 |
| 1086 | 2937820341 | 2937813078 | Bacteria | 7783518 |
| 1087 | 2939656395 | 2939651529 | Bacteria | 5895393 |
| 1088 | 2941481569 | |||
| 1089 | 2945939649 | 2945934425 | Bacteria | 7444609 |
| 1090 | 2946084357 | 2946080515 | Bacteria | 4310960 |
| 1091 | 2954011839 | 2954011201 | Bacteria | 4762601 |
| 1092 | 2961118090 | 2961114664 | Bacteria | 6680456 |
| 1093 | 2961131681 | 2961127735 | Bacteria | 7196641 |
| 1094 | 2968114151 | 2968110612 | Bacteria | 6814636 |
| 1095 | 2977976786 | 2977971508 | Bacteria | 7472917 |
| 1096 | 2984288944 | 2984286254 | Bacteria | 6702062 |
| 1097 | 2984504956 | 2984504281 | Bacteria | 5262371 |
| 1098 | 2984566946 | 2984564862 | Bacteria | 4339992 |
| 1099 | 3002143416 | 3002141150 | Bacteria | 5254435 |
| 1100 | 3004175461 | 3004167301 | Bacteria | 8330599 |
| 1101 | 8001847822 | 8001845381 | Bacteria | 5804942 |
| 1102 | 8054931282 | 8054929484 | Bacteria | 5599761 |
| 1103 | 8055037760 | 8055034563 | Bacteria | 3562128 |
| 1104 | 8055882677 | 8055878733 | Bacteria | 5907058 |
| 1105 | 8055912357 | 8055909800 | Bacteria | 7278581 |
| 1106 | 8055914797 | 8055909800 | Bacteria | 7278581 |
| 1107 | 8055915393 | 8055909800 | Bacteria | 7278581 |
| 1108 | 8056118612 | 8056115690 | Bacteria | 5527654 |
| 1109 | 8056123322 | 8056120720 | Bacteria | 5758328 |
| 1110 | JGI24740J21852_10000424 | |||
| 1111 | JGI25155J39150_1000432 | |||
| 1112 | JGI25155J39150_1000469 | |||
| 1113 | JGI25156J39149_1000314 | |||
| 1114 | JGI25156J39149_1001147 | |||
| 1115 | JGI25156J39149_1001292 | |||
| 1116 | JGI25154J39366_1000961 | |||
| 1117 | JGI25154J39366_1001064 | |||
| 1118 | JGI25157J39369_1000990 | |||
| 1119 | JGI25151J46595_10000291 | |||
| 1120 | JGI25406J46586_10000343 | |||
| 1121 | JGI25153J46596_10006349 | |||
| 1122 | JGI25153J46596_10006551 | |||
| 1123 | JGI25153J46596_10028010 | |||
| 1124 | rootH2_10050768 | |||
| 1125 | rootL2_10133328 | |||
| 1126 | rootL2_10186049 | |||
| 1127 | Ga0055538_1000002 | |||
| 1128 | Ga0055538_1000019 | |||
| 1129 | Ga0055539_1000002 | |||
| 1130 | Ga0055539_1000024 | |||
| 1131 | Ga0055533_1000004 | |||
| 1132 | Ga0055533_1000032 | |||
| 1133 | Ga0055532_1000102 | |||
| 1134 | Ga0055525_1000002 | |||
| 1135 | Ga0055525_1000041 | |||
| 1136 | Ga0055526_1001849 | |||
| 1137 | Ga0055524_1028161 | |||
| 1138 | Ga0055536_1000058 | |||
| 1139 | Ga0055536_1000175 | |||
| 1140 | Ga0055534_1000403 | |||
| 1141 | Ga0055530_10000200 | |||
| 1142 | Ga0055540_1000516 | |||
| 1143 | Ga0055540_1000568 | |||
| 1144 | Ga0055540_1003036 | |||
| 1145 | Ga0055540_1010535 | |||
| 1146 | Ga0055541_1000002 | |||
| 1147 | Ga0055541_1000018 | |||
| 1148 | JGI25405J52794_10002710 | |||
| 1149 | Ga0070658_10020589 | |||
| 1150 | Ga0070683_100026259 | |||
| 1151 | Ga0070683_100104654 | |||
| 1152 | Ga0068869_100204959 | |||
| 1153 | Ga0070680_100026388 | |||
| 1154 | Ga0068868_100049983 | |||
| 1155 | Ga0070689_100006722 | |||
| 1156 | Ga0070691_10028918 | |||
| 1157 | Ga0070675_100025603 | |||
| 1158 | Ga0070671_100016593 | |||
| 1159 | Ga0070674_100036796 | |||
| 1160 | Ga0070674_100060048 | |||
| 1161 | Ga0070659_100093457 | |||
| 1162 | Ga0070709_10015869 | |||
| 1163 | Ga0070714_100013296 | |||
| 1164 | Ga0070714_100142842 | |||
| 1165 | Ga0070713_100133787 | |||
| 1166 | Ga0070710_10088314 | |||
| 1167 | Ga0070700_100008200 | |||
| 1168 | Ga0070700_100075304 | |||
| 1169 | Ga0070708_100024334 | |||
| 1170 | Ga0070662_100169586 | |||
| 1171 | Ga0070706_100008592 | |||
| 1172 | Ga0070706_100031146 | |||
| 1173 | Ga0070707_100014383 | |||
| 1174 | Ga0070698_100007330 | |||
| 1175 | Ga0070698_100152523 | |||
| 1176 | Ga0070699_100014800 | |||
| 1177 | Ga0070679_100026332 | |||
| 1178 | Ga0070697_100014114 | |||
| 1179 | Ga0070697_100027393 | |||
| 1180 | Ga0068853_100034457 | |||
| 1181 | Ga0070686_100002853 | |||
| 1182 | Ga0070686_100068182 | |||
| 1183 | Ga0068855_100005098 | |||
| 1184 | Ga0068855_100010105 | |||
| 1185 | Ga0068855_100038271 | |||
| 1186 | Ga0070664_100128410 | |||
| 1187 | Ga0068857_100160130 | |||
| 1188 | Ga0068856_100032432 | |||
| 1189 | Ga0068856_100112484 | |||
| 1190 | Ga0068852_100032627 | |||
| 1191 | Ga0068859_100093301 | |||
| 1192 | Ga0068864_100152928 | |||
| 1193 | Ga0068864_100153684 | |||
| 1194 | Ga0081455_10000019 | |||
| 1195 | Ga0081455_10003434 | |||
| 1196 | Ga0081455_10012375 | |||
| 1197 | Ga0081455_10047479 | |||
| 1198 | Ga0081455_10093531 | |||
| 1199 | Ga0081538_10021482 | |||
| 1200 | Ga0081538_10088732 | |||
| 1201 | Ga0081540_1000090 | |||
| 1202 | Ga0081540_1008840 | |||
| 1203 | Ga0081540_1009725 | |||
| 1204 | Ga0081539_10000581 | |||
| 1205 | Ga0081539_10024921 | |||
| 1206 | Ga0070717_10000090 | |||
| 1207 | Ga0070717_10003473 | |||
| 1208 | Ga0070717_10003739 | |||
| 1209 | Ga0070717_10006936 | |||
| 1210 | Ga0075365_10002637 | |||
| 1211 | Ga0075365_10023931 | |||
| 1212 | Ga0075365_10061172 | |||
| 1213 | Ga0075365_10075292 | |||
| 1214 | Ga0075363_100036221 | |||
| 1215 | Ga0075364_10031117 | |||
| 1216 | Ga0075364_10034011 | |||
| 1217 | Ga0075364_10088455 | |||
| 1218 | Ga0075364_10117386 | |||
| 1219 | Ga0070715_10081680 | |||
| 1220 | Ga0070712_100000682 | |||
| 1221 | Ga0075362_10002339 | |||
| 1222 | Ga0075362_10002936 | |||
| 1223 | Ga0075362_10024622 | |||
| 1224 | Ga0075367_10009116 | |||
| 1225 | Ga0075367_10022620 | |||
| 1226 | Ga0075367_10034082 | |||
| 1227 | Ga0075369_10001875 | |||
| 1228 | Ga0075369_10010608 | |||
| 1229 | Ga0075369_10024072 | |||
| 1230 | Ga0075366_10016313 | |||
| 1231 | Ga0075366_10064022 | |||
| 1232 | Ga0075370_10005694 | |||
| 1233 | Ga0075370_10102230 | |||
| 1234 | Ga0068871_100095523 | |||
| 1235 | Ga0075428_100000723 | |||
| 1236 | Ga0075428_100012335 | |||
| 1237 | Ga0075428_100150674 | |||
| 1238 | Ga0075430_100000543 | |||
| 1239 | Ga0075430_100018697 | |||
| 1240 | Ga0075430_100021087 | |||
| 1241 | Ga0075430_100037947 | |||
| 1242 | Ga0075431_100010747 | |||
| 1243 | Ga0075431_100011584 | |||
| 1244 | Ga0075431_100067071 | |||
| 1245 | Ga0075434_100002827 | |||
| 1246 | Ga0075434_100052338 | |||
| 1247 | Ga0075434_100104117 | |||
| 1248 | Ga0075429_100008420 | |||
| 1249 | Ga0075429_100076672 | |||
| 1250 | Ga0097620_100093303 | |||
| 1251 | Ga0099826_10000009 | |||
| 1252 | Ga0075435_100095730 | |||
| 1253 | Ga0099795_10007558 | |||
| 1254 | Ga0105251_10000050 | |||
| 1255 | Ga0105251_10001403 | |||
| 1256 | Ga0105251_10006219 | |||
| 1257 | Ga0105244_10021577 | |||
| 1258 | Ga0105244_10032683 | |||
| 1259 | Ga0105250_10006158 | |||
| 1260 | Ga0105240_10001785 | |||
| 1261 | Ga0105240_10003659 | |||
| 1262 | Ga0105240_10006815 | |||
| 1263 | Ga0105240_10045320 | |||
| 1264 | Ga0105240_10235787 | |||
| 1265 | Ga0105240_10331839 | |||
| 1266 | Ga0105240_10383216 | |||
| 1267 | Ga0111539_10022604 | |||
| 1268 | Ga0111539_10029801 | |||
| 1269 | Ga0111539_10096026 | |||
| 1270 | Ga0111539_10128838 | |||
| 1271 | Ga0114129_10004497 | |||
| 1272 | Ga0114129_10038492 | |||
| 1273 | Ga0105243_10069218 | |||
| 1274 | Ga0105242_10291514 | |||
| 1275 | Ga0105248_10001640 | |||
| 1276 | Ga0105248_10096017 | |||
| 1277 | Ga0105248_10362004 | |||
| 1278 | Ga0105237_10035681 | |||
| 1279 | Ga0105237_10112168 | |||
| 1280 | Ga0105238_10028484 | |||
| 1281 | Ga0123341_1008347 | |||
| 1282 | Ga0123342_1017545 | |||
| 1283 | Ga0099796_10000715 | |||
| 1284 | Ga0105239_10171174 | |||
| 1285 | Ga0105239_10293817 | |||
| 1286 | Ga0105239_10338126 | |||
| 1287 | Ga0105246_10047901 | |||
| 1288 | Ga0157370_10000641 | |||
| 1289 | Ga0157370_10000995 | |||
| 1290 | Ga0157369_10064273 | |||
| 1291 | Ga0157369_10116729 | |||
| 1292 | Ga0157369_10186220 | |||
| 1293 | Ga0171463_1002 | |||
| 1294 | Ga0157374_10015089 | |||
| 1295 | Ga0157374_10160845 | |||
| 1296 | Ga0163162_10005236 | |||
| 1297 | Ga0163162_10007657 | |||
| 1298 | Ga0163162_10154658 | |||
| 1299 | Ga0163162_10268798 | |||
| 1300 | Ga0157372_10115854 | |||
| 1301 | Ga0163163_10037466 | |||
| 1302 | Ga0163163_10084055 | |||
| 1303 | Ga0163163_10101321 | |||
| 1304 | Ga0163163_10105027 | |||
| 1305 | Ga0182008_10000998 | |||
| 1306 | Ga0182008_10071551 | |||
| 1307 | Ga0157379_10006783 | |||
| 1308 | Ga0157379_10258949 | |||
| 1309 | Ga0157376_10035694 | |||
| 1310 | Ga0182006_1005000 | |||
| 1311 | Ga0182006_1036424 | |||
| 1312 | Ga0183365_10036 | |||
| 1313 | Ga0183363_1033 | |||
| 1314 | Ga0183361_10008 | |||
| 1315 | Ga0163161_10137471 | |||
| 1316 | Ga0213872_10005244 | |||
| 1317 | Ga0213872_10011003 | |||
| 1318 | Ga0213872_10020337 | |||
| 1319 | Ga0213875_10000003 | |||
| 1320 | Ga0213875_10002676 | |||
| 1321 | Ga0213875_10003117 | |||
| 1322 | Ga0209435_100030 | |||
| 1323 | Ga0209435_100134 | |||
| 1324 | Ga0209784_100002 | |||
| 1325 | Ga0209784_100009 | |||
| 1326 | Ga0209566_100003 | |||
| 1327 | Ga0209566_100007 | |||
| 1328 | Ga0209674_100004 | |||
| 1329 | Ga0209674_100018 | |||
| 1330 | Ga0209147_100159 | |||
| 1331 | Ga0209563_100006 | |||
| 1332 | Ga0209563_100020 | |||
| 1333 | Ga0209437_100284 | |||
| 1334 | Ga0209258_100259 | |||
| 1335 | Ga0209646_1000057 | |||
| 1336 | Ga0209646_1000100 | |||
| 1337 | Ga0209026_1000091 | |||
| 1338 | Ga0209677_100003 | |||
| 1339 | Ga0209677_100010 | |||
| 1340 | Ga0209759_1000084 | |||
| 1341 | Ga0209759_1000123 | |||
| 1342 | Ga0209759_1000141 | |||
| 1343 | Ga0209455_1004064 | |||
| 1344 | Ga0209675_1000147 | |||
| 1345 | Ga0209675_1005918 | |||
| 1346 | Ga0209676_1000003 | |||
| 1347 | Ga0209676_1000210 | |||
| 1348 | Ga0209025_1000051 | |||
| 1349 | Ga0209025_1025482 | |||
| 1350 | Ga0209025_1035155 | |||
| 1351 | Ga0209564_1000185 | |||
| 1352 | Ga0209564_1000324 | |||
| 1353 | Ga0209758_1000294 | |||
| 1354 | Ga0209758_1000702 | |||
| 1355 | Ga0209050_1000004 | |||
| 1356 | Ga0209050_1000140 | |||
| 1357 | Ga0209256_1001487 | |||
| 1358 | Ga0207426_1011906 | |||
| 1359 | Ga0207426_1023279 | |||
| 1360 | Ga0209051_1000341 | |||
| 1361 | Ga0209051_1000964 | |||
| 1362 | Ga0209051_1001433 | |||
| 1363 | Ga0209051_1014824 | |||
| 1364 | Ga0209051_1015821 | |||
| 1365 | Ga0207697_10064516 | |||
| 1366 | Ga0207655_1017113 | |||
| 1367 | Ga0207655_1018378 | |||
| 1368 | Ga0207713_1000245 | |||
| 1369 | Ga0207713_1003742 | |||
| 1370 | Ga0207705_10017332 | |||
| 1371 | Ga0207684_10013530 | |||
| 1372 | Ga0207684_10024208 | |||
| 1373 | Ga0207684_10065690 | |||
| 1374 | Ga0207695_10005698 | |||
| 1375 | Ga0207671_10048210 | |||
| 1376 | Ga0207693_10003422 | |||
| 1377 | Ga0207693_10012484 | |||
| 1378 | Ga0207693_10111991 | |||
| 1379 | Ga0207652_10011383 | |||
| 1380 | Ga0207652_10264113 | |||
| 1381 | Ga0207646_10008930 | |||
| 1382 | Ga0207694_10015844 | |||
| 1383 | Ga0207694_10021462 | |||
| 1384 | Ga0207687_10012572 | |||
| 1385 | Ga0207700_10022953 | |||
| 1386 | Ga0207700_10033739 | |||
| 1387 | Ga0207664_10038815 | |||
| 1388 | Ga0207644_10023749 | |||
| 1389 | Ga0207644_10061004 | |||
| 1390 | Ga0207644_10100625 | |||
| 1391 | Ga0207706_10168596 | |||
| 1392 | Ga0207706_10182742 | |||
| 1393 | Ga0207686_10047378 | |||
| 1394 | Ga0207709_10040139 | |||
| 1395 | Ga0207670_10000848 | |||
| 1396 | Ga0207670_10064098 | |||
| 1397 | Ga0207665_10070815 | |||
| 1398 | Ga0207711_10158860 | |||
| 1399 | Ga0207667_10026499 | |||
| 1400 | Ga0207667_10033200 | |||
| 1401 | Ga0207667_10173526 | |||
| 1402 | Ga0207651_10140665 | |||
| 1403 | Ga0207712_10056066 | |||
| 1404 | Ga0207658_10201018 | |||
| 1405 | Ga0207677_10248722 | |||
| 1406 | Ga0207703_10009447 | |||
| 1407 | Ga0207703_10053157 | |||
| 1408 | Ga0207639_10026530 | |||
| 1409 | Ga0207708_10060477 | |||
| 1410 | Ga0207676_10026504 | |||
| 1411 | Ga0207676_10128799 | |||
| 1412 | Ga0207676_10222681 | |||
| 1413 | Ga0207674_10203476 | |||
| 1414 | Ga0207674_10228205 | |||
| 1415 | Ga0207698_10147725 | |||
| 1416 | Ga0209371_1004585 | |||
| 1417 | Ga0209589_1000008 | |||
| 1418 | Ga0209282_1000017 | |||
| 1419 | Ga0268266_10007720 | |||
| 1420 | Ga0268266_10036429 | |||
| 1421 | Ga0268265_10017350 | |||
| 1422 | Ga0265319_1015553 | |||
| 1423 | Ga0265334_10001418 | |||
| 1424 | Ga0265318_10000063 | |||
| 1425 | Ga0307515_10002150 | |||
| 1426 | Ga0307515_10049357 | |||
| 1427 | Ga0265338_10156490 | |||
| 1428 | Ga0268256_1004341 | |||
| 1429 | Ga0265332_10021801 | |||
| 1430 | Ga0265320_10000745 | |||
| 1431 | Ga0265325_10000523 | |||
| 1432 | Ga0265331_10005957 | |||
| 1433 | Ga0265331_10010753 | |||
| 1434 | Ga0265327_10001095 | |||
| 1435 | Ga0265327_10002079 | |||
| 1436 | Ga0265327_10031734 | |||
| 1437 | Ga0265316_10001831 | |||
| 1438 | Ga0265316_10043553 | |||
| 1439 | Ga0307513_10001121 | |||
| 1440 | Ga0307513_10001865 | |||
| 1441 | Ga0265313_10016373 | |||
| 1442 | Ga0265313_10035711 | |||
| 1443 | Ga0265314_10034388 | |||
| 1444 | Ga0316576_10001880 | |||
| 1445 | Ga0316576_10068124 | |||
| 1446 | Ga0307516_10016684 | |||
| 1447 | Ga0307510_10117664 | |||
| 1448 | Ga0373926_0020143 | |||
| 1449 | Ga0373929_0009921 | |||
| 1450 | Ga0373940_0001174 | |||
| 1451 | Ga0373944_0002802 | |||
| 1452 | Ga0373949_0005681 | |||
| 1453 | Ga0373923_0025466 | |||
| 1454 | Ga0373932_0007326 | |||
| 1455 | Ga0373936_0007006 | |||
| 1456 | Ga0373939_0006094 | |||
| 1457 | Ga0373945_0003110 | |||
| 1458 | Ga0373953_0006456 | |||
| 1459 | Ga0373954_0000282 | |||
| 1460 | Ga0373954_0001082 | |||
| 1461 | Ga0373954_0037711 | |||
| 1462 | Ga0373956_0001412 | |||
| 1463 | Ga0373956_0005724 | |||
| 1464 | Ga0373956_0038803 | |||
| 1465 | Ga0373960_0001745 | |||
| 1466 | Ga0373960_0017262 | |||
| 1467 | Ga0373943_0042097 | |||
| 1468 | Ga0373955_0001129 | |||
| 1469 | Ga0373955_0005927 | |||
| 1470 | Ga0373955_0137055 | |||
| 1471 | Ga0373942_0009219 | |||
| 1472 | Ga0373924_0062523 | |||
| 1473 | Ga0373931_0003182 | |||
| 1474 | Ga0373931_0003892 | |||
| 1475 | Ga0373931_0008217 | |||
| 1476 | Ga0373931_0010834 | |||
| 1477 | Ga0373935_0112091 | |||
| 1478 | Ga0373935_0139792 | |||
| 1479 | Ga0373927_0000142 | |||
| 1480 | Ga0373927_0044709 | |||
| 1481 | Ga0373927_0087035 | |||
| 1482 | Ga0373933_0016280 | |||
| 1483 | Ga0373933_0025495 | |||
| 1484 | Ga0373933_0058029 | |||
| 1485 | Ga0373947_0002200 | |||
| 1486 | Ga0373947_0047995 | |||
| 1487 | Ga0373937_0002042 | |||
| 1488 | Ga0373937_0002212 | |||
| 1489 | Ga0373937_0009659 | |||
| 1490 | Ga0373937_0014426 | |||
| 1491 | Ga0373937_0034890 | |||
| 1492 | Ga0373937_0052862 | |||
| 1493 | Ga0373937_0059883 | |||
| 1494 | Ga0373937_0248099 | |||
| 1495 | Ga0316584_0018567 | |||
| 1496 | Ga0316584_0062883 | |||
| 1497 | Ga0373925_0021114 | |||
| 1498 | Ga0373925_0039075 | |||
| 1499 | Ga0373925_0142994 | |||
| 1500 | Ga0395900_0001597 | |||
| 1501 | Ga0395900_0161453 | |||
| 1502 | Ga0395900_0187034 | |||
| 1503 | Ga0395898_0041200 | |||
| 1504 | Ga0395905_0000822 | |||
| 1505 | Ga0395905_0006358 | |||
| 1506 | Ga0436364_0251269 | |||
| 1507 | Ga0436364_0384470 | |||
| 1508 | Ga0436364_0505381 | |||
| 1509 | Ga0436364_0935620 | |||
| 1510 | Ga0436364_1068046 | |||
| 1511 | Ga0436364_1093291 | |||
| 1512 | Ga0436364_1128745 | |||
| 1513 | Ga0436364_1331333 | |||
| 1514 | Ga0395901_0001683 | |||
| 1515 | Ga0395901_0192850 | |||
| 1516 | Ga0436365_0734924 | |||
| 1517 | Ga0436365_1741883 | |||
| 1518 | Ga0436360_0322442 | |||
| 1519 | Ga0436360_0891318 | |||
| 1520 | Ga0436360_1095189 | |||
| 1521 | Ga0436360_1173188 | |||
| 1522 | Ga0436361_0505480 | |||
| 1523 | Ga0436361_0509106 | |||
| 1524 | Ga0436361_0544047 | |||
| 1525 | Ga0436361_0722746 | |||
| 1526 | Ga0436363_1314326 | |||
| 1527 | Ga0436362_0144684 | |||
| 1528 | Ga0439438_000277 | |||
| 1529 | Ga0439466_0003181 | |||
| 1530 | Ga0439431_0001299 | |||
| 1531 | Ga0439456_000129 | |||
| 1532 | Ga0439463_000319 | |||
| 1533 | Ga0439463_015876 | |||
| 1534 | Ga0450902_000251 | |||
| 1535 | Ga0450905_000059 | |||
| 1536 | Ga0439434_0022437 | |||
| 1537 | Ga0439435_0026989 | |||
| 1538 | Ga0450901_000272 | |||
| 1539 | Ga0439440_0007012 | |||
| 1540 | Ga0466969_0031089 | |||
| 1541 | Ga0466969_0052929 | |||
| 1542 | Ga0466972_0006560 | |||
| 1543 | Ga0466965_0001487 | |||
| 1544 | Ga0466966_0001908 | |||
| 1545 | Ga0466961_0032134 | |||
| 1546 | Ga0466968_0000230 | |||
| 1547 | Ga0466970_0014809 | |||
| 1548 | Ga0466970_0084465 | |||
| 1549 | Ga0466957_0005103 | |||
| 1550 | Ga0466959_0009066 | |||
| 1551 | Ga0466958_0033395 | |||
| 1552 | Ga0466967_0174888 | |||
| 1553 | Ga0466967_0239867 | |||
| 1554 | Ga0495617_007138 | |||
| 1555 | Ga0495617_007537 | |||
| 1556 | Ga0495627_034703 | |||
| 1557 | Ga0495592_0032137 | |||
| 1558 | Ga0495592_0044915 | |||
| 1559 | Ga0495603_0006045 | |||
| 1560 | Ga0495603_0016306 | |||
| 1561 | Ga0495590_0008537 | |||
| 1562 | Ga0495590_0025248 | |||
| 1563 | Ga0495591_000074 | |||
| 1564 | Ga0495591_002611 | |||
| 1565 | Ga0495591_003533 | |||
| 1566 | Ga0495591_004766 | |||
| 1567 | Ga0495591_022844 | |||
| 1568 | Ga0495629_0000294 | |||
| 1569 | Ga0495629_0005958 | |||
| 1570 | Ga0495629_0050235 | |||
| 1571 | Ga0495651_0001331 | |||
| 1572 | Ga0495651_0054232 | |||
| 1573 | Ga0495653_0001016 | |||
| 1574 | Ga0495653_0002851 | |||
| 1575 | Ga0495650_0000143 | |||
| 1576 | Ga0495650_0000401 | |||
| 1577 | Ga0495650_0000588 | |||
| 1578 | Ga0495650_0000592 | |||
| 1579 | Ga0495650_0004127 | |||
| 1580 | Ga0495650_0005087 | |||
| 1581 | Ga0495580_0000323 | |||
| 1582 | Ga0495580_0003629 | |||
| 1583 | Ga0495580_0027475 | |||
| 1584 | Ga0495580_0053287 | |||
| 1585 | Ga0495605_0000001 | |||
| 1586 | Ga0495605_0000066 | |||
| 1587 | Ga0495605_0000091 | |||
| 1588 | Ga0495605_0002280 | |||
| 1589 | Ga0495605_0007266 | |||
| 1590 | Ga0495605_0008779 | |||
| 1591 | Ga0495605_0012615 | |||
| 1592 | Ga0495605_0022630 | |||
| 1593 | Ga0495605_0026235 | |||
| 1594 | Ga0495605_0078051 | |||
| 1595 | Ga0495639_0042342 | |||
| 1596 | Ga0495664_0042449 | |||
| 1597 | Ga0495664_0074136 | |||
| 1598 | Ga0495584_0000846 | |||
| 1599 | Ga0495584_0002425 | |||
| 1600 | Ga0495584_0015298 | |||
| 1601 | Ga0495584_0034437 | |||
| 1602 | Ga0495585_0000127 | |||
| 1603 | Ga0495585_0000129 | |||
| 1604 | Ga0495585_0001065 | |||
| 1605 | Ga0495585_0030928 | |||
| 1606 | Ga0495585_0045428 | |||
| 1607 | Ga0495594_0031347 | |||
| 1608 | Ga0495596_0000020 | |||
| 1609 | Ga0495596_0000039 | |||
| 1610 | Ga0495596_0000093 | |||
| 1611 | Ga0495596_0001366 | |||
| 1612 | Ga0495596_0050782 | |||
| 1613 | Ga0495607_0000018 | |||
| 1614 | Ga0495607_0000112 | |||
| 1615 | Ga0495607_0000291 | |||
| 1616 | Ga0495607_0002244 | |||
| 1617 | Ga0495607_0004619 | |||
| 1618 | Ga0495607_0005556 | |||
| 1619 | Ga0495607_0007404 | |||
| 1620 | Ga0495607_0011693 | |||
| 1621 | Ga0495607_0027691 | |||
| 1622 | Ga0495607_0034890 | |||
| 1623 | Ga0495607_0049280 | |||
| 1624 | Ga0495607_0072623 | |||
| 1625 | Ga0495583_0000356 | |||
| 1626 | Ga0495583_0000964 | |||
| 1627 | Ga0495583_0001205 | |||
| 1628 | Ga0495583_0001302 | |||
| 1629 | Ga0495583_0001341 | |||
| 1630 | Ga0495583_0003226 | |||
| 1631 | Ga0495583_0008152 | |||
| 1632 | Ga0495583_0025948 | |||
| 1633 | Ga0495606_0000013 | |||
| 1634 | Ga0495606_0001129 | |||
| 1635 | Ga0495606_0001769 | |||
| 1636 | Ga0495606_0002361 | |||
| 1637 | Ga0495606_0003982 | |||
| 1638 | Ga0495606_0004304 | |||
| 1639 | Ga0495606_0007124 | |||
| 1640 | Ga0495606_0008235 | |||
| 1641 | Ga0495606_0014622 | |||
| 1642 | Ga0495608_0032488 | |||
| 1643 | Ga0495610_0000241 | |||
| 1644 | Ga0495610_0000814 | |||
| 1645 | Ga0495610_0003250 | |||
| 1646 | Ga0495610_0009338 | |||
| 1647 | Ga0495610_0030686 | |||
| 1648 | Ga0495610_0033014 | |||
| 1649 | Ga0495610_0034278 | |||
| 1650 | Ga0495610_0068255 | |||
| 1651 | Ga0495610_0078693 | |||
| 1652 | Ga0495616_0002672 | |||
| 1653 | Ga0495616_0006880 | |||
| 1654 | Ga0495616_0056840 | |||
| 1655 | Ga0495618_0177486 | |||
| 1656 | Ga0495620_0000540 | |||
| 1657 | Ga0495620_0000678 | |||
| 1658 | Ga0495620_0000810 | |||
| 1659 | Ga0495620_0002166 | |||
| 1660 | Ga0495620_0021849 | |||
| 1661 | Ga0495628_0012650 | |||
| 1662 | Ga0495628_0039477 | |||
| 1663 | Ga0495628_0158167 | |||
| 1664 | Ga0495630_0005357 | |||
| 1665 | Ga0495630_0010165 | |||
| 1666 | Ga0495631_0006666 | |||
| 1667 | Ga0495631_0008600 | |||
| 1668 | Ga0495631_0054493 | |||
| 1669 | Ga0495632_0001463 | |||
| 1670 | Ga0495632_0001842 | |||
| 1671 | Ga0495632_0003165 | |||
| 1672 | Ga0495632_0012803 | |||
| 1673 | Ga0495632_0013668 | |||
| 1674 | Ga0495632_0029793 | |||
| 1675 | Ga0495637_0000021 | |||
| 1676 | Ga0495637_0000039 | |||
| 1677 | Ga0495637_0000093 | |||
| 1678 | Ga0495637_0003954 | |||
| 1679 | Ga0495637_0009400 | |||
| 1680 | Ga0495637_0012673 | |||
| 1681 | Ga0495637_0014476 | |||
| 1682 | Ga0495637_0023177 | |||
| 1683 | Ga0495637_0035556 | |||
| 1684 | Ga0495637_0035563 | |||
| 1685 | Ga0495637_0058971 | |||
| 1686 | Ga0495643_0000004 | |||
| 1687 | Ga0495643_0000017 | |||
| 1688 | Ga0495643_0000971 | |||
| 1689 | Ga0495643_0003304 | |||
| 1690 | Ga0495643_0007847 | |||
| 1691 | Ga0495643_0008233 | |||
| 1692 | Ga0495643_0009867 | |||
| 1693 | Ga0495643_0020831 | |||
| 1694 | Ga0495644_0003889 | |||
| 1695 | Ga0495644_0006565 | |||
| 1696 | Ga0495644_0052340 | |||
| 1697 | Ga0495648_0000085 | |||
| 1698 | Ga0495648_0003337 | |||
| 1699 | Ga0495648_0008954 | |||
| 1700 | Ga0495648_0025775 | |||
| 1701 | Ga0495666_0012098 | |||
| 1702 | Ga0495666_0051934 | |||
| 1703 | Ga0495642_0001958 | |||
| 1704 | Ga0495652_0007120 | |||
| 1705 | Ga0495654_0009302 | |||
| 1706 | Ga0495654_0010039 | |||
| 1707 | Ga0495654_0011753 | |||
| 1708 | Ga0495654_0012116 | |||
| 1709 | Ga0495654_0022421 | |||
| 1710 | Ga0495654_0026935 | |||
| 1711 | Ga0495665_0000360 | |||
| 1712 | Ga0495665_0004745 | |||
| 1713 | Ga0495665_0005775 | |||
| 1714 | Ga0495640_0063565 | |||
| 1715 | Ga0495640_0067239 | |||
| 1716 | Ga0495640_0107611 | |||
| 1717 | Ga0495586_0046107 | |||
| 1718 | Ga0495609_0000020 | |||
| 1719 | Ga0495609_0000062 | |||
| 1720 | Ga0495609_0000209 | |||
| 1721 | Ga0495609_0002224 | |||
| 1722 | Ga0495609_0006158 | |||
| 1723 | Ga0495621_0021252 | |||
| 1724 | Ga0495621_0033943 | |||
| 1725 | Ga0495597_0018676 | |||
| 1726 | Ga0495597_0029962 | |||
| 1727 | Ga0495597_0034281 | |||
| 1728 | Ga0495645_0000295 | |||
| 1729 | Ga0495645_0011388 | |||
| 1730 | Ga0495622_0003817 | |||
| 1731 | Ga0495633_0057921 | |||
| 1732 | Ga0495633_0059104 | |||
| 1733 | Ga0495667_0006471 | |||
| 1734 | Ga0495667_0020017 | |||
| 1735 | Ga0495656_0019182 | |||
| 1736 | Ga0495668_0002202 | |||
| 1737 | Ga0495668_0002445 | |||
| 1738 | Ga0495668_0002827 | |||
| 1739 | Ga0495668_0017925 | |||
| 1740 | Ga0495668_0026718 | |||
| 1741 | Ga0495668_0035252 | |||
| 1742 | Ga0495634_0101653 | |||
| 1743 | Ga0495611_0000306 | |||
| 1744 | Ga0495611_0000359 | |||
| 1745 | Ga0495611_0000802 | |||
| 1746 | Ga0495611_0000925 | |||
| 1747 | Ga0495625_0000015 | |||
| 1748 | Ga0495625_0000016 | |||
| 1749 | Ga0495625_0000028 | |||
| 1750 | Ga0495625_0000128 | |||
| 1751 | Ga0495625_0001843 | |||
| 1752 | Ga0495625_0004665 | |||
| 1753 | Ga0495625_0024058 | |||
| 1754 | Ga0495625_0036096 | |||
| 1755 | Ga0495635_0003310 | |||
| 1756 | Ga0495635_0051331 | |||
| 1757 | Ga0495659_0013474 | |||
| 1758 | Ga0495661_0000001 | |||
| 1759 | Ga0495661_0000013 | |||
| 1760 | Ga0495661_0044997 | |||
| 1761 | Ga0495661_0059022 | |||
| 1762 | Ga0495661_0125446 | |||
| 1763 | Ga0495588_0019157 | |||
| 1764 | Ga0495599_0011331 | |||
| 1765 | Ga0495599_0055638 | |||
| 1766 | Ga0495623_0003047 | |||
| 1767 | Ga0495646_0000865 | |||
| 1768 | Ga0495646_0069229 | |||
| 1769 | Ga0495647_0008690 | |||
| 1770 | Ga0495669_0109366 | |||
| 1771 | Ga0495624_0000231 | |||
| 1772 | Ga0495624_0000629 | |||
| 1773 | Ga0495624_0030493 | |||
| 1774 | Ga0495670_0019272 | |||
| 1775 | Ga0495670_0047751 | |||
| 1776 | Ga0495670_0049833 | |||
| 1777 | Ga0495670_0059004 | |||
| 1778 | Ga0495671_0000066 | |||
| 1779 | Ga0495671_0000461 | |||
| 1780 | Ga0495671_0001197 | |||
| 1781 | Ga0495671_0002104 | |||
| 1782 | Ga0495671_0014157 | |||
| 1783 | Ga0495671_0044069 | |||
| 1784 | Ga0495649_0000033 | |||
| 1785 | Ga0495649_0000233 | |||
| 1786 | Ga0495649_0001590 | |||
| 1787 | Ga0495649_0002311 | |||
| 1788 | Ga0495649_0013985 | |||
| 1789 | Ga0495649_0019213 | |||
| 1790 | Ga0495649_0039518 | |||
| 1791 | Ga0495600_0045840 | |||
| 1792 | Ga0495600_0107129 | |||
| 1793 | Ga0495660_0002752 | |||
| 1794 | Ga0495660_0004492 | |||
| 1795 | Ga0495660_0005072 | |||
| 1796 | Ga0495660_0016561 | |||
| 1797 | Ga0495660_0021127 | |||
| 1798 | Ga0495581_0011356 | |||
| 1799 | Ga0495581_0030951 | |||
| 1800 | Ga0495581_0041353 | |||
| 1801 | Ga0495581_0120018 | |||
| 1802 | Ga0495604_0072851 | |||
| 1803 | Ga0495674_0000381 | |||
| 1804 | Ga0495674_0068801 | |||
| 1805 | Ga0495674_0086621 | |||
| 1806 | Ga0495672_0002839 | |||
| 1807 | Ga0495672_0030446 | |||
| 1808 | Ga0495672_0033522 | |||
| 1809 | Ga0495676_0000006 | |||
| 1810 | Ga0495676_0000239 | |||
| 1811 | Ga0495676_0000322 | |||
| 1812 | Ga0495676_0027229 | |||
| 1813 | Ga0495680_0012101 | |||
| 1814 | Ga0495680_0040548 | |||
| 1815 | Ga0495680_0045592 | |||
| 1816 | Ga0495680_0095110 | |||
| 1817 | Ga0495683_0000006 | |||
| 1818 | Ga0495683_0000099 | |||
| 1819 | Ga0495683_0007813 | |||
| 1820 | Ga0495683_0012254 | |||
| 1821 | Ga0495687_000069 | |||
| 1822 | Ga0495687_016931 | |||
| 1823 | Ga0495675_0058673 | |||
| 1824 | Ga0495679_000150 | |||
| 1825 | Ga0495679_000422 | |||
| 1826 | Ga0495685_032521 | |||
| 1827 | Ga0495673_0000118 | |||
| 1828 | Ga0495673_0000357 | |||
| 1829 | Ga0495673_0000469 | |||
| 1830 | Ga0495673_0000490 | |||
| 1831 | Ga0495673_0001371 | |||
| 1832 | Ga0495673_0001473 | |||
| 1833 | Ga0495673_0001957 | |||
| 1834 | Ga0495673_0039729 | |||
| 1835 | Ga0495673_0053755 | |||
| 1836 | Ga0495681_0004720 | |||
| 1837 | Ga0495681_0007704 | |||
| 1838 | Ga0495684_0045397 | |||
| 1839 | Ga0495686_0000754 | |||
| 1840 | Ga0495686_0018106 | |||
| 1841 | Ga0495686_0042466 | |||
| 1842 | Ga0495602_0001776 | |||
| 1843 | Ga0495602_0147572 | |||
| 1844 | Ga0495614_0042099 | |||
| 1845 | Ga0495615_0000147 | |||
| 1846 | Ga0495626_0000019 | |||
| 1847 | Ga0495626_0000251 | |||
| 1848 | Ga0495626_0000480 | |||
| 1849 | Ga0495626_0000566 | |||
| 1850 | Ga0495626_0000720 | |||
| 1851 | Ga0495626_0001042 | |||
| 1852 | Ga0496100_0052503 | |||
| 1853 | Ga0496100_0057381 | |||
| 1854 | Ga0496101_0019805 | |||
| 1855 | Ga0496102_0047101 | |||
| 1856 | Ga0496102_0150461 | |||
| 1857 | Ga0496103_0002554 | |||
| 1858 | Ga0496103_0047662 | |||
| 1859 | Ga0496104_0000789 | |||
| 1860 | Ga0496104_0001491 | |||
| 1861 | Ga0496104_0002884 | |||
| 1862 | Ga0496104_0006888 | |||
| 1863 | Ga0496104_0007194 | |||
| 1864 | Ga0496104_0008012 | |||
| 1865 | Ga0496104_0021778 | |||
| 1866 | Ga0496104_0035224 | |||
| 1867 | Ga0496105_0000539 | |||
| 1868 | Ga0496105_0017820 | |||
| 1869 | Ga0496105_0029290 | |||
| 1870 | Ga0496105_0036873 | |||
| 1871 | Ga0496105_0049525 | |||
| 1872 | Ga0496106_0030802 | |||
| 1873 | Ga0496106_0052384 | |||
| 1874 | Ga0496106_0089616 | |||
| 1875 | Ga0496107_0047938 | |||
| 1876 | Ga0496107_0157962 | |||
| 1877 | Ga0496108_0053395 | |||
| 1878 | Ga0496108_0080945 | |||
| 1879 | Ga0496109_0011932 | |||
| 1880 | Ga0496109_0015824 | |||
| 1881 | Ga0496109_0063885 | |||
| 1882 | Ga0496109_0191013 | |||
| 1883 | Ga0496110_0011579 | |||
| 1884 | Ga0496110_0014287 | |||
| 1885 | Ga0496110_0037217 | |||
| 1886 | Ga0496110_0096731 | |||
| 1887 | Ga0496110_0180514 | |||
| 1888 | Ga0496111_0009871 | |||
| 1889 | Ga0496111_0053788 | |||
| 1890 | Ga0496112_0004841 | |||
| 1891 | Ga0496112_0076086 | |||
| 1892 | Ga0496112_0091190 | |||
| 1893 | Ga0496112_0144233 | |||
| 1894 | Ga0496112_0193304 | |||
| 1895 | Ga0496113_0021261 | |||
| 1896 | Ga0496113_0026975 | |||
| 1897 | Ga0496113_0064303 | |||
| 1898 | Ga0496113_0085276 | |||
| 1899 | Ga0496113_0156851 | |||
| 1900 | Ga0496114_0003959 | |||
| 1901 | Ga0496114_0015099 | |||
| 1902 | Ga0496114_0032447 | |||
| 1903 | Ga0496115_0003412 | |||
| 1904 | Ga0496115_0034808 | |||
| 1905 | Ga0496115_0094236 | |||
| 1906 | Ga0496115_0145880 | |||
| 1907 | Ga0496116_0008018 | |||
| 1908 | Ga0496116_0014627 | |||
| 1909 | Ga0496116_0015786 | |||
| 1910 | Ga0496116_0072927 | |||
| 1911 | Ga0496117_0006077 | |||
| 1912 | Ga0496117_0043853 | |||
| 1913 | Ga0496117_0086104 | |||
| 1914 | Ga0496118_0016654 | |||
| 1915 | Ga0496118_0035084 | |||
| 1916 | Ga0496118_0069418 | |||
| 1917 | Ga0496118_0100146 | |||
| 1918 | Ga0496119_0006237 | |||
| 1919 | Ga0496119_0016615 | |||
| 1920 | Ga0496119_0071681 | |||
| 1921 | Ga0496120_0048141 | |||
| 1922 | Ga0496121_0000159 | |||
| 1923 | Ga0496121_0000487 | |||
| 1924 | Ga0496121_0000863 | |||
| 1925 | Ga0496121_0000982 | |||
| 1926 | Ga0496121_0001682 | |||
| 1927 | Ga0496121_0002567 | |||
| 1928 | Ga0496121_0002636 | |||
| 1929 | Ga0496121_0003787 | |||
| 1930 | Ga0496121_0009279 | |||
| 1931 | Ga0496121_0016367 | |||
| 1932 | Ga0496121_0039492 | |||
| 1933 | Ga0496121_0058546 | |||
| 1934 | Ga0496121_0131515 | |||
| 1935 | Ga0496122_0000175 | |||
| 1936 | Ga0496122_0000748 | |||
| 1937 | Ga0496122_0002017 | |||
| 1938 | Ga0496122_0026852 | |||
| 1939 | Ga0496122_0028919 | |||
| 1940 | Ga0496122_0039009 | |||
| 1941 | Ga0496122_0043457 | |||
| 1942 | Ga0496122_0046500 | |||
| 1943 | Ga0496122_0068984 | |||
| 1944 | Ga0496123_0000079 | |||
| 1945 | Ga0496123_0000224 | |||
| 1946 | Ga0496123_0001196 | |||
| 1947 | Ga0496123_0004790 | |||
| 1948 | Ga0496123_0021801 | |||
| 1949 | Ga0496123_0069527 | |||
| 1950 | Ga0496124_0000228 | |||
| 1951 | Ga0496124_0000580 | |||
| 1952 | Ga0496124_0010919 | |||
| 1953 | Ga0496124_0015876 | |||
| 1954 | Ga0496124_0016270 | |||
| 1955 | Ga0496124_0059903 | |||
| 1956 | Ga0496124_0082089 | |||
| 1957 | Ga0496124_0084366 | |||
| 1958 | Ga0496124_0087677 | |||
| 1959 | Ga0496125_0000005 | |||
| 1960 | Ga0496125_0000735 | |||
| 1961 | Ga0496125_0007191 | |||
| 1962 | Ga0496125_0017139 | |||
| 1963 | Ga0496125_0018724 | |||
| 1964 | Ga0496125_0032440 | |||
| 1965 | Ga0496125_0046993 | |||
| 1966 | Ga0496125_0056608 | |||
| 1967 | Ga0496125_0146103 | |||
| 1968 | Ga0496126_0000948 | |||
| 1969 | Ga0496126_0001493 | |||
| 1970 | Ga0496126_0005694 | |||
| 1971 | Ga0496126_0013109 | |||
| 1972 | Ga0496126_0034973 | |||
| 1973 | Ga0496126_0047065 | |||
| 1974 | Ga0496126_0163069 | |||
| 1975 | Ga0496126_0164204 | |||
| 1976 | Ga0496126_0175519 | |||
| 1977 | Ga0496126_0201786 | |||
| 1978 | Ga0495678_000083 | |||
| 1979 | Ga0495678_000119 | |||
| 1980 | Ga0495678_004091 | |||
| 1981 | Ga0495678_006390 | |||
| 1982 | Ga0495682_0000087 | |||
| 1983 | Ga0501033_0029709 | |||
| 1984 | Ga0501033_0092464 | |||
| 1985 | Ga0501034_0001458 | |||
| 1986 | Ga0501034_0026600 | |||
| 1987 | Ga0501034_0055323 | |||
| 1988 | Ga0501034_0133421 | |||
| 1989 | Ga0501036_0023348 | |||
| 1990 | Ga0501037_0018710 | |||
| 1991 | Ga0501038_0028867 | |||
| 1992 | Ga0501038_0114106 | |||
| 1993 | Ga0501038_0162159 | |||
| 1994 | Ga0501039_0013598 | |||
| 1995 | Ga0501040_0008476 | |||
| 1996 | Ga0501042_0072390 | |||
| 1997 | Ga0501043_0042966 | |||
| 1998 | Ga0501043_0102059 | |||
| 1999 | Ga0501046_0008866 | |||
| 2000 | Ga0501046_0052865 | |||
| 2001 | Ga0501047_0120727 | |||
| 2002 | Ga0501047_0157997 | |||
| 2003 | Ga0501048_0111480 | |||
| 2004 | Ga0501068_0033622 | |||
| 2005 | Ga0501070_0032957 | |||
| 2006 | Ga0501070_0220745 | |||
| 2007 | Ga0501071_0168572 | |||
| 2008 | Ga0501071_0208626 | |||
| 2009 | Ga0501072_0007568 | |||
| 2010 | Ga0501072_0039639 | |||
| 2011 | Ga0501074_0044773 | |||
| 2012 | Ga0501076_0043313 | |||
| 2013 | Ga0501079_0129512 | |||
| 2014 | Ga0501081_0178738 | |||
| 2015 | Ga0501044_0018371 | |||
| 2016 | Ga0501044_0066932 | |||
| 2017 | Ga0501044_0100362 | |||
| 2018 | nmdc:mga03683_1577_c2 | |||
| 2019 | nmdc:mga03683_8975_c1 | |||
| 2020 | nmdc:mga00v17_3116_c1 | |||
| 2021 | nmdc:mga0yw44_51208_c1 | |||
| 2022 | nmdc:mga0yw44_95408_c1 | |||
| 2023 | nmdc:mga0k408_18659_c1 | |||
| 2024 | nmdc:mga04h51_33158_c1 | |||
| 2025 | nmdc:mga05p37_10808_c1 | |||
| 2026 | nmdc:mga05p37_359778_c1 | |||
| 2027 | nmdc:mga05p37_807_c1 | |||
| 2028 | nmdc:mga09592_14585_c1 | |||
| 2029 | nmdc:mga09592_5262_c1 | |||
| 2030 | nmdc:mga09592_70286_c1 | |||
| 2031 | nmdc:mga0qj67_14_c1 | |||
| 2032 | nmdc:mga0qj67_195010_c1 | |||
| 2033 | nmdc:mga0qj67_205219_c1 | |||
| 2034 | nmdc:mga0qj67_9662_c1 | |||
| 2035 | nmdc:mga0qj67_97601_c1 | |||
| 2036 | nmdc:mga06r32_11089_c1 | |||
| 2037 | nmdc:mga06r32_119518_c1 | |||
| 2038 | nmdc:mga06r32_21880_c1 | |||
| 2039 | nmdc:mga06r32_221455_c1 | |||
| 2040 | nmdc:mga06r32_31004_c1 | |||
| 2041 | nmdc:mga06r32_4368_c1 | |||
| 2042 | nmdc:mga08y16_186691_c1 | |||
| 2043 | nmdc:mga08y16_92034_c1 | |||
| 2044 | nmdc:mga0n895_18353_c1 | |||
| 2045 | nmdc:mga0n895_67783_c1 | |||
| 2046 | nmdc:mga0n895_80639_c1 | |||
| 2047 | nmdc:mga0rr50_182285_c1 | |||
| 2048 | nmdc:mga0sz30_26243_c1 | |||
| 2049 | Ga0495601_0017336 | |||
| 2050 | Ga0495595_0020025 | |||
| 2051 | Ga0495595_0020617 | |||
| 2052 | Ga0495595_0035058 | |||
| 2053 | Ga0495595_0083824 | |||
| 2054 | Ga0495619_0005250 | |||
| 2055 | Ga0495619_0018715 | |||
| 2056 | Ga0495619_0043341 | |||
| 2057 | Ga0500644_0009067 | |||
| 2058 | Ga0500651_0000338 | |||
| 2059 | Ga0500641_0004758 | |||
| 2060 | Ga0500641_0009883 | |||
| 2061 | Ga0500571_000087 | |||
| 2062 | Ga0500594_0026838 | |||
| 2063 | Ga0500607_003436 | |||
| 2064 | Ga0500618_000157 | |||
| 2065 | Ga0500618_002071 | |||
| 2066 | Ga0500618_003052 | |||
| 2067 | Ga0500618_004735 | |||
| 2068 | Ga0500618_009823 | |||
| 2069 | Ga0500618_009997 | |||
| 2070 | Ga0500642_0000023 | |||
| 2071 | Ga0500652_000019 | |||
| 2072 | Ga0500652_000802 | |||
| 2073 | Ga0500655_001139 | |||
| 2074 | Ga0500658_0001092 | |||
| 2075 | Ga0500658_0001599 | |||
| 2076 | Ga0500568_0001751 | |||
| 2077 | Ga0500568_0004961 | |||
| 2078 | Ga0500573_0000185 | |||
| 2079 | Ga0500573_0003993 | |||
| 2080 | Ga0500573_0007073 | |||
| 2081 | Ga0500573_0014494 | |||
| 2082 | Ga0500586_015646 | |||
| 2083 | Ga0500616_0000945 | |||
| 2084 | Ga0500616_0045103 | |||
| 2085 | Ga0500616_0097198 | |||
| 2086 | Ga0500630_035386 | |||
| 2087 | Ga0500634_0053650 | |||
| 2088 | Ga0500636_0004583 | |||
| 2089 | Ga0500636_0020606 | |||
| 2090 | Ga0500609_006374 | |||
| 2091 | Ga0501084_0021672 | |||
| 2092 | Ga0501082_0117574 | |||
| 2093 | Ga0530510_0019075 | |||
| 2094 | 2876396287 | |||
| 2095 | 2501079169 | |||
| 2096 | 2501409442 | |||
| 2097 | 2511093563 | |||
| 2098 | 2511098989 | |||
| 2099 | 2511249046 | |||
| 2100 | 2511378003 | |||
| 2101 | 2511389526 | |||
| 2102 | 2513589786 | |||
| 2103 | 2515683669 | |||
| 2104 | 2548695310 | |||
| 2105 | 2550696008 | |||
| 2106 | 2601624056 | |||
| 2107 | 2644455994 | |||
| 2108 | 2644491081 | |||
| 2109 | 2644634505 | |||
| 2110 | 2644680763 | |||
| 2111 | 2738891516 | |||
| 2112 | 2739285452 | |||
| 2113 | 2739290765 | |||
| 2114 | 2739364421 | |||
| 2115 | 2739366344 | |||
| 2116 | 2753038002 | |||
| 2117 | 2753325870 | |||
| 2118 | 2765468668 | |||
| 2119 | 2765584519 | |||
| 2120 | 2770198442 | |||
| 2121 | 2776269234 | |||
| 2122 | 2776283627 | |||
| 2123 | 2807408471 | |||
| 2124 | 2807456786 | |||
| 2125 | 2808629025 | |||
| 2126 | 2812366704 | |||
| 2127 | 2819554196 | |||
| 2128 | 2819593507 | |||
| 2129 | 2819616205 | |||
| 2130 | 2839997095 | |||
| 2131 | 2840770152 | |||
| 2132 | 2841915200 | |||
| 2133 | 2841922097 | |||
| 2134 | 2842695217 | |||
| 2135 | 2842734878 | |||
| 2136 | 2842776414 | |||
| 2137 | 2842806454 | |||
| 2138 | 2842872658 | |||
| 2139 | 2847931728 | |||
| 2140 | 2856314272 | |||
| 2141 | 2856367928 | |||
| 2142 | 2874152705 | |||
| 2143 | 2876418620 | |||
| 2144 | 2881152962 | |||
| 2145 | 2881155283 | |||
| 2146 | 2881166182 | |||
| 2147 | 2883577453 | |||
| 2148 | 2884816516 | |||
| 2149 | 2884837736 | |||
| 2150 | 2884854028 | |||
| 2151 | 2885306002 | |||
| 2152 | 2885330136 | |||
| 2153 | 2885338085 | |||
| 2154 | 2887479675 | |||
| 2155 | 2894776894 | |||
| 2156 | 2896154855 | |||
| 2157 | 2897564634 | |||
| 2158 | 2902688580 | |||
| 2159 | 2902816775 | |||
| 2160 | 2902843769 | |||
| 2161 | 2904482252 | |||
| 2162 | 2904482286 | |||
| 2163 | 2904532907 | |||
| 2164 | 2904534072 | |||
| 2165 | 2904580517 | |||
| 2166 | 2904585459 | |||
| 2167 | 2904589087 | |||
| 2168 | 2904590431 | |||
| 2169 | 2904593808 | |||
| 2170 | 2904603700 | |||
| 2171 | 2904604042 | |||
| 2172 | 2904663063 | |||
| 2173 | 2906414694 | |||
| 2174 | 2908815495 | |||
| 2175 | 2912967088 | |||
| 2176 | 2919046793 | |||
| 2177 | 2919080294 | |||
| 2178 | 2919081724 | |||
| 2179 | 2919121738 | |||
| 2180 | 2919126843 | |||
| 2181 | 2919126905 | |||
| 2182 | 2919453617 | |||
| 2183 | 2919719880 | |||
| 2184 | 2923520736 | |||
| 2185 | 2925333218 | |||
| 2186 | 2925333446 | |||
| 2187 | 2928029250 | |||
| 2188 | 2928084310 | |||
| 2189 | 2928119492 | |||
| 2190 | 2928131474 | |||
| 2191 | 2928526068 | |||
| 2192 | 2929203983 | |||
| 2193 | 2929205905 | |||
| 2194 | 2929216989 | |||
| 2195 | 2937820341 | |||
| 2196 | 2939656395 | |||
| 2197 | 2941481569 | |||
| 2198 | 2945939649 | |||
| 2199 | 2946084357 | |||
| 2200 | 2954011839 | |||
| 2201 | 2961118090 | |||
| 2202 | 2961131681 | |||
| 2203 | 2968114151 | |||
| 2204 | 2977976786 | |||
| 2205 | 2984288944 | |||
| 2206 | 2984504956 | |||
| 2207 | 2984566946 | |||
| 2208 | 3002143416 | |||
| 2209 | 3004175461 | |||
| 2210 | 8001847822 | |||
| 2211 | 8054931282 | |||
| 2212 | 8055037760 | |||
| 2213 | 8055882677 | |||
| 2214 | 8055912357 | |||
| 2215 | 8055914797 | |||
| 2216 | 8055915393 | |||
| 2217 | 8056118612 | |||
| 2218 | 8056123322 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5tlc-assembly1.cif.gz_D | crystal structure of bdsa from bacillus subtilis wu-s2b | 0.9439 | 7 | 436 |
| 5tlc-assembly1.cif.gz_D | crystal structure of bdsa from bacillus subtilis wu-s2b | 0.9391 | 7 | 436 |
| 1yw1-assembly1.cif.gz_A-2 | structure of ytnj from bacillus subtilis in complex with fmn | 0.9368 | 4 | 438 |
| 1yw1-assembly1.cif.gz_A-2 | structure of ytnj from bacillus subtilis in complex with fmn | 0.9345 | 4 | 438 |
| 1tvl-assembly1.cif.gz_A-2 | structure of ytnj from bacillus subtilis | 0.9285 | 4 | 439 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5tlcD00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.9439 | 7 | 436 | 3.20.20.30 |
| 5tlcD00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.9391 | 7 | 436 | 3.20.20.30 |
| 3sdoB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.9264 | 5 | 442 | 3.20.20.30 |
| 3sdoB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.9219 | 5 | 442 | 3.20.20.30 |
| 5dqpB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.9111 | 7 | 437 | 3.20.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A529XC09-F1-model_v4 | LLM class flavin-dependent oxidoreductase | 0.985 | 81 | 226 |
GO:0016705
|
| AF-A0A377ZIW4-F1-model_v4 | Nitrilotriacetate monooxygenase component A (EC 1.14.-.-) | 0.9841 | 132 | 276 |
GO:0004497
GO:0016705 |
| AF-A0A2E3K7J9-F1-model_v4 | Nitrilotriacetate monooxygenase | 0.9829 | 7 | 438 |
GO:0004497
GO:0016705 |
| AF-A0A7W5XZC9-F1-model_v4 | Alkanesulfonate monooxygenase SsuD/methylene tetrahydromethanopterin reductase-like flavin-dependent oxidoreductase (Luciferase family) | 0.9814 | 1 | 193 |
GO:0004497
GO:0016705 |
| AF-A0A6J5IPM6-F1-model_v4 | Nitrilotriacetate monooxygenase component A | 0.9809 | 1 | 440 |
GO:0004497
GO:0009279 GO:0016705 |