F490383

General Info

Members Datasets Scaffolds Average Seq Length
1120 431 1115 411

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10027127|Ga0157370_100271272
Length 437
Sequence MGEFDRVGRENFLQNAPNEQEGGDMRFDDNLSGERPSFVTHLECAMTGERHEADVVHNLSRAGKPLLVRYDLAGVKKALSKETIARRAPDLWRYRELLPVRKAADIVSLGECMTPIVPMPRLSKKLGGGDILVKDEGRLPTGSFKARGLVMAVSMAKALDIKHMAMPTNGNAGAALAAYATRAGIKTTIFCPEDTPEVNVSEIALQGADVYRVNGLIDDCGKIVGEGKAKVGWFDTSTLKEPYRIEGKKTMGLELAEQLGWDVPDAIFYPTGGGTGLIGMWKAFDELEKIGFIGSKRPRMVAVQASGCAPMVKAYEDGVEHAPRWENAHTIASGIRVPQAVGDFLILRAVRESKGFAIAVDDEAISAGLNEMAREEGFLLCPEGAATYAAYKKSLADGRVAKSDRAVLFNCASGLKYPLPKMERKLDRHQPIDYGMF

Samples

Sample ID Description Type Environment
1 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
2 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
3 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
4 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
5 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
6 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
7 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
8 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
9 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
10 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
11 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
12 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
13 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
14 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
15 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
16 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
17 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
18 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
19 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
20 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
21 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
35 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
36 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
49 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
50 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
51 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
52 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
53 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
54 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
55 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
56 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
57 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
58 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
59 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
60 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
61 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
64 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
65 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
66 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
67 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
70 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
71 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
72 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
73 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
76 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
77 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
78 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
79 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
80 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
81 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
82 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
83 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
84 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
85 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
86 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
87 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
88 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
89 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
90 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
91 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
92 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
93 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
94 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
95 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
96 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
97 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
98 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
99 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
100 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
101 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
102 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
103 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
105 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
106 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
107 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
108 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
109 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
110 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
111 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
112 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
113 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
114 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
116 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
118 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
119 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
120 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
121 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
122 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
123 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
124 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
125 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
126 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
127 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
128 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
129 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
130 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
131 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
132 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
133 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
134 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
135 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
136 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
137 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
138 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
139 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
140 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
141 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
142 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
143 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
144 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
146 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
147 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
148 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
149 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
150 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
153 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
222 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
226 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
227 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
228 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
229 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
230 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
231 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
232 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
233 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
234 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
235 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
236 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
237 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
238 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
239 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
240 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
241 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
242 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
243 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
244 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
245 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
246 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
247 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
248 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
249 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
250 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
251 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
252 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
253 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
254 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
255 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
256 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
257 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
258 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
259 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
260 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
261 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
262 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
263 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
264 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
265 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
266 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
267 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
268 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
269 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
270 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
271 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
272 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
273 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
274 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
275 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
276 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
277 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
278 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
279 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
280 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
281 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
282 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
283 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
284 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
285 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
286 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
287 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
288 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
289 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
290 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
291 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
292 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
293 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
294 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
295 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
296 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
297 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
298 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
299 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
300 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
301 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
302 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
303 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
304 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
305 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
306 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
307 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
308 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
309 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
310 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
311 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
312 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
313 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
314 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
315 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
316 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
317 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
318 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
319 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
320 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
321 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
322 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
323 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
324 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
325 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
326 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
327 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
328 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
329 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
330 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
331 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
332 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
333 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
334 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
335 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
336 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
337 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
338 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
339 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
340 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
341 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
342 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
343 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
344 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
345 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
346 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
347 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
348 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
349 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
350 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
351 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
352 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
353 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
354 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
355 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
356 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
357 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
358 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
359 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
360 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
361 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
362 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
363 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
364 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
365 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
366 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
367 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
368 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
369 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
370 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
371 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
372 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
373 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
374 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
375 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
376 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
377 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
378 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
379 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
380 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
381 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
382 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
383 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
384 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
385 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
386 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
387 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
388 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
389 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
390 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
392 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
393 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
394 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
395 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
396 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
397 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
398 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
399 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
400 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
401 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
402 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
403 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
404 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
405 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
406 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
407 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
408 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
409 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
410 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
411 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
412 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
413 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
414 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
415 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
416 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
417 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
418 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
419 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
420 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
421 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
422 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
423 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
424 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
425 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
426 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
427 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
428 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
429 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
430 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
431 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.29
Metatranscriptomes 0.27
Isolates 0.45

Biome Distribution

Category Percentage (%)
Aerial Root 0.18
Bulb 0
Endosphere 1.88
Nodule 0
Rhizoplane 6.07
Rhizosphere 90.45
Stem 0
Stem Tuber 0
Unclassified 1.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c000094 3300000041 Bacteria 16375
2 ARSoilYngRDRAFT_c00429 3300000042 Bacteria 5297
3 ARcpr5yngRDRAFT_c000310 3300000043 Bacteria 6831
4 ARCol0oldRDRAFT_c00220 3300000045 Bacteria 5293
5 JGI24740J21852_10001716 3300001979 Bacteria 10064
6 JGI24740J21852_10003446 3300001979 Bacteria 6950
7 JGI24739J22299_10000147 3300001989 Bacteria 22531
8 JGI24739J22299_10000568 3300001989 Bacteria 13310
9 JGI24737J22298_10000225 3300001990 Bacteria 18597
10 JGI24737J22298_10000646 3300001990 Bacteria 12309
11 JGI24745J21846_1000198 3300002073 Bacteria 4895
12 JGI24738J21930_10000274 3300002075 Bacteria 14117
13 JGI24749J21850_1000977 3300002076 Bacteria 4077
14 JGI24744J21845_10002039 3300002077 Bacteria 4092
15 JGI24035J26624_1000334 3300002126 Bacteria 4407
16 JGI24035J26624_1000883 3300002126 Bacteria 2838
17 JGI24742J22300_10000166 3300002244 Bacteria 9701
18 JGI25165J46597_1000007 3300003214 Bacteria 518996
19 Ga0007417J51691_1019057 3300003544 Bacteria 1570
20 Ga0065715_10001130 3300005293 Bacteria 11867
21 Ga0070658_10000199 3300005327 Bacteria 52822
22 Ga0070658_10000571 3300005327 Bacteria 32039
23 Ga0070658_10003259 3300005327 Bacteria 13402
24 Ga0070658_10003718 3300005327 Bacteria 12480
25 Ga0070658_10028885 3300005327 Bacteria 4452
26 Ga0070658_10053493 3300005327 Bacteria 3277
27 Ga0070658_10082892 3300005327 Bacteria 2635
28 Ga0070676_10001885 3300005328 Bacteria 10659
29 Ga0070676_10003713 3300005328 Bacteria 8000
30 Ga0070683_100000177 3300005329 Bacteria 42316
31 Ga0070683_100128519 3300005329 Bacteria 2397
32 Ga0070690_100000693 3300005330 Bacteria 17271
33 Ga0070690_100049547 3300005330 Bacteria 2678
34 Ga0070690_100049986 3300005330 Bacteria 2667
35 Ga0070690_100054743 3300005330 Bacteria 2554
36 Ga0070670_100000445 3300005331 Bacteria 33591
37 Ga0070670_100009008 3300005331 Bacteria 8527
38 Ga0070670_100076461 3300005331 Bacteria 2876
39 Ga0070670_100076830 3300005331 Bacteria 2869
40 Ga0070677_10000012 3300005333 Bacteria 55279
41 Ga0068869_100000008 3300005334 Bacteria 78682
42 Ga0068869_100000057 3300005334 Bacteria 49267
43 Ga0068869_100079904 3300005334 Bacteria 2438
44 Ga0070666_10012332 3300005335 Bacteria 5387
45 Ga0070666_10015494 3300005335 Bacteria 4864
46 Ga0070666_10043038 3300005335 Bacteria 3022
47 Ga0070680_100004044 3300005336 Bacteria 10969
48 Ga0070680_100013240 3300005336 Bacteria 6421
49 Ga0070680_100016591 3300005336 Bacteria 5795
50 Ga0070680_100040597 3300005336 Bacteria 3769
51 Ga0070682_100000132 3300005337 Bacteria 62330
52 Ga0070682_100080940 3300005337 Bacteria 2101
53 Ga0068868_100000231 3300005338 Bacteria 38013
54 Ga0068868_100000705 3300005338 Bacteria 22464
55 Ga0068868_100002032 3300005338 Bacteria 13916
56 Ga0068868_100042434 3300005338 Bacteria 3550
57 Ga0070660_100002696 3300005339 Bacteria 12199
58 Ga0070660_100003369 3300005339 Bacteria 10993
59 Ga0070660_100005299 3300005339 Bacteria 8925
60 Ga0070660_100042224 3300005339 Bacteria 3480
61 Ga0070689_100001829 3300005340 Bacteria 13703
62 Ga0070689_100004446 3300005340 Bacteria 9474
63 Ga0070691_10001308 3300005341 Bacteria 10575
64 Ga0070691_10027579 3300005341 Bacteria 2650
65 Ga0070687_100000446 3300005343 Bacteria 13890
66 Ga0070687_100008694 3300005343 Bacteria 4312
67 Ga0070687_100015318 3300005343 Bacteria 3464
68 Ga0070661_100000107 3300005344 Bacteria 68766
69 Ga0070661_100033954 3300005344 Bacteria 3699
70 Ga0070661_100049720 3300005344 Bacteria 3069
71 Ga0070692_10000375 3300005345 Bacteria 13192
72 Ga0070692_10000543 3300005345 Bacteria 11731
73 Ga0070692_10003256 3300005345 Bacteria 6545
74 Ga0070692_10013333 3300005345 Bacteria 3828
75 Ga0070692_10120110 3300005345 Bacteria 1465
76 Ga0070668_100000419 3300005347 Bacteria 28126
77 Ga0070668_100077950 3300005347 Bacteria 2590
78 Ga0070669_100000916 3300005353 Bacteria 21441
79 Ga0070669_100002478 3300005353 Bacteria 13371
80 Ga0070669_100035118 3300005353 Bacteria 3631
81 Ga0070669_100070854 3300005353 Bacteria 2577
82 Ga0070675_100000032 3300005354 Bacteria 97014
83 Ga0070675_100002803 3300005354 Bacteria 13129
84 Ga0070675_100004652 3300005354 Bacteria 10479
85 Ga0070675_100008496 3300005354 Bacteria 7971
86 Ga0070675_100382113 3300005354 Bacteria 1254
87 Ga0070671_100000519 3300005355 Bacteria 27074
88 Ga0070671_100000865 3300005355 Bacteria 22124
89 Ga0070671_100003872 3300005355 Bacteria 11766
90 Ga0070671_100005241 3300005355 Bacteria 10331
91 Ga0070671_100010172 3300005355 Bacteria 7550
92 Ga0070674_100000288 3300005356 Bacteria 24683
93 Ga0070674_100251547 3300005356 Bacteria 1388
94 Ga0070673_100000024 3300005364 Bacteria 75170
95 Ga0070673_100000696 3300005364 Bacteria 18523
96 Ga0070673_100024738 3300005364 Bacteria 4407
97 Ga0070673_100042154 3300005364 Bacteria 3517
98 Ga0070688_100000281 3300005365 Bacteria 26161
99 Ga0070688_100014752 3300005365 Bacteria 4432
100 Ga0070659_100000238 3300005366 Bacteria 42955
101 Ga0070659_100000240 3300005366 Bacteria 42863
102 Ga0070659_100003410 3300005366 Bacteria 11327
103 Ga0070659_100024132 3300005366 Bacteria 4661
104 Ga0070659_100024978 3300005366 Bacteria 4585
105 Ga0070659_100040446 3300005366 Bacteria 3643
106 Ga0070659_100074082 3300005366 Bacteria 2712
107 Ga0070659_100080097 3300005366 Bacteria 2607
108 Ga0070667_100000994 3300005367 Bacteria 26033
109 Ga0070667_100001628 3300005367 Bacteria 20106
110 Ga0070667_100005520 3300005367 Bacteria 10562
111 Ga0070667_100035728 3300005367 Bacteria 4164
112 Ga0070667_100180535 3300005367 Bacteria 1866
113 Ga0070703_10002021 3300005406 Bacteria 5935
114 Ga0070709_10002849 3300005434 Bacteria 9349
115 Ga0070709_10065813 3300005434 Bacteria 2322
116 Ga0070714_100010583 3300005435 Bacteria 7296
117 Ga0070714_100020397 3300005435 Bacteria 5412
118 Ga0070714_100044663 3300005435 Bacteria 3752
119 Ga0070714_100157313 3300005435 Bacteria 2053
120 Ga0070714_100158649 3300005435 Bacteria 2045
121 Ga0070713_100016386 3300005436 Bacteria 5572
122 Ga0070713_100037000 3300005436 Bacteria 3943
123 Ga0070713_100061529 3300005436 Bacteria 3141
124 Ga0070710_10003252 3300005437 Bacteria 7701
125 Ga0070710_10014787 3300005437 Bacteria 3933
126 Ga0070710_10015872 3300005437 Bacteria 3821
127 Ga0070710_10039820 3300005437 Bacteria 2587
128 Ga0070701_10009447 3300005438 Bacteria 4272
129 Ga0070701_10039755 3300005438 Bacteria 2388
130 Ga0070711_100002902 3300005439 Bacteria 9883
131 Ga0070711_100008446 3300005439 Bacteria 6307
132 Ga0070711_100106117 3300005439 Bacteria 2053
133 Ga0070711_100110803 3300005439 Bacteria 2014
134 Ga0070705_100027305 3300005440 Bacteria 3116
135 Ga0070705_100084445 3300005440 Bacteria 1959
136 Ga0070700_100000615 3300005441 Bacteria 17714
137 Ga0070700_100031506 3300005441 Bacteria 3178
138 Ga0070694_100000181 3300005444 Bacteria 32956
139 Ga0070694_100000250 3300005444 Bacteria 28411
140 Ga0070694_100005598 3300005444 Bacteria 7614
141 Ga0070694_100073258 3300005444 Bacteria 2365
142 Ga0070663_100009797 3300005455 Bacteria 5951
143 Ga0070663_100079443 3300005455 Bacteria 2407
144 Ga0070663_100082816 3300005455 Bacteria 2361
145 Ga0070663_100101441 3300005455 Bacteria 2148
146 Ga0070678_100000211 3300005456 Bacteria 26054
147 Ga0070678_100003017 3300005456 Bacteria 9328
148 Ga0070662_100000268 3300005457 Bacteria 30569
149 Ga0070662_100006788 3300005457 Bacteria 7400
150 Ga0070662_100007668 3300005457 Bacteria 7001
151 Ga0070681_10004709 3300005458 Bacteria 13058
152 Ga0070681_10022513 3300005458 Bacteria 6328
153 Ga0070681_10188923 3300005458 Bacteria 1980
154 Ga0068867_100000660 3300005459 Bacteria 22843
155 Ga0068867_100001143 3300005459 Bacteria 18134
156 Ga0070685_10001436 3300005466 Bacteria 12497
157 Ga0070685_10031604 3300005466 Bacteria 2959
158 Ga0070699_100002292 3300005518 Bacteria 17217
159 Ga0070679_100000352 3300005530 Bacteria 39151
160 Ga0070679_100056192 3300005530 Bacteria 3922
161 Ga0070679_100061622 3300005530 Bacteria 3739
162 Ga0070679_100128118 3300005530 Bacteria 2520
163 Ga0070679_100153310 3300005530 Bacteria 2280
164 Ga0070684_100000022 3300005535 Bacteria 128353
165 Ga0070684_100059496 3300005535 Bacteria 3340
166 Ga0070697_100115247 3300005536 Bacteria 2243
167 Ga0068853_100003212 3300005539 Bacteria 12490
168 Ga0068853_100006604 3300005539 Bacteria 9237
169 Ga0068853_100117866 3300005539 Bacteria 2365
170 Ga0070672_100000226 3300005543 Bacteria 31423
171 Ga0070672_100000401 3300005543 Bacteria 25012
172 Ga0070672_100003438 3300005543 Bacteria 10257
173 Ga0070672_100010268 3300005543 Bacteria 6491
174 Ga0070672_100114508 3300005543 Bacteria 2201
175 Ga0070672_100197903 3300005543 Bacteria 1680
176 Ga0070686_100000336 3300005544 Bacteria 30396
177 Ga0070686_100000395 3300005544 Bacteria 27599
178 Ga0070686_100020030 3300005544 Bacteria 3954
179 Ga0070686_100051814 3300005544 Bacteria 2614
180 Ga0070695_100000242 3300005545 Bacteria 27098
181 Ga0070695_100031056 3300005545 Bacteria 3328
182 Ga0070696_100000885 3300005546 Bacteria 19400
183 Ga0070696_100004160 3300005546 Bacteria 9637
184 Ga0070696_100017360 3300005546 Bacteria 4857
185 Ga0070693_100000428 3300005547 Bacteria 19004
186 Ga0070693_100002630 3300005547 Bacteria 8268
187 Ga0070665_100026013 3300005548 Bacteria 5895
188 Ga0070665_100052989 3300005548 Bacteria 4069
189 Ga0070665_100060381 3300005548 Bacteria 3800
190 Ga0070665_100071224 3300005548 Bacteria 3483
191 Ga0070704_100001996 3300005549 Bacteria 11301
192 Ga0070704_100004811 3300005549 Bacteria 7822
193 Ga0070704_100007538 3300005549 Bacteria 6479
194 Ga0068855_100000129 3300005563 Bacteria 96519
195 Ga0068855_100004217 3300005563 Bacteria 17547
196 Ga0068855_100005134 3300005563 Bacteria 15967
197 Ga0068855_100032137 3300005563 Bacteria 6266
198 Ga0070664_100000248 3300005564 Bacteria 38923
199 Ga0070664_100001618 3300005564 Bacteria 18025
200 Ga0070664_100009369 3300005564 Bacteria 7940
201 Ga0070664_100018098 3300005564 Bacteria 5784
202 Ga0070664_100094009 3300005564 Bacteria 2599
203 Ga0070664_100141972 3300005564 Bacteria 2115
204 Ga0068857_100000393 3300005577 Bacteria 30712
205 Ga0068857_100008676 3300005577 Bacteria 8796
206 Ga0068857_100124372 3300005577 Bacteria 2324
207 Ga0068857_100174739 3300005577 Bacteria 1953
208 Ga0068857_100342704 3300005577 Bacteria 1383
209 Ga0068854_100000210 3300005578 Bacteria 39202
210 Ga0068854_100000806 3300005578 Bacteria 18679
211 Ga0068854_100095380 3300005578 Bacteria 2221
212 Ga0068856_100000990 3300005614 Bacteria 30328
213 Ga0068856_100054786 3300005614 Bacteria 3935
214 Ga0070702_100000029 3300005615 Bacteria 39388
215 Ga0070702_100091057 3300005615 Bacteria 1850
216 Ga0068852_100000628 3300005616 Bacteria 23079
217 Ga0068852_100004350 3300005616 Bacteria 10000
218 Ga0068852_100029528 3300005616 Bacteria 4506
219 Ga0068852_100096276 3300005616 Bacteria 2660
220 Ga0068852_100112314 3300005616 Bacteria 2479
221 Ga0068859_100002192 3300005617 Bacteria 19839
222 Ga0068859_100002303 3300005617 Bacteria 19397
223 Ga0068859_100006115 3300005617 Bacteria 12227
224 Ga0068859_100015921 3300005617 Bacteria 7558
225 Ga0068859_100132287 3300005617 Bacteria 2566
226 Ga0068859_100179115 3300005617 Bacteria 2202
227 Ga0068864_100000338 3300005618 Bacteria 41280
228 Ga0068864_100000492 3300005618 Bacteria 34166
229 Ga0068864_100013256 3300005618 Bacteria 6828
230 Ga0068864_100015515 3300005618 Bacteria 6334
231 Ga0068866_10000179 3300005718 Bacteria 29712
232 Ga0068861_100000140 3300005719 Bacteria 36794
233 Ga0068861_100001124 3300005719 Bacteria 16598
234 Ga0068861_100009236 3300005719 Bacteria 6803
235 Ga0068861_100025604 3300005719 Bacteria 4280
236 Ga0068861_100040904 3300005719 Bacteria 3469
237 Ga0068861_100123253 3300005719 Bacteria 2094
238 Ga0068851_10005731 3300005834 Bacteria 5651
239 Ga0068851_10009297 3300005834 Bacteria 4563
240 Ga0068870_10000001 3300005840 Bacteria 97513
241 Ga0068870_10036649 3300005840 Bacteria 2524
242 Ga0068863_100000246 3300005841 Bacteria 57714
243 Ga0068863_100000409 3300005841 Bacteria 43632
244 Ga0068863_100018899 3300005841 Bacteria 6594
245 Ga0068863_100089977 3300005841 Bacteria 2910
246 Ga0068858_100000897 3300005842 Bacteria 30873
247 Ga0068858_100001644 3300005842 Bacteria 22821
248 Ga0068858_100004175 3300005842 Bacteria 14217
249 Ga0068858_100008307 3300005842 Bacteria 9983
250 Ga0068860_100001266 3300005843 Bacteria 27606
251 Ga0068860_100010676 3300005843 Bacteria 9070
252 Ga0068860_100014184 3300005843 Bacteria 7812
253 Ga0068860_100014402 3300005843 Bacteria 7748
254 Ga0068860_100046274 3300005843 Bacteria 4148
255 Ga0068862_100001531 3300005844 Bacteria 21154
256 Ga0068862_100001891 3300005844 Bacteria 18987
257 Ga0068862_100034983 3300005844 Bacteria 4252
258 Ga0068862_100070033 3300005844 Bacteria 3028
259 Ga0068862_100137749 3300005844 Bacteria 2164
260 Ga0081455_10007245 3300005937 Bacteria 11708
261 Ga0081455_10027309 3300005937 Bacteria 5232
262 Ga0081455_10062384 3300005937 Bacteria 3133
263 Ga0081539_10016110 3300005985 Bacteria 5369
264 Ga0070717_10000215 3300006028 Bacteria 40202
265 Ga0070717_10041913 3300006028 Bacteria 3733
266 Ga0070717_10043671 3300006028 Bacteria 3659
267 Ga0075365_10002820 3300006038 Bacteria 8708
268 Ga0075365_10173359 3300006038 Bacteria 1506
269 Ga0075368_10015431 3300006042 Bacteria 2834
270 Ga0075363_100154618 3300006048 Bacteria 1296
271 Ga0075364_10129279 3300006051 Bacteria 1694
272 Ga0075432_10002730 3300006058 Bacteria 5899
273 Ga0070716_100000605 3300006173 Bacteria 15148
274 Ga0070716_100073071 3300006173 Bacteria 2022
275 Ga0070712_100005387 3300006175 Bacteria 7920
276 Ga0070712_100015217 3300006175 Bacteria 4948
277 Ga0070712_100023430 3300006175 Bacteria 4079
278 Ga0070712_100032573 3300006175 Bacteria 3520
279 Ga0097621_100001299 3300006237 Bacteria 17186
280 Ga0097621_100059032 3300006237 Bacteria 3140
281 Ga0097621_100073302 3300006237 Bacteria 2834
282 Ga0097621_100089756 3300006237 Bacteria 2570
283 Ga0075370_10033860 3300006353 Bacteria 2862
284 Ga0068871_100000007 3300006358 Bacteria 115829
285 Ga0068871_100071392 3300006358 Bacteria 2856
286 Ga0075428_100016903 3300006844 Bacteria 8057
287 Ga0075428_100035713 3300006844 Bacteria 5478
288 Ga0075428_100043146 3300006844 Bacteria 4959
289 Ga0075430_100000128 3300006846 Bacteria 47770
290 Ga0075430_100020523 3300006846 Bacteria 5620
291 Ga0075431_100000557 3300006847 Bacteria 31397
292 Ga0075431_100011821 3300006847 Bacteria 8809
293 Ga0075433_10000103 3300006852 Bacteria 41320
294 Ga0075433_10032108 3300006852 Bacteria 4494
295 Ga0075434_100003002 3300006871 Bacteria 15007
296 Ga0075434_100005851 3300006871 Bacteria 11231
297 Ga0075434_100090618 3300006871 Bacteria 3059
298 Ga0075429_100004986 3300006880 Bacteria 11434
299 Ga0075429_100014311 3300006880 Bacteria 6881
300 Ga0068865_100000091 3300006881 Bacteria 47674
301 Ga0068865_100000947 3300006881 Bacteria 16504
302 Ga0068865_100067561 3300006881 Bacteria 2525
303 Ga0075436_100141693 3300006914 Bacteria 1690
304 Ga0097620_100002192 3300006931 Bacteria 19839
305 Ga0097620_100002303 3300006931 Bacteria 19397
306 Ga0097620_100006115 3300006931 Bacteria 12227
307 Ga0097620_100015921 3300006931 Bacteria 7558
308 Ga0097620_100132286 3300006931 Bacteria 2566
309 Ga0097620_100179116 3300006931 Bacteria 2202
310 Ga0075435_100050157 3300007076 Bacteria 3358
311 Ga0075435_100052637 3300007076 Bacteria 3281
312 Ga0111539_10000265 3300009094 Bacteria 62336
313 Ga0111539_10003594 3300009094 Bacteria 20438
314 Ga0111539_10006865 3300009094 Bacteria 14627
315 Ga0111539_10179216 3300009094 Bacteria 2475
316 Ga0105245_10000187 3300009098 Bacteria 58607
317 Ga0105245_10003932 3300009098 Bacteria 13216
318 Ga0105245_10053267 3300009098 Bacteria 3631
319 Ga0105247_10003235 3300009101 Bacteria 10717
320 Ga0105247_10047964 3300009101 Bacteria 2624
321 Ga0114129_10037638 3300009147 Bacteria 6830
322 Ga0105243_10001870 3300009148 Bacteria 17965
323 Ga0105243_10024775 3300009148 Bacteria 4580
324 Ga0105243_10061475 3300009148 Bacteria 3004
325 Ga0105243_10075117 3300009148 Bacteria 2742
326 Ga0105241_10000958 3300009174 Bacteria 21825
327 Ga0105242_10000633 3300009176 Bacteria 27598
328 Ga0105248_10001205 3300009177 Bacteria 28902
329 Ga0105248_10002490 3300009177 Bacteria 20477
330 Ga0105248_10010094 3300009177 Bacteria 10400
331 Ga0105248_10091898 3300009177 Bacteria 3418
332 Ga0105248_10110580 3300009177 Bacteria 3098
333 Ga0105237_10002942 3300009545 Bacteria 20619
334 Ga0105238_10001421 3300009551 Bacteria 23984
335 Ga0105238_10090689 3300009551 Bacteria 3044
336 Ga0105238_10093032 3300009551 Bacteria 3003
337 Ga0105238_10204990 3300009551 Bacteria 1948
338 Ga0105238_10396989 3300009551 Bacteria 1372
339 Ga0105249_10000564 3300009553 Bacteria 34176
340 Ga0105249_10007631 3300009553 Bacteria 9434
341 Ga0105249_10027715 3300009553 Bacteria 5112
342 Ga0105239_10003234 3300010375 Bacteria 20124
343 Ga0105239_10227438 3300010375 Bacteria 2093
344 Ga0105246_10000316 3300011119 Bacteria 25627
345 Ga0157335_1000272 3300012492 Bacteria 2250
346 Ga0157371_10003004 3300013102 Bacteria 15667
347 Ga0157371_10008818 3300013102 Bacteria 7987
348 Ga0157371_10024995 3300013102 Bacteria 4358
349 Ga0157371_10030452 3300013102 Bacteria 3893
350 Ga0157370_10027127 3300013104 Bacteria 5648
351 Ga0157370_10033382 3300013104 Bacteria 5018
352 Ga0157370_10075953 3300013104 Bacteria 3166
353 Ga0157370_10189456 3300013104 Bacteria 1909
354 Ga0157369_10001231 3300013105 Bacteria 31905
355 Ga0157369_10164746 3300013105 Bacteria 2339
356 Ga0157374_10053572 3300013296 Bacteria 3761
357 Ga0157374_10066905 3300013296 Bacteria 3377
358 Ga0157374_10241691 3300013296 Bacteria 1775
359 Ga0157378_10000417 3300013297 Bacteria 41934
360 Ga0157378_10001984 3300013297 Bacteria 18313
361 Ga0157378_10035180 3300013297 Bacteria 4429
362 Ga0163162_10002975 3300013306 Bacteria 16181
363 Ga0163162_10011395 3300013306 Bacteria 8669
364 Ga0163162_10030784 3300013306 Bacteria 5318
365 Ga0157372_10165227 3300013307 Bacteria 2559
366 Ga0157375_10000430 3300013308 Bacteria 37838
367 Ga0157375_10024976 3300013308 Bacteria 5541
368 Ga0157375_10067479 3300013308 Bacteria 3574
369 Ga0157375_10084835 3300013308 Bacteria 3216
370 Ga0163163_10119598 3300014325 Bacteria 2667
371 Ga0157380_10000203 3300014326 Bacteria 35045
372 Ga0157380_10204499 3300014326 Bacteria 1754
373 Ga0157377_10000290 3300014745 Bacteria 23959
374 Ga0157377_10014739 3300014745 Bacteria 3984
375 Ga0157379_10003225 3300014968 Bacteria 13816
376 Ga0157379_10033973 3300014968 Bacteria 4546
377 Ga0157376_10000104 3300014969 Bacteria 61530
378 Ga0157376_10034976 3300014969 Bacteria 4060
379 Ga0157376_10086330 3300014969 Bacteria 2705
380 Ga0163161_10000724 3300017792 Bacteria 25964
381 Ga0163161_10066684 3300017792 Bacteria 2629
382 Ga0206354_10333486 3300020081 Bacteria 2769
383 Ga0206353_10140861 3300020082 Bacteria 6359
384 Ga0213874_10003678 3300021377 Bacteria 3429
385 Ga0213876_10001649 3300021384 Bacteria 13615
386 Ga0213876_10017509 3300021384 Bacteria 3783
387 Ga0213875_10005756 3300021388 Bacteria 6600
388 Ga0209233_1000026 3300025261 Bacteria 678466
389 Ga0209233_1005712 3300025261 Bacteria 4102
390 Ga0207666_1000008 3300025271 Bacteria 49296
391 Ga0209455_1007486 3300025272 Bacteria 3076
392 Ga0207673_1000195 3300025290 Bacteria 6076
393 Ga0207697_10000093 3300025315 Bacteria 40647
394 Ga0207697_10000972 3300025315 Bacteria 16118
395 Ga0207656_10006616 3300025321 Bacteria 4181
396 Ga0207653_10000374 3300025885 Bacteria 20974
397 Ga0207653_10029472 3300025885 Bacteria 1768
398 Ga0207682_10000002 3300025893 Bacteria 132580
399 Ga0207682_10054763 3300025893 Bacteria 1658
400 Ga0207692_10033347 3300025898 Bacteria 2483
401 Ga0207642_10000064 3300025899 Bacteria 29771
402 Ga0207710_10015153 3300025900 Bacteria 3256
403 Ga0207710_10031104 3300025900 Bacteria 2332
404 Ga0207688_10000061 3300025901 Bacteria 39296
405 Ga0207688_10000850 3300025901 Bacteria 15383
406 Ga0207688_10136516 3300025901 Bacteria 1441
407 Ga0207680_10014546 3300025903 Bacteria 4077
408 Ga0207680_10018129 3300025903 Bacteria 3735
409 Ga0207680_10145866 3300025903 Bacteria 1573
410 Ga0207680_10153937 3300025903 Bacteria 1535
411 Ga0207647_10000393 3300025904 Bacteria 35865
412 Ga0207647_10002907 3300025904 Bacteria 12898
413 Ga0207647_10013938 3300025904 Bacteria 5563
414 Ga0207647_10043767 3300025904 Bacteria 2799
415 Ga0207699_10005831 3300025906 Bacteria 5928
416 Ga0207699_10023468 3300025906 Bacteria 3357
417 Ga0207699_10025362 3300025906 Bacteria 3253
418 Ga0207645_10000026 3300025907 Bacteria 97025
419 Ga0207645_10003852 3300025907 Bacteria 11225
420 Ga0207643_10000090 3300025908 Bacteria 60972
421 Ga0207643_10006777 3300025908 Bacteria 6146
422 Ga0207705_10000002 3300025909 Bacteria 2046852
423 Ga0207705_10000091 3300025909 Bacteria 110768
424 Ga0207705_10001555 3300025909 Bacteria 18213
425 Ga0207705_10006449 3300025909 Bacteria 8691
426 Ga0207705_10011264 3300025909 Bacteria 6481
427 Ga0207705_10024056 3300025909 Bacteria 4346
428 Ga0207705_10025205 3300025909 Bacteria 4246
429 Ga0207705_10042460 3300025909 Bacteria 3264
430 Ga0207707_10060256 3300025912 Bacteria 3302
431 Ga0207707_10156931 3300025912 Bacteria 1990
432 Ga0207707_10326852 3300025912 Bacteria 1323
433 Ga0207695_10073797 3300025913 Bacteria 3475
434 Ga0207671_10031527 3300025914 Bacteria 3950
435 Ga0207693_10006780 3300025915 Bacteria 9456
436 Ga0207693_10007813 3300025915 Bacteria 8779
437 Ga0207693_10014507 3300025915 Bacteria 6333
438 Ga0207693_10016177 3300025915 Bacteria 5966
439 Ga0207693_10020815 3300025915 Bacteria 5216
440 Ga0207693_10030868 3300025915 Bacteria 4233
441 Ga0207693_10035663 3300025915 Bacteria 3921
442 Ga0207663_10021669 3300025916 Bacteria 3662
443 Ga0207660_10000374 3300025917 Bacteria 29233
444 Ga0207660_10030691 3300025917 Bacteria 3695
445 Ga0207660_10053001 3300025917 Bacteria 2890
446 Ga0207662_10000244 3300025918 Bacteria 25094
447 Ga0207662_10000473 3300025918 Bacteria 17944
448 Ga0207662_10001021 3300025918 Bacteria 13119
449 Ga0207657_10000092 3300025919 Bacteria 85665
450 Ga0207657_10001122 3300025919 Bacteria 28419
451 Ga0207657_10001644 3300025919 Bacteria 24105
452 Ga0207657_10003953 3300025919 Bacteria 15731
453 Ga0207657_10008488 3300025919 Bacteria 10421
454 Ga0207657_10030980 3300025919 Bacteria 4849
455 Ga0207657_10097515 3300025919 Bacteria 2444
456 Ga0207657_10124392 3300025919 Bacteria 2119
457 Ga0207649_10000143 3300025920 Bacteria 59962
458 Ga0207649_10049398 3300025920 Bacteria 2598
459 Ga0207652_10003863 3300025921 Bacteria 12271
460 Ga0207652_10031422 3300025921 Bacteria 4460
461 Ga0207681_10000457 3300025923 Bacteria 28651
462 Ga0207681_10001615 3300025923 Bacteria 14537
463 Ga0207681_10118699 3300025923 Bacteria 1936
464 Ga0207694_10001995 3300025924 Bacteria 16888
465 Ga0207694_10030859 3300025924 Bacteria 4092
466 Ga0207694_10053905 3300025924 Bacteria 3119
467 Ga0207694_10066479 3300025924 Bacteria 2813
468 Ga0207650_10004633 3300025925 Bacteria 9404
469 Ga0207650_10010118 3300025925 Bacteria 6463
470 Ga0207650_10081524 3300025925 Bacteria 2454
471 Ga0207650_10257962 3300025925 Bacteria 1413
472 Ga0207659_10000015 3300025926 Bacteria 168475
473 Ga0207659_10015849 3300025926 Bacteria 4896
474 Ga0207659_10048394 3300025926 Bacteria 3011
475 Ga0207687_10000543 3300025927 Bacteria 25288
476 Ga0207687_10003367 3300025927 Bacteria 10796
477 Ga0207687_10019356 3300025927 Bacteria 4510
478 Ga0207700_10012884 3300025928 Bacteria 5411
479 Ga0207700_10057915 3300025928 Bacteria 2924
480 Ga0207700_10130082 3300025928 Bacteria 2054
481 Ga0207664_10021035 3300025929 Bacteria 4843
482 Ga0207664_10117024 3300025929 Bacteria 2224
483 Ga0207644_10000463 3300025931 Bacteria 26317
484 Ga0207644_10007001 3300025931 Bacteria 7344
485 Ga0207644_10012135 3300025931 Bacteria 5716
486 Ga0207644_10024447 3300025931 Bacteria 4147
487 Ga0207644_10073760 3300025931 Bacteria 2503
488 Ga0207644_10092329 3300025931 Bacteria 2258
489 Ga0207644_10148990 3300025931 Bacteria 1809
490 Ga0207690_10000397 3300025932 Bacteria 28759
491 Ga0207690_10001140 3300025932 Bacteria 16917
492 Ga0207690_10006879 3300025932 Bacteria 6745
493 Ga0207690_10018172 3300025932 Bacteria 4309
494 Ga0207690_10061933 3300025932 Bacteria 2545
495 Ga0207706_10000185 3300025933 Bacteria 69659
496 Ga0207706_10001387 3300025933 Bacteria 24176
497 Ga0207706_10008224 3300025933 Bacteria 9624
498 Ga0207706_10010598 3300025933 Bacteria 8419
499 Ga0207706_10010688 3300025933 Bacteria 8385
500 Ga0207706_10010902 3300025933 Bacteria 8295
501 Ga0207706_10017204 3300025933 Bacteria 6517
502 Ga0207706_10028751 3300025933 Bacteria 4962
503 Ga0207706_10126787 3300025933 Bacteria 2245
504 Ga0207686_10000065 3300025934 Bacteria 95366
505 Ga0207686_10019330 3300025934 Bacteria 3872
506 Ga0207686_10027500 3300025934 Bacteria 3332
507 Ga0207709_10000081 3300025935 Bacteria 164427
508 Ga0207709_10002863 3300025935 Bacteria 10567
509 Ga0207670_10000056 3300025936 Bacteria 84496
510 Ga0207670_10009248 3300025936 Bacteria 5611
511 Ga0207670_10025321 3300025936 Bacteria 3723
512 Ga0207670_10032470 3300025936 Bacteria 3358
513 Ga0207669_10000008 3300025937 Bacteria 168213
514 Ga0207704_10000031 3300025938 Bacteria 111710
515 Ga0207704_10002888 3300025938 Bacteria 7772
516 Ga0207704_10012582 3300025938 Bacteria 4204
517 Ga0207704_10018925 3300025938 Bacteria 3606
518 Ga0207665_10107454 3300025939 Bacteria 1956
519 Ga0207691_10000114 3300025940 Bacteria 72745
520 Ga0207691_10001398 3300025940 Bacteria 24158
521 Ga0207691_10002093 3300025940 Bacteria 19499
522 Ga0207691_10003704 3300025940 Bacteria 14824
523 Ga0207691_10015203 3300025940 Bacteria 7323
524 Ga0207711_10000784 3300025941 Bacteria 31210
525 Ga0207711_10001138 3300025941 Bacteria 25380
526 Ga0207711_10031680 3300025941 Bacteria 4465
527 Ga0207711_10067676 3300025941 Bacteria 3092
528 Ga0207711_10076645 3300025941 Bacteria 2912
529 Ga0207689_10000014 3300025942 Bacteria 122534
530 Ga0207689_10000772 3300025942 Bacteria 30699
531 Ga0207689_10002348 3300025942 Bacteria 17690
532 Ga0207689_10018494 3300025942 Bacteria 5880
533 Ga0207689_10071406 3300025942 Bacteria 2851
534 Ga0207689_10215997 3300025942 Bacteria 1585
535 Ga0207661_10000255 3300025944 Bacteria 34585
536 Ga0207661_10109985 3300025944 Bacteria 2329
537 Ga0207661_10299682 3300025944 Bacteria 1441
538 Ga0207679_10000014 3300025945 Bacteria 275841
539 Ga0207679_10008134 3300025945 Bacteria 6672
540 Ga0207679_10013763 3300025945 Bacteria 5306
541 Ga0207679_10017311 3300025945 Bacteria 4805
542 Ga0207679_10095038 3300025945 Bacteria 2316
543 Ga0207679_10133870 3300025945 Bacteria 1993
544 Ga0207679_10153391 3300025945 Bacteria 1878
545 Ga0207667_10001226 3300025949 Bacteria 32150
546 Ga0207667_10010693 3300025949 Bacteria 10710
547 Ga0207667_10030878 3300025949 Bacteria 5790
548 Ga0207667_10039605 3300025949 Bacteria 5022
549 Ga0207651_10000055 3300025960 Bacteria 49506
550 Ga0207651_10000396 3300025960 Bacteria 18460
551 Ga0207651_10077553 3300025960 Bacteria 2379
552 Ga0207651_10093902 3300025960 Bacteria 2204
553 Ga0207651_10259870 3300025960 Bacteria 1425
554 Ga0207712_10002119 3300025961 Bacteria 12977
555 Ga0207712_10002532 3300025961 Bacteria 11749
556 Ga0207712_10033210 3300025961 Bacteria 3487
557 Ga0207712_10040509 3300025961 Bacteria 3198
558 Ga0207712_10071181 3300025961 Bacteria 2500
559 Ga0207668_10000037 3300025972 Bacteria 115995
560 Ga0207668_10026112 3300025972 Bacteria 3788
561 Ga0207668_10050698 3300025972 Bacteria 2862
562 Ga0207640_10001137 3300025981 Bacteria 14601
563 Ga0207640_10003009 3300025981 Bacteria 9065
564 Ga0207640_10068763 3300025981 Bacteria 2375
565 Ga0207658_10002855 3300025986 Bacteria 12369
566 Ga0207658_10005866 3300025986 Bacteria 8399
567 Ga0207658_10018209 3300025986 Bacteria 4846
568 Ga0207677_10000363 3300026023 Bacteria 31847
569 Ga0207677_10017614 3300026023 Bacteria 4265
570 Ga0207677_10246966 3300026023 Bacteria 1447
571 Ga0207703_10000483 3300026035 Bacteria 41615
572 Ga0207703_10000858 3300026035 Bacteria 29827
573 Ga0207703_10001589 3300026035 Bacteria 20561
574 Ga0207703_10033233 3300026035 Bacteria 4087
575 Ga0207639_10000767 3300026041 Bacteria 21905
576 Ga0207639_10000903 3300026041 Bacteria 20098
577 Ga0207678_10000372 3300026067 Bacteria 40922
578 Ga0207678_10014392 3300026067 Bacteria 6956
579 Ga0207678_10069749 3300026067 Bacteria 3014
580 Ga0207678_10078943 3300026067 Bacteria 2819
581 Ga0207708_10000460 3300026075 Bacteria 31639
582 Ga0207708_10001478 3300026075 Bacteria 17560
583 Ga0207708_10002409 3300026075 Bacteria 13725
584 Ga0207708_10089575 3300026075 Bacteria 2371
585 Ga0207702_10001048 3300026078 Bacteria 28323
586 Ga0207702_10070691 3300026078 Bacteria 3003
587 Ga0207641_10001563 3300026088 Bacteria 22380
588 Ga0207641_10002957 3300026088 Bacteria 15368
589 Ga0207641_10007922 3300026088 Bacteria 8811
590 Ga0207641_10057553 3300026088 Bacteria 3306
591 Ga0207648_10001536 3300026089 Bacteria 25412
592 Ga0207648_10002021 3300026089 Bacteria 22147
593 Ga0207648_10004845 3300026089 Bacteria 13728
594 Ga0207676_10000483 3300026095 Bacteria 33535
595 Ga0207676_10002489 3300026095 Bacteria 13118
596 Ga0207676_10006265 3300026095 Bacteria 8398
597 Ga0207676_10012844 3300026095 Bacteria 6013
598 Ga0207674_10002391 3300026116 Bacteria 23726
599 Ga0207674_10003948 3300026116 Bacteria 18040
600 Ga0207674_10012453 3300026116 Bacteria 9505
601 Ga0207674_10028442 3300026116 Bacteria 5900
602 Ga0207674_10176694 3300026116 Bacteria 2087
603 Ga0207675_100000231 3300026118 Bacteria 52812
604 Ga0207675_100000264 3300026118 Bacteria 49823
605 Ga0207675_100007144 3300026118 Bacteria 10554
606 Ga0207675_100011322 3300026118 Bacteria 8349
607 Ga0207675_100039730 3300026118 Bacteria 4391
608 Ga0207675_100150405 3300026118 Bacteria 2215
609 Ga0207683_10000002 3300026121 Bacteria 258441
610 Ga0207683_10006794 3300026121 Bacteria 9796
611 Ga0207683_10020956 3300026121 Bacteria 5595
612 Ga0207683_10023336 3300026121 Bacteria 5321
613 Ga0207683_10036600 3300026121 Bacteria 4275
614 Ga0207683_10245217 3300026121 Bacteria 1634
615 Ga0207698_10001676 3300026142 Bacteria 12913
616 Ga0207698_10009377 3300026142 Bacteria 6239
617 Ga0207698_10018583 3300026142 Bacteria 4740
618 Ga0207698_10056437 3300026142 Bacteria 3033
619 Ga0207698_10146935 3300026142 Bacteria 2040
620 Ga0210002_1000756 3300027617 Bacteria 4385
621 Ga0209966_1000521 3300027695 Bacteria 9898
622 Ga0209998_10002232 3300027717 Bacteria 4488
623 Ga0209998_10006254 3300027717 Bacteria 2473
624 Ga0209974_10001820 3300027876 Bacteria 7777
625 Ga0207428_10000011 3300027907 Bacteria 354388
626 Ga0207428_10000046 3300027907 Bacteria 191032
627 Ga0207428_10000058 3300027907 Bacteria 158579
628 Ga0207428_10002321 3300027907 Bacteria 19048
629 Ga0268266_10008645 3300028379 Bacteria 9040
630 Ga0268266_10041930 3300028379 Bacteria 3907
631 Ga0268266_10045085 3300028379 Bacteria 3771
632 Ga0268266_10146264 3300028379 Bacteria 2125
633 Ga0268266_10153726 3300028379 Bacteria 2076
634 Ga0268266_10161494 3300028379 Bacteria 2027
635 Ga0268266_10252219 3300028379 Bacteria 1632
636 Ga0268265_10000117 3300028380 Bacteria 99955
637 Ga0268265_10003608 3300028380 Bacteria 11049
638 Ga0268265_10043471 3300028380 Bacteria 3340
639 Ga0268265_10308277 3300028380 Bacteria 1428
640 Ga0268264_10000487 3300028381 Bacteria 52821
641 Ga0268264_10001467 3300028381 Bacteria 22033
642 Ga0268264_10008522 3300028381 Bacteria 8521
643 Ga0268264_10086083 3300028381 Bacteria 2699
644 Ga0265330_10017416 3300031235 Bacteria 3309
645 Ga0265330_10048501 3300031235 Bacteria 1867
646 Ga0265325_10000062 3300031241 Bacteria 74697
647 Ga0265325_10003451 3300031241 Bacteria 10314
648 Ga0265340_10007678 3300031247 Bacteria 5849
649 Ga0265331_10005011 3300031250 Bacteria 8120
650 Ga0265316_10095710 3300031344 Bacteria 2261
651 Ga0265316_10209046 3300031344 Bacteria 1444
652 Ga0307509_10087436 3300031507 Bacteria 3202
653 Ga0265313_10000524 3300031595 Bacteria 40120
654 Ga0265313_10047917 3300031595 Bacteria 2065
655 Ga0307508_10003330 3300031616 Bacteria 16325
656 Ga0265314_10000419 3300031711 Bacteria 57263
657 Ga0265314_10008641 3300031711 Bacteria 8712
658 Ga0265342_10000256 3300031712 Bacteria 59799
659 Ga0265342_10056280 3300031712 Bacteria 2331
660 Ga0307405_10020655 3300031731 Bacteria 3684
661 Ga0307405_10127102 3300031731 Bacteria 1754
662 Ga0307413_10003015 3300031824 Bacteria 6993
663 Ga0307413_10005295 3300031824 Bacteria 5737
664 Ga0307413_10103932 3300031824 Bacteria 1885
665 Ga0307413_10222493 3300031824 Bacteria 1380
666 Ga0307410_10002760 3300031852 Bacteria 8586
667 Ga0307410_10006820 3300031852 Bacteria 6200
668 Ga0307410_10046452 3300031852 Bacteria 2896
669 Ga0307410_10084197 3300031852 Bacteria 2241
670 Ga0307406_10016842 3300031901 Bacteria 4252
671 Ga0307406_10125060 3300031901 Bacteria 1795
672 Ga0307407_10003274 3300031903 Bacteria 6601
673 Ga0307407_10053886 3300031903 Bacteria 2316
674 Ga0307407_10111753 3300031903 Bacteria 1716
675 Ga0307412_10029585 3300031911 Bacteria 3440
676 Ga0307412_10046214 3300031911 Bacteria 2851
677 Ga0307412_10080182 3300031911 Bacteria 2254
678 Ga0307412_10123349 3300031911 Bacteria 1869
679 Ga0307409_100000453 3300031995 Bacteria 17394
680 Ga0307409_100008366 3300031995 Bacteria 6273
681 Ga0307409_100043973 3300031995 Bacteria 3359
682 Ga0307409_100083805 3300031995 Bacteria 2586
683 Ga0307409_100086027 3300031995 Bacteria 2557
684 Ga0307416_100053277 3300032002 Bacteria 3245
685 Ga0307416_100053613 3300032002 Bacteria 3236
686 Ga0307416_100138845 3300032002 Bacteria 2205
687 Ga0307414_10015188 3300032004 Bacteria 4642
688 Ga0307414_10106385 3300032004 Bacteria 2123
689 Ga0307414_10167317 3300032004 Bacteria 1753
690 Ga0307411_10004056 3300032005 Bacteria 6935
691 Ga0307411_10004217 3300032005 Bacteria 6838
692 Ga0307411_10040280 3300032005 Bacteria 2962
693 Ga0307411_10076722 3300032005 Bacteria 2285
694 Ga0307411_10176369 3300032005 Bacteria 1617
695 Ga0307415_100000325 3300032126 Bacteria 20671
696 Ga0307415_100026145 3300032126 Bacteria 3677
697 Ga0307415_100045372 3300032126 Bacteria 2946
698 Ga0307415_100047261 3300032126 Bacteria 2896
699 Ga0307415_100066483 3300032126 Bacteria 2516
700 Ga0373930_0000298 3300034816 Bacteria 6405
701 Ga0373948_0000018 3300034817 Bacteria 21496
702 Ga0373948_0008122 3300034817 Bacteria 1781
703 Ga0373959_0001867 3300034820 Bacteria 3362
704 Ga0373959_0002399 3300034820 Bacteria 2984
705 Ga0373938_0002615 3300034957 Bacteria 2905
706 Ga0373926_0001552 3300035083 Bacteria 7052
707 Ga0373928_0002316 3300035084 Bacteria 3700
708 Ga0373928_0004518 3300035084 Bacteria 2652
709 Ga0373929_0008373 3300035085 Bacteria 1905
710 Ga0373934_0002917 3300035086 Bacteria 6259
711 Ga0373940_0000354 3300035088 Bacteria 6866
712 Ga0373944_0005358 3300035089 Bacteria 3376
713 Ga0373949_0000408 3300035090 Bacteria 14959
714 Ga0373949_0004126 3300035090 Bacteria 3360
715 Ga0373951_0003513 3300035091 Bacteria 3790
716 Ga0373952_0000056 3300035092 Bacteria 14099
717 Ga0373952_0000964 3300035092 Bacteria 5223
718 Ga0373923_0005076 3300035111 Bacteria 4438
719 Ga0373932_0000734 3300035112 Bacteria 9858
720 Ga0373932_0001197 3300035112 Bacteria 7423
721 Ga0373932_0013506 3300035112 Bacteria 2033
722 Ga0373936_0008301 3300035113 Bacteria 3906
723 Ga0373939_0000559 3300035114 Bacteria 9296
724 Ga0373941_0000709 3300035115 Bacteria 6833
725 Ga0373945_0003571 3300035116 Bacteria 4896
726 Ga0373945_0009489 3300035116 Bacteria 3189
727 Ga0373953_0006521 3300035117 Bacteria 3851
728 Ga0373953_0023897 3300035117 Bacteria 2318
729 Ga0373954_0003029 3300035118 Bacteria 7090
730 Ga0373954_0004278 3300035118 Bacteria 6134
731 Ga0373954_0040237 3300035118 Bacteria 2177
732 Ga0373956_0002599 3300035119 Bacteria 7319
733 Ga0373956_0004206 3300035119 Bacteria 5773
734 Ga0373956_0013448 3300035119 Bacteria 3404
735 Ga0373957_0003413 3300035120 Bacteria 4692
736 Ga0373960_0001479 3300035121 Bacteria 5214
737 Ga0373960_0002840 3300035121 Bacteria 3923
738 Ga0373943_0000352 3300035170 Bacteria 19408
739 Ga0373943_0011002 3300035170 Bacteria 4065
740 Ga0373943_0071472 3300035170 Bacteria 1758
741 Ga0373946_0001249 3300035171 Bacteria 8793
742 Ga0373946_0006482 3300035171 Bacteria 4243
743 Ga0373946_0023711 3300035171 Bacteria 2399
744 Ga0373942_0000491 3300035207 Bacteria 11209
745 Ga0373942_0002258 3300035207 Bacteria 4722
746 Ga0373961_0001829 3300035241 Bacteria 5830
747 Ga0373961_0004217 3300035241 Bacteria 3490
748 Ga0373962_0000574 3300035242 Bacteria 8320
749 Ga0373931_0000087 3300035691 Bacteria 42915
750 Ga0373935_0018763 3300035692 Bacteria 4213
751 Ga0373927_0004615 3300035695 Bacteria 9604
752 Ga0373927_0034470 3300035695 Bacteria 3292
753 Ga0373933_0003625 3300035724 Bacteria 8559
754 Ga0373933_0066951 3300035724 Bacteria 2178
755 Ga0373947_0002498 3300035725 Bacteria 11057
756 Ga0373947_0003411 3300035725 Bacteria 9404
757 Ga0373947_0039873 3300035725 Bacteria 2796
758 Ga0373947_0177609 3300035725 Bacteria 1384
759 Ga0373937_0000851 3300036401 Bacteria 26158
760 Ga0373937_0000862 3300036401 Bacteria 26051
761 Ga0373937_0006835 3300036401 Bacteria 9842
762 Ga0373937_0009142 3300036401 Bacteria 8597
763 Ga0373937_0009393 3300036401 Bacteria 8498
764 Ga0373937_0093118 3300036401 Bacteria 2794
765 Ga0373937_0224279 3300036401 Bacteria 1769
766 Ga0373925_0005584 3300037068 Bacteria 9363
767 Ga0373925_0013965 3300037068 Bacteria 5813
768 Ga0395899_0000132 3300037312 Bacteria 115455
769 Ga0395899_0021386 3300037312 Bacteria 4906
770 Ga0395899_0061738 3300037312 Bacteria 2760
771 Ga0395900_0000359 3300037418 Bacteria 66277
772 Ga0395900_0002893 3300037418 Bacteria 18698
773 Ga0395900_0017741 3300037418 Bacteria 7263
774 Ga0395900_0026333 3300037418 Bacteria 5956
775 Ga0395900_0045160 3300037418 Bacteria 4538
776 Ga0395900_0119293 3300037418 Bacteria 2707
777 Ga0395900_0160060 3300037418 Bacteria 2297
778 Ga0395900_0270156 3300037418 Bacteria 1695
779 Ga0395898_0003726 3300037466 Bacteria 16905
780 Ga0395898_0012491 3300037466 Bacteria 8781
781 Ga0395898_0057320 3300037466 Bacteria 3797
782 Ga0395898_0067291 3300037466 Bacteria 3468
783 Ga0395905_0006676 3300037471 Bacteria 11564
784 Ga0395905_0102372 3300037471 Bacteria 2688
785 Ga0395905_0109263 3300037471 Bacteria 2596
786 Ga0436364_0461445 3300037853 Bacteria 7019
787 Ga0395901_0000275 3300038443 Bacteria 63659
788 Ga0395901_0068130 3300038443 Bacteria 3707
789 Ga0395901_0074904 3300038443 Bacteria 3531
790 Ga0395901_0140635 3300038443 Bacteria 2537
791 Ga0436365_0324214 3300039437 Bacteria 1482
792 Ga0436365_0664268 3300039437 Bacteria 20300
793 Ga0436365_0794411 3300039437 Bacteria 78184
794 Ga0436365_1151519 3300039437 Bacteria 2115
795 Ga0436360_0451948 3300039438 Bacteria 4078
796 Ga0436360_0723710 3300039438 Bacteria 2355
797 Ga0436363_0060576 3300039450 Bacteria 4873
798 Ga0436363_1100437 3300039450 Bacteria 17324
799 Ga0436363_1491361 3300039450 Bacteria 3158
800 Ga0436363_1497978 3300039450 Bacteria 1655
801 Ga0439448_0000630 3300042005 Bacteria 8306
802 Ga0439449_0012796 3300042007 Bacteria 3155
803 Ga0439455_0009233 3300042012 Bacteria 2134
804 Ga0439458_0000029 3300042157 Bacteria 22494
805 Ga0439435_0032346 3300042436 Bacteria 1427
806 Ga0439460_0032422 3300042461 Bacteria 1496
807 Ga0466966_0065097 3300044684 Bacteria 2293
808 Ga0466961_0067381 3300044693 Bacteria 2274
809 Ga0466963_0040007 3300044694 Bacteria 3072
810 Ga0453684_0036104 3300044712 Bacteria 6818
811 Ga0466957_0051056 3300044842 Bacteria 2517
812 Ga0466959_0054770 3300045049 Bacteria 2913
813 Ga0451576_0061573 3300045051 Bacteria 3913
814 Ga0466967_0001672 3300045976 Bacteria 13146
815 Ga0495592_0010297 3300046454 Bacteria 7049
816 Ga0495592_0011377 3300046454 Bacteria 6731
817 Ga0495592_0032282 3300046454 Bacteria 3952
818 Ga0495592_0118130 3300046454 Bacteria 1869
819 Ga0495629_0003086 3300046459 Bacteria 12637
820 Ga0495638_0001274 3300046460 Bacteria 23496
821 Ga0495641_0030804 3300046461 Bacteria 2567
822 Ga0495651_0007457 3300046462 Bacteria 8365
823 Ga0495651_0021404 3300046462 Bacteria 5026
824 Ga0495651_0038247 3300046462 Bacteria 3736
825 Ga0495653_0002676 3300046463 Bacteria 14187
826 Ga0495653_0013738 3300046463 Bacteria 6599
827 Ga0495653_0023498 3300046463 Bacteria 4978
828 Ga0495580_0014862 3300046472 Bacteria 5898
829 Ga0495580_0025839 3300046472 Bacteria 4288
830 Ga0495580_0028983 3300046472 Bacteria 4021
831 Ga0495582_0001834 3300046473 Bacteria 12002
832 Ga0495605_0045697 3300046474 Bacteria 2157
833 Ga0495639_0011034 3300046475 Bacteria 3893
834 Ga0495639_0038415 3300046475 Bacteria 2150
835 Ga0495662_0007015 3300046476 Bacteria 5594
836 Ga0495662_0007266 3300046476 Bacteria 5482
837 Ga0495662_0080640 3300046476 Bacteria 1582
838 Ga0495664_0000398 3300046477 Bacteria 21306
839 Ga0495664_0001582 3300046477 Bacteria 12075
840 Ga0495584_0014313 3300046491 Bacteria 4042
841 Ga0495584_0076113 3300046491 Bacteria 1688
842 Ga0495584_0129666 3300046491 Bacteria 1279
843 Ga0495585_0012227 3300046492 Bacteria 5058
844 Ga0495585_0068626 3300046492 Bacteria 1936
845 Ga0495608_0006901 3300046511 Bacteria 8043
846 Ga0495608_0030439 3300046511 Bacteria 3654
847 Ga0495616_0065451 3300046513 Bacteria 1771
848 Ga0495618_0001798 3300046514 Bacteria 14199
849 Ga0495618_0004894 3300046514 Bacteria 8186
850 Ga0495628_0021800 3300046516 Bacteria 5263
851 Ga0495628_0076649 3300046516 Bacteria 2601
852 Ga0495628_0133533 3300046516 Bacteria 1898
853 Ga0495630_0005356 3300046517 Bacteria 9049
854 Ga0495631_0056938 3300046518 Bacteria 1702
855 Ga0495632_0124590 3300046519 Bacteria 1202
856 Ga0495637_0016284 3300046520 Bacteria 3477
857 Ga0495663_0002965 3300046525 Bacteria 4991
858 Ga0495666_0004260 3300046526 Bacteria 7212
859 Ga0495666_0045386 3300046526 Bacteria 2120
860 Ga0495652_0000531 3300046529 Bacteria 44460
861 Ga0495652_0108200 3300046529 Bacteria 2241
862 Ga0495665_0001228 3300046531 Bacteria 13704
863 Ga0495665_0009811 3300046531 Bacteria 5183
864 Ga0495665_0027512 3300046531 Bacteria 3052
865 Ga0495665_0058379 3300046531 Bacteria 2037
866 Ga0495640_0001922 3300046533 Bacteria 16557
867 Ga0495640_0013247 3300046533 Bacteria 6270
868 Ga0495640_0058291 3300046533 Bacteria 2634
869 Ga0495586_0012528 3300046535 Bacteria 4499
870 Ga0495586_0026452 3300046535 Bacteria 3105
871 Ga0495586_0033699 3300046535 Bacteria 2749
872 Ga0495587_0016396 3300046536 Bacteria 4610
873 Ga0495587_0016549 3300046536 Bacteria 4587
874 Ga0495587_0032503 3300046536 Bacteria 3154
875 Ga0495587_0037736 3300046536 Bacteria 2900
876 Ga0495587_0053294 3300046536 Bacteria 2385
877 Ga0495598_0001181 3300046537 Bacteria 5045
878 Ga0495621_0000388 3300046539 Bacteria 10786
879 Ga0495621_0020185 3300046539 Bacteria 2184
880 Ga0495645_0001513 3300046543 Bacteria 15682
881 Ga0495645_0002097 3300046543 Bacteria 13543
882 Ga0495645_0003462 3300046543 Bacteria 10707
883 Ga0495622_0017216 3300046557 Bacteria 3364
884 Ga0495622_0026865 3300046557 Bacteria 2686
885 Ga0495633_0002898 3300046558 Bacteria 11762
886 Ga0495633_0013739 3300046558 Bacteria 4255
887 Ga0495633_0027931 3300046558 Bacteria 2752
888 Ga0495667_0003336 3300046559 Bacteria 10748
889 Ga0495667_0004207 3300046559 Bacteria 9698
890 Ga0495667_0009091 3300046559 Bacteria 6749
891 Ga0495667_0023502 3300046559 Bacteria 4153
892 Ga0495656_0000729 3300046615 Bacteria 10635
893 Ga0495656_0004585 3300046615 Bacteria 4743
894 Ga0495668_0065159 3300046616 Bacteria 2005
895 Ga0495634_0004091 3300046642 Bacteria 11553
896 Ga0495634_0006411 3300046642 Bacteria 8941
897 Ga0495635_0003726 3300046663 Bacteria 10580
898 Ga0495635_0006571 3300046663 Bacteria 8113
899 Ga0495635_0006850 3300046663 Bacteria 7962
900 Ga0495659_0016235 3300046664 Bacteria 2454
901 Ga0495659_0018915 3300046664 Bacteria 2300
902 Ga0495661_0086829 3300046665 Bacteria 1790
903 Ga0495588_0046617 3300046674 Bacteria 2223
904 Ga0495657_0002845 3300046675 Bacteria 14362
905 Ga0495657_0010336 3300046675 Bacteria 7027
906 Ga0495657_0024564 3300046675 Bacteria 4290
907 Ga0495599_0001644 3300046678 Bacteria 12894
908 Ga0495599_0040862 3300046678 Bacteria 2912
909 Ga0495599_0096207 3300046678 Bacteria 1846
910 Ga0495623_0000187 3300046679 Bacteria 39206
911 Ga0495647_0003806 3300046681 Bacteria 4854
912 Ga0495647_0026338 3300046681 Bacteria 2129
913 Ga0495658_0001330 3300046683 Bacteria 12958
914 Ga0495669_0000269 3300046684 Bacteria 29811
915 Ga0495669_0001684 3300046684 Bacteria 9054
916 Ga0495669_0003175 3300046684 Bacteria 6767
917 Ga0495669_0005515 3300046684 Bacteria 5281
918 Ga0495669_0022078 3300046684 Bacteria 2764
919 Ga0495613_0046701 3300046689 Bacteria 3201
920 Ga0495624_0001710 3300046690 Bacteria 16774
921 Ga0495624_0014147 3300046690 Bacteria 5422
922 Ga0495670_0008346 3300046691 Bacteria 5091
923 Ga0495670_0026936 3300046691 Bacteria 2845
924 Ga0495589_0045992 3300046794 Bacteria 2167
925 Ga0495600_0012966 3300046809 Bacteria 5225
926 Ga0495600_0065394 3300046809 Bacteria 2377
927 Ga0495581_0036727 3300047315 Bacteria 2834
928 Ga0495604_0002167 3300047317 Bacteria 15769
929 Ga0495604_0004215 3300047317 Bacteria 11385
930 Ga0495674_0012504 3300047319 Bacteria 7996
931 Ga0495676_0048198 3300047321 Bacteria 3437
932 Ga0495680_0001596 3300047322 Bacteria 24170
933 Ga0495680_0007052 3300047322 Bacteria 10356
934 Ga0495680_0025820 3300047322 Bacteria 4856
935 Ga0495680_0110221 3300047322 Bacteria 2040
936 Ga0495675_0000781 3300047444 Bacteria 19671
937 Ga0495675_0013134 3300047444 Bacteria 5225
938 Ga0495684_0002371 3300047471 Bacteria 15057
939 Ga0495684_0007415 3300047471 Bacteria 8501
940 Ga0495684_0044558 3300047471 Bacteria 3396
941 Ga0495684_0131914 3300047471 Bacteria 1876
942 Ga0495684_0168033 3300047471 Bacteria 1633
943 Ga0495593_0008885 3300047673 Bacteria 5830
944 Ga0495593_0013963 3300047673 Bacteria 4575
945 Ga0495593_0014466 3300047673 Bacteria 4485
946 Ga0495593_0078618 3300047673 Bacteria 1708
947 Ga0495602_0004816 3300048088 Bacteria 14117
948 Ga0495602_0013239 3300048088 Bacteria 8437
949 Ga0495602_0104729 3300048088 Bacteria 2314
950 Ga0495602_0227881 3300048088 Bacteria 1402
951 Ga0495614_0023802 3300048089 Bacteria 2643
952 Ga0496100_0000283 3300048903 Bacteria 25773
953 Ga0496100_0062330 3300048903 Bacteria 2460
954 Ga0496101_0000434 3300048904 Bacteria 26751
955 Ga0496101_0034822 3300048904 Bacteria 3559
956 Ga0496102_0067010 3300048905 Bacteria 3291
957 Ga0496102_0078004 3300048905 Bacteria 3049
958 Ga0496102_0098203 3300048905 Bacteria 2717
959 Ga0496102_0131327 3300048905 Bacteria 2344
960 Ga0496103_0000686 3300048906 Bacteria 25269
961 Ga0496103_0011234 3300048906 Bacteria 5303
962 Ga0496103_0040115 3300048906 Bacteria 2877
963 Ga0496104_0000273 3300048907 Bacteria 45919
964 Ga0496104_0038056 3300048907 Bacteria 4499
965 Ga0496104_0075907 3300048907 Bacteria 3200
966 Ga0496104_0083230 3300048907 Bacteria 3052
967 Ga0496104_0125327 3300048907 Bacteria 2466
968 Ga0496104_0358508 3300048907 Bacteria 1370
969 Ga0496105_0004529 3300048908 Bacteria 10472
970 Ga0496105_0006140 3300048908 Bacteria 9205
971 Ga0496105_0013298 3300048908 Bacteria 6531
972 Ga0496105_0033860 3300048908 Bacteria 4198
973 Ga0496105_0146919 3300048908 Bacteria 1938
974 Ga0496106_0028030 3300048909 Bacteria 4193
975 Ga0496106_0035075 3300048909 Bacteria 3749
976 Ga0496106_0042232 3300048909 Bacteria 3419
977 Ga0496106_0113553 3300048909 Bacteria 2111
978 Ga0496107_0000297 3300048910 Bacteria 26478
979 Ga0496107_0015675 3300048910 Bacteria 5313
980 Ga0496107_0042340 3300048910 Bacteria 3271
981 Ga0496107_0058895 3300048910 Bacteria 2778
982 Ga0496108_0000614 3300048911 Bacteria 27954
983 Ga0496108_0013337 3300048911 Bacteria 6701
984 Ga0496108_0016150 3300048911 Bacteria 6086
985 Ga0496108_0025961 3300048911 Bacteria 4831
986 Ga0496108_0079761 3300048911 Bacteria 2771
987 Ga0496108_0098184 3300048911 Bacteria 2496
988 Ga0496108_0125325 3300048911 Bacteria 2205
989 Ga0496109_0000296 3300048912 Bacteria 47206
990 Ga0496109_0020129 3300048912 Bacteria 5894
991 Ga0496109_0063918 3300048912 Bacteria 3366
992 Ga0496109_0137891 3300048912 Bacteria 2280
993 Ga0496109_0141381 3300048912 Bacteria 2250
994 Ga0496109_0168800 3300048912 Bacteria 2052
995 Ga0496110_0008408 3300048913 Bacteria 8303
996 Ga0496110_0065699 3300048913 Bacteria 3208
997 Ga0496110_0067933 3300048913 Bacteria 3154
998 Ga0496110_0191999 3300048913 Bacteria 1854
999 Ga0496111_0037785 3300048914 Bacteria 3456
1000 Ga0496111_0060753 3300048914 Bacteria 2739
1001 Ga0496111_0071599 3300048914 Bacteria 2523
1002 Ga0496111_0078017 3300048914 Bacteria 2415
1003 Ga0496112_0035364 3300048915 Bacteria 4866
1004 Ga0496112_0087825 3300048915 Bacteria 3076
1005 Ga0496112_0109652 3300048915 Bacteria 2730
1006 Ga0496112_0173484 3300048915 Bacteria 2122
1007 Ga0496112_0192343 3300048915 Bacteria 2001
1008 Ga0496112_0243974 3300048915 Bacteria 1748
1009 Ga0496113_0009386 3300048916 Bacteria 6415
1010 Ga0496113_0012944 3300048916 Bacteria 5627
1011 Ga0496113_0076618 3300048916 Bacteria 2555
1012 Ga0496114_0001211 3300048917 Bacteria 19508
1013 Ga0496114_0022869 3300048917 Bacteria 5095
1014 Ga0496114_0034114 3300048917 Bacteria 4196
1015 Ga0496115_0001319 3300048918 Bacteria 17692
1016 Ga0496115_0034865 3300048918 Bacteria 3977
1017 Ga0496115_0100422 3300048918 Bacteria 2372
1018 Ga0496115_0111038 3300048918 Bacteria 2252
1019 Ga0496115_0300754 3300048918 Bacteria 1315
1020 Ga0501034_0004028 3300049571 Bacteria 16487
1021 Ga0501034_0020632 3300049571 Bacteria 6730
1022 Ga0501036_0016699 3300049572 Bacteria 6130
1023 Ga0501036_0025862 3300049572 Bacteria 4953
1024 Ga0501038_0031016 3300049574 Bacteria 4725
1025 Ga0501039_0077028 3300049575 Bacteria 2593
1026 Ga0501043_0019155 3300049579 Bacteria 5372
1027 Ga0501043_0031259 3300049579 Bacteria 4186
1028 Ga0501046_0018676 3300049580 Bacteria 5763
1029 Ga0501046_0050708 3300049580 Bacteria 3278
1030 Ga0501047_0000179 3300049581 Bacteria 77520
1031 Ga0501047_0183702 3300049581 Bacteria 1957
1032 Ga0501048_0002734 3300049582 Bacteria 13445
1033 Ga0501067_0114846 3300049583 Bacteria 1497
1034 Ga0501068_0045526 3300049584 Bacteria 2643
1035 Ga0501069_0029347 3300049585 Bacteria 3018
1036 Ga0501070_0011503 3300049586 Bacteria 7473
1037 Ga0501070_0031154 3300049586 Bacteria 4468
1038 Ga0501071_0043948 3300049587 Bacteria 3205
1039 Ga0501071_0057739 3300049587 Bacteria 2805
1040 Ga0501075_0049434 3300049591 Bacteria 3161
1041 Ga0501076_0145372 3300049592 Bacteria 1928
1042 Ga0501076_0174581 3300049592 Bacteria 1752
1043 Ga0501077_0024109 3300049593 Bacteria 3862
1044 Ga0501079_0199153 3300049741 Bacteria 1564
1045 Ga0501080_0001318 3300049742 Bacteria 20663
1046 Ga0501080_0031286 3300049742 Bacteria 4959
1047 Ga0501080_0040847 3300049742 Bacteria 4325
1048 Ga0501081_0000809 3300049743 Bacteria 18456
1049 Ga0501081_0058736 3300049743 Bacteria 2662
1050 Ga0501083_0104261 3300049744 Bacteria 1868
1051 Ga0501035_0007682 3300049822 Bacteria 10074
1052 Ga0501044_0005728 3300049823 Bacteria 13769
1053 Ga0501044_0049636 3300049823 Bacteria 4331
1054 Ga0501045_0040673 3300049824 Bacteria 3382
1055 nmdc:mga0yw44_1089_c1 3300050492 Bacteria 10440
1056 nmdc:mga06z11_9135_c1 3300050494 Bacteria 4163
1057 nmdc:mga05p37_12654_c1 3300050507 Bacteria 10079
1058 nmdc:mga05p37_35_c1 3300050507 Bacteria 110751
1059 nmdc:mga09592_127507_c1 3300050508 Bacteria 2188
1060 nmdc:mga09592_22512_c1 3300050508 Bacteria 5201
1061 nmdc:mga09592_4780_c1 3300050508 Bacteria 10973
1062 nmdc:mga0qj67_14976_c1 3300050509 Bacteria 5867
1063 nmdc:mga0qj67_16122_c1 3300050509 Bacteria 5662
1064 nmdc:mga0qj67_381142_c1 3300050509 Bacteria 1139
1065 nmdc:mga0qj67_7319_c1 3300050509 Bacteria 8160
1066 nmdc:mga06r32_27981_c1 3300050510 Bacteria 5273
1067 nmdc:mga06r32_32011_c1 3300050510 Bacteria 4943
1068 nmdc:mga06r32_774_c1 3300050510 Bacteria 28232
1069 nmdc:mga08y16_356_c1 3300050511 Bacteria 41239
1070 nmdc:mga08y16_42596_c1 3300050511 Bacteria 4755
1071 nmdc:mga0n895_16080_c1 3300050512 Bacteria 6856
1072 nmdc:mga0n895_2421_c1 3300050512 Bacteria 14552
1073 nmdc:mga0n895_46489_c1 3300050512 Bacteria 4241
1074 nmdc:mga0n895_725_c1 3300050512 Bacteria 23201
1075 nmdc:mga0rr50_11637_c1 3300050513 Bacteria 5643
1076 nmdc:mga0rr50_26607_c2 3300050513 Bacteria 2952
1077 nmdc:mga0a205_400_c1 3300050515 Bacteria 33140
1078 nmdc:mga0a205_91_c2 3300050515 Bacteria 18098
1079 Ga0495601_0000081 3300053077 Bacteria 51417
1080 Ga0495601_0015420 3300053077 Bacteria 4618
1081 Ga0495601_0035667 3300053077 Bacteria 3105
1082 Ga0495601_0045615 3300053077 Bacteria 2757
1083 Ga0495601_0072671 3300053077 Bacteria 2197
1084 Ga0495601_0108030 3300053077 Bacteria 1800
1085 Ga0495601_0118715 3300053077 Bacteria 1716
1086 Ga0495612_0000315 3300053078 Bacteria 19515
1087 Ga0495612_0008832 3300053078 Bacteria 4084
1088 Ga0495612_0014269 3300053078 Bacteria 3197
1089 Ga0495612_0034735 3300053078 Bacteria 2042
1090 Ga0495595_0001073 3300053084 Bacteria 10579
1091 Ga0495595_0004290 3300053084 Bacteria 5735
1092 Ga0495595_0004961 3300053084 Bacteria 5368
1093 Ga0495595_0007889 3300053084 Bacteria 4357
1094 Ga0495595_0009362 3300053084 Bacteria 4052
1095 Ga0495619_0000270 3300053085 Bacteria 37699
1096 Ga0495619_0001648 3300053085 Bacteria 14730
1097 Ga0495619_0001786 3300053085 Bacteria 14305
1098 Ga0495619_0001885 3300053085 Bacteria 13966
1099 Ga0495619_0004104 3300053085 Bacteria 9322
1100 Ga0495619_0034874 3300053085 Bacteria 3271
1101 Ga0495619_0064373 3300053085 Bacteria 2444
1102 Ga0495619_0269712 3300053085 Bacteria 1179
1103 Ga0500643_001479 3300053087 Bacteria 13483
1104 Ga0500651_0035480 3300053093 Bacteria 3143
1105 Ga0500641_0048570 3300053096 Bacteria 1739
1106 Ga0500595_000055 3300053119 Bacteria 84205
1107 Ga0500652_010527 3300053131 Bacteria 3172
1108 Ga0500658_0006831 3300053134 Bacteria 4221
1109 Ga0500616_0000001 3300053153 Bacteria 1986011
1110 Ga0500616_0030853 3300053153 Bacteria 2940
1111 Ga0500645_000216 3300053730 Bacteria 43997
1112 Ga0501084_0116472 3300054114 Bacteria 2246
1113 Ga0501082_0025039 3300060353 Bacteria 5141
1114 Ga0501082_0116059 3300060353 Bacteria 2319
1115 Ga0530510_0053318 3300061734 Bacteria 2923

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005354 Ga0070675_100382113 Ga0070675_1003821131 356
2 3300035119 Ga0373956_0013448 Ga0373956_0013448_17_1096 359
3 3300046519 Ga0495632_0124590 Ga0495632_0124590_14_1093 359
4 3300046691 Ga0495670_0008346 Ga0495670_0008346_23_1102 359
5 3300050509 nmdc:mga0qj67_381142_c1 nmdc:mga0qj67_381142_c1_37_1128 363
6 3300039437 Ga0436365_0324214 Ga0436365_0324214_51_1169 371
7 3300048908 Ga0496105_0004529 Ga0496105_0004529_3050_4222 372
8 3300031731 Ga0307405_10020655 Ga0307405_100206552 382
9 3300031911 Ga0307412_10029585 Ga0307412_100295853 382
10 3300032126 Ga0307415_100026145 Ga0307415_1000261453 382
11 3300053085 Ga0495619_0269712 Ga0495619_0269712_14_1162 382
12 3300031903 Ga0307407_10053886 Ga0307407_100538861 384
13 3300032002 Ga0307416_100138845 Ga0307416_1001388452 384
14 3300032005 Ga0307411_10004217 Ga0307411_100042175 384
15 3300020081 Ga0206354_10333486 Ga0206354_103334862 385
16 3300020082 Ga0206353_10140861 Ga0206353_101408612 385
17 3300005617 Ga0068859_100006115 Ga0068859_1000061157 386
18 3300006931 Ga0097620_100006115 Ga0097620_1000061157 386
19 3300006880 Ga0075429_100014311 Ga0075429_1000143114 389
20 3300013296 Ga0157374_10066905 Ga0157374_100669053 389
21 3300031507 Ga0307509_10087436 Ga0307509_100874363 389
22 3300050508 nmdc:mga09592_22512_c1 nmdc:mga09592_22512_c1_2897_4138 389
23 3300050510 nmdc:mga06r32_32011_c1 nmdc:mga06r32_32011_c1_2637_3878 389
24 3300048914 Ga0496111_0078017 Ga0496111_0078017_521_1693 390
25 3300005344 Ga0070661_100049720 Ga0070661_1000497202 391
26 3300005366 Ga0070659_100074082 Ga0070659_1000740823 391
27 3300005547 Ga0070693_100002630 Ga0070693_1000026306 391
28 3300005548 Ga0070665_100026013 Ga0070665_1000260132 391
29 3300005564 Ga0070664_100141972 Ga0070664_1001419722 391
30 3300009551 Ga0105238_10090689 Ga0105238_100906891 391
31 3300013104 Ga0157370_10189456 Ga0157370_101894562 391
32 3300025920 Ga0207649_10049398 Ga0207649_100493981 391
33 3300025924 Ga0207694_10066479 Ga0207694_100664792 391
34 3300025942 Ga0207689_10215997 Ga0207689_102159972 391
35 3300025945 Ga0207679_10153391 Ga0207679_101533911 391
36 3300028379 Ga0268266_10008645 Ga0268266_100086453 391
37 3300028379 Ga0268266_10252219 Ga0268266_102522192 391
38 3300031824 Ga0307413_10003015 Ga0307413_100030154 391
39 3300035170 Ga0373943_0071472 Ga0373943_0071472_337_1512 391
40 3300037312 Ga0395899_0061738 Ga0395899_0061738_859_2043 391
41 3300037418 Ga0395900_0026333 Ga0395900_0026333_3952_5136 391
42 3300037418 Ga0395900_0270156 Ga0395900_0270156_112_1296 391
43 3300037466 Ga0395898_0057320 Ga0395898_0057320_1669_2853 391
44 3300037471 Ga0395905_0006676 Ga0395905_0006676_5355_6539 391
45 3300038443 Ga0395901_0140635 Ga0395901_0140635_1266_2450 391
46 3300001979 JGI24740J21852_10001716 JGI24740J21852_1000171612 392
47 3300001989 JGI24739J22299_10000568 JGI24739J22299_100005689 392
48 3300001990 JGI24737J22298_10000646 JGI24737J22298_1000064614 392
49 3300002126 JGI24035J26624_1000883 JGI24035J26624_10008832 392
50 3300005328 Ga0070676_10001885 Ga0070676_1000188511 392
51 3300005330 Ga0070690_100049547 Ga0070690_1000495472 392
52 3300005334 Ga0068869_100000057 Ga0068869_10000005713 392
53 3300005335 Ga0070666_10015494 Ga0070666_100154945 392
54 3300005338 Ga0068868_100000231 Ga0068868_10000023110 392
55 3300005339 Ga0070660_100005299 Ga0070660_10000529910 392
56 3300005353 Ga0070669_100000916 Ga0070669_10000091618 392
57 3300005354 Ga0070675_100008496 Ga0070675_1000084962 392
58 3300005355 Ga0070671_100003872 Ga0070671_1000038725 392
59 3300005364 Ga0070673_100000696 Ga0070673_10000069615 392
60 3300005366 Ga0070659_100000240 Ga0070659_10000024029 392
61 3300005367 Ga0070667_100001628 Ga0070667_10000162814 392
62 3300005457 Ga0070662_100000268 Ga0070662_10000026813 392
63 3300005459 Ga0068867_100000660 Ga0068867_10000066017 392
64 3300005539 Ga0068853_100003212 Ga0068853_10000321212 392
65 3300005543 Ga0070672_100003438 Ga0070672_1000034389 392
66 3300005548 Ga0070665_100060381 Ga0070665_1000603813 392
67 3300005563 Ga0068855_100005134 Ga0068855_10000513414 392
68 3300005577 Ga0068857_100008676 Ga0068857_10000867610 392
69 3300005578 Ga0068854_100000210 Ga0068854_10000021029 392
70 3300005616 Ga0068852_100000628 Ga0068852_10000062816 392
71 3300005617 Ga0068859_100002303 Ga0068859_10000230318 392
72 3300005618 Ga0068864_100000338 Ga0068864_10000033816 392
73 3300005719 Ga0068861_100009236 Ga0068861_1000092366 392
74 3300005834 Ga0068851_10009297 Ga0068851_100092972 392
75 3300005841 Ga0068863_100000409 Ga0068863_10000040937 392
76 3300005842 Ga0068858_100004175 Ga0068858_1000041754 392
77 3300005843 Ga0068860_100010676 Ga0068860_10001067610 392
78 3300005844 Ga0068862_100070033 Ga0068862_1000700331 392
79 3300006881 Ga0068865_100000947 Ga0068865_1000009478 392
80 3300006931 Ga0097620_100002303 Ga0097620_10000230318 392
81 3300009098 Ga0105245_10003932 Ga0105245_1000393215 392
82 3300009148 Ga0105243_10075117 Ga0105243_100751172 392
83 3300009177 Ga0105248_10001205 Ga0105248_1000120520 392
84 3300009551 Ga0105238_10204990 Ga0105238_102049902 392
85 3300013102 Ga0157371_10003004 Ga0157371_1000300415 392
86 3300013297 Ga0157378_10000417 Ga0157378_1000041730 392
87 3300013306 Ga0163162_10030784 Ga0163162_100307847 392
88 3300013308 Ga0157375_10024976 Ga0157375_100249765 392
89 3300025315 Ga0207697_10000093 Ga0207697_1000009327 392
90 3300025321 Ga0207656_10006616 Ga0207656_100066162 392
91 3300025901 Ga0207688_10000061 Ga0207688_1000006118 392
92 3300025903 Ga0207680_10014546 Ga0207680_100145463 392
93 3300025904 Ga0207647_10000393 Ga0207647_1000039318 392
94 3300025907 Ga0207645_10003852 Ga0207645_100038524 392
95 3300025919 Ga0207657_10003953 Ga0207657_1000395310 392
96 3300025923 Ga0207681_10001615 Ga0207681_100016158 392
97 3300025927 Ga0207687_10003367 Ga0207687_100033679 392
98 3300025932 Ga0207690_10001140 Ga0207690_100011408 392
99 3300025933 Ga0207706_10000185 Ga0207706_1000018531 392
100 3300025936 Ga0207670_10025321 Ga0207670_100253212 392
101 3300025938 Ga0207704_10002888 Ga0207704_100028888 392
102 3300025940 Ga0207691_10000114 Ga0207691_1000011461 392
103 3300025941 Ga0207711_10000784 Ga0207711_1000078416 392
104 3300025942 Ga0207689_10000014 Ga0207689_1000001417 392
105 3300025945 Ga0207679_10013763 Ga0207679_100137637 392
106 3300025949 Ga0207667_10030878 Ga0207667_100308789 392
107 3300025960 Ga0207651_10000396 Ga0207651_1000039616 392
108 3300025972 Ga0207668_10050698 Ga0207668_100506983 392
109 3300025981 Ga0207640_10003009 Ga0207640_1000300911 392
110 3300025986 Ga0207658_10018209 Ga0207658_100182092 392
111 3300026035 Ga0207703_10001589 Ga0207703_1000158917 392
112 3300026041 Ga0207639_10000767 Ga0207639_1000076714 392
113 3300026088 Ga0207641_10001563 Ga0207641_100015636 392
114 3300026089 Ga0207648_10002021 Ga0207648_1000202115 392
115 3300026095 Ga0207676_10002489 Ga0207676_100024898 392
116 3300026116 Ga0207674_10003948 Ga0207674_1000394817 392
117 3300026118 Ga0207675_100011322 Ga0207675_1000113226 392
118 3300026142 Ga0207698_10001676 Ga0207698_1000167614 392
119 3300026142 Ga0207698_10146935 Ga0207698_101469352 392
120 3300028379 Ga0268266_10161494 Ga0268266_101614941 392
121 3300028380 Ga0268265_10308277 Ga0268265_103082772 392
122 3300028381 Ga0268264_10008522 Ga0268264_100085228 392
123 3300037471 Ga0395905_0102372 Ga0395905_0102372_1337_2521 392
124 3300042461 Ga0439460_0032422 Ga0439460_0032422_115_1302 392
125 3300046491 Ga0495584_0076113 Ga0495584_0076113_10_1188 392
126 3300046616 Ga0495668_0065159 Ga0495668_0065159_180_1367 392
127 3300046678 Ga0495599_0040862 Ga0495599_0040862_42_1220 392
128 3300046684 Ga0495669_0000269 Ga0495669_0000269_4965_6152 392
129 3300046684 Ga0495669_0003175 Ga0495669_0003175_337_1524 392
130 3300046684 Ga0495669_0022078 Ga0495669_0022078_1428_2615 392
131 3300048911 Ga0496108_0000614 Ga0496108_0000614_9805_10992 392
132 3300048913 Ga0496110_0191999 Ga0496110_0191999_21_1199 392
133 3300013102 Ga0157371_10024995 Ga0157371_100249954 393
134 3300042005 Ga0439448_0000630 Ga0439448_0000630_4184_5374 393
135 3300042012 Ga0439455_0009233 Ga0439455_0009233_44_1234 393
136 3300042157 Ga0439458_0000029 Ga0439458_0000029_9277_10467 393
137 3300005366 Ga0070659_100080097 Ga0070659_1000800973 394
138 3300005455 Ga0070663_100082816 Ga0070663_1000828162 394
139 3300005578 Ga0068854_100095380 Ga0068854_1000953802 394
140 3300005616 Ga0068852_100112314 Ga0068852_1001123142 394
141 3300005834 Ga0068851_10005731 Ga0068851_100057312 394
142 3300013296 Ga0157374_10241691 Ga0157374_102416912 394
143 3300025909 Ga0207705_10006449 Ga0207705_100064492 394
144 3300025919 Ga0207657_10030980 Ga0207657_100309804 394
145 3300025932 Ga0207690_10061933 Ga0207690_100619332 394
146 3300026067 Ga0207678_10014392 Ga0207678_100143925 394
147 3300026142 Ga0207698_10018583 Ga0207698_100185833 394
148 3300046460 Ga0495638_0001274 Ga0495638_0001274_16969_18192 394
149 3300053134 Ga0500658_0006831 Ga0500658_0006831_1568_2791 394
150 3300001979 JGI24740J21852_10003446 JGI24740J21852_100034467 395
151 3300005327 Ga0070658_10082892 Ga0070658_100828922 395
152 3300005331 Ga0070670_100076461 Ga0070670_1000764613 395
153 3300005344 Ga0070661_100033954 Ga0070661_1000339543 395
154 3300005355 Ga0070671_100010172 Ga0070671_1000101722 395
155 3300005364 Ga0070673_100042154 Ga0070673_1000421542 395
156 3300005435 Ga0070714_100020397 Ga0070714_1000203972 395
157 3300005435 Ga0070714_100044663 Ga0070714_1000446632 395
158 3300005456 Ga0070678_100003017 Ga0070678_1000030178 395
159 3300005543 Ga0070672_100197903 Ga0070672_1001979032 395
160 3300005564 Ga0070664_100001618 Ga0070664_10000161812 395
161 3300005577 Ga0068857_100342704 Ga0068857_1003427041 395
162 3300005618 Ga0068864_100015515 Ga0068864_1000155154 395
163 3300005841 Ga0068863_100089977 Ga0068863_1000899772 395
164 3300025893 Ga0207682_10054763 Ga0207682_100547631 395
165 3300025909 Ga0207705_10025205 Ga0207705_100252053 395
166 3300025925 Ga0207650_10010118 Ga0207650_100101186 395
167 3300025929 Ga0207664_10021035 Ga0207664_100210352 395
168 3300025931 Ga0207644_10012135 Ga0207644_100121353 395
169 3300025933 Ga0207706_10010598 Ga0207706_100105986 395
170 3300025933 Ga0207706_10010688 Ga0207706_100106887 395
171 3300025940 Ga0207691_10015203 Ga0207691_100152036 395
172 3300025941 Ga0207711_10031680 Ga0207711_100316803 395
173 3300025944 Ga0207661_10109985 Ga0207661_101099852 395
174 3300025944 Ga0207661_10299682 Ga0207661_102996821 395
175 3300025945 Ga0207679_10017311 Ga0207679_100173112 395
176 3300025981 Ga0207640_10068763 Ga0207640_100687632 395
177 3300026088 Ga0207641_10007922 Ga0207641_100079228 395
178 3300026116 Ga0207674_10176694 Ga0207674_101766942 395
179 3300026121 Ga0207683_10036600 Ga0207683_100366003 395
180 3300026121 Ga0207683_10245217 Ga0207683_102452172 395
181 3300031824 Ga0307413_10103932 Ga0307413_101039322 395
182 3300037312 Ga0395899_0021386 Ga0395899_0021386_1463_2659 395
183 3300037418 Ga0395900_0017741 Ga0395900_0017741_3746_4942 395
184 3300037466 Ga0395898_0067291 Ga0395898_0067291_1001_2197 395
185 3300038443 Ga0395901_0068130 Ga0395901_0068130_1240_2436 395
186 3300048911 Ga0496108_0025961 Ga0496108_0025961_3096_4292 395
187 3300048911 Ga0496108_0125325 Ga0496108_0125325_88_1293 395
188 3300048912 Ga0496109_0137891 Ga0496109_0137891_1056_2252 395
189 3300048915 Ga0496112_0035364 Ga0496112_0035364_3061_4257 395
190 3300048916 Ga0496113_0012944 Ga0496113_0012944_3187_4383 395
191 3300031731 Ga0307405_10127102 Ga0307405_101271022 396
192 3300031824 Ga0307413_10005295 Ga0307413_100052953 396
193 3300031852 Ga0307410_10046452 Ga0307410_100464521 396
194 3300031901 Ga0307406_10016842 Ga0307406_100168424 396
195 3300031903 Ga0307407_10003274 Ga0307407_100032742 396
196 3300031911 Ga0307412_10046214 Ga0307412_100462141 396
197 3300031995 Ga0307409_100043973 Ga0307409_1000439733 396
198 3300032002 Ga0307416_100053613 Ga0307416_1000536131 396
199 3300032004 Ga0307414_10167317 Ga0307414_101673171 396
200 3300032005 Ga0307411_10176369 Ga0307411_101763692 396
201 3300032126 Ga0307415_100047261 Ga0307415_1000472611 396
202 3300044684 Ga0466966_0065097 Ga0466966_0065097_813_2012 396
203 3300005327 Ga0070658_10000571 Ga0070658_1000057127 397
204 3300005327 Ga0070658_10003718 Ga0070658_100037182 397
205 3300005327 Ga0070658_10028885 Ga0070658_100288853 397
206 3300005331 Ga0070670_100000445 Ga0070670_10000044522 397
207 3300005331 Ga0070670_100009008 Ga0070670_1000090089 397
208 3300005339 Ga0070660_100002696 Ga0070660_1000026966 397
209 3300005339 Ga0070660_100042224 Ga0070660_1000422241 397
210 3300005345 Ga0070692_10000543 Ga0070692_100005437 397
211 3300005354 Ga0070675_100002803 Ga0070675_10000280313 397
212 3300005354 Ga0070675_100004652 Ga0070675_1000046529 397
213 3300005355 Ga0070671_100000865 Ga0070671_1000008653 397
214 3300005356 Ga0070674_100251547 Ga0070674_1002515471 397
215 3300005367 Ga0070667_100005520 Ga0070667_1000055205 397
216 3300005455 Ga0070663_100101441 Ga0070663_1001014412 397
217 3300005543 Ga0070672_100000401 Ga0070672_10000040118 397
218 3300005543 Ga0070672_100010268 Ga0070672_1000102682 397
219 3300005548 Ga0070665_100052989 Ga0070665_1000529893 397
220 3300005563 Ga0068855_100000129 Ga0068855_1000001296 397
221 3300005564 Ga0070664_100009369 Ga0070664_1000093693 397
222 3300005564 Ga0070664_100094009 Ga0070664_1000940092 397
223 3300005577 Ga0068857_100174739 Ga0068857_1001747393 397
224 3300005719 Ga0068861_100001124 Ga0068861_10000112410 397
225 3300005985 Ga0081539_10016110 Ga0081539_100161107 397
226 3300009177 Ga0105248_10110580 Ga0105248_101105801 397
227 3300013102 Ga0157371_10008818 Ga0157371_100088187 397
228 3300013102 Ga0157371_10030452 Ga0157371_100304525 397
229 3300013104 Ga0157370_10033382 Ga0157370_100333825 397
230 3300025903 Ga0207680_10018129 Ga0207680_100181292 397
231 3300025904 Ga0207647_10043767 Ga0207647_100437671 397
232 3300025909 Ga0207705_10000091 Ga0207705_1000009146 397
233 3300025909 Ga0207705_10001555 Ga0207705_1000155513 397
234 3300025909 Ga0207705_10024056 Ga0207705_100240562 397
235 3300025909 Ga0207705_10042460 Ga0207705_100424603 397
236 3300025919 Ga0207657_10000092 Ga0207657_1000009219 397
237 3300025919 Ga0207657_10001122 Ga0207657_1000112217 397
238 3300025921 Ga0207652_10031422 Ga0207652_100314223 397
239 3300025925 Ga0207650_10004633 Ga0207650_1000463310 397
240 3300025925 Ga0207650_10257962 Ga0207650_102579621 397
241 3300025926 Ga0207659_10015849 Ga0207659_100158492 397
242 3300025931 Ga0207644_10007001 Ga0207644_100070013 397
243 3300025931 Ga0207644_10073760 Ga0207644_100737602 397
244 3300025933 Ga0207706_10010902 Ga0207706_100109022 397
245 3300025933 Ga0207706_10017204 Ga0207706_100172046 397
246 3300025933 Ga0207706_10126787 Ga0207706_101267871 397
247 3300025940 Ga0207691_10002093 Ga0207691_1000209322 397
248 3300025941 Ga0207711_10067676 Ga0207711_100676763 397
249 3300025945 Ga0207679_10008134 Ga0207679_100081347 397
250 3300025945 Ga0207679_10095038 Ga0207679_100950381 397
251 3300025949 Ga0207667_10001226 Ga0207667_1000122611 397
252 3300025960 Ga0207651_10093902 Ga0207651_100939022 397
253 3300025960 Ga0207651_10259870 Ga0207651_102598701 397
254 3300025986 Ga0207658_10005866 Ga0207658_100058663 397
255 3300026116 Ga0207674_10028442 Ga0207674_100284422 397
256 3300026118 Ga0207675_100000264 Ga0207675_1000002649 397
257 3300028379 Ga0268266_10045085 Ga0268266_100450853 397
258 3300031824 Ga0307413_10222493 Ga0307413_102224931 397
259 3300031852 Ga0307410_10002760 Ga0307410_100027602 397
260 3300031852 Ga0307410_10006820 Ga0307410_100068202 397
261 3300031852 Ga0307410_10084197 Ga0307410_100841972 397
262 3300031901 Ga0307406_10125060 Ga0307406_101250602 397
263 3300031903 Ga0307407_10111753 Ga0307407_101117532 397
264 3300031911 Ga0307412_10080182 Ga0307412_100801822 397
265 3300031911 Ga0307412_10123349 Ga0307412_101233492 397
266 3300031995 Ga0307409_100000453 Ga0307409_10000045317 397
267 3300031995 Ga0307409_100008366 Ga0307409_1000083669 397
268 3300031995 Ga0307409_100083805 Ga0307409_1000838052 397
269 3300031995 Ga0307409_100086027 Ga0307409_1000860271 397
270 3300032002 Ga0307416_100053277 Ga0307416_1000532772 397
271 3300032004 Ga0307414_10015188 Ga0307414_100151883 397
272 3300032004 Ga0307414_10106385 Ga0307414_101063852 397
273 3300032005 Ga0307411_10004056 Ga0307411_100040563 397
274 3300032005 Ga0307411_10040280 Ga0307411_100402802 397
275 3300032005 Ga0307411_10076722 Ga0307411_100767222 397
276 3300032126 Ga0307415_100000325 Ga0307415_10000032514 397
277 3300032126 Ga0307415_100045372 Ga0307415_1000453723 397
278 3300032126 Ga0307415_100066483 Ga0307415_1000664831 397
279 3300037312 Ga0395899_0000132 Ga0395899_0000132_77880_79082 397
280 3300037418 Ga0395900_0000359 Ga0395900_0000359_6622_7824 397
281 3300037418 Ga0395900_0119293 Ga0395900_0119293_1246_2448 397
282 3300037466 Ga0395898_0012491 Ga0395898_0012491_1174_2376 397
283 3300037471 Ga0395905_0109263 Ga0395905_0109263_121_1323 397
284 3300038443 Ga0395901_0000275 Ga0395901_0000275_33084_34286 397
285 3300042007 Ga0439449_0012796 Ga0439449_0012796_1732_2934 397
286 3300046525 Ga0495663_0002965 Ga0495663_0002965_1201_2403 397
287 3300046539 Ga0495621_0000388 Ga0495621_0000388_3142_4344 397
288 3300046558 Ga0495633_0002898 Ga0495633_0002898_8238_9440 397
289 3300046665 Ga0495661_0086829 Ga0495661_0086829_422_1624 397
290 3300046684 Ga0495669_0001684 Ga0495669_0001684_286_1488 397
291 3300046684 Ga0495669_0005515 Ga0495669_0005515_915_2117 397
292 3300046691 Ga0495670_0026936 Ga0495670_0026936_987_2189 397
293 3300048914 Ga0496111_0071599 Ga0496111_0071599_657_1859 397
294 3300005439 Ga0070711_100008446 Ga0070711_1000084464 398
295 3300025931 Ga0207644_10148990 Ga0207644_101489902 398
296 3300031616 Ga0307508_10003330 Ga0307508_100033306 398
297 3300035725 Ga0373947_0039873 Ga0373947_0039873_18_1214 398
298 3300035170 Ga0373943_0011002 Ga0373943_0011002_20_1219 399
299 3300035725 Ga0373947_0177609 Ga0373947_0177609_166_1365 399
300 3300053077 Ga0495601_0118715 Ga0495601_0118715_498_1697 399
301 3300005535 Ga0070684_100059496 Ga0070684_1000594962 400
302 3300013307 Ga0157372_10165227 Ga0157372_101652271 400
303 3300021377 Ga0213874_10003678 Ga0213874_100036783 400
304 3300039450 Ga0436363_1491361 Ga0436363_1491361_303_1505 400
305 3300021384 Ga0213876_10017509 Ga0213876_100175092 402
306 3300039437 Ga0436365_0664268 Ga0436365_0664268_1939_3147 402
307 3300025915 Ga0207693_10035663 Ga0207693_100356632 403
308 3300039438 Ga0436360_0723710 Ga0436360_0723710_342_1565 403
309 iso_pu_bacteria 2990265787 2990266174 404
310 iso_pu_bacteria 2993693658 2993696032 404
311 iso_pu_bacteria 2946787523 2946789574 405
312 3300005330 Ga0070690_100049986 Ga0070690_1000499863 406
313 3300005617 Ga0068859_100179115 Ga0068859_1001791151 406
314 3300006931 Ga0097620_100179116 Ga0097620_1001791162 406
315 3300039450 Ga0436363_0060576 Ga0436363_0060576_64_1299 406
316 3300049571 Ga0501034_0020632 Ga0501034_0020632_4266_5486 406
317 3300049581 Ga0501047_0183702 Ga0501047_0183702_634_1854 406
318 3300053153 Ga0500616_0030853 Ga0500616_0030853_1629_2849 406
319 3300005327 Ga0070658_10000199 Ga0070658_1000019919 407
320 3300005345 Ga0070692_10003256 Ga0070692_100032567 407
321 3300005366 Ga0070659_100003410 Ga0070659_1000034103 407
322 3300005366 Ga0070659_100024132 Ga0070659_1000241322 407
323 3300013105 Ga0157369_10001231 Ga0157369_1000123123 407
324 3300021384 Ga0213876_10001649 Ga0213876_100016495 407
325 3300025904 Ga0207647_10013938 Ga0207647_100139384 407
326 3300025909 Ga0207705_10000002 Ga0207705_10000002716 407
327 3300025932 Ga0207690_10006879 Ga0207690_100068792 407
328 3300025932 Ga0207690_10018172 Ga0207690_100181725 407
329 3300039437 Ga0436365_0794411 Ga0436365_0794411_42838_44067 407
330 3300048918 Ga0496115_0300754 Ga0496115_0300754_18_1259 407
331 3300005842 Ga0068858_100000897 Ga0068858_1000008973 408
332 3300025924 Ga0207694_10030859 Ga0207694_100308591 408
333 3300026035 Ga0207703_10000483 Ga0207703_1000048330 408
334 3300039437 Ga0436365_1151519 Ga0436365_1151519_222_1448 408
335 3300025272 Ga0209455_1007486 Ga0209455_10074862 409
336 iso_pu_bacteria 2643221547 2643755083 409
337 iso_pu_bacteria 2883291878 2883297197 409
338 3300003214 JGI25165J46597_1000007 JGI25165J46597_100000711 410
339 3300005544 Ga0070686_100000336 Ga0070686_10000033618 410
340 3300021388 Ga0213875_10005756 Ga0213875_100057565 410
341 3300025261 Ga0209233_1000026 Ga0209233_100002612 410
342 3300037853 Ga0436364_0461445 Ga0436364_0461445_1188_2420 410
343 3300005435 Ga0070714_100010583 Ga0070714_1000105837 411
344 3300005437 Ga0070710_10014787 Ga0070710_100147874 411
345 3300005439 Ga0070711_100110803 Ga0070711_1001108032 411
346 3300006028 Ga0070717_10043671 Ga0070717_100436714 411
347 3300006175 Ga0070712_100015217 Ga0070712_1000152175 411
348 3300006175 Ga0070712_100023430 Ga0070712_1000234302 411
349 3300009551 Ga0105238_10001421 Ga0105238_100014217 411
350 3300025906 Ga0207699_10025362 Ga0207699_100253624 411
351 3300025915 Ga0207693_10016177 Ga0207693_100161774 411
352 3300025915 Ga0207693_10030868 Ga0207693_100308685 411
353 3300025916 Ga0207663_10021669 Ga0207663_100216694 411
354 3300025924 Ga0207694_10001995 Ga0207694_100019954 411
355 3300025928 Ga0207700_10057915 Ga0207700_100579153 411
356 3300025929 Ga0207664_10117024 Ga0207664_101170243 411
357 3300025939 Ga0207665_10107454 Ga0207665_101074543 411
358 3300031247 Ga0265340_10007678 Ga0265340_100076782 411
359 3300037418 Ga0395900_0160060 Ga0395900_0160060_496_1731 411
360 3300039438 Ga0436360_0451948 Ga0436360_0451948_1488_2747 411
361 3300039450 Ga0436363_1100437 Ga0436363_1100437_3199_4434 411
362 3300000041 ARcpr5oldR_c000094 ARcpr5oldR_0000943 413
363 3300000042 ARSoilYngRDRAFT_c00429 ARSoilYngRDRAFT_004295 413
364 3300000043 ARcpr5yngRDRAFT_c000310 ARcpr5yngRDRAFT_0003105 413
365 3300000045 ARCol0oldRDRAFT_c00220 ARCol0oldRDRAFT_002202 413
366 3300001989 JGI24739J22299_10000147 JGI24739J22299_100001471 413
367 3300001990 JGI24737J22298_10000225 JGI24737J22298_100002253 413
368 3300002073 JGI24745J21846_1000198 JGI24745J21846_10001982 413
369 3300002075 JGI24738J21930_10000274 JGI24738J21930_1000027411 413
370 3300002076 JGI24749J21850_1000977 JGI24749J21850_10009772 413
371 3300002077 JGI24744J21845_10002039 JGI24744J21845_100020394 413
372 3300002126 JGI24035J26624_1000334 JGI24035J26624_10003341 413
373 3300002244 JGI24742J22300_10000166 JGI24742J22300_100001662 413
374 3300003544 Ga0007417J51691_1019057 Ga0007417J51691_10190571 413
375 3300005293 Ga0065715_10001130 Ga0065715_100011307 413
376 3300005327 Ga0070658_10003259 Ga0070658_100032599 413
377 3300005327 Ga0070658_10053493 Ga0070658_100534931 413
378 3300005328 Ga0070676_10003713 Ga0070676_100037134 413
379 3300005329 Ga0070683_100000177 Ga0070683_10000017719 413
380 3300005329 Ga0070683_100128519 Ga0070683_1001285192 413
381 3300005330 Ga0070690_100000693 Ga0070690_10000069313 413
382 3300005330 Ga0070690_100054743 Ga0070690_1000547433 413
383 3300005331 Ga0070670_100076830 Ga0070670_1000768303 413
384 3300005333 Ga0070677_10000012 Ga0070677_100000127 413
385 3300005334 Ga0068869_100000008 Ga0068869_1000000087 413
386 3300005334 Ga0068869_100079904 Ga0068869_1000799042 413
387 3300005335 Ga0070666_10012332 Ga0070666_100123325 413
388 3300005335 Ga0070666_10043038 Ga0070666_100430382 413
389 3300005336 Ga0070680_100004044 Ga0070680_1000040442 413
390 3300005336 Ga0070680_100013240 Ga0070680_1000132407 413
391 3300005336 Ga0070680_100016591 Ga0070680_1000165914 413
392 3300005336 Ga0070680_100040597 Ga0070680_1000405973 413
393 3300005337 Ga0070682_100000132 Ga0070682_10000013217 413
394 3300005337 Ga0070682_100080940 Ga0070682_1000809402 413
395 3300005338 Ga0068868_100000705 Ga0068868_1000007057 413
396 3300005338 Ga0068868_100002032 Ga0068868_10000203210 413
397 3300005338 Ga0068868_100042434 Ga0068868_1000424343 413
398 3300005339 Ga0070660_100003369 Ga0070660_1000033693 413
399 3300005340 Ga0070689_100001829 Ga0070689_10000182910 413
400 3300005340 Ga0070689_100004446 Ga0070689_10000444611 413
401 3300005341 Ga0070691_10001308 Ga0070691_100013081 413
402 3300005341 Ga0070691_10027579 Ga0070691_100275793 413
403 3300005343 Ga0070687_100000446 Ga0070687_1000004465 413
404 3300005343 Ga0070687_100008694 Ga0070687_1000086944 413
405 3300005343 Ga0070687_100015318 Ga0070687_1000153182 413
406 3300005344 Ga0070661_100000107 Ga0070661_10000010715 413
407 3300005345 Ga0070692_10000375 Ga0070692_100003757 413
408 3300005345 Ga0070692_10013333 Ga0070692_100133332 413
409 3300005345 Ga0070692_10120110 Ga0070692_101201101 413
410 3300005347 Ga0070668_100000419 Ga0070668_10000041921 413
411 3300005347 Ga0070668_100077950 Ga0070668_1000779503 413
412 3300005353 Ga0070669_100002478 Ga0070669_10000247812 413
413 3300005353 Ga0070669_100035118 Ga0070669_1000351183 413
414 3300005353 Ga0070669_100070854 Ga0070669_1000708543 413
415 3300005354 Ga0070675_100000032 Ga0070675_10000003213 413
416 3300005355 Ga0070671_100000519 Ga0070671_1000005196 413
417 3300005355 Ga0070671_100005241 Ga0070671_1000052415 413
418 3300005356 Ga0070674_100000288 Ga0070674_10000028818 413
419 3300005364 Ga0070673_100000024 Ga0070673_10000002464 413
420 3300005364 Ga0070673_100024738 Ga0070673_1000247385 413
421 3300005365 Ga0070688_100000281 Ga0070688_10000028117 413
422 3300005365 Ga0070688_100014752 Ga0070688_1000147522 413
423 3300005366 Ga0070659_100000238 Ga0070659_10000023814 413
424 3300005366 Ga0070659_100024978 Ga0070659_1000249785 413
425 3300005366 Ga0070659_100040446 Ga0070659_1000404463 413
426 3300005367 Ga0070667_100000994 Ga0070667_1000009943 413
427 3300005367 Ga0070667_100035728 Ga0070667_1000357283 413
428 3300005367 Ga0070667_100180535 Ga0070667_1001805352 413
429 3300005406 Ga0070703_10002021 Ga0070703_100020212 413
430 3300005434 Ga0070709_10002849 Ga0070709_100028493 413
431 3300005434 Ga0070709_10065813 Ga0070709_100658132 413
432 3300005435 Ga0070714_100157313 Ga0070714_1001573132 413
433 3300005435 Ga0070714_100158649 Ga0070714_1001586492 413
434 3300005436 Ga0070713_100016386 Ga0070713_1000163863 413
435 3300005436 Ga0070713_100037000 Ga0070713_1000370004 413
436 3300005436 Ga0070713_100061529 Ga0070713_1000615292 413
437 3300005437 Ga0070710_10003252 Ga0070710_100032526 413
438 3300005437 Ga0070710_10015872 Ga0070710_100158723 413
439 3300005437 Ga0070710_10039820 Ga0070710_100398203 413
440 3300005438 Ga0070701_10009447 Ga0070701_100094472 413
441 3300005438 Ga0070701_10039755 Ga0070701_100397551 413
442 3300005439 Ga0070711_100002902 Ga0070711_10000290211 413
443 3300005439 Ga0070711_100106117 Ga0070711_1001061171 413
444 3300005440 Ga0070705_100027305 Ga0070705_1000273052 413
445 3300005440 Ga0070705_100084445 Ga0070705_1000844452 413
446 3300005441 Ga0070700_100000615 Ga0070700_1000006158 413
447 3300005441 Ga0070700_100031506 Ga0070700_1000315063 413
448 3300005444 Ga0070694_100000181 Ga0070694_10000018132 413
449 3300005444 Ga0070694_100000250 Ga0070694_10000025019 413
450 3300005444 Ga0070694_100005598 Ga0070694_1000055985 413
451 3300005444 Ga0070694_100073258 Ga0070694_1000732582 413
452 3300005455 Ga0070663_100009797 Ga0070663_1000097973 413
453 3300005455 Ga0070663_100079443 Ga0070663_1000794431 413
454 3300005456 Ga0070678_100000211 Ga0070678_10000021116 413
455 3300005457 Ga0070662_100006788 Ga0070662_1000067884 413
456 3300005457 Ga0070662_100007668 Ga0070662_1000076687 413
457 3300005458 Ga0070681_10004709 Ga0070681_100047093 413
458 3300005458 Ga0070681_10022513 Ga0070681_100225136 413
459 3300005458 Ga0070681_10188923 Ga0070681_101889232 413
460 3300005459 Ga0068867_100001143 Ga0068867_1000011433 413
461 3300005466 Ga0070685_10001436 Ga0070685_100014365 413
462 3300005466 Ga0070685_10031604 Ga0070685_100316042 413
463 3300005518 Ga0070699_100002292 Ga0070699_1000022929 413
464 3300005530 Ga0070679_100000352 Ga0070679_10000035217 413
465 3300005530 Ga0070679_100056192 Ga0070679_1000561923 413
466 3300005530 Ga0070679_100061622 Ga0070679_1000616222 413
467 3300005530 Ga0070679_100128118 Ga0070679_1001281182 413
468 3300005530 Ga0070679_100153310 Ga0070679_1001533102 413
469 3300005535 Ga0070684_100000022 Ga0070684_10000002244 413
470 3300005536 Ga0070697_100115247 Ga0070697_1001152472 413
471 3300005539 Ga0068853_100006604 Ga0068853_1000066043 413
472 3300005539 Ga0068853_100117866 Ga0068853_1001178662 413
473 3300005543 Ga0070672_100000226 Ga0070672_10000022629 413
474 3300005543 Ga0070672_100114508 Ga0070672_1001145083 413
475 3300005544 Ga0070686_100000395 Ga0070686_10000039512 413
476 3300005544 Ga0070686_100020030 Ga0070686_1000200304 413
477 3300005544 Ga0070686_100051814 Ga0070686_1000518142 413
478 3300005545 Ga0070695_100000242 Ga0070695_10000024210 413
479 3300005545 Ga0070695_100031056 Ga0070695_1000310562 413
480 3300005546 Ga0070696_100000885 Ga0070696_10000088511 413
481 3300005546 Ga0070696_100004160 Ga0070696_1000041603 413
482 3300005546 Ga0070696_100017360 Ga0070696_1000173604 413
483 3300005547 Ga0070693_100000428 Ga0070693_1000004286 413
484 3300005548 Ga0070665_100071224 Ga0070665_1000712242 413
485 3300005549 Ga0070704_100001996 Ga0070704_1000019969 413
486 3300005549 Ga0070704_100004811 Ga0070704_1000048118 413
487 3300005549 Ga0070704_100007538 Ga0070704_1000075388 413
488 3300005563 Ga0068855_100004217 Ga0068855_1000042177 413
489 3300005563 Ga0068855_100032137 Ga0068855_1000321372 413
490 3300005564 Ga0070664_100000248 Ga0070664_10000024821 413
491 3300005564 Ga0070664_100018098 Ga0070664_1000180983 413
492 3300005577 Ga0068857_100000393 Ga0068857_10000039322 413
493 3300005577 Ga0068857_100124372 Ga0068857_1001243722 413
494 3300005578 Ga0068854_100000806 Ga0068854_1000008063 413
495 3300005614 Ga0068856_100000990 Ga0068856_10000099017 413
496 3300005614 Ga0068856_100054786 Ga0068856_1000547863 413
497 3300005615 Ga0070702_100000029 Ga0070702_10000002928 413
498 3300005615 Ga0070702_100091057 Ga0070702_1000910572 413
499 3300005616 Ga0068852_100004350 Ga0068852_1000043506 413
500 3300005616 Ga0068852_100029528 Ga0068852_1000295284 413
501 3300005616 Ga0068852_100096276 Ga0068852_1000962763 413
502 3300005617 Ga0068859_100002192 Ga0068859_1000021925 413
503 3300005617 Ga0068859_100015921 Ga0068859_1000159212 413
504 3300005617 Ga0068859_100132287 Ga0068859_1001322873 413
505 3300005618 Ga0068864_100000492 Ga0068864_10000049218 413
506 3300005618 Ga0068864_100013256 Ga0068864_1000132565 413
507 3300005718 Ga0068866_10000179 Ga0068866_1000017912 413
508 3300005719 Ga0068861_100000140 Ga0068861_10000014026 413
509 3300005719 Ga0068861_100025604 Ga0068861_1000256042 413
510 3300005719 Ga0068861_100040904 Ga0068861_1000409043 413
511 3300005719 Ga0068861_100123253 Ga0068861_1001232532 413
512 3300005840 Ga0068870_10000001 Ga0068870_100000013 413
513 3300005840 Ga0068870_10036649 Ga0068870_100366492 413
514 3300005841 Ga0068863_100000246 Ga0068863_10000024617 413
515 3300005841 Ga0068863_100018899 Ga0068863_1000188992 413
516 3300005842 Ga0068858_100001644 Ga0068858_1000016447 413
517 3300005842 Ga0068858_100008307 Ga0068858_1000083075 413
518 3300005843 Ga0068860_100001266 Ga0068860_10000126612 413
519 3300005843 Ga0068860_100014184 Ga0068860_1000141841 413
520 3300005843 Ga0068860_100014402 Ga0068860_1000144028 413
521 3300005843 Ga0068860_100046274 Ga0068860_1000462744 413
522 3300005844 Ga0068862_100001531 Ga0068862_10000153117 413
523 3300005844 Ga0068862_100001891 Ga0068862_1000018917 413
524 3300005844 Ga0068862_100034983 Ga0068862_1000349833 413
525 3300005844 Ga0068862_100137749 Ga0068862_1001377492 413
526 3300005937 Ga0081455_10007245 Ga0081455_100072452 413
527 3300005937 Ga0081455_10027309 Ga0081455_100273094 413
528 3300005937 Ga0081455_10062384 Ga0081455_100623843 413
529 3300006028 Ga0070717_10000215 Ga0070717_1000021532 413
530 3300006028 Ga0070717_10041913 Ga0070717_100419132 413
531 3300006038 Ga0075365_10002820 Ga0075365_100028203 413
532 3300006038 Ga0075365_10173359 Ga0075365_101733592 413
533 3300006042 Ga0075368_10015431 Ga0075368_100154313 413
534 3300006048 Ga0075363_100154618 Ga0075363_1001546181 413
535 3300006051 Ga0075364_10129279 Ga0075364_101292792 413
536 3300006058 Ga0075432_10002730 Ga0075432_100027304 413
537 3300006173 Ga0070716_100000605 Ga0070716_1000006058 413
538 3300006173 Ga0070716_100073071 Ga0070716_1000730712 413
539 3300006175 Ga0070712_100005387 Ga0070712_1000053877 413
540 3300006175 Ga0070712_100032573 Ga0070712_1000325732 413
541 3300006237 Ga0097621_100001299 Ga0097621_1000012992 413
542 3300006237 Ga0097621_100059032 Ga0097621_1000590323 413
543 3300006237 Ga0097621_100073302 Ga0097621_1000733023 413
544 3300006237 Ga0097621_100089756 Ga0097621_1000897562 413
545 3300006353 Ga0075370_10033860 Ga0075370_100338603 413
546 3300006358 Ga0068871_100000007 Ga0068871_10000000720 413
547 3300006358 Ga0068871_100071392 Ga0068871_1000713923 413
548 3300006844 Ga0075428_100016903 Ga0075428_1000169035 413
549 3300006844 Ga0075428_100035713 Ga0075428_1000357135 413
550 3300006844 Ga0075428_100043146 Ga0075428_1000431465 413
551 3300006846 Ga0075430_100000128 Ga0075430_10000012841 413
552 3300006846 Ga0075430_100020523 Ga0075430_1000205233 413
553 3300006847 Ga0075431_100000557 Ga0075431_1000005573 413
554 3300006847 Ga0075431_100011821 Ga0075431_1000118215 413
555 3300006852 Ga0075433_10000103 Ga0075433_100001035 413
556 3300006852 Ga0075433_10032108 Ga0075433_100321083 413
557 3300006871 Ga0075434_100003002 Ga0075434_10000300213 413
558 3300006871 Ga0075434_100005851 Ga0075434_10000585110 413
559 3300006871 Ga0075434_100090618 Ga0075434_1000906182 413
560 3300006880 Ga0075429_100004986 Ga0075429_10000498613 413
561 3300006881 Ga0068865_100000091 Ga0068865_10000009121 413
562 3300006881 Ga0068865_100067561 Ga0068865_1000675613 413
563 3300006914 Ga0075436_100141693 Ga0075436_1001416932 413
564 3300006931 Ga0097620_100002192 Ga0097620_10000219217 413
565 3300006931 Ga0097620_100015921 Ga0097620_1000159218 413
566 3300006931 Ga0097620_100132286 Ga0097620_1001322862 413
567 3300007076 Ga0075435_100050157 Ga0075435_1000501573 413
568 3300007076 Ga0075435_100052637 Ga0075435_1000526373 413
569 3300009094 Ga0111539_10000265 Ga0111539_1000026517 413
570 3300009094 Ga0111539_10003594 Ga0111539_1000359417 413
571 3300009094 Ga0111539_10006865 Ga0111539_1000686511 413
572 3300009094 Ga0111539_10179216 Ga0111539_101792162 413
573 3300009098 Ga0105245_10000187 Ga0105245_1000018719 413
574 3300009098 Ga0105245_10053267 Ga0105245_100532673 413
575 3300009101 Ga0105247_10003235 Ga0105247_1000323512 413
576 3300009101 Ga0105247_10047964 Ga0105247_100479642 413
577 3300009147 Ga0114129_10037638 Ga0114129_100376386 413
578 3300009148 Ga0105243_10001870 Ga0105243_1000187017 413
579 3300009148 Ga0105243_10024775 Ga0105243_100247753 413
580 3300009148 Ga0105243_10061475 Ga0105243_100614753 413
581 3300009174 Ga0105241_10000958 Ga0105241_1000095812 413
582 3300009176 Ga0105242_10000633 Ga0105242_1000063323 413
583 3300009177 Ga0105248_10002490 Ga0105248_1000249011 413
584 3300009177 Ga0105248_10010094 Ga0105248_100100942 413
585 3300009177 Ga0105248_10091898 Ga0105248_100918984 413
586 3300009545 Ga0105237_10002942 Ga0105237_100029426 413
587 3300009551 Ga0105238_10093032 Ga0105238_100930323 413
588 3300009551 Ga0105238_10396989 Ga0105238_103969891 413
589 3300009553 Ga0105249_10000564 Ga0105249_1000056424 413
590 3300009553 Ga0105249_10007631 Ga0105249_100076313 413
591 3300009553 Ga0105249_10027715 Ga0105249_100277155 413
592 3300010375 Ga0105239_10003234 Ga0105239_1000323417 413
593 3300010375 Ga0105239_10227438 Ga0105239_102274381 413
594 3300011119 Ga0105246_10000316 Ga0105246_1000031619 413
595 3300012492 Ga0157335_1000272 Ga0157335_10002722 413
596 3300013104 Ga0157370_10027127 Ga0157370_100271272 413
597 3300013104 Ga0157370_10075953 Ga0157370_100759532 413
598 3300013105 Ga0157369_10164746 Ga0157369_101647462 413
599 3300013296 Ga0157374_10053572 Ga0157374_100535722 413
600 3300013297 Ga0157378_10001984 Ga0157378_100019846 413
601 3300013297 Ga0157378_10035180 Ga0157378_100351804 413
602 3300013306 Ga0163162_10002975 Ga0163162_1000297510 413
603 3300013306 Ga0163162_10011395 Ga0163162_1001139510 413
604 3300013308 Ga0157375_10000430 Ga0157375_1000043021 413
605 3300013308 Ga0157375_10067479 Ga0157375_100674793 413
606 3300013308 Ga0157375_10084835 Ga0157375_100848352 413
607 3300014325 Ga0163163_10119598 Ga0163163_101195982 413
608 3300014326 Ga0157380_10000203 Ga0157380_1000020323 413
609 3300014326 Ga0157380_10204499 Ga0157380_102044992 413
610 3300014745 Ga0157377_10000290 Ga0157377_100002905 413
611 3300014745 Ga0157377_10014739 Ga0157377_100147394 413
612 3300014968 Ga0157379_10003225 Ga0157379_100032253 413
613 3300014968 Ga0157379_10033973 Ga0157379_100339735 413
614 3300014969 Ga0157376_10000104 Ga0157376_1000010433 413
615 3300014969 Ga0157376_10034976 Ga0157376_100349762 413
616 3300014969 Ga0157376_10086330 Ga0157376_100863302 413
617 3300017792 Ga0163161_10000724 Ga0163161_100007243 413
618 3300017792 Ga0163161_10066684 Ga0163161_100666842 413
619 3300025261 Ga0209233_1005712 Ga0209233_10057123 413
620 3300025271 Ga0207666_1000008 Ga0207666_10000088 413
621 3300025290 Ga0207673_1000195 Ga0207673_10001953 413
622 3300025315 Ga0207697_10000972 Ga0207697_100009727 413
623 3300025885 Ga0207653_10000374 Ga0207653_1000037419 413
624 3300025885 Ga0207653_10029472 Ga0207653_100294722 413
625 3300025893 Ga0207682_10000002 Ga0207682_1000000217 413
626 3300025898 Ga0207692_10033347 Ga0207692_100333471 413
627 3300025899 Ga0207642_10000064 Ga0207642_1000006415 413
628 3300025900 Ga0207710_10015153 Ga0207710_100151533 413
629 3300025900 Ga0207710_10031104 Ga0207710_100311043 413
630 3300025901 Ga0207688_10000850 Ga0207688_1000085010 413
631 3300025901 Ga0207688_10136516 Ga0207688_101365161 413
632 3300025903 Ga0207680_10145866 Ga0207680_101458662 413
633 3300025903 Ga0207680_10153937 Ga0207680_101539371 413
634 3300025904 Ga0207647_10002907 Ga0207647_1000290711 413
635 3300025906 Ga0207699_10005831 Ga0207699_100058316 413
636 3300025906 Ga0207699_10023468 Ga0207699_100234682 413
637 3300025907 Ga0207645_10000026 Ga0207645_1000002613 413
638 3300025908 Ga0207643_10000090 Ga0207643_1000009042 413
639 3300025908 Ga0207643_10006777 Ga0207643_100067775 413
640 3300025909 Ga0207705_10011264 Ga0207705_100112646 413
641 3300025912 Ga0207707_10060256 Ga0207707_100602563 413
642 3300025912 Ga0207707_10156931 Ga0207707_101569312 413
643 3300025912 Ga0207707_10326852 Ga0207707_103268521 413
644 3300025913 Ga0207695_10073797 Ga0207695_100737973 413
645 3300025914 Ga0207671_10031527 Ga0207671_100315274 413
646 3300025915 Ga0207693_10006780 Ga0207693_100067806 413
647 3300025915 Ga0207693_10007813 Ga0207693_100078132 413
648 3300025915 Ga0207693_10014507 Ga0207693_100145074 413
649 3300025915 Ga0207693_10020815 Ga0207693_100208153 413
650 3300025917 Ga0207660_10000374 Ga0207660_1000037410 413
651 3300025917 Ga0207660_10030691 Ga0207660_100306914 413
652 3300025917 Ga0207660_10053001 Ga0207660_100530013 413
653 3300025918 Ga0207662_10000244 Ga0207662_100002447 413
654 3300025918 Ga0207662_10000473 Ga0207662_1000047311 413
655 3300025918 Ga0207662_10001021 Ga0207662_1000102112 413
656 3300025919 Ga0207657_10001644 Ga0207657_100016447 413
657 3300025919 Ga0207657_10008488 Ga0207657_100084884 413
658 3300025919 Ga0207657_10097515 Ga0207657_100975152 413
659 3300025919 Ga0207657_10124392 Ga0207657_101243922 413
660 3300025920 Ga0207649_10000143 Ga0207649_1000014354 413
661 3300025921 Ga0207652_10003863 Ga0207652_1000386310 413
662 3300025923 Ga0207681_10000457 Ga0207681_1000045712 413
663 3300025923 Ga0207681_10118699 Ga0207681_101186992 413
664 3300025924 Ga0207694_10053905 Ga0207694_100539052 413
665 3300025925 Ga0207650_10081524 Ga0207650_100815242 413
666 3300025926 Ga0207659_10000015 Ga0207659_1000001582 413
667 3300025926 Ga0207659_10048394 Ga0207659_100483942 413
668 3300025927 Ga0207687_10000543 Ga0207687_100005436 413
669 3300025927 Ga0207687_10019356 Ga0207687_100193565 413
670 3300025928 Ga0207700_10012884 Ga0207700_100128845 413
671 3300025928 Ga0207700_10130082 Ga0207700_101300822 413
672 3300025931 Ga0207644_10000463 Ga0207644_1000046313 413
673 3300025931 Ga0207644_10024447 Ga0207644_100244473 413
674 3300025931 Ga0207644_10092329 Ga0207644_100923292 413
675 3300025932 Ga0207690_10000397 Ga0207690_1000039720 413
676 3300025933 Ga0207706_10001387 Ga0207706_100013877 413
677 3300025933 Ga0207706_10008224 Ga0207706_100082249 413
678 3300025933 Ga0207706_10028751 Ga0207706_100287515 413
679 3300025934 Ga0207686_10000065 Ga0207686_1000006553 413
680 3300025934 Ga0207686_10019330 Ga0207686_100193303 413
681 3300025934 Ga0207686_10027500 Ga0207686_100275002 413
682 3300025935 Ga0207709_10000081 Ga0207709_1000008169 413
683 3300025935 Ga0207709_10002863 Ga0207709_100028637 413
684 3300025936 Ga0207670_10000056 Ga0207670_1000005626 413
685 3300025936 Ga0207670_10009248 Ga0207670_100092483 413
686 3300025936 Ga0207670_10032470 Ga0207670_100324702 413
687 3300025937 Ga0207669_10000008 Ga0207669_1000000880 413
688 3300025938 Ga0207704_10000031 Ga0207704_1000003196 413
689 3300025938 Ga0207704_10012582 Ga0207704_100125822 413
690 3300025938 Ga0207704_10018925 Ga0207704_100189253 413
691 3300025940 Ga0207691_10001398 Ga0207691_100013987 413
692 3300025940 Ga0207691_10003704 Ga0207691_100037047 413
693 3300025941 Ga0207711_10001138 Ga0207711_100011382 413
694 3300025941 Ga0207711_10076645 Ga0207711_100766453 413
695 3300025942 Ga0207689_10000772 Ga0207689_1000077222 413
696 3300025942 Ga0207689_10002348 Ga0207689_100023485 413
697 3300025942 Ga0207689_10018494 Ga0207689_100184943 413
698 3300025942 Ga0207689_10071406 Ga0207689_100714062 413
699 3300025944 Ga0207661_10000255 Ga0207661_1000025528 413
700 3300025945 Ga0207679_10000014 Ga0207679_1000001421 413
701 3300025945 Ga0207679_10133870 Ga0207679_101338702 413
702 3300025949 Ga0207667_10010693 Ga0207667_100106936 413
703 3300025949 Ga0207667_10039605 Ga0207667_100396052 413
704 3300025960 Ga0207651_10000055 Ga0207651_1000005538 413
705 3300025960 Ga0207651_10077553 Ga0207651_100775532 413
706 3300025961 Ga0207712_10002119 Ga0207712_100021198 413
707 3300025961 Ga0207712_10002532 Ga0207712_100025322 413
708 3300025961 Ga0207712_10033210 Ga0207712_100332103 413
709 3300025961 Ga0207712_10040509 Ga0207712_100405093 413
710 3300025961 Ga0207712_10071181 Ga0207712_100711813 413
711 3300025972 Ga0207668_10000037 Ga0207668_1000003785 413
712 3300025972 Ga0207668_10026112 Ga0207668_100261123 413
713 3300025981 Ga0207640_10001137 Ga0207640_1000113710 413
714 3300025986 Ga0207658_10002855 Ga0207658_100028552 413
715 3300026023 Ga0207677_10000363 Ga0207677_1000036315 413
716 3300026023 Ga0207677_10017614 Ga0207677_100176143 413
717 3300026023 Ga0207677_10246966 Ga0207677_102469662 413
718 3300026035 Ga0207703_10000858 Ga0207703_1000085826 413
719 3300026035 Ga0207703_10033233 Ga0207703_100332334 413
720 3300026041 Ga0207639_10000903 Ga0207639_1000090316 413
721 3300026067 Ga0207678_10000372 Ga0207678_100003727 413
722 3300026067 Ga0207678_10069749 Ga0207678_100697493 413
723 3300026067 Ga0207678_10078943 Ga0207678_100789432 413
724 3300026075 Ga0207708_10000460 Ga0207708_1000046017 413
725 3300026075 Ga0207708_10001478 Ga0207708_1000147810 413
726 3300026075 Ga0207708_10002409 Ga0207708_100024097 413
727 3300026075 Ga0207708_10089575 Ga0207708_100895752 413
728 3300026078 Ga0207702_10001048 Ga0207702_1000104815 413
729 3300026078 Ga0207702_10070691 Ga0207702_100706913 413
730 3300026088 Ga0207641_10002957 Ga0207641_1000295715 413
731 3300026088 Ga0207641_10057553 Ga0207641_100575532 413
732 3300026089 Ga0207648_10001536 Ga0207648_100015368 413
733 3300026089 Ga0207648_10004845 Ga0207648_1000484510 413
734 3300026095 Ga0207676_10000483 Ga0207676_1000048327 413
735 3300026095 Ga0207676_10006265 Ga0207676_100062654 413
736 3300026095 Ga0207676_10012844 Ga0207676_100128445 413
737 3300026116 Ga0207674_10002391 Ga0207674_1000239112 413
738 3300026116 Ga0207674_10012453 Ga0207674_100124535 413
739 3300026118 Ga0207675_100000231 Ga0207675_10000023135 413
740 3300026118 Ga0207675_100007144 Ga0207675_1000071448 413
741 3300026118 Ga0207675_100039730 Ga0207675_1000397302 413
742 3300026118 Ga0207675_100150405 Ga0207675_1001504053 413
743 3300026121 Ga0207683_10000002 Ga0207683_10000002204 413
744 3300026121 Ga0207683_10006794 Ga0207683_1000679411 413
745 3300026121 Ga0207683_10020956 Ga0207683_100209564 413
746 3300026121 Ga0207683_10023336 Ga0207683_100233364 413
747 3300026142 Ga0207698_10009377 Ga0207698_100093776 413
748 3300026142 Ga0207698_10056437 Ga0207698_100564373 413
749 3300027617 Ga0210002_1000756 Ga0210002_10007562 413
750 3300027695 Ga0209966_1000521 Ga0209966_10005216 413
751 3300027717 Ga0209998_10002232 Ga0209998_100022323 413
752 3300027717 Ga0209998_10006254 Ga0209998_100062542 413
753 3300027876 Ga0209974_10001820 Ga0209974_100018208 413
754 3300027907 Ga0207428_10000011 Ga0207428_1000001198 413
755 3300027907 Ga0207428_10000046 Ga0207428_1000004682 413
756 3300027907 Ga0207428_10000058 Ga0207428_1000005818 413
757 3300027907 Ga0207428_10002321 Ga0207428_1000232117 413
758 3300028379 Ga0268266_10041930 Ga0268266_100419304 413
759 3300028379 Ga0268266_10146264 Ga0268266_101462642 413
760 3300028379 Ga0268266_10153726 Ga0268266_101537262 413
761 3300028380 Ga0268265_10000117 Ga0268265_1000011753 413
762 3300028380 Ga0268265_10003608 Ga0268265_100036087 413
763 3300028380 Ga0268265_10043471 Ga0268265_100434714 413
764 3300028381 Ga0268264_10000487 Ga0268264_1000048717 413
765 3300028381 Ga0268264_10001467 Ga0268264_100014679 413
766 3300028381 Ga0268264_10086083 Ga0268264_100860832 413
767 3300031235 Ga0265330_10017416 Ga0265330_100174163 413
768 3300031235 Ga0265330_10048501 Ga0265330_100485011 413
769 3300031241 Ga0265325_10000062 Ga0265325_1000006251 413
770 3300031241 Ga0265325_10003451 Ga0265325_100034515 413
771 3300031250 Ga0265331_10005011 Ga0265331_100050119 413
772 3300031344 Ga0265316_10095710 Ga0265316_100957103 413
773 3300031344 Ga0265316_10209046 Ga0265316_102090461 413
774 3300031595 Ga0265313_10000524 Ga0265313_100005242 413
775 3300031595 Ga0265313_10047917 Ga0265313_100479173 413
776 3300031711 Ga0265314_10000419 Ga0265314_100004191 413
777 3300031711 Ga0265314_10008641 Ga0265314_100086413 413
778 3300031712 Ga0265342_10000256 Ga0265342_1000025646 413
779 3300031712 Ga0265342_10056280 Ga0265342_100562802 413
780 3300034816 Ga0373930_0000298 Ga0373930_0000298_905_2146 413
781 3300034817 Ga0373948_0000018 Ga0373948_0000018_4342_5583 413
782 3300034817 Ga0373948_0008122 Ga0373948_0008122_185_1426 413
783 3300034820 Ga0373959_0001867 Ga0373959_0001867_1779_3020 413
784 3300034820 Ga0373959_0002399 Ga0373959_0002399_1150_2391 413
785 3300034957 Ga0373938_0002615 Ga0373938_0002615_1422_2663 413
786 3300035083 Ga0373926_0001552 Ga0373926_0001552_3995_5257 413
787 3300035084 Ga0373928_0002316 Ga0373928_0002316_1326_2567 413
788 3300035084 Ga0373928_0004518 Ga0373928_0004518_327_1568 413
789 3300035085 Ga0373929_0008373 Ga0373929_0008373_529_1770 413
790 3300035086 Ga0373934_0002917 Ga0373934_0002917_3242_4483 413
791 3300035088 Ga0373940_0000354 Ga0373940_0000354_1841_3082 413
792 3300035089 Ga0373944_0005358 Ga0373944_0005358_1533_2774 413
793 3300035090 Ga0373949_0000408 Ga0373949_0000408_13336_14577 413
794 3300035090 Ga0373949_0004126 Ga0373949_0004126_1525_2793 413
795 3300035091 Ga0373951_0003513 Ga0373951_0003513_273_1514 413
796 3300035092 Ga0373952_0000056 Ga0373952_0000056_11290_12531 413
797 3300035092 Ga0373952_0000964 Ga0373952_0000964_3576_4817 413
798 3300035111 Ga0373923_0005076 Ga0373923_0005076_57_1319 413
799 3300035112 Ga0373932_0000734 Ga0373932_0000734_3988_5229 413
800 3300035112 Ga0373932_0001197 Ga0373932_0001197_954_2222 413
801 3300035112 Ga0373932_0013506 Ga0373932_0013506_565_1806 413
802 3300035113 Ga0373936_0008301 Ga0373936_0008301_2579_3820 413
803 3300035114 Ga0373939_0000559 Ga0373939_0000559_3279_4520 413
804 3300035115 Ga0373941_0000709 Ga0373941_0000709_3988_5229 413
805 3300035116 Ga0373945_0003571 Ga0373945_0003571_2804_4045 413
806 3300035116 Ga0373945_0009489 Ga0373945_0009489_654_1916 413
807 3300035117 Ga0373953_0006521 Ga0373953_0006521_567_1844 413
808 3300035117 Ga0373953_0023897 Ga0373953_0023897_248_1489 413
809 3300035118 Ga0373954_0003029 Ga0373954_0003029_3250_4491 413
810 3300035118 Ga0373954_0004278 Ga0373954_0004278_3217_4494 413
811 3300035118 Ga0373954_0040237 Ga0373954_0040237_159_1400 413
812 3300035119 Ga0373956_0002599 Ga0373956_0002599_52_1293 413
813 3300035119 Ga0373956_0004206 Ga0373956_0004206_3439_4716 413
814 3300035120 Ga0373957_0003413 Ga0373957_0003413_2746_4023 413
815 3300035121 Ga0373960_0001479 Ga0373960_0001479_3473_4714 413
816 3300035121 Ga0373960_0002840 Ga0373960_0002840_1771_3039 413
817 3300035170 Ga0373943_0000352 Ga0373943_0000352_9781_11022 413
818 3300035171 Ga0373946_0001249 Ga0373946_0001249_1575_2816 413
819 3300035171 Ga0373946_0006482 Ga0373946_0006482_2092_3333 413
820 3300035171 Ga0373946_0023711 Ga0373946_0023711_589_1830 413
821 3300035207 Ga0373942_0000491 Ga0373942_0000491_3240_4508 413
822 3300035207 Ga0373942_0002258 Ga0373942_0002258_1460_2701 413
823 3300035241 Ga0373961_0001829 Ga0373961_0001829_2986_4227 413
824 3300035241 Ga0373961_0004217 Ga0373961_0004217_1737_3005 413
825 3300035242 Ga0373962_0000574 Ga0373962_0000574_2908_4176 413
826 3300035691 Ga0373931_0000087 Ga0373931_0000087_14722_15963 413
827 3300035692 Ga0373935_0018763 Ga0373935_0018763_1615_2856 413
828 3300035695 Ga0373927_0004615 Ga0373927_0004615_3080_4321 413
829 3300035695 Ga0373927_0034470 Ga0373927_0034470_1684_2946 413
830 3300035724 Ga0373933_0003625 Ga0373933_0003625_6293_7534 413
831 3300035724 Ga0373933_0066951 Ga0373933_0066951_758_2041 413
832 3300035725 Ga0373947_0002498 Ga0373947_0002498_7442_8683 413
833 3300035725 Ga0373947_0003411 Ga0373947_0003411_2963_4204 413
834 3300036401 Ga0373937_0000851 Ga0373937_0000851_15388_16629 413
835 3300036401 Ga0373937_0000862 Ga0373937_0000862_19882_21123 413
836 3300036401 Ga0373937_0006835 Ga0373937_0006835_2784_4025 413
837 3300036401 Ga0373937_0009142 Ga0373937_0009142_1500_2777 413
838 3300036401 Ga0373937_0009393 Ga0373937_0009393_1496_2737 413
839 3300036401 Ga0373937_0093118 Ga0373937_0093118_1512_2753 413
840 3300036401 Ga0373937_0224279 Ga0373937_0224279_384_1637 413
841 3300037068 Ga0373925_0005584 Ga0373925_0005584_5256_6497 413
842 3300037068 Ga0373925_0013965 Ga0373925_0013965_2570_3811 413
843 3300037418 Ga0395900_0002893 Ga0395900_0002893_8806_10047 413
844 3300037418 Ga0395900_0045160 Ga0395900_0045160_1777_3018 413
845 3300037466 Ga0395898_0003726 Ga0395898_0003726_6855_8096 413
846 3300038443 Ga0395901_0074904 Ga0395901_0074904_2066_3307 413
847 3300039450 Ga0436363_1497978 Ga0436363_1497978_278_1534 413
848 3300042436 Ga0439435_0032346 Ga0439435_0032346_70_1311 413
849 3300044693 Ga0466961_0067381 Ga0466961_0067381_461_1702 413
850 3300044694 Ga0466963_0040007 Ga0466963_0040007_1175_2416 413
851 3300044712 Ga0453684_0036104 Ga0453684_0036104_382_1623 413
852 3300044842 Ga0466957_0051056 Ga0466957_0051056_80_1321 413
853 3300045049 Ga0466959_0054770 Ga0466959_0054770_600_1841 413
854 3300045051 Ga0451576_0061573 Ga0451576_0061573_304_1545 413
855 3300045976 Ga0466967_0001672 Ga0466967_0001672_2412_3653 413
856 3300046454 Ga0495592_0010297 Ga0495592_0010297_3933_5174 413
857 3300046454 Ga0495592_0011377 Ga0495592_0011377_3476_4717 413
858 3300046454 Ga0495592_0032282 Ga0495592_0032282_410_1687 413
859 3300046454 Ga0495592_0118130 Ga0495592_0118130_604_1845 413
860 3300046459 Ga0495629_0003086 Ga0495629_0003086_5495_6736 413
861 3300046461 Ga0495641_0030804 Ga0495641_0030804_792_2033 413
862 3300046462 Ga0495651_0007457 Ga0495651_0007457_2299_3576 413
863 3300046462 Ga0495651_0021404 Ga0495651_0021404_523_1764 413
864 3300046462 Ga0495651_0038247 Ga0495651_0038247_185_1426 413
865 3300046463 Ga0495653_0002676 Ga0495653_0002676_10718_11995 413
866 3300046463 Ga0495653_0013738 Ga0495653_0013738_30_1271 413
867 3300046463 Ga0495653_0023498 Ga0495653_0023498_3633_4874 413
868 3300046472 Ga0495580_0014862 Ga0495580_0014862_4615_5856 413
869 3300046472 Ga0495580_0025839 Ga0495580_0025839_2911_4173 413
870 3300046472 Ga0495580_0028983 Ga0495580_0028983_62_1303 413
871 3300046473 Ga0495582_0001834 Ga0495582_0001834_3215_4456 413
872 3300046474 Ga0495605_0045697 Ga0495605_0045697_95_1369 413
873 3300046475 Ga0495639_0011034 Ga0495639_0011034_2102_3364 413
874 3300046475 Ga0495639_0038415 Ga0495639_0038415_870_2111 413
875 3300046476 Ga0495662_0007015 Ga0495662_0007015_2751_3992 413
876 3300046476 Ga0495662_0007266 Ga0495662_0007266_3875_5137 413
877 3300046476 Ga0495662_0080640 Ga0495662_0080640_24_1265 413
878 3300046477 Ga0495664_0000398 Ga0495664_0000398_12257_13498 413
879 3300046477 Ga0495664_0001582 Ga0495664_0001582_3628_4905 413
880 3300046491 Ga0495584_0014313 Ga0495584_0014313_2207_3448 413
881 3300046491 Ga0495584_0129666 Ga0495584_0129666_13_1254 413
882 3300046492 Ga0495585_0012227 Ga0495585_0012227_2706_3947 413
883 3300046492 Ga0495585_0068626 Ga0495585_0068626_452_1747 413
884 3300046511 Ga0495608_0006901 Ga0495608_0006901_3916_5157 413
885 3300046511 Ga0495608_0030439 Ga0495608_0030439_494_1735 413
886 3300046513 Ga0495616_0065451 Ga0495616_0065451_166_1461 413
887 3300046514 Ga0495618_0001798 Ga0495618_0001798_1031_2272 413
888 3300046514 Ga0495618_0004894 Ga0495618_0004894_1047_2324 413
889 3300046516 Ga0495628_0021800 Ga0495628_0021800_324_1565 413
890 3300046516 Ga0495628_0076649 Ga0495628_0076649_477_1754 413
891 3300046516 Ga0495628_0133533 Ga0495628_0133533_496_1737 413
892 3300046517 Ga0495630_0005356 Ga0495630_0005356_2525_3766 413
893 3300046518 Ga0495631_0056938 Ga0495631_0056938_95_1390 413
894 3300046520 Ga0495637_0016284 Ga0495637_0016284_720_1961 413
895 3300046526 Ga0495666_0004260 Ga0495666_0004260_3852_5114 413
896 3300046526 Ga0495666_0045386 Ga0495666_0045386_572_1813 413
897 3300046529 Ga0495652_0000531 Ga0495652_0000531_20396_21637 413
898 3300046529 Ga0495652_0108200 Ga0495652_0108200_106_1368 413
899 3300046531 Ga0495665_0001228 Ga0495665_0001228_289_1530 413
900 3300046531 Ga0495665_0009811 Ga0495665_0009811_1831_3093 413
901 3300046531 Ga0495665_0027512 Ga0495665_0027512_69_1310 413
902 3300046531 Ga0495665_0058379 Ga0495665_0058379_242_1483 413
903 3300046533 Ga0495640_0001922 Ga0495640_0001922_2968_4209 413
904 3300046533 Ga0495640_0013247 Ga0495640_0013247_4478_5740 413
905 3300046533 Ga0495640_0058291 Ga0495640_0058291_813_2054 413
906 3300046535 Ga0495586_0012528 Ga0495586_0012528_1750_3012 413
907 3300046535 Ga0495586_0026452 Ga0495586_0026452_901_2142 413
908 3300046535 Ga0495586_0033699 Ga0495586_0033699_1087_2328 413
909 3300046536 Ga0495587_0016396 Ga0495587_0016396_1293_2534 413
910 3300046536 Ga0495587_0016549 Ga0495587_0016549_2349_3590 413
911 3300046536 Ga0495587_0032503 Ga0495587_0032503_477_1754 413
912 3300046536 Ga0495587_0037736 Ga0495587_0037736_1557_2840 413
913 3300046536 Ga0495587_0053294 Ga0495587_0053294_70_1311 413
914 3300046537 Ga0495598_0001181 Ga0495598_0001181_1150_2445 413
915 3300046539 Ga0495621_0020185 Ga0495621_0020185_600_1841 413
916 3300046543 Ga0495645_0001513 Ga0495645_0001513_9060_10337 413
917 3300046543 Ga0495645_0002097 Ga0495645_0002097_6079_7320 413
918 3300046543 Ga0495645_0003462 Ga0495645_0003462_423_1664 413
919 3300046557 Ga0495622_0017216 Ga0495622_0017216_1787_3028 413
920 3300046557 Ga0495622_0026865 Ga0495622_0026865_37_1299 413
921 3300046558 Ga0495633_0013739 Ga0495633_0013739_428_1723 413
922 3300046558 Ga0495633_0027931 Ga0495633_0027931_601_1842 413
923 3300046559 Ga0495667_0003336 Ga0495667_0003336_7909_9186 413
924 3300046559 Ga0495667_0004207 Ga0495667_0004207_7508_8749 413
925 3300046559 Ga0495667_0009091 Ga0495667_0009091_1550_2791 413
926 3300046559 Ga0495667_0023502 Ga0495667_0023502_2043_3284 413
927 3300046615 Ga0495656_0000729 Ga0495656_0000729_537_1778 413
928 3300046615 Ga0495656_0004585 Ga0495656_0004585_1283_2578 413
929 3300046642 Ga0495634_0004091 Ga0495634_0004091_9081_10322 413
930 3300046642 Ga0495634_0006411 Ga0495634_0006411_6967_8208 413
931 3300046663 Ga0495635_0003726 Ga0495635_0003726_7227_8504 413
932 3300046663 Ga0495635_0006571 Ga0495635_0006571_851_2092 413
933 3300046663 Ga0495635_0006850 Ga0495635_0006850_1370_2611 413
934 3300046664 Ga0495659_0016235 Ga0495659_0016235_719_2014 413
935 3300046664 Ga0495659_0018915 Ga0495659_0018915_915_2156 413
936 3300046674 Ga0495588_0046617 Ga0495588_0046617_688_1929 413
937 3300046675 Ga0495657_0002845 Ga0495657_0002845_3735_5012 413
938 3300046675 Ga0495657_0010336 Ga0495657_0010336_2853_4094 413
939 3300046675 Ga0495657_0024564 Ga0495657_0024564_2789_4030 413
940 3300046678 Ga0495599_0001644 Ga0495599_0001644_6711_7988 413
941 3300046678 Ga0495599_0096207 Ga0495599_0096207_83_1324 413
942 3300046679 Ga0495623_0000187 Ga0495623_0000187_20111_21388 413
943 3300046681 Ga0495647_0003806 Ga0495647_0003806_1480_2742 413
944 3300046681 Ga0495647_0026338 Ga0495647_0026338_820_2061 413
945 3300046683 Ga0495658_0001330 Ga0495658_0001330_4512_5753 413
946 3300046689 Ga0495613_0046701 Ga0495613_0046701_751_1992 413
947 3300046690 Ga0495624_0001710 Ga0495624_0001710_15494_16735 413
948 3300046690 Ga0495624_0014147 Ga0495624_0014147_4011_5252 413
949 3300046794 Ga0495589_0045992 Ga0495589_0045992_588_1883 413
950 3300046809 Ga0495600_0012966 Ga0495600_0012966_57_1340 413
951 3300046809 Ga0495600_0065394 Ga0495600_0065394_677_1918 413
952 3300047315 Ga0495581_0036727 Ga0495581_0036727_526_1767 413
953 3300047317 Ga0495604_0002167 Ga0495604_0002167_8271_9512 413
954 3300047317 Ga0495604_0004215 Ga0495604_0004215_7784_9061 413
955 3300047319 Ga0495674_0012504 Ga0495674_0012504_934_2175 413
956 3300047321 Ga0495676_0048198 Ga0495676_0048198_334_1596 413
957 3300047322 Ga0495680_0001596 Ga0495680_0001596_17177_18418 413
958 3300047322 Ga0495680_0007052 Ga0495680_0007052_8411_9688 413
959 3300047322 Ga0495680_0025820 Ga0495680_0025820_251_1534 413
960 3300047322 Ga0495680_0110221 Ga0495680_0110221_398_1639 413
961 3300047444 Ga0495675_0000781 Ga0495675_0000781_10170_11447 413
962 3300047444 Ga0495675_0013134 Ga0495675_0013134_1259_2500 413
963 3300047471 Ga0495684_0002371 Ga0495684_0002371_9657_10898 413
964 3300047471 Ga0495684_0007415 Ga0495684_0007415_5271_6512 413
965 3300047471 Ga0495684_0044558 Ga0495684_0044558_802_2043 413
966 3300047471 Ga0495684_0131914 Ga0495684_0131914_407_1648 413
967 3300047471 Ga0495684_0168033 Ga0495684_0168033_54_1337 413
968 3300047673 Ga0495593_0008885 Ga0495593_0008885_706_1947 413
969 3300047673 Ga0495593_0013963 Ga0495593_0013963_1595_2857 413
970 3300047673 Ga0495593_0014466 Ga0495593_0014466_2730_3971 413
971 3300047673 Ga0495593_0078618 Ga0495593_0078618_78_1361 413
972 3300048088 Ga0495602_0004816 Ga0495602_0004816_2672_3949 413
973 3300048088 Ga0495602_0013239 Ga0495602_0013239_4547_5788 413
974 3300048088 Ga0495602_0104729 Ga0495602_0104729_592_1848 413
975 3300048088 Ga0495602_0227881 Ga0495602_0227881_101_1342 413
976 3300048089 Ga0495614_0023802 Ga0495614_0023802_835_2097 413
977 3300048903 Ga0496100_0000283 Ga0496100_0000283_23833_25074 413
978 3300048903 Ga0496100_0062330 Ga0496100_0062330_855_2150 413
979 3300048904 Ga0496101_0000434 Ga0496101_0000434_21575_22816 413
980 3300048904 Ga0496101_0034822 Ga0496101_0034822_319_1596 413
981 3300048905 Ga0496102_0067010 Ga0496102_0067010_1479_2720 413
982 3300048905 Ga0496102_0078004 Ga0496102_0078004_601_1875 413
983 3300048905 Ga0496102_0098203 Ga0496102_0098203_105_1367 413
984 3300048905 Ga0496102_0131327 Ga0496102_0131327_733_2010 413
985 3300048906 Ga0496103_0000686 Ga0496103_0000686_14635_15903 413
986 3300048906 Ga0496103_0011234 Ga0496103_0011234_2376_3671 413
987 3300048906 Ga0496103_0040115 Ga0496103_0040115_1623_2864 413
988 3300048907 Ga0496104_0000273 Ga0496104_0000273_31455_32696 413
989 3300048907 Ga0496104_0038056 Ga0496104_0038056_2188_3429 413
990 3300048907 Ga0496104_0075907 Ga0496104_0075907_1574_2815 413
991 3300048907 Ga0496104_0083230 Ga0496104_0083230_318_1574 413
992 3300048907 Ga0496104_0125327 Ga0496104_0125327_381_1658 413
993 3300048907 Ga0496104_0358508 Ga0496104_0358508_101_1342 413
994 3300048908 Ga0496105_0006140 Ga0496105_0006140_5821_7116 413
995 3300048908 Ga0496105_0013298 Ga0496105_0013298_3033_4310 413
996 3300048908 Ga0496105_0033860 Ga0496105_0033860_2781_4022 413
997 3300048908 Ga0496105_0146919 Ga0496105_0146919_521_1762 413
998 3300048909 Ga0496106_0028030 Ga0496106_0028030_809_2104 413
999 3300048909 Ga0496106_0035075 Ga0496106_0035075_402_1679 413
1000 3300048909 Ga0496106_0042232 Ga0496106_0042232_545_1813 413
1001 3300048909 Ga0496106_0113553 Ga0496106_0113553_747_2009 413
1002 3300048910 Ga0496107_0000297 Ga0496107_0000297_1679_2947 413
1003 3300048910 Ga0496107_0015675 Ga0496107_0015675_2649_3890 413
1004 3300048910 Ga0496107_0042340 Ga0496107_0042340_977_2218 413
1005 3300048910 Ga0496107_0058895 Ga0496107_0058895_878_2152 413
1006 3300048911 Ga0496108_0013337 Ga0496108_0013337_1098_2339 413
1007 3300048911 Ga0496108_0016150 Ga0496108_0016150_2024_3319 413
1008 3300048911 Ga0496108_0079761 Ga0496108_0079761_818_2059 413
1009 3300048911 Ga0496108_0098184 Ga0496108_0098184_242_1498 413
1010 3300048912 Ga0496109_0000296 Ga0496109_0000296_15027_16295 413
1011 3300048912 Ga0496109_0020129 Ga0496109_0020129_1014_2309 413
1012 3300048912 Ga0496109_0063918 Ga0496109_0063918_511_1752 413
1013 3300048912 Ga0496109_0141381 Ga0496109_0141381_721_1962 413
1014 3300048912 Ga0496109_0168800 Ga0496109_0168800_456_1733 413
1015 3300048913 Ga0496110_0008408 Ga0496110_0008408_2373_3614 413
1016 3300048913 Ga0496110_0065699 Ga0496110_0065699_1484_2725 413
1017 3300048913 Ga0496110_0067933 Ga0496110_0067933_386_1627 413
1018 3300048914 Ga0496111_0037785 Ga0496111_0037785_1503_2744 413
1019 3300048914 Ga0496111_0060753 Ga0496111_0060753_753_2048 413
1020 3300048915 Ga0496112_0087825 Ga0496112_0087825_689_1930 413
1021 3300048915 Ga0496112_0109652 Ga0496112_0109652_1238_2479 413
1022 3300048915 Ga0496112_0173484 Ga0496112_0173484_320_1588 413
1023 3300048915 Ga0496112_0192343 Ga0496112_0192343_311_1606 413
1024 3300048915 Ga0496112_0243974 Ga0496112_0243974_28_1269 413
1025 3300048916 Ga0496113_0009386 Ga0496113_0009386_2995_4236 413
1026 3300048916 Ga0496113_0076618 Ga0496113_0076618_330_1571 413
1027 3300048917 Ga0496114_0001211 Ga0496114_0001211_7911_9152 413
1028 3300048917 Ga0496114_0022869 Ga0496114_0022869_639_1934 413
1029 3300048917 Ga0496114_0034114 Ga0496114_0034114_1446_2687 413
1030 3300048918 Ga0496115_0001319 Ga0496115_0001319_4877_6145 413
1031 3300048918 Ga0496115_0034865 Ga0496115_0034865_2498_3793 413
1032 3300048918 Ga0496115_0100422 Ga0496115_0100422_76_1338 413
1033 3300048918 Ga0496115_0111038 Ga0496115_0111038_509_1750 413
1034 3300049571 Ga0501034_0004028 Ga0501034_0004028_14964_16205 413
1035 3300049572 Ga0501036_0016699 Ga0501036_0016699_3981_5222 413
1036 3300049572 Ga0501036_0025862 Ga0501036_0025862_923_2170 413
1037 3300049574 Ga0501038_0031016 Ga0501038_0031016_246_1487 413
1038 3300049575 Ga0501039_0077028 Ga0501039_0077028_406_1668 413
1039 3300049579 Ga0501043_0019155 Ga0501043_0019155_3215_4456 413
1040 3300049579 Ga0501043_0031259 Ga0501043_0031259_596_1837 413
1041 3300049580 Ga0501046_0018676 Ga0501046_0018676_4377_5618 413
1042 3300049580 Ga0501046_0050708 Ga0501046_0050708_1885_3126 413
1043 3300049581 Ga0501047_0000179 Ga0501047_0000179_37609_38850 413
1044 3300049582 Ga0501048_0002734 Ga0501048_0002734_3766_5007 413
1045 3300049583 Ga0501067_0114846 Ga0501067_0114846_16_1257 413
1046 3300049584 Ga0501068_0045526 Ga0501068_0045526_706_1953 413
1047 3300049585 Ga0501069_0029347 Ga0501069_0029347_628_1869 413
1048 3300049586 Ga0501070_0011503 Ga0501070_0011503_125_1366 413
1049 3300049586 Ga0501070_0031154 Ga0501070_0031154_2357_3598 413
1050 3300049587 Ga0501071_0043948 Ga0501071_0043948_756_1997 413
1051 3300049587 Ga0501071_0057739 Ga0501071_0057739_1180_2442 413
1052 3300049591 Ga0501075_0049434 Ga0501075_0049434_352_1593 413
1053 3300049592 Ga0501076_0145372 Ga0501076_0145372_15_1256 413
1054 3300049592 Ga0501076_0174581 Ga0501076_0174581_162_1403 413
1055 3300049593 Ga0501077_0024109 Ga0501077_0024109_2607_3848 413
1056 3300049741 Ga0501079_0199153 Ga0501079_0199153_287_1528 413
1057 3300049742 Ga0501080_0001318 Ga0501080_0001318_2978_4219 413
1058 3300049742 Ga0501080_0031286 Ga0501080_0031286_1661_2902 413
1059 3300049742 Ga0501080_0040847 Ga0501080_0040847_2259_3506 413
1060 3300049743 Ga0501081_0000809 Ga0501081_0000809_3866_5107 413
1061 3300049743 Ga0501081_0058736 Ga0501081_0058736_11_1252 413
1062 3300049744 Ga0501083_0104261 Ga0501083_0104261_584_1825 413
1063 3300049822 Ga0501035_0007682 Ga0501035_0007682_5898_7139 413
1064 3300049823 Ga0501044_0005728 Ga0501044_0005728_4248_5489 413
1065 3300049823 Ga0501044_0049636 Ga0501044_0049636_1341_2588 413
1066 3300049824 Ga0501045_0040673 Ga0501045_0040673_391_1653 413
1067 3300050492 nmdc:mga0yw44_1089_c1 nmdc:mga0yw44_1089_c1_6366_7607 413
1068 3300050494 nmdc:mga06z11_9135_c1 nmdc:mga06z11_9135_c1_552_1820 413
1069 3300050507 nmdc:mga05p37_12654_c1 nmdc:mga05p37_12654_c1_189_1466 413
1070 3300050507 nmdc:mga05p37_35_c1 nmdc:mga05p37_35_c1_103640_104881 413
1071 3300050508 nmdc:mga09592_127507_c1 nmdc:mga09592_127507_c1_330_1607 413
1072 3300050508 nmdc:mga09592_4780_c1 nmdc:mga09592_4780_c1_197_1438 413
1073 3300050509 nmdc:mga0qj67_14976_c1 nmdc:mga0qj67_14976_c1_1441_2682 413
1074 3300050509 nmdc:mga0qj67_16122_c1 nmdc:mga0qj67_16122_c1_1722_2963 413
1075 3300050509 nmdc:mga0qj67_7319_c1 nmdc:mga0qj67_7319_c1_5880_7157 413
1076 3300050510 nmdc:mga06r32_27981_c1 nmdc:mga06r32_27981_c1_3710_4987 413
1077 3300050510 nmdc:mga06r32_774_c1 nmdc:mga06r32_774_c1_3213_4454 413
1078 3300050511 nmdc:mga08y16_356_c1 nmdc:mga08y16_356_c1_32112_33353 413
1079 3300050511 nmdc:mga08y16_42596_c1 nmdc:mga08y16_42596_c1_1366_2607 413
1080 3300050512 nmdc:mga0n895_16080_c1 nmdc:mga0n895_16080_c1_701_1978 413
1081 3300050512 nmdc:mga0n895_2421_c1 nmdc:mga0n895_2421_c1_4573_5814 413
1082 3300050512 nmdc:mga0n895_46489_c1 nmdc:mga0n895_46489_c1_461_1702 413
1083 3300050512 nmdc:mga0n895_725_c1 nmdc:mga0n895_725_c1_2574_3815 413
1084 3300050513 nmdc:mga0rr50_11637_c1 nmdc:mga0rr50_11637_c1_1001_2242 413
1085 3300050513 nmdc:mga0rr50_26607_c2 nmdc:mga0rr50_26607_c2_332_1573 413
1086 3300050515 nmdc:mga0a205_400_c1 nmdc:mga0a205_400_c1_18164_19405 413
1087 3300050515 nmdc:mga0a205_91_c2 nmdc:mga0a205_91_c2_5304_6572 413
1088 3300053077 Ga0495601_0000081 Ga0495601_0000081_25449_26690 413
1089 3300053077 Ga0495601_0015420 Ga0495601_0015420_2726_3967 413
1090 3300053077 Ga0495601_0035667 Ga0495601_0035667_1079_2362 413
1091 3300053077 Ga0495601_0045615 Ga0495601_0045615_975_2249 413
1092 3300053077 Ga0495601_0072671 Ga0495601_0072671_883_2124 413
1093 3300053077 Ga0495601_0108030 Ga0495601_0108030_373_1614 413
1094 3300053078 Ga0495612_0000315 Ga0495612_0000315_7495_8736 413
1095 3300053078 Ga0495612_0008832 Ga0495612_0008832_1198_2475 413
1096 3300053078 Ga0495612_0014269 Ga0495612_0014269_947_2188 413
1097 3300053078 Ga0495612_0034735 Ga0495612_0034735_152_1393 413
1098 3300053084 Ga0495595_0001073 Ga0495595_0001073_7774_9051 413
1099 3300053084 Ga0495595_0004290 Ga0495595_0004290_3283_4524 413
1100 3300053084 Ga0495595_0004961 Ga0495595_0004961_295_1536 413
1101 3300053084 Ga0495595_0007889 Ga0495595_0007889_679_1920 413
1102 3300053084 Ga0495595_0009362 Ga0495595_0009362_2720_3997 413
1103 3300053085 Ga0495619_0000270 Ga0495619_0000270_17817_19100 413
1104 3300053085 Ga0495619_0001648 Ga0495619_0001648_6339_7601 413
1105 3300053085 Ga0495619_0001786 Ga0495619_0001786_3727_4968 413
1106 3300053085 Ga0495619_0001885 Ga0495619_0001885_12143_13384 413
1107 3300053085 Ga0495619_0004104 Ga0495619_0004104_2607_3848 413
1108 3300053085 Ga0495619_0034874 Ga0495619_0034874_79_1335 413
1109 3300053085 Ga0495619_0064373 Ga0495619_0064373_251_1492 413
1110 3300053087 Ga0500643_001479 Ga0500643_001479_7580_8821 413
1111 3300053093 Ga0500651_0035480 Ga0500651_0035480_1357_2598 413
1112 3300053096 Ga0500641_0048570 Ga0500641_0048570_113_1408 413
1113 3300053119 Ga0500595_000055 Ga0500595_000055_58926_60167 413
1114 3300053131 Ga0500652_010527 Ga0500652_010527_557_1798 413
1115 3300053153 Ga0500616_0000001 Ga0500616_0000001_141785_143026 413
1116 3300053730 Ga0500645_000216 Ga0500645_000216_35453_36694 413
1117 3300054114 Ga0501084_0116472 Ga0501084_0116472_757_1998 413
1118 3300060353 Ga0501082_0025039 Ga0501082_0025039_1619_2860 413
1119 3300060353 Ga0501082_0116059 Ga0501082_0116059_346_1608 413
1120 3300061734 Ga0530510_0053318 Ga0530510_0053318_858_2099 413

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00291

PALP

Pyridoxal-phosphate dependent enzyme

107

412

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2c2b-assembly2.cif.gz_C crystallographic structure of arabidopsis thaliana threonine synthase complexed with pyridoxal phosphate and s-adenosylmethionine 0.9323 14 390
6cgq-assembly1.cif.gz_B-2 threonine synthase from bacillus subtilis atcc 6633 with plp and plp-ala 0.9268 65 392
6cgq-assembly1.cif.gz_A threonine synthase from bacillus subtilis atcc 6633 with plp and plp-ala 0.9263 69 390
2zsj-assembly2.cif.gz_D crystal structure of threonine synthase from aquifex aeolicus vf5 0.9201 64 390
2zsj-assembly2.cif.gz_C crystal structure of threonine synthase from aquifex aeolicus vf5 0.9175 64 390
ID Description Score Start End Superfamily
4d9gB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9422 138 212 3.40.50.1100
af_A0A1D6M0B0_306_515_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9411 228 390 3.40.50.1100
af_Q9SSP5_269_516_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9221 194 390 3.40.50.1100
af_O43061_57_367_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9157 161 188 3.90.550.10
1pwhA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9125 136 213 3.40.50.1100
ID Description Score Start End GO Terms
AF-A0A535BMY9-F1-model_v4 Pyridoxal-phosphate dependent enzyme 0.9934 230 336
AF-A0A2V5Q374-F1-model_v4 Threonine synthase 0.9859 132 329 GO:0003941
GO:0004794
GO:0006565
GO:0006567
GO:0009097
AF-A0A3N5QL49-F1-model_v4 Threonine synthase (EC 4.2.3.1) 0.9853 13 343 GO:0003941
GO:0004794
GO:0004795
GO:0006565
GO:0006567
GO:0009097
GO:0030170
AF-A0A2U3D9E5-F1-model_v4 Threonine synthase 0.9839 11 390 GO:0003941
GO:0004794
GO:0006565
GO:0006567
GO:0009097
AF-A0A3N5TSH5-F1-model_v4 deleted 0.9828 195 390

Feature Viewer

pLDDT pTM Quality
93.41 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map