F490383
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1120 | 431 | 1115 | 411 |
Family's Representative Sequence
| Representative Sequence | 3300013104|Ga0157370_10027127|Ga0157370_100271272 |
| Length | 437 |
| Sequence | MGEFDRVGRENFLQNAPNEQEGGDMRFDDNLSGERPSFVTHLECAMTGERHEADVVHNLSRAGKPLLVRYDLAGVKKALSKETIARRAPDLWRYRELLPVRKAADIVSLGECMTPIVPMPRLSKKLGGGDILVKDEGRLPTGSFKARGLVMAVSMAKALDIKHMAMPTNGNAGAALAAYATRAGIKTTIFCPEDTPEVNVSEIALQGADVYRVNGLIDDCGKIVGEGKAKVGWFDTSTLKEPYRIEGKKTMGLELAEQLGWDVPDAIFYPTGGGTGLIGMWKAFDELEKIGFIGSKRPRMVAVQASGCAPMVKAYEDGVEHAPRWENAHTIASGIRVPQAVGDFLILRAVRESKGFAIAVDDEAISAGLNEMAREEGFLLCPEGAATYAAYKKSLADGRVAKSDRAVLFNCASGLKYPLPKMERKLDRHQPIDYGMF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 2 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 3 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 4 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 5 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 6 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 7 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 8 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 9 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 10 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 11 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 12 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 13 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 14 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 15 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 16 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 17 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 18 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 19 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 20 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 21 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 29 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 33 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 63 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 69 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 77 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 79 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 80 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 81 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 83 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 84 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 85 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 86 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 87 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 88 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 89 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 90 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 91 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 92 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 93 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 94 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 95 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 97 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 98 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 99 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 100 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 101 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 102 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 103 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 105 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 106 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 107 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 108 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 109 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 110 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 111 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 112 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 113 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 114 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 116 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 130 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 145 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 146 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 147 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 148 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 149 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 222 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 226 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 227 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 228 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 229 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 230 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 231 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 232 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 233 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 234 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 235 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 236 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 237 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 238 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 239 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 240 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 241 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 242 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 243 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 244 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 245 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 246 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 247 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 248 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 249 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 250 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 251 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 252 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 253 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 254 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 255 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 256 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 257 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 258 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 259 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 260 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 261 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 262 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 263 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 264 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 265 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 266 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 267 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 268 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 269 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 270 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 271 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 272 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 273 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 274 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 275 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 276 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 277 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 278 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 279 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 280 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 281 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 282 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 283 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 284 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 285 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 286 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 287 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 288 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 289 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 290 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 291 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 292 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 293 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 294 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 295 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 296 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 297 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 298 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 299 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 300 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 301 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 302 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 303 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 304 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 305 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 369 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 370 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 371 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 372 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 373 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 374 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 375 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 376 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 377 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 378 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 379 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 380 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 381 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 382 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 383 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 384 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 395 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 399 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 403 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 405 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 406 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 407 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 408 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 409 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 411 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 412 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 413 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 417 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 422 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 423 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 424 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 425 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 426 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 427 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 428 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 429 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 430 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 431 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.29 |
| Metatranscriptomes | 0.27 |
| Isolates | 0.45 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.18 |
| Bulb | 0 |
| Endosphere | 1.88 |
| Nodule | 0 |
| Rhizoplane | 6.07 |
| Rhizosphere | 90.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.43 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARcpr5oldR_c000094 | 3300000041 | Bacteria | 16375 |
| 2 | ARSoilYngRDRAFT_c00429 | 3300000042 | Bacteria | 5297 |
| 3 | ARcpr5yngRDRAFT_c000310 | 3300000043 | Bacteria | 6831 |
| 4 | ARCol0oldRDRAFT_c00220 | 3300000045 | Bacteria | 5293 |
| 5 | JGI24740J21852_10001716 | 3300001979 | Bacteria | 10064 |
| 6 | JGI24740J21852_10003446 | 3300001979 | Bacteria | 6950 |
| 7 | JGI24739J22299_10000147 | 3300001989 | Bacteria | 22531 |
| 8 | JGI24739J22299_10000568 | 3300001989 | Bacteria | 13310 |
| 9 | JGI24737J22298_10000225 | 3300001990 | Bacteria | 18597 |
| 10 | JGI24737J22298_10000646 | 3300001990 | Bacteria | 12309 |
| 11 | JGI24745J21846_1000198 | 3300002073 | Bacteria | 4895 |
| 12 | JGI24738J21930_10000274 | 3300002075 | Bacteria | 14117 |
| 13 | JGI24749J21850_1000977 | 3300002076 | Bacteria | 4077 |
| 14 | JGI24744J21845_10002039 | 3300002077 | Bacteria | 4092 |
| 15 | JGI24035J26624_1000334 | 3300002126 | Bacteria | 4407 |
| 16 | JGI24035J26624_1000883 | 3300002126 | Bacteria | 2838 |
| 17 | JGI24742J22300_10000166 | 3300002244 | Bacteria | 9701 |
| 18 | JGI25165J46597_1000007 | 3300003214 | Bacteria | 518996 |
| 19 | Ga0007417J51691_1019057 | 3300003544 | Bacteria | 1570 |
| 20 | Ga0065715_10001130 | 3300005293 | Bacteria | 11867 |
| 21 | Ga0070658_10000199 | 3300005327 | Bacteria | 52822 |
| 22 | Ga0070658_10000571 | 3300005327 | Bacteria | 32039 |
| 23 | Ga0070658_10003259 | 3300005327 | Bacteria | 13402 |
| 24 | Ga0070658_10003718 | 3300005327 | Bacteria | 12480 |
| 25 | Ga0070658_10028885 | 3300005327 | Bacteria | 4452 |
| 26 | Ga0070658_10053493 | 3300005327 | Bacteria | 3277 |
| 27 | Ga0070658_10082892 | 3300005327 | Bacteria | 2635 |
| 28 | Ga0070676_10001885 | 3300005328 | Bacteria | 10659 |
| 29 | Ga0070676_10003713 | 3300005328 | Bacteria | 8000 |
| 30 | Ga0070683_100000177 | 3300005329 | Bacteria | 42316 |
| 31 | Ga0070683_100128519 | 3300005329 | Bacteria | 2397 |
| 32 | Ga0070690_100000693 | 3300005330 | Bacteria | 17271 |
| 33 | Ga0070690_100049547 | 3300005330 | Bacteria | 2678 |
| 34 | Ga0070690_100049986 | 3300005330 | Bacteria | 2667 |
| 35 | Ga0070690_100054743 | 3300005330 | Bacteria | 2554 |
| 36 | Ga0070670_100000445 | 3300005331 | Bacteria | 33591 |
| 37 | Ga0070670_100009008 | 3300005331 | Bacteria | 8527 |
| 38 | Ga0070670_100076461 | 3300005331 | Bacteria | 2876 |
| 39 | Ga0070670_100076830 | 3300005331 | Bacteria | 2869 |
| 40 | Ga0070677_10000012 | 3300005333 | Bacteria | 55279 |
| 41 | Ga0068869_100000008 | 3300005334 | Bacteria | 78682 |
| 42 | Ga0068869_100000057 | 3300005334 | Bacteria | 49267 |
| 43 | Ga0068869_100079904 | 3300005334 | Bacteria | 2438 |
| 44 | Ga0070666_10012332 | 3300005335 | Bacteria | 5387 |
| 45 | Ga0070666_10015494 | 3300005335 | Bacteria | 4864 |
| 46 | Ga0070666_10043038 | 3300005335 | Bacteria | 3022 |
| 47 | Ga0070680_100004044 | 3300005336 | Bacteria | 10969 |
| 48 | Ga0070680_100013240 | 3300005336 | Bacteria | 6421 |
| 49 | Ga0070680_100016591 | 3300005336 | Bacteria | 5795 |
| 50 | Ga0070680_100040597 | 3300005336 | Bacteria | 3769 |
| 51 | Ga0070682_100000132 | 3300005337 | Bacteria | 62330 |
| 52 | Ga0070682_100080940 | 3300005337 | Bacteria | 2101 |
| 53 | Ga0068868_100000231 | 3300005338 | Bacteria | 38013 |
| 54 | Ga0068868_100000705 | 3300005338 | Bacteria | 22464 |
| 55 | Ga0068868_100002032 | 3300005338 | Bacteria | 13916 |
| 56 | Ga0068868_100042434 | 3300005338 | Bacteria | 3550 |
| 57 | Ga0070660_100002696 | 3300005339 | Bacteria | 12199 |
| 58 | Ga0070660_100003369 | 3300005339 | Bacteria | 10993 |
| 59 | Ga0070660_100005299 | 3300005339 | Bacteria | 8925 |
| 60 | Ga0070660_100042224 | 3300005339 | Bacteria | 3480 |
| 61 | Ga0070689_100001829 | 3300005340 | Bacteria | 13703 |
| 62 | Ga0070689_100004446 | 3300005340 | Bacteria | 9474 |
| 63 | Ga0070691_10001308 | 3300005341 | Bacteria | 10575 |
| 64 | Ga0070691_10027579 | 3300005341 | Bacteria | 2650 |
| 65 | Ga0070687_100000446 | 3300005343 | Bacteria | 13890 |
| 66 | Ga0070687_100008694 | 3300005343 | Bacteria | 4312 |
| 67 | Ga0070687_100015318 | 3300005343 | Bacteria | 3464 |
| 68 | Ga0070661_100000107 | 3300005344 | Bacteria | 68766 |
| 69 | Ga0070661_100033954 | 3300005344 | Bacteria | 3699 |
| 70 | Ga0070661_100049720 | 3300005344 | Bacteria | 3069 |
| 71 | Ga0070692_10000375 | 3300005345 | Bacteria | 13192 |
| 72 | Ga0070692_10000543 | 3300005345 | Bacteria | 11731 |
| 73 | Ga0070692_10003256 | 3300005345 | Bacteria | 6545 |
| 74 | Ga0070692_10013333 | 3300005345 | Bacteria | 3828 |
| 75 | Ga0070692_10120110 | 3300005345 | Bacteria | 1465 |
| 76 | Ga0070668_100000419 | 3300005347 | Bacteria | 28126 |
| 77 | Ga0070668_100077950 | 3300005347 | Bacteria | 2590 |
| 78 | Ga0070669_100000916 | 3300005353 | Bacteria | 21441 |
| 79 | Ga0070669_100002478 | 3300005353 | Bacteria | 13371 |
| 80 | Ga0070669_100035118 | 3300005353 | Bacteria | 3631 |
| 81 | Ga0070669_100070854 | 3300005353 | Bacteria | 2577 |
| 82 | Ga0070675_100000032 | 3300005354 | Bacteria | 97014 |
| 83 | Ga0070675_100002803 | 3300005354 | Bacteria | 13129 |
| 84 | Ga0070675_100004652 | 3300005354 | Bacteria | 10479 |
| 85 | Ga0070675_100008496 | 3300005354 | Bacteria | 7971 |
| 86 | Ga0070675_100382113 | 3300005354 | Bacteria | 1254 |
| 87 | Ga0070671_100000519 | 3300005355 | Bacteria | 27074 |
| 88 | Ga0070671_100000865 | 3300005355 | Bacteria | 22124 |
| 89 | Ga0070671_100003872 | 3300005355 | Bacteria | 11766 |
| 90 | Ga0070671_100005241 | 3300005355 | Bacteria | 10331 |
| 91 | Ga0070671_100010172 | 3300005355 | Bacteria | 7550 |
| 92 | Ga0070674_100000288 | 3300005356 | Bacteria | 24683 |
| 93 | Ga0070674_100251547 | 3300005356 | Bacteria | 1388 |
| 94 | Ga0070673_100000024 | 3300005364 | Bacteria | 75170 |
| 95 | Ga0070673_100000696 | 3300005364 | Bacteria | 18523 |
| 96 | Ga0070673_100024738 | 3300005364 | Bacteria | 4407 |
| 97 | Ga0070673_100042154 | 3300005364 | Bacteria | 3517 |
| 98 | Ga0070688_100000281 | 3300005365 | Bacteria | 26161 |
| 99 | Ga0070688_100014752 | 3300005365 | Bacteria | 4432 |
| 100 | Ga0070659_100000238 | 3300005366 | Bacteria | 42955 |
| 101 | Ga0070659_100000240 | 3300005366 | Bacteria | 42863 |
| 102 | Ga0070659_100003410 | 3300005366 | Bacteria | 11327 |
| 103 | Ga0070659_100024132 | 3300005366 | Bacteria | 4661 |
| 104 | Ga0070659_100024978 | 3300005366 | Bacteria | 4585 |
| 105 | Ga0070659_100040446 | 3300005366 | Bacteria | 3643 |
| 106 | Ga0070659_100074082 | 3300005366 | Bacteria | 2712 |
| 107 | Ga0070659_100080097 | 3300005366 | Bacteria | 2607 |
| 108 | Ga0070667_100000994 | 3300005367 | Bacteria | 26033 |
| 109 | Ga0070667_100001628 | 3300005367 | Bacteria | 20106 |
| 110 | Ga0070667_100005520 | 3300005367 | Bacteria | 10562 |
| 111 | Ga0070667_100035728 | 3300005367 | Bacteria | 4164 |
| 112 | Ga0070667_100180535 | 3300005367 | Bacteria | 1866 |
| 113 | Ga0070703_10002021 | 3300005406 | Bacteria | 5935 |
| 114 | Ga0070709_10002849 | 3300005434 | Bacteria | 9349 |
| 115 | Ga0070709_10065813 | 3300005434 | Bacteria | 2322 |
| 116 | Ga0070714_100010583 | 3300005435 | Bacteria | 7296 |
| 117 | Ga0070714_100020397 | 3300005435 | Bacteria | 5412 |
| 118 | Ga0070714_100044663 | 3300005435 | Bacteria | 3752 |
| 119 | Ga0070714_100157313 | 3300005435 | Bacteria | 2053 |
| 120 | Ga0070714_100158649 | 3300005435 | Bacteria | 2045 |
| 121 | Ga0070713_100016386 | 3300005436 | Bacteria | 5572 |
| 122 | Ga0070713_100037000 | 3300005436 | Bacteria | 3943 |
| 123 | Ga0070713_100061529 | 3300005436 | Bacteria | 3141 |
| 124 | Ga0070710_10003252 | 3300005437 | Bacteria | 7701 |
| 125 | Ga0070710_10014787 | 3300005437 | Bacteria | 3933 |
| 126 | Ga0070710_10015872 | 3300005437 | Bacteria | 3821 |
| 127 | Ga0070710_10039820 | 3300005437 | Bacteria | 2587 |
| 128 | Ga0070701_10009447 | 3300005438 | Bacteria | 4272 |
| 129 | Ga0070701_10039755 | 3300005438 | Bacteria | 2388 |
| 130 | Ga0070711_100002902 | 3300005439 | Bacteria | 9883 |
| 131 | Ga0070711_100008446 | 3300005439 | Bacteria | 6307 |
| 132 | Ga0070711_100106117 | 3300005439 | Bacteria | 2053 |
| 133 | Ga0070711_100110803 | 3300005439 | Bacteria | 2014 |
| 134 | Ga0070705_100027305 | 3300005440 | Bacteria | 3116 |
| 135 | Ga0070705_100084445 | 3300005440 | Bacteria | 1959 |
| 136 | Ga0070700_100000615 | 3300005441 | Bacteria | 17714 |
| 137 | Ga0070700_100031506 | 3300005441 | Bacteria | 3178 |
| 138 | Ga0070694_100000181 | 3300005444 | Bacteria | 32956 |
| 139 | Ga0070694_100000250 | 3300005444 | Bacteria | 28411 |
| 140 | Ga0070694_100005598 | 3300005444 | Bacteria | 7614 |
| 141 | Ga0070694_100073258 | 3300005444 | Bacteria | 2365 |
| 142 | Ga0070663_100009797 | 3300005455 | Bacteria | 5951 |
| 143 | Ga0070663_100079443 | 3300005455 | Bacteria | 2407 |
| 144 | Ga0070663_100082816 | 3300005455 | Bacteria | 2361 |
| 145 | Ga0070663_100101441 | 3300005455 | Bacteria | 2148 |
| 146 | Ga0070678_100000211 | 3300005456 | Bacteria | 26054 |
| 147 | Ga0070678_100003017 | 3300005456 | Bacteria | 9328 |
| 148 | Ga0070662_100000268 | 3300005457 | Bacteria | 30569 |
| 149 | Ga0070662_100006788 | 3300005457 | Bacteria | 7400 |
| 150 | Ga0070662_100007668 | 3300005457 | Bacteria | 7001 |
| 151 | Ga0070681_10004709 | 3300005458 | Bacteria | 13058 |
| 152 | Ga0070681_10022513 | 3300005458 | Bacteria | 6328 |
| 153 | Ga0070681_10188923 | 3300005458 | Bacteria | 1980 |
| 154 | Ga0068867_100000660 | 3300005459 | Bacteria | 22843 |
| 155 | Ga0068867_100001143 | 3300005459 | Bacteria | 18134 |
| 156 | Ga0070685_10001436 | 3300005466 | Bacteria | 12497 |
| 157 | Ga0070685_10031604 | 3300005466 | Bacteria | 2959 |
| 158 | Ga0070699_100002292 | 3300005518 | Bacteria | 17217 |
| 159 | Ga0070679_100000352 | 3300005530 | Bacteria | 39151 |
| 160 | Ga0070679_100056192 | 3300005530 | Bacteria | 3922 |
| 161 | Ga0070679_100061622 | 3300005530 | Bacteria | 3739 |
| 162 | Ga0070679_100128118 | 3300005530 | Bacteria | 2520 |
| 163 | Ga0070679_100153310 | 3300005530 | Bacteria | 2280 |
| 164 | Ga0070684_100000022 | 3300005535 | Bacteria | 128353 |
| 165 | Ga0070684_100059496 | 3300005535 | Bacteria | 3340 |
| 166 | Ga0070697_100115247 | 3300005536 | Bacteria | 2243 |
| 167 | Ga0068853_100003212 | 3300005539 | Bacteria | 12490 |
| 168 | Ga0068853_100006604 | 3300005539 | Bacteria | 9237 |
| 169 | Ga0068853_100117866 | 3300005539 | Bacteria | 2365 |
| 170 | Ga0070672_100000226 | 3300005543 | Bacteria | 31423 |
| 171 | Ga0070672_100000401 | 3300005543 | Bacteria | 25012 |
| 172 | Ga0070672_100003438 | 3300005543 | Bacteria | 10257 |
| 173 | Ga0070672_100010268 | 3300005543 | Bacteria | 6491 |
| 174 | Ga0070672_100114508 | 3300005543 | Bacteria | 2201 |
| 175 | Ga0070672_100197903 | 3300005543 | Bacteria | 1680 |
| 176 | Ga0070686_100000336 | 3300005544 | Bacteria | 30396 |
| 177 | Ga0070686_100000395 | 3300005544 | Bacteria | 27599 |
| 178 | Ga0070686_100020030 | 3300005544 | Bacteria | 3954 |
| 179 | Ga0070686_100051814 | 3300005544 | Bacteria | 2614 |
| 180 | Ga0070695_100000242 | 3300005545 | Bacteria | 27098 |
| 181 | Ga0070695_100031056 | 3300005545 | Bacteria | 3328 |
| 182 | Ga0070696_100000885 | 3300005546 | Bacteria | 19400 |
| 183 | Ga0070696_100004160 | 3300005546 | Bacteria | 9637 |
| 184 | Ga0070696_100017360 | 3300005546 | Bacteria | 4857 |
| 185 | Ga0070693_100000428 | 3300005547 | Bacteria | 19004 |
| 186 | Ga0070693_100002630 | 3300005547 | Bacteria | 8268 |
| 187 | Ga0070665_100026013 | 3300005548 | Bacteria | 5895 |
| 188 | Ga0070665_100052989 | 3300005548 | Bacteria | 4069 |
| 189 | Ga0070665_100060381 | 3300005548 | Bacteria | 3800 |
| 190 | Ga0070665_100071224 | 3300005548 | Bacteria | 3483 |
| 191 | Ga0070704_100001996 | 3300005549 | Bacteria | 11301 |
| 192 | Ga0070704_100004811 | 3300005549 | Bacteria | 7822 |
| 193 | Ga0070704_100007538 | 3300005549 | Bacteria | 6479 |
| 194 | Ga0068855_100000129 | 3300005563 | Bacteria | 96519 |
| 195 | Ga0068855_100004217 | 3300005563 | Bacteria | 17547 |
| 196 | Ga0068855_100005134 | 3300005563 | Bacteria | 15967 |
| 197 | Ga0068855_100032137 | 3300005563 | Bacteria | 6266 |
| 198 | Ga0070664_100000248 | 3300005564 | Bacteria | 38923 |
| 199 | Ga0070664_100001618 | 3300005564 | Bacteria | 18025 |
| 200 | Ga0070664_100009369 | 3300005564 | Bacteria | 7940 |
| 201 | Ga0070664_100018098 | 3300005564 | Bacteria | 5784 |
| 202 | Ga0070664_100094009 | 3300005564 | Bacteria | 2599 |
| 203 | Ga0070664_100141972 | 3300005564 | Bacteria | 2115 |
| 204 | Ga0068857_100000393 | 3300005577 | Bacteria | 30712 |
| 205 | Ga0068857_100008676 | 3300005577 | Bacteria | 8796 |
| 206 | Ga0068857_100124372 | 3300005577 | Bacteria | 2324 |
| 207 | Ga0068857_100174739 | 3300005577 | Bacteria | 1953 |
| 208 | Ga0068857_100342704 | 3300005577 | Bacteria | 1383 |
| 209 | Ga0068854_100000210 | 3300005578 | Bacteria | 39202 |
| 210 | Ga0068854_100000806 | 3300005578 | Bacteria | 18679 |
| 211 | Ga0068854_100095380 | 3300005578 | Bacteria | 2221 |
| 212 | Ga0068856_100000990 | 3300005614 | Bacteria | 30328 |
| 213 | Ga0068856_100054786 | 3300005614 | Bacteria | 3935 |
| 214 | Ga0070702_100000029 | 3300005615 | Bacteria | 39388 |
| 215 | Ga0070702_100091057 | 3300005615 | Bacteria | 1850 |
| 216 | Ga0068852_100000628 | 3300005616 | Bacteria | 23079 |
| 217 | Ga0068852_100004350 | 3300005616 | Bacteria | 10000 |
| 218 | Ga0068852_100029528 | 3300005616 | Bacteria | 4506 |
| 219 | Ga0068852_100096276 | 3300005616 | Bacteria | 2660 |
| 220 | Ga0068852_100112314 | 3300005616 | Bacteria | 2479 |
| 221 | Ga0068859_100002192 | 3300005617 | Bacteria | 19839 |
| 222 | Ga0068859_100002303 | 3300005617 | Bacteria | 19397 |
| 223 | Ga0068859_100006115 | 3300005617 | Bacteria | 12227 |
| 224 | Ga0068859_100015921 | 3300005617 | Bacteria | 7558 |
| 225 | Ga0068859_100132287 | 3300005617 | Bacteria | 2566 |
| 226 | Ga0068859_100179115 | 3300005617 | Bacteria | 2202 |
| 227 | Ga0068864_100000338 | 3300005618 | Bacteria | 41280 |
| 228 | Ga0068864_100000492 | 3300005618 | Bacteria | 34166 |
| 229 | Ga0068864_100013256 | 3300005618 | Bacteria | 6828 |
| 230 | Ga0068864_100015515 | 3300005618 | Bacteria | 6334 |
| 231 | Ga0068866_10000179 | 3300005718 | Bacteria | 29712 |
| 232 | Ga0068861_100000140 | 3300005719 | Bacteria | 36794 |
| 233 | Ga0068861_100001124 | 3300005719 | Bacteria | 16598 |
| 234 | Ga0068861_100009236 | 3300005719 | Bacteria | 6803 |
| 235 | Ga0068861_100025604 | 3300005719 | Bacteria | 4280 |
| 236 | Ga0068861_100040904 | 3300005719 | Bacteria | 3469 |
| 237 | Ga0068861_100123253 | 3300005719 | Bacteria | 2094 |
| 238 | Ga0068851_10005731 | 3300005834 | Bacteria | 5651 |
| 239 | Ga0068851_10009297 | 3300005834 | Bacteria | 4563 |
| 240 | Ga0068870_10000001 | 3300005840 | Bacteria | 97513 |
| 241 | Ga0068870_10036649 | 3300005840 | Bacteria | 2524 |
| 242 | Ga0068863_100000246 | 3300005841 | Bacteria | 57714 |
| 243 | Ga0068863_100000409 | 3300005841 | Bacteria | 43632 |
| 244 | Ga0068863_100018899 | 3300005841 | Bacteria | 6594 |
| 245 | Ga0068863_100089977 | 3300005841 | Bacteria | 2910 |
| 246 | Ga0068858_100000897 | 3300005842 | Bacteria | 30873 |
| 247 | Ga0068858_100001644 | 3300005842 | Bacteria | 22821 |
| 248 | Ga0068858_100004175 | 3300005842 | Bacteria | 14217 |
| 249 | Ga0068858_100008307 | 3300005842 | Bacteria | 9983 |
| 250 | Ga0068860_100001266 | 3300005843 | Bacteria | 27606 |
| 251 | Ga0068860_100010676 | 3300005843 | Bacteria | 9070 |
| 252 | Ga0068860_100014184 | 3300005843 | Bacteria | 7812 |
| 253 | Ga0068860_100014402 | 3300005843 | Bacteria | 7748 |
| 254 | Ga0068860_100046274 | 3300005843 | Bacteria | 4148 |
| 255 | Ga0068862_100001531 | 3300005844 | Bacteria | 21154 |
| 256 | Ga0068862_100001891 | 3300005844 | Bacteria | 18987 |
| 257 | Ga0068862_100034983 | 3300005844 | Bacteria | 4252 |
| 258 | Ga0068862_100070033 | 3300005844 | Bacteria | 3028 |
| 259 | Ga0068862_100137749 | 3300005844 | Bacteria | 2164 |
| 260 | Ga0081455_10007245 | 3300005937 | Bacteria | 11708 |
| 261 | Ga0081455_10027309 | 3300005937 | Bacteria | 5232 |
| 262 | Ga0081455_10062384 | 3300005937 | Bacteria | 3133 |
| 263 | Ga0081539_10016110 | 3300005985 | Bacteria | 5369 |
| 264 | Ga0070717_10000215 | 3300006028 | Bacteria | 40202 |
| 265 | Ga0070717_10041913 | 3300006028 | Bacteria | 3733 |
| 266 | Ga0070717_10043671 | 3300006028 | Bacteria | 3659 |
| 267 | Ga0075365_10002820 | 3300006038 | Bacteria | 8708 |
| 268 | Ga0075365_10173359 | 3300006038 | Bacteria | 1506 |
| 269 | Ga0075368_10015431 | 3300006042 | Bacteria | 2834 |
| 270 | Ga0075363_100154618 | 3300006048 | Bacteria | 1296 |
| 271 | Ga0075364_10129279 | 3300006051 | Bacteria | 1694 |
| 272 | Ga0075432_10002730 | 3300006058 | Bacteria | 5899 |
| 273 | Ga0070716_100000605 | 3300006173 | Bacteria | 15148 |
| 274 | Ga0070716_100073071 | 3300006173 | Bacteria | 2022 |
| 275 | Ga0070712_100005387 | 3300006175 | Bacteria | 7920 |
| 276 | Ga0070712_100015217 | 3300006175 | Bacteria | 4948 |
| 277 | Ga0070712_100023430 | 3300006175 | Bacteria | 4079 |
| 278 | Ga0070712_100032573 | 3300006175 | Bacteria | 3520 |
| 279 | Ga0097621_100001299 | 3300006237 | Bacteria | 17186 |
| 280 | Ga0097621_100059032 | 3300006237 | Bacteria | 3140 |
| 281 | Ga0097621_100073302 | 3300006237 | Bacteria | 2834 |
| 282 | Ga0097621_100089756 | 3300006237 | Bacteria | 2570 |
| 283 | Ga0075370_10033860 | 3300006353 | Bacteria | 2862 |
| 284 | Ga0068871_100000007 | 3300006358 | Bacteria | 115829 |
| 285 | Ga0068871_100071392 | 3300006358 | Bacteria | 2856 |
| 286 | Ga0075428_100016903 | 3300006844 | Bacteria | 8057 |
| 287 | Ga0075428_100035713 | 3300006844 | Bacteria | 5478 |
| 288 | Ga0075428_100043146 | 3300006844 | Bacteria | 4959 |
| 289 | Ga0075430_100000128 | 3300006846 | Bacteria | 47770 |
| 290 | Ga0075430_100020523 | 3300006846 | Bacteria | 5620 |
| 291 | Ga0075431_100000557 | 3300006847 | Bacteria | 31397 |
| 292 | Ga0075431_100011821 | 3300006847 | Bacteria | 8809 |
| 293 | Ga0075433_10000103 | 3300006852 | Bacteria | 41320 |
| 294 | Ga0075433_10032108 | 3300006852 | Bacteria | 4494 |
| 295 | Ga0075434_100003002 | 3300006871 | Bacteria | 15007 |
| 296 | Ga0075434_100005851 | 3300006871 | Bacteria | 11231 |
| 297 | Ga0075434_100090618 | 3300006871 | Bacteria | 3059 |
| 298 | Ga0075429_100004986 | 3300006880 | Bacteria | 11434 |
| 299 | Ga0075429_100014311 | 3300006880 | Bacteria | 6881 |
| 300 | Ga0068865_100000091 | 3300006881 | Bacteria | 47674 |
| 301 | Ga0068865_100000947 | 3300006881 | Bacteria | 16504 |
| 302 | Ga0068865_100067561 | 3300006881 | Bacteria | 2525 |
| 303 | Ga0075436_100141693 | 3300006914 | Bacteria | 1690 |
| 304 | Ga0097620_100002192 | 3300006931 | Bacteria | 19839 |
| 305 | Ga0097620_100002303 | 3300006931 | Bacteria | 19397 |
| 306 | Ga0097620_100006115 | 3300006931 | Bacteria | 12227 |
| 307 | Ga0097620_100015921 | 3300006931 | Bacteria | 7558 |
| 308 | Ga0097620_100132286 | 3300006931 | Bacteria | 2566 |
| 309 | Ga0097620_100179116 | 3300006931 | Bacteria | 2202 |
| 310 | Ga0075435_100050157 | 3300007076 | Bacteria | 3358 |
| 311 | Ga0075435_100052637 | 3300007076 | Bacteria | 3281 |
| 312 | Ga0111539_10000265 | 3300009094 | Bacteria | 62336 |
| 313 | Ga0111539_10003594 | 3300009094 | Bacteria | 20438 |
| 314 | Ga0111539_10006865 | 3300009094 | Bacteria | 14627 |
| 315 | Ga0111539_10179216 | 3300009094 | Bacteria | 2475 |
| 316 | Ga0105245_10000187 | 3300009098 | Bacteria | 58607 |
| 317 | Ga0105245_10003932 | 3300009098 | Bacteria | 13216 |
| 318 | Ga0105245_10053267 | 3300009098 | Bacteria | 3631 |
| 319 | Ga0105247_10003235 | 3300009101 | Bacteria | 10717 |
| 320 | Ga0105247_10047964 | 3300009101 | Bacteria | 2624 |
| 321 | Ga0114129_10037638 | 3300009147 | Bacteria | 6830 |
| 322 | Ga0105243_10001870 | 3300009148 | Bacteria | 17965 |
| 323 | Ga0105243_10024775 | 3300009148 | Bacteria | 4580 |
| 324 | Ga0105243_10061475 | 3300009148 | Bacteria | 3004 |
| 325 | Ga0105243_10075117 | 3300009148 | Bacteria | 2742 |
| 326 | Ga0105241_10000958 | 3300009174 | Bacteria | 21825 |
| 327 | Ga0105242_10000633 | 3300009176 | Bacteria | 27598 |
| 328 | Ga0105248_10001205 | 3300009177 | Bacteria | 28902 |
| 329 | Ga0105248_10002490 | 3300009177 | Bacteria | 20477 |
| 330 | Ga0105248_10010094 | 3300009177 | Bacteria | 10400 |
| 331 | Ga0105248_10091898 | 3300009177 | Bacteria | 3418 |
| 332 | Ga0105248_10110580 | 3300009177 | Bacteria | 3098 |
| 333 | Ga0105237_10002942 | 3300009545 | Bacteria | 20619 |
| 334 | Ga0105238_10001421 | 3300009551 | Bacteria | 23984 |
| 335 | Ga0105238_10090689 | 3300009551 | Bacteria | 3044 |
| 336 | Ga0105238_10093032 | 3300009551 | Bacteria | 3003 |
| 337 | Ga0105238_10204990 | 3300009551 | Bacteria | 1948 |
| 338 | Ga0105238_10396989 | 3300009551 | Bacteria | 1372 |
| 339 | Ga0105249_10000564 | 3300009553 | Bacteria | 34176 |
| 340 | Ga0105249_10007631 | 3300009553 | Bacteria | 9434 |
| 341 | Ga0105249_10027715 | 3300009553 | Bacteria | 5112 |
| 342 | Ga0105239_10003234 | 3300010375 | Bacteria | 20124 |
| 343 | Ga0105239_10227438 | 3300010375 | Bacteria | 2093 |
| 344 | Ga0105246_10000316 | 3300011119 | Bacteria | 25627 |
| 345 | Ga0157335_1000272 | 3300012492 | Bacteria | 2250 |
| 346 | Ga0157371_10003004 | 3300013102 | Bacteria | 15667 |
| 347 | Ga0157371_10008818 | 3300013102 | Bacteria | 7987 |
| 348 | Ga0157371_10024995 | 3300013102 | Bacteria | 4358 |
| 349 | Ga0157371_10030452 | 3300013102 | Bacteria | 3893 |
| 350 | Ga0157370_10027127 | 3300013104 | Bacteria | 5648 |
| 351 | Ga0157370_10033382 | 3300013104 | Bacteria | 5018 |
| 352 | Ga0157370_10075953 | 3300013104 | Bacteria | 3166 |
| 353 | Ga0157370_10189456 | 3300013104 | Bacteria | 1909 |
| 354 | Ga0157369_10001231 | 3300013105 | Bacteria | 31905 |
| 355 | Ga0157369_10164746 | 3300013105 | Bacteria | 2339 |
| 356 | Ga0157374_10053572 | 3300013296 | Bacteria | 3761 |
| 357 | Ga0157374_10066905 | 3300013296 | Bacteria | 3377 |
| 358 | Ga0157374_10241691 | 3300013296 | Bacteria | 1775 |
| 359 | Ga0157378_10000417 | 3300013297 | Bacteria | 41934 |
| 360 | Ga0157378_10001984 | 3300013297 | Bacteria | 18313 |
| 361 | Ga0157378_10035180 | 3300013297 | Bacteria | 4429 |
| 362 | Ga0163162_10002975 | 3300013306 | Bacteria | 16181 |
| 363 | Ga0163162_10011395 | 3300013306 | Bacteria | 8669 |
| 364 | Ga0163162_10030784 | 3300013306 | Bacteria | 5318 |
| 365 | Ga0157372_10165227 | 3300013307 | Bacteria | 2559 |
| 366 | Ga0157375_10000430 | 3300013308 | Bacteria | 37838 |
| 367 | Ga0157375_10024976 | 3300013308 | Bacteria | 5541 |
| 368 | Ga0157375_10067479 | 3300013308 | Bacteria | 3574 |
| 369 | Ga0157375_10084835 | 3300013308 | Bacteria | 3216 |
| 370 | Ga0163163_10119598 | 3300014325 | Bacteria | 2667 |
| 371 | Ga0157380_10000203 | 3300014326 | Bacteria | 35045 |
| 372 | Ga0157380_10204499 | 3300014326 | Bacteria | 1754 |
| 373 | Ga0157377_10000290 | 3300014745 | Bacteria | 23959 |
| 374 | Ga0157377_10014739 | 3300014745 | Bacteria | 3984 |
| 375 | Ga0157379_10003225 | 3300014968 | Bacteria | 13816 |
| 376 | Ga0157379_10033973 | 3300014968 | Bacteria | 4546 |
| 377 | Ga0157376_10000104 | 3300014969 | Bacteria | 61530 |
| 378 | Ga0157376_10034976 | 3300014969 | Bacteria | 4060 |
| 379 | Ga0157376_10086330 | 3300014969 | Bacteria | 2705 |
| 380 | Ga0163161_10000724 | 3300017792 | Bacteria | 25964 |
| 381 | Ga0163161_10066684 | 3300017792 | Bacteria | 2629 |
| 382 | Ga0206354_10333486 | 3300020081 | Bacteria | 2769 |
| 383 | Ga0206353_10140861 | 3300020082 | Bacteria | 6359 |
| 384 | Ga0213874_10003678 | 3300021377 | Bacteria | 3429 |
| 385 | Ga0213876_10001649 | 3300021384 | Bacteria | 13615 |
| 386 | Ga0213876_10017509 | 3300021384 | Bacteria | 3783 |
| 387 | Ga0213875_10005756 | 3300021388 | Bacteria | 6600 |
| 388 | Ga0209233_1000026 | 3300025261 | Bacteria | 678466 |
| 389 | Ga0209233_1005712 | 3300025261 | Bacteria | 4102 |
| 390 | Ga0207666_1000008 | 3300025271 | Bacteria | 49296 |
| 391 | Ga0209455_1007486 | 3300025272 | Bacteria | 3076 |
| 392 | Ga0207673_1000195 | 3300025290 | Bacteria | 6076 |
| 393 | Ga0207697_10000093 | 3300025315 | Bacteria | 40647 |
| 394 | Ga0207697_10000972 | 3300025315 | Bacteria | 16118 |
| 395 | Ga0207656_10006616 | 3300025321 | Bacteria | 4181 |
| 396 | Ga0207653_10000374 | 3300025885 | Bacteria | 20974 |
| 397 | Ga0207653_10029472 | 3300025885 | Bacteria | 1768 |
| 398 | Ga0207682_10000002 | 3300025893 | Bacteria | 132580 |
| 399 | Ga0207682_10054763 | 3300025893 | Bacteria | 1658 |
| 400 | Ga0207692_10033347 | 3300025898 | Bacteria | 2483 |
| 401 | Ga0207642_10000064 | 3300025899 | Bacteria | 29771 |
| 402 | Ga0207710_10015153 | 3300025900 | Bacteria | 3256 |
| 403 | Ga0207710_10031104 | 3300025900 | Bacteria | 2332 |
| 404 | Ga0207688_10000061 | 3300025901 | Bacteria | 39296 |
| 405 | Ga0207688_10000850 | 3300025901 | Bacteria | 15383 |
| 406 | Ga0207688_10136516 | 3300025901 | Bacteria | 1441 |
| 407 | Ga0207680_10014546 | 3300025903 | Bacteria | 4077 |
| 408 | Ga0207680_10018129 | 3300025903 | Bacteria | 3735 |
| 409 | Ga0207680_10145866 | 3300025903 | Bacteria | 1573 |
| 410 | Ga0207680_10153937 | 3300025903 | Bacteria | 1535 |
| 411 | Ga0207647_10000393 | 3300025904 | Bacteria | 35865 |
| 412 | Ga0207647_10002907 | 3300025904 | Bacteria | 12898 |
| 413 | Ga0207647_10013938 | 3300025904 | Bacteria | 5563 |
| 414 | Ga0207647_10043767 | 3300025904 | Bacteria | 2799 |
| 415 | Ga0207699_10005831 | 3300025906 | Bacteria | 5928 |
| 416 | Ga0207699_10023468 | 3300025906 | Bacteria | 3357 |
| 417 | Ga0207699_10025362 | 3300025906 | Bacteria | 3253 |
| 418 | Ga0207645_10000026 | 3300025907 | Bacteria | 97025 |
| 419 | Ga0207645_10003852 | 3300025907 | Bacteria | 11225 |
| 420 | Ga0207643_10000090 | 3300025908 | Bacteria | 60972 |
| 421 | Ga0207643_10006777 | 3300025908 | Bacteria | 6146 |
| 422 | Ga0207705_10000002 | 3300025909 | Bacteria | 2046852 |
| 423 | Ga0207705_10000091 | 3300025909 | Bacteria | 110768 |
| 424 | Ga0207705_10001555 | 3300025909 | Bacteria | 18213 |
| 425 | Ga0207705_10006449 | 3300025909 | Bacteria | 8691 |
| 426 | Ga0207705_10011264 | 3300025909 | Bacteria | 6481 |
| 427 | Ga0207705_10024056 | 3300025909 | Bacteria | 4346 |
| 428 | Ga0207705_10025205 | 3300025909 | Bacteria | 4246 |
| 429 | Ga0207705_10042460 | 3300025909 | Bacteria | 3264 |
| 430 | Ga0207707_10060256 | 3300025912 | Bacteria | 3302 |
| 431 | Ga0207707_10156931 | 3300025912 | Bacteria | 1990 |
| 432 | Ga0207707_10326852 | 3300025912 | Bacteria | 1323 |
| 433 | Ga0207695_10073797 | 3300025913 | Bacteria | 3475 |
| 434 | Ga0207671_10031527 | 3300025914 | Bacteria | 3950 |
| 435 | Ga0207693_10006780 | 3300025915 | Bacteria | 9456 |
| 436 | Ga0207693_10007813 | 3300025915 | Bacteria | 8779 |
| 437 | Ga0207693_10014507 | 3300025915 | Bacteria | 6333 |
| 438 | Ga0207693_10016177 | 3300025915 | Bacteria | 5966 |
| 439 | Ga0207693_10020815 | 3300025915 | Bacteria | 5216 |
| 440 | Ga0207693_10030868 | 3300025915 | Bacteria | 4233 |
| 441 | Ga0207693_10035663 | 3300025915 | Bacteria | 3921 |
| 442 | Ga0207663_10021669 | 3300025916 | Bacteria | 3662 |
| 443 | Ga0207660_10000374 | 3300025917 | Bacteria | 29233 |
| 444 | Ga0207660_10030691 | 3300025917 | Bacteria | 3695 |
| 445 | Ga0207660_10053001 | 3300025917 | Bacteria | 2890 |
| 446 | Ga0207662_10000244 | 3300025918 | Bacteria | 25094 |
| 447 | Ga0207662_10000473 | 3300025918 | Bacteria | 17944 |
| 448 | Ga0207662_10001021 | 3300025918 | Bacteria | 13119 |
| 449 | Ga0207657_10000092 | 3300025919 | Bacteria | 85665 |
| 450 | Ga0207657_10001122 | 3300025919 | Bacteria | 28419 |
| 451 | Ga0207657_10001644 | 3300025919 | Bacteria | 24105 |
| 452 | Ga0207657_10003953 | 3300025919 | Bacteria | 15731 |
| 453 | Ga0207657_10008488 | 3300025919 | Bacteria | 10421 |
| 454 | Ga0207657_10030980 | 3300025919 | Bacteria | 4849 |
| 455 | Ga0207657_10097515 | 3300025919 | Bacteria | 2444 |
| 456 | Ga0207657_10124392 | 3300025919 | Bacteria | 2119 |
| 457 | Ga0207649_10000143 | 3300025920 | Bacteria | 59962 |
| 458 | Ga0207649_10049398 | 3300025920 | Bacteria | 2598 |
| 459 | Ga0207652_10003863 | 3300025921 | Bacteria | 12271 |
| 460 | Ga0207652_10031422 | 3300025921 | Bacteria | 4460 |
| 461 | Ga0207681_10000457 | 3300025923 | Bacteria | 28651 |
| 462 | Ga0207681_10001615 | 3300025923 | Bacteria | 14537 |
| 463 | Ga0207681_10118699 | 3300025923 | Bacteria | 1936 |
| 464 | Ga0207694_10001995 | 3300025924 | Bacteria | 16888 |
| 465 | Ga0207694_10030859 | 3300025924 | Bacteria | 4092 |
| 466 | Ga0207694_10053905 | 3300025924 | Bacteria | 3119 |
| 467 | Ga0207694_10066479 | 3300025924 | Bacteria | 2813 |
| 468 | Ga0207650_10004633 | 3300025925 | Bacteria | 9404 |
| 469 | Ga0207650_10010118 | 3300025925 | Bacteria | 6463 |
| 470 | Ga0207650_10081524 | 3300025925 | Bacteria | 2454 |
| 471 | Ga0207650_10257962 | 3300025925 | Bacteria | 1413 |
| 472 | Ga0207659_10000015 | 3300025926 | Bacteria | 168475 |
| 473 | Ga0207659_10015849 | 3300025926 | Bacteria | 4896 |
| 474 | Ga0207659_10048394 | 3300025926 | Bacteria | 3011 |
| 475 | Ga0207687_10000543 | 3300025927 | Bacteria | 25288 |
| 476 | Ga0207687_10003367 | 3300025927 | Bacteria | 10796 |
| 477 | Ga0207687_10019356 | 3300025927 | Bacteria | 4510 |
| 478 | Ga0207700_10012884 | 3300025928 | Bacteria | 5411 |
| 479 | Ga0207700_10057915 | 3300025928 | Bacteria | 2924 |
| 480 | Ga0207700_10130082 | 3300025928 | Bacteria | 2054 |
| 481 | Ga0207664_10021035 | 3300025929 | Bacteria | 4843 |
| 482 | Ga0207664_10117024 | 3300025929 | Bacteria | 2224 |
| 483 | Ga0207644_10000463 | 3300025931 | Bacteria | 26317 |
| 484 | Ga0207644_10007001 | 3300025931 | Bacteria | 7344 |
| 485 | Ga0207644_10012135 | 3300025931 | Bacteria | 5716 |
| 486 | Ga0207644_10024447 | 3300025931 | Bacteria | 4147 |
| 487 | Ga0207644_10073760 | 3300025931 | Bacteria | 2503 |
| 488 | Ga0207644_10092329 | 3300025931 | Bacteria | 2258 |
| 489 | Ga0207644_10148990 | 3300025931 | Bacteria | 1809 |
| 490 | Ga0207690_10000397 | 3300025932 | Bacteria | 28759 |
| 491 | Ga0207690_10001140 | 3300025932 | Bacteria | 16917 |
| 492 | Ga0207690_10006879 | 3300025932 | Bacteria | 6745 |
| 493 | Ga0207690_10018172 | 3300025932 | Bacteria | 4309 |
| 494 | Ga0207690_10061933 | 3300025932 | Bacteria | 2545 |
| 495 | Ga0207706_10000185 | 3300025933 | Bacteria | 69659 |
| 496 | Ga0207706_10001387 | 3300025933 | Bacteria | 24176 |
| 497 | Ga0207706_10008224 | 3300025933 | Bacteria | 9624 |
| 498 | Ga0207706_10010598 | 3300025933 | Bacteria | 8419 |
| 499 | Ga0207706_10010688 | 3300025933 | Bacteria | 8385 |
| 500 | Ga0207706_10010902 | 3300025933 | Bacteria | 8295 |
| 501 | Ga0207706_10017204 | 3300025933 | Bacteria | 6517 |
| 502 | Ga0207706_10028751 | 3300025933 | Bacteria | 4962 |
| 503 | Ga0207706_10126787 | 3300025933 | Bacteria | 2245 |
| 504 | Ga0207686_10000065 | 3300025934 | Bacteria | 95366 |
| 505 | Ga0207686_10019330 | 3300025934 | Bacteria | 3872 |
| 506 | Ga0207686_10027500 | 3300025934 | Bacteria | 3332 |
| 507 | Ga0207709_10000081 | 3300025935 | Bacteria | 164427 |
| 508 | Ga0207709_10002863 | 3300025935 | Bacteria | 10567 |
| 509 | Ga0207670_10000056 | 3300025936 | Bacteria | 84496 |
| 510 | Ga0207670_10009248 | 3300025936 | Bacteria | 5611 |
| 511 | Ga0207670_10025321 | 3300025936 | Bacteria | 3723 |
| 512 | Ga0207670_10032470 | 3300025936 | Bacteria | 3358 |
| 513 | Ga0207669_10000008 | 3300025937 | Bacteria | 168213 |
| 514 | Ga0207704_10000031 | 3300025938 | Bacteria | 111710 |
| 515 | Ga0207704_10002888 | 3300025938 | Bacteria | 7772 |
| 516 | Ga0207704_10012582 | 3300025938 | Bacteria | 4204 |
| 517 | Ga0207704_10018925 | 3300025938 | Bacteria | 3606 |
| 518 | Ga0207665_10107454 | 3300025939 | Bacteria | 1956 |
| 519 | Ga0207691_10000114 | 3300025940 | Bacteria | 72745 |
| 520 | Ga0207691_10001398 | 3300025940 | Bacteria | 24158 |
| 521 | Ga0207691_10002093 | 3300025940 | Bacteria | 19499 |
| 522 | Ga0207691_10003704 | 3300025940 | Bacteria | 14824 |
| 523 | Ga0207691_10015203 | 3300025940 | Bacteria | 7323 |
| 524 | Ga0207711_10000784 | 3300025941 | Bacteria | 31210 |
| 525 | Ga0207711_10001138 | 3300025941 | Bacteria | 25380 |
| 526 | Ga0207711_10031680 | 3300025941 | Bacteria | 4465 |
| 527 | Ga0207711_10067676 | 3300025941 | Bacteria | 3092 |
| 528 | Ga0207711_10076645 | 3300025941 | Bacteria | 2912 |
| 529 | Ga0207689_10000014 | 3300025942 | Bacteria | 122534 |
| 530 | Ga0207689_10000772 | 3300025942 | Bacteria | 30699 |
| 531 | Ga0207689_10002348 | 3300025942 | Bacteria | 17690 |
| 532 | Ga0207689_10018494 | 3300025942 | Bacteria | 5880 |
| 533 | Ga0207689_10071406 | 3300025942 | Bacteria | 2851 |
| 534 | Ga0207689_10215997 | 3300025942 | Bacteria | 1585 |
| 535 | Ga0207661_10000255 | 3300025944 | Bacteria | 34585 |
| 536 | Ga0207661_10109985 | 3300025944 | Bacteria | 2329 |
| 537 | Ga0207661_10299682 | 3300025944 | Bacteria | 1441 |
| 538 | Ga0207679_10000014 | 3300025945 | Bacteria | 275841 |
| 539 | Ga0207679_10008134 | 3300025945 | Bacteria | 6672 |
| 540 | Ga0207679_10013763 | 3300025945 | Bacteria | 5306 |
| 541 | Ga0207679_10017311 | 3300025945 | Bacteria | 4805 |
| 542 | Ga0207679_10095038 | 3300025945 | Bacteria | 2316 |
| 543 | Ga0207679_10133870 | 3300025945 | Bacteria | 1993 |
| 544 | Ga0207679_10153391 | 3300025945 | Bacteria | 1878 |
| 545 | Ga0207667_10001226 | 3300025949 | Bacteria | 32150 |
| 546 | Ga0207667_10010693 | 3300025949 | Bacteria | 10710 |
| 547 | Ga0207667_10030878 | 3300025949 | Bacteria | 5790 |
| 548 | Ga0207667_10039605 | 3300025949 | Bacteria | 5022 |
| 549 | Ga0207651_10000055 | 3300025960 | Bacteria | 49506 |
| 550 | Ga0207651_10000396 | 3300025960 | Bacteria | 18460 |
| 551 | Ga0207651_10077553 | 3300025960 | Bacteria | 2379 |
| 552 | Ga0207651_10093902 | 3300025960 | Bacteria | 2204 |
| 553 | Ga0207651_10259870 | 3300025960 | Bacteria | 1425 |
| 554 | Ga0207712_10002119 | 3300025961 | Bacteria | 12977 |
| 555 | Ga0207712_10002532 | 3300025961 | Bacteria | 11749 |
| 556 | Ga0207712_10033210 | 3300025961 | Bacteria | 3487 |
| 557 | Ga0207712_10040509 | 3300025961 | Bacteria | 3198 |
| 558 | Ga0207712_10071181 | 3300025961 | Bacteria | 2500 |
| 559 | Ga0207668_10000037 | 3300025972 | Bacteria | 115995 |
| 560 | Ga0207668_10026112 | 3300025972 | Bacteria | 3788 |
| 561 | Ga0207668_10050698 | 3300025972 | Bacteria | 2862 |
| 562 | Ga0207640_10001137 | 3300025981 | Bacteria | 14601 |
| 563 | Ga0207640_10003009 | 3300025981 | Bacteria | 9065 |
| 564 | Ga0207640_10068763 | 3300025981 | Bacteria | 2375 |
| 565 | Ga0207658_10002855 | 3300025986 | Bacteria | 12369 |
| 566 | Ga0207658_10005866 | 3300025986 | Bacteria | 8399 |
| 567 | Ga0207658_10018209 | 3300025986 | Bacteria | 4846 |
| 568 | Ga0207677_10000363 | 3300026023 | Bacteria | 31847 |
| 569 | Ga0207677_10017614 | 3300026023 | Bacteria | 4265 |
| 570 | Ga0207677_10246966 | 3300026023 | Bacteria | 1447 |
| 571 | Ga0207703_10000483 | 3300026035 | Bacteria | 41615 |
| 572 | Ga0207703_10000858 | 3300026035 | Bacteria | 29827 |
| 573 | Ga0207703_10001589 | 3300026035 | Bacteria | 20561 |
| 574 | Ga0207703_10033233 | 3300026035 | Bacteria | 4087 |
| 575 | Ga0207639_10000767 | 3300026041 | Bacteria | 21905 |
| 576 | Ga0207639_10000903 | 3300026041 | Bacteria | 20098 |
| 577 | Ga0207678_10000372 | 3300026067 | Bacteria | 40922 |
| 578 | Ga0207678_10014392 | 3300026067 | Bacteria | 6956 |
| 579 | Ga0207678_10069749 | 3300026067 | Bacteria | 3014 |
| 580 | Ga0207678_10078943 | 3300026067 | Bacteria | 2819 |
| 581 | Ga0207708_10000460 | 3300026075 | Bacteria | 31639 |
| 582 | Ga0207708_10001478 | 3300026075 | Bacteria | 17560 |
| 583 | Ga0207708_10002409 | 3300026075 | Bacteria | 13725 |
| 584 | Ga0207708_10089575 | 3300026075 | Bacteria | 2371 |
| 585 | Ga0207702_10001048 | 3300026078 | Bacteria | 28323 |
| 586 | Ga0207702_10070691 | 3300026078 | Bacteria | 3003 |
| 587 | Ga0207641_10001563 | 3300026088 | Bacteria | 22380 |
| 588 | Ga0207641_10002957 | 3300026088 | Bacteria | 15368 |
| 589 | Ga0207641_10007922 | 3300026088 | Bacteria | 8811 |
| 590 | Ga0207641_10057553 | 3300026088 | Bacteria | 3306 |
| 591 | Ga0207648_10001536 | 3300026089 | Bacteria | 25412 |
| 592 | Ga0207648_10002021 | 3300026089 | Bacteria | 22147 |
| 593 | Ga0207648_10004845 | 3300026089 | Bacteria | 13728 |
| 594 | Ga0207676_10000483 | 3300026095 | Bacteria | 33535 |
| 595 | Ga0207676_10002489 | 3300026095 | Bacteria | 13118 |
| 596 | Ga0207676_10006265 | 3300026095 | Bacteria | 8398 |
| 597 | Ga0207676_10012844 | 3300026095 | Bacteria | 6013 |
| 598 | Ga0207674_10002391 | 3300026116 | Bacteria | 23726 |
| 599 | Ga0207674_10003948 | 3300026116 | Bacteria | 18040 |
| 600 | Ga0207674_10012453 | 3300026116 | Bacteria | 9505 |
| 601 | Ga0207674_10028442 | 3300026116 | Bacteria | 5900 |
| 602 | Ga0207674_10176694 | 3300026116 | Bacteria | 2087 |
| 603 | Ga0207675_100000231 | 3300026118 | Bacteria | 52812 |
| 604 | Ga0207675_100000264 | 3300026118 | Bacteria | 49823 |
| 605 | Ga0207675_100007144 | 3300026118 | Bacteria | 10554 |
| 606 | Ga0207675_100011322 | 3300026118 | Bacteria | 8349 |
| 607 | Ga0207675_100039730 | 3300026118 | Bacteria | 4391 |
| 608 | Ga0207675_100150405 | 3300026118 | Bacteria | 2215 |
| 609 | Ga0207683_10000002 | 3300026121 | Bacteria | 258441 |
| 610 | Ga0207683_10006794 | 3300026121 | Bacteria | 9796 |
| 611 | Ga0207683_10020956 | 3300026121 | Bacteria | 5595 |
| 612 | Ga0207683_10023336 | 3300026121 | Bacteria | 5321 |
| 613 | Ga0207683_10036600 | 3300026121 | Bacteria | 4275 |
| 614 | Ga0207683_10245217 | 3300026121 | Bacteria | 1634 |
| 615 | Ga0207698_10001676 | 3300026142 | Bacteria | 12913 |
| 616 | Ga0207698_10009377 | 3300026142 | Bacteria | 6239 |
| 617 | Ga0207698_10018583 | 3300026142 | Bacteria | 4740 |
| 618 | Ga0207698_10056437 | 3300026142 | Bacteria | 3033 |
| 619 | Ga0207698_10146935 | 3300026142 | Bacteria | 2040 |
| 620 | Ga0210002_1000756 | 3300027617 | Bacteria | 4385 |
| 621 | Ga0209966_1000521 | 3300027695 | Bacteria | 9898 |
| 622 | Ga0209998_10002232 | 3300027717 | Bacteria | 4488 |
| 623 | Ga0209998_10006254 | 3300027717 | Bacteria | 2473 |
| 624 | Ga0209974_10001820 | 3300027876 | Bacteria | 7777 |
| 625 | Ga0207428_10000011 | 3300027907 | Bacteria | 354388 |
| 626 | Ga0207428_10000046 | 3300027907 | Bacteria | 191032 |
| 627 | Ga0207428_10000058 | 3300027907 | Bacteria | 158579 |
| 628 | Ga0207428_10002321 | 3300027907 | Bacteria | 19048 |
| 629 | Ga0268266_10008645 | 3300028379 | Bacteria | 9040 |
| 630 | Ga0268266_10041930 | 3300028379 | Bacteria | 3907 |
| 631 | Ga0268266_10045085 | 3300028379 | Bacteria | 3771 |
| 632 | Ga0268266_10146264 | 3300028379 | Bacteria | 2125 |
| 633 | Ga0268266_10153726 | 3300028379 | Bacteria | 2076 |
| 634 | Ga0268266_10161494 | 3300028379 | Bacteria | 2027 |
| 635 | Ga0268266_10252219 | 3300028379 | Bacteria | 1632 |
| 636 | Ga0268265_10000117 | 3300028380 | Bacteria | 99955 |
| 637 | Ga0268265_10003608 | 3300028380 | Bacteria | 11049 |
| 638 | Ga0268265_10043471 | 3300028380 | Bacteria | 3340 |
| 639 | Ga0268265_10308277 | 3300028380 | Bacteria | 1428 |
| 640 | Ga0268264_10000487 | 3300028381 | Bacteria | 52821 |
| 641 | Ga0268264_10001467 | 3300028381 | Bacteria | 22033 |
| 642 | Ga0268264_10008522 | 3300028381 | Bacteria | 8521 |
| 643 | Ga0268264_10086083 | 3300028381 | Bacteria | 2699 |
| 644 | Ga0265330_10017416 | 3300031235 | Bacteria | 3309 |
| 645 | Ga0265330_10048501 | 3300031235 | Bacteria | 1867 |
| 646 | Ga0265325_10000062 | 3300031241 | Bacteria | 74697 |
| 647 | Ga0265325_10003451 | 3300031241 | Bacteria | 10314 |
| 648 | Ga0265340_10007678 | 3300031247 | Bacteria | 5849 |
| 649 | Ga0265331_10005011 | 3300031250 | Bacteria | 8120 |
| 650 | Ga0265316_10095710 | 3300031344 | Bacteria | 2261 |
| 651 | Ga0265316_10209046 | 3300031344 | Bacteria | 1444 |
| 652 | Ga0307509_10087436 | 3300031507 | Bacteria | 3202 |
| 653 | Ga0265313_10000524 | 3300031595 | Bacteria | 40120 |
| 654 | Ga0265313_10047917 | 3300031595 | Bacteria | 2065 |
| 655 | Ga0307508_10003330 | 3300031616 | Bacteria | 16325 |
| 656 | Ga0265314_10000419 | 3300031711 | Bacteria | 57263 |
| 657 | Ga0265314_10008641 | 3300031711 | Bacteria | 8712 |
| 658 | Ga0265342_10000256 | 3300031712 | Bacteria | 59799 |
| 659 | Ga0265342_10056280 | 3300031712 | Bacteria | 2331 |
| 660 | Ga0307405_10020655 | 3300031731 | Bacteria | 3684 |
| 661 | Ga0307405_10127102 | 3300031731 | Bacteria | 1754 |
| 662 | Ga0307413_10003015 | 3300031824 | Bacteria | 6993 |
| 663 | Ga0307413_10005295 | 3300031824 | Bacteria | 5737 |
| 664 | Ga0307413_10103932 | 3300031824 | Bacteria | 1885 |
| 665 | Ga0307413_10222493 | 3300031824 | Bacteria | 1380 |
| 666 | Ga0307410_10002760 | 3300031852 | Bacteria | 8586 |
| 667 | Ga0307410_10006820 | 3300031852 | Bacteria | 6200 |
| 668 | Ga0307410_10046452 | 3300031852 | Bacteria | 2896 |
| 669 | Ga0307410_10084197 | 3300031852 | Bacteria | 2241 |
| 670 | Ga0307406_10016842 | 3300031901 | Bacteria | 4252 |
| 671 | Ga0307406_10125060 | 3300031901 | Bacteria | 1795 |
| 672 | Ga0307407_10003274 | 3300031903 | Bacteria | 6601 |
| 673 | Ga0307407_10053886 | 3300031903 | Bacteria | 2316 |
| 674 | Ga0307407_10111753 | 3300031903 | Bacteria | 1716 |
| 675 | Ga0307412_10029585 | 3300031911 | Bacteria | 3440 |
| 676 | Ga0307412_10046214 | 3300031911 | Bacteria | 2851 |
| 677 | Ga0307412_10080182 | 3300031911 | Bacteria | 2254 |
| 678 | Ga0307412_10123349 | 3300031911 | Bacteria | 1869 |
| 679 | Ga0307409_100000453 | 3300031995 | Bacteria | 17394 |
| 680 | Ga0307409_100008366 | 3300031995 | Bacteria | 6273 |
| 681 | Ga0307409_100043973 | 3300031995 | Bacteria | 3359 |
| 682 | Ga0307409_100083805 | 3300031995 | Bacteria | 2586 |
| 683 | Ga0307409_100086027 | 3300031995 | Bacteria | 2557 |
| 684 | Ga0307416_100053277 | 3300032002 | Bacteria | 3245 |
| 685 | Ga0307416_100053613 | 3300032002 | Bacteria | 3236 |
| 686 | Ga0307416_100138845 | 3300032002 | Bacteria | 2205 |
| 687 | Ga0307414_10015188 | 3300032004 | Bacteria | 4642 |
| 688 | Ga0307414_10106385 | 3300032004 | Bacteria | 2123 |
| 689 | Ga0307414_10167317 | 3300032004 | Bacteria | 1753 |
| 690 | Ga0307411_10004056 | 3300032005 | Bacteria | 6935 |
| 691 | Ga0307411_10004217 | 3300032005 | Bacteria | 6838 |
| 692 | Ga0307411_10040280 | 3300032005 | Bacteria | 2962 |
| 693 | Ga0307411_10076722 | 3300032005 | Bacteria | 2285 |
| 694 | Ga0307411_10176369 | 3300032005 | Bacteria | 1617 |
| 695 | Ga0307415_100000325 | 3300032126 | Bacteria | 20671 |
| 696 | Ga0307415_100026145 | 3300032126 | Bacteria | 3677 |
| 697 | Ga0307415_100045372 | 3300032126 | Bacteria | 2946 |
| 698 | Ga0307415_100047261 | 3300032126 | Bacteria | 2896 |
| 699 | Ga0307415_100066483 | 3300032126 | Bacteria | 2516 |
| 700 | Ga0373930_0000298 | 3300034816 | Bacteria | 6405 |
| 701 | Ga0373948_0000018 | 3300034817 | Bacteria | 21496 |
| 702 | Ga0373948_0008122 | 3300034817 | Bacteria | 1781 |
| 703 | Ga0373959_0001867 | 3300034820 | Bacteria | 3362 |
| 704 | Ga0373959_0002399 | 3300034820 | Bacteria | 2984 |
| 705 | Ga0373938_0002615 | 3300034957 | Bacteria | 2905 |
| 706 | Ga0373926_0001552 | 3300035083 | Bacteria | 7052 |
| 707 | Ga0373928_0002316 | 3300035084 | Bacteria | 3700 |
| 708 | Ga0373928_0004518 | 3300035084 | Bacteria | 2652 |
| 709 | Ga0373929_0008373 | 3300035085 | Bacteria | 1905 |
| 710 | Ga0373934_0002917 | 3300035086 | Bacteria | 6259 |
| 711 | Ga0373940_0000354 | 3300035088 | Bacteria | 6866 |
| 712 | Ga0373944_0005358 | 3300035089 | Bacteria | 3376 |
| 713 | Ga0373949_0000408 | 3300035090 | Bacteria | 14959 |
| 714 | Ga0373949_0004126 | 3300035090 | Bacteria | 3360 |
| 715 | Ga0373951_0003513 | 3300035091 | Bacteria | 3790 |
| 716 | Ga0373952_0000056 | 3300035092 | Bacteria | 14099 |
| 717 | Ga0373952_0000964 | 3300035092 | Bacteria | 5223 |
| 718 | Ga0373923_0005076 | 3300035111 | Bacteria | 4438 |
| 719 | Ga0373932_0000734 | 3300035112 | Bacteria | 9858 |
| 720 | Ga0373932_0001197 | 3300035112 | Bacteria | 7423 |
| 721 | Ga0373932_0013506 | 3300035112 | Bacteria | 2033 |
| 722 | Ga0373936_0008301 | 3300035113 | Bacteria | 3906 |
| 723 | Ga0373939_0000559 | 3300035114 | Bacteria | 9296 |
| 724 | Ga0373941_0000709 | 3300035115 | Bacteria | 6833 |
| 725 | Ga0373945_0003571 | 3300035116 | Bacteria | 4896 |
| 726 | Ga0373945_0009489 | 3300035116 | Bacteria | 3189 |
| 727 | Ga0373953_0006521 | 3300035117 | Bacteria | 3851 |
| 728 | Ga0373953_0023897 | 3300035117 | Bacteria | 2318 |
| 729 | Ga0373954_0003029 | 3300035118 | Bacteria | 7090 |
| 730 | Ga0373954_0004278 | 3300035118 | Bacteria | 6134 |
| 731 | Ga0373954_0040237 | 3300035118 | Bacteria | 2177 |
| 732 | Ga0373956_0002599 | 3300035119 | Bacteria | 7319 |
| 733 | Ga0373956_0004206 | 3300035119 | Bacteria | 5773 |
| 734 | Ga0373956_0013448 | 3300035119 | Bacteria | 3404 |
| 735 | Ga0373957_0003413 | 3300035120 | Bacteria | 4692 |
| 736 | Ga0373960_0001479 | 3300035121 | Bacteria | 5214 |
| 737 | Ga0373960_0002840 | 3300035121 | Bacteria | 3923 |
| 738 | Ga0373943_0000352 | 3300035170 | Bacteria | 19408 |
| 739 | Ga0373943_0011002 | 3300035170 | Bacteria | 4065 |
| 740 | Ga0373943_0071472 | 3300035170 | Bacteria | 1758 |
| 741 | Ga0373946_0001249 | 3300035171 | Bacteria | 8793 |
| 742 | Ga0373946_0006482 | 3300035171 | Bacteria | 4243 |
| 743 | Ga0373946_0023711 | 3300035171 | Bacteria | 2399 |
| 744 | Ga0373942_0000491 | 3300035207 | Bacteria | 11209 |
| 745 | Ga0373942_0002258 | 3300035207 | Bacteria | 4722 |
| 746 | Ga0373961_0001829 | 3300035241 | Bacteria | 5830 |
| 747 | Ga0373961_0004217 | 3300035241 | Bacteria | 3490 |
| 748 | Ga0373962_0000574 | 3300035242 | Bacteria | 8320 |
| 749 | Ga0373931_0000087 | 3300035691 | Bacteria | 42915 |
| 750 | Ga0373935_0018763 | 3300035692 | Bacteria | 4213 |
| 751 | Ga0373927_0004615 | 3300035695 | Bacteria | 9604 |
| 752 | Ga0373927_0034470 | 3300035695 | Bacteria | 3292 |
| 753 | Ga0373933_0003625 | 3300035724 | Bacteria | 8559 |
| 754 | Ga0373933_0066951 | 3300035724 | Bacteria | 2178 |
| 755 | Ga0373947_0002498 | 3300035725 | Bacteria | 11057 |
| 756 | Ga0373947_0003411 | 3300035725 | Bacteria | 9404 |
| 757 | Ga0373947_0039873 | 3300035725 | Bacteria | 2796 |
| 758 | Ga0373947_0177609 | 3300035725 | Bacteria | 1384 |
| 759 | Ga0373937_0000851 | 3300036401 | Bacteria | 26158 |
| 760 | Ga0373937_0000862 | 3300036401 | Bacteria | 26051 |
| 761 | Ga0373937_0006835 | 3300036401 | Bacteria | 9842 |
| 762 | Ga0373937_0009142 | 3300036401 | Bacteria | 8597 |
| 763 | Ga0373937_0009393 | 3300036401 | Bacteria | 8498 |
| 764 | Ga0373937_0093118 | 3300036401 | Bacteria | 2794 |
| 765 | Ga0373937_0224279 | 3300036401 | Bacteria | 1769 |
| 766 | Ga0373925_0005584 | 3300037068 | Bacteria | 9363 |
| 767 | Ga0373925_0013965 | 3300037068 | Bacteria | 5813 |
| 768 | Ga0395899_0000132 | 3300037312 | Bacteria | 115455 |
| 769 | Ga0395899_0021386 | 3300037312 | Bacteria | 4906 |
| 770 | Ga0395899_0061738 | 3300037312 | Bacteria | 2760 |
| 771 | Ga0395900_0000359 | 3300037418 | Bacteria | 66277 |
| 772 | Ga0395900_0002893 | 3300037418 | Bacteria | 18698 |
| 773 | Ga0395900_0017741 | 3300037418 | Bacteria | 7263 |
| 774 | Ga0395900_0026333 | 3300037418 | Bacteria | 5956 |
| 775 | Ga0395900_0045160 | 3300037418 | Bacteria | 4538 |
| 776 | Ga0395900_0119293 | 3300037418 | Bacteria | 2707 |
| 777 | Ga0395900_0160060 | 3300037418 | Bacteria | 2297 |
| 778 | Ga0395900_0270156 | 3300037418 | Bacteria | 1695 |
| 779 | Ga0395898_0003726 | 3300037466 | Bacteria | 16905 |
| 780 | Ga0395898_0012491 | 3300037466 | Bacteria | 8781 |
| 781 | Ga0395898_0057320 | 3300037466 | Bacteria | 3797 |
| 782 | Ga0395898_0067291 | 3300037466 | Bacteria | 3468 |
| 783 | Ga0395905_0006676 | 3300037471 | Bacteria | 11564 |
| 784 | Ga0395905_0102372 | 3300037471 | Bacteria | 2688 |
| 785 | Ga0395905_0109263 | 3300037471 | Bacteria | 2596 |
| 786 | Ga0436364_0461445 | 3300037853 | Bacteria | 7019 |
| 787 | Ga0395901_0000275 | 3300038443 | Bacteria | 63659 |
| 788 | Ga0395901_0068130 | 3300038443 | Bacteria | 3707 |
| 789 | Ga0395901_0074904 | 3300038443 | Bacteria | 3531 |
| 790 | Ga0395901_0140635 | 3300038443 | Bacteria | 2537 |
| 791 | Ga0436365_0324214 | 3300039437 | Bacteria | 1482 |
| 792 | Ga0436365_0664268 | 3300039437 | Bacteria | 20300 |
| 793 | Ga0436365_0794411 | 3300039437 | Bacteria | 78184 |
| 794 | Ga0436365_1151519 | 3300039437 | Bacteria | 2115 |
| 795 | Ga0436360_0451948 | 3300039438 | Bacteria | 4078 |
| 796 | Ga0436360_0723710 | 3300039438 | Bacteria | 2355 |
| 797 | Ga0436363_0060576 | 3300039450 | Bacteria | 4873 |
| 798 | Ga0436363_1100437 | 3300039450 | Bacteria | 17324 |
| 799 | Ga0436363_1491361 | 3300039450 | Bacteria | 3158 |
| 800 | Ga0436363_1497978 | 3300039450 | Bacteria | 1655 |
| 801 | Ga0439448_0000630 | 3300042005 | Bacteria | 8306 |
| 802 | Ga0439449_0012796 | 3300042007 | Bacteria | 3155 |
| 803 | Ga0439455_0009233 | 3300042012 | Bacteria | 2134 |
| 804 | Ga0439458_0000029 | 3300042157 | Bacteria | 22494 |
| 805 | Ga0439435_0032346 | 3300042436 | Bacteria | 1427 |
| 806 | Ga0439460_0032422 | 3300042461 | Bacteria | 1496 |
| 807 | Ga0466966_0065097 | 3300044684 | Bacteria | 2293 |
| 808 | Ga0466961_0067381 | 3300044693 | Bacteria | 2274 |
| 809 | Ga0466963_0040007 | 3300044694 | Bacteria | 3072 |
| 810 | Ga0453684_0036104 | 3300044712 | Bacteria | 6818 |
| 811 | Ga0466957_0051056 | 3300044842 | Bacteria | 2517 |
| 812 | Ga0466959_0054770 | 3300045049 | Bacteria | 2913 |
| 813 | Ga0451576_0061573 | 3300045051 | Bacteria | 3913 |
| 814 | Ga0466967_0001672 | 3300045976 | Bacteria | 13146 |
| 815 | Ga0495592_0010297 | 3300046454 | Bacteria | 7049 |
| 816 | Ga0495592_0011377 | 3300046454 | Bacteria | 6731 |
| 817 | Ga0495592_0032282 | 3300046454 | Bacteria | 3952 |
| 818 | Ga0495592_0118130 | 3300046454 | Bacteria | 1869 |
| 819 | Ga0495629_0003086 | 3300046459 | Bacteria | 12637 |
| 820 | Ga0495638_0001274 | 3300046460 | Bacteria | 23496 |
| 821 | Ga0495641_0030804 | 3300046461 | Bacteria | 2567 |
| 822 | Ga0495651_0007457 | 3300046462 | Bacteria | 8365 |
| 823 | Ga0495651_0021404 | 3300046462 | Bacteria | 5026 |
| 824 | Ga0495651_0038247 | 3300046462 | Bacteria | 3736 |
| 825 | Ga0495653_0002676 | 3300046463 | Bacteria | 14187 |
| 826 | Ga0495653_0013738 | 3300046463 | Bacteria | 6599 |
| 827 | Ga0495653_0023498 | 3300046463 | Bacteria | 4978 |
| 828 | Ga0495580_0014862 | 3300046472 | Bacteria | 5898 |
| 829 | Ga0495580_0025839 | 3300046472 | Bacteria | 4288 |
| 830 | Ga0495580_0028983 | 3300046472 | Bacteria | 4021 |
| 831 | Ga0495582_0001834 | 3300046473 | Bacteria | 12002 |
| 832 | Ga0495605_0045697 | 3300046474 | Bacteria | 2157 |
| 833 | Ga0495639_0011034 | 3300046475 | Bacteria | 3893 |
| 834 | Ga0495639_0038415 | 3300046475 | Bacteria | 2150 |
| 835 | Ga0495662_0007015 | 3300046476 | Bacteria | 5594 |
| 836 | Ga0495662_0007266 | 3300046476 | Bacteria | 5482 |
| 837 | Ga0495662_0080640 | 3300046476 | Bacteria | 1582 |
| 838 | Ga0495664_0000398 | 3300046477 | Bacteria | 21306 |
| 839 | Ga0495664_0001582 | 3300046477 | Bacteria | 12075 |
| 840 | Ga0495584_0014313 | 3300046491 | Bacteria | 4042 |
| 841 | Ga0495584_0076113 | 3300046491 | Bacteria | 1688 |
| 842 | Ga0495584_0129666 | 3300046491 | Bacteria | 1279 |
| 843 | Ga0495585_0012227 | 3300046492 | Bacteria | 5058 |
| 844 | Ga0495585_0068626 | 3300046492 | Bacteria | 1936 |
| 845 | Ga0495608_0006901 | 3300046511 | Bacteria | 8043 |
| 846 | Ga0495608_0030439 | 3300046511 | Bacteria | 3654 |
| 847 | Ga0495616_0065451 | 3300046513 | Bacteria | 1771 |
| 848 | Ga0495618_0001798 | 3300046514 | Bacteria | 14199 |
| 849 | Ga0495618_0004894 | 3300046514 | Bacteria | 8186 |
| 850 | Ga0495628_0021800 | 3300046516 | Bacteria | 5263 |
| 851 | Ga0495628_0076649 | 3300046516 | Bacteria | 2601 |
| 852 | Ga0495628_0133533 | 3300046516 | Bacteria | 1898 |
| 853 | Ga0495630_0005356 | 3300046517 | Bacteria | 9049 |
| 854 | Ga0495631_0056938 | 3300046518 | Bacteria | 1702 |
| 855 | Ga0495632_0124590 | 3300046519 | Bacteria | 1202 |
| 856 | Ga0495637_0016284 | 3300046520 | Bacteria | 3477 |
| 857 | Ga0495663_0002965 | 3300046525 | Bacteria | 4991 |
| 858 | Ga0495666_0004260 | 3300046526 | Bacteria | 7212 |
| 859 | Ga0495666_0045386 | 3300046526 | Bacteria | 2120 |
| 860 | Ga0495652_0000531 | 3300046529 | Bacteria | 44460 |
| 861 | Ga0495652_0108200 | 3300046529 | Bacteria | 2241 |
| 862 | Ga0495665_0001228 | 3300046531 | Bacteria | 13704 |
| 863 | Ga0495665_0009811 | 3300046531 | Bacteria | 5183 |
| 864 | Ga0495665_0027512 | 3300046531 | Bacteria | 3052 |
| 865 | Ga0495665_0058379 | 3300046531 | Bacteria | 2037 |
| 866 | Ga0495640_0001922 | 3300046533 | Bacteria | 16557 |
| 867 | Ga0495640_0013247 | 3300046533 | Bacteria | 6270 |
| 868 | Ga0495640_0058291 | 3300046533 | Bacteria | 2634 |
| 869 | Ga0495586_0012528 | 3300046535 | Bacteria | 4499 |
| 870 | Ga0495586_0026452 | 3300046535 | Bacteria | 3105 |
| 871 | Ga0495586_0033699 | 3300046535 | Bacteria | 2749 |
| 872 | Ga0495587_0016396 | 3300046536 | Bacteria | 4610 |
| 873 | Ga0495587_0016549 | 3300046536 | Bacteria | 4587 |
| 874 | Ga0495587_0032503 | 3300046536 | Bacteria | 3154 |
| 875 | Ga0495587_0037736 | 3300046536 | Bacteria | 2900 |
| 876 | Ga0495587_0053294 | 3300046536 | Bacteria | 2385 |
| 877 | Ga0495598_0001181 | 3300046537 | Bacteria | 5045 |
| 878 | Ga0495621_0000388 | 3300046539 | Bacteria | 10786 |
| 879 | Ga0495621_0020185 | 3300046539 | Bacteria | 2184 |
| 880 | Ga0495645_0001513 | 3300046543 | Bacteria | 15682 |
| 881 | Ga0495645_0002097 | 3300046543 | Bacteria | 13543 |
| 882 | Ga0495645_0003462 | 3300046543 | Bacteria | 10707 |
| 883 | Ga0495622_0017216 | 3300046557 | Bacteria | 3364 |
| 884 | Ga0495622_0026865 | 3300046557 | Bacteria | 2686 |
| 885 | Ga0495633_0002898 | 3300046558 | Bacteria | 11762 |
| 886 | Ga0495633_0013739 | 3300046558 | Bacteria | 4255 |
| 887 | Ga0495633_0027931 | 3300046558 | Bacteria | 2752 |
| 888 | Ga0495667_0003336 | 3300046559 | Bacteria | 10748 |
| 889 | Ga0495667_0004207 | 3300046559 | Bacteria | 9698 |
| 890 | Ga0495667_0009091 | 3300046559 | Bacteria | 6749 |
| 891 | Ga0495667_0023502 | 3300046559 | Bacteria | 4153 |
| 892 | Ga0495656_0000729 | 3300046615 | Bacteria | 10635 |
| 893 | Ga0495656_0004585 | 3300046615 | Bacteria | 4743 |
| 894 | Ga0495668_0065159 | 3300046616 | Bacteria | 2005 |
| 895 | Ga0495634_0004091 | 3300046642 | Bacteria | 11553 |
| 896 | Ga0495634_0006411 | 3300046642 | Bacteria | 8941 |
| 897 | Ga0495635_0003726 | 3300046663 | Bacteria | 10580 |
| 898 | Ga0495635_0006571 | 3300046663 | Bacteria | 8113 |
| 899 | Ga0495635_0006850 | 3300046663 | Bacteria | 7962 |
| 900 | Ga0495659_0016235 | 3300046664 | Bacteria | 2454 |
| 901 | Ga0495659_0018915 | 3300046664 | Bacteria | 2300 |
| 902 | Ga0495661_0086829 | 3300046665 | Bacteria | 1790 |
| 903 | Ga0495588_0046617 | 3300046674 | Bacteria | 2223 |
| 904 | Ga0495657_0002845 | 3300046675 | Bacteria | 14362 |
| 905 | Ga0495657_0010336 | 3300046675 | Bacteria | 7027 |
| 906 | Ga0495657_0024564 | 3300046675 | Bacteria | 4290 |
| 907 | Ga0495599_0001644 | 3300046678 | Bacteria | 12894 |
| 908 | Ga0495599_0040862 | 3300046678 | Bacteria | 2912 |
| 909 | Ga0495599_0096207 | 3300046678 | Bacteria | 1846 |
| 910 | Ga0495623_0000187 | 3300046679 | Bacteria | 39206 |
| 911 | Ga0495647_0003806 | 3300046681 | Bacteria | 4854 |
| 912 | Ga0495647_0026338 | 3300046681 | Bacteria | 2129 |
| 913 | Ga0495658_0001330 | 3300046683 | Bacteria | 12958 |
| 914 | Ga0495669_0000269 | 3300046684 | Bacteria | 29811 |
| 915 | Ga0495669_0001684 | 3300046684 | Bacteria | 9054 |
| 916 | Ga0495669_0003175 | 3300046684 | Bacteria | 6767 |
| 917 | Ga0495669_0005515 | 3300046684 | Bacteria | 5281 |
| 918 | Ga0495669_0022078 | 3300046684 | Bacteria | 2764 |
| 919 | Ga0495613_0046701 | 3300046689 | Bacteria | 3201 |
| 920 | Ga0495624_0001710 | 3300046690 | Bacteria | 16774 |
| 921 | Ga0495624_0014147 | 3300046690 | Bacteria | 5422 |
| 922 | Ga0495670_0008346 | 3300046691 | Bacteria | 5091 |
| 923 | Ga0495670_0026936 | 3300046691 | Bacteria | 2845 |
| 924 | Ga0495589_0045992 | 3300046794 | Bacteria | 2167 |
| 925 | Ga0495600_0012966 | 3300046809 | Bacteria | 5225 |
| 926 | Ga0495600_0065394 | 3300046809 | Bacteria | 2377 |
| 927 | Ga0495581_0036727 | 3300047315 | Bacteria | 2834 |
| 928 | Ga0495604_0002167 | 3300047317 | Bacteria | 15769 |
| 929 | Ga0495604_0004215 | 3300047317 | Bacteria | 11385 |
| 930 | Ga0495674_0012504 | 3300047319 | Bacteria | 7996 |
| 931 | Ga0495676_0048198 | 3300047321 | Bacteria | 3437 |
| 932 | Ga0495680_0001596 | 3300047322 | Bacteria | 24170 |
| 933 | Ga0495680_0007052 | 3300047322 | Bacteria | 10356 |
| 934 | Ga0495680_0025820 | 3300047322 | Bacteria | 4856 |
| 935 | Ga0495680_0110221 | 3300047322 | Bacteria | 2040 |
| 936 | Ga0495675_0000781 | 3300047444 | Bacteria | 19671 |
| 937 | Ga0495675_0013134 | 3300047444 | Bacteria | 5225 |
| 938 | Ga0495684_0002371 | 3300047471 | Bacteria | 15057 |
| 939 | Ga0495684_0007415 | 3300047471 | Bacteria | 8501 |
| 940 | Ga0495684_0044558 | 3300047471 | Bacteria | 3396 |
| 941 | Ga0495684_0131914 | 3300047471 | Bacteria | 1876 |
| 942 | Ga0495684_0168033 | 3300047471 | Bacteria | 1633 |
| 943 | Ga0495593_0008885 | 3300047673 | Bacteria | 5830 |
| 944 | Ga0495593_0013963 | 3300047673 | Bacteria | 4575 |
| 945 | Ga0495593_0014466 | 3300047673 | Bacteria | 4485 |
| 946 | Ga0495593_0078618 | 3300047673 | Bacteria | 1708 |
| 947 | Ga0495602_0004816 | 3300048088 | Bacteria | 14117 |
| 948 | Ga0495602_0013239 | 3300048088 | Bacteria | 8437 |
| 949 | Ga0495602_0104729 | 3300048088 | Bacteria | 2314 |
| 950 | Ga0495602_0227881 | 3300048088 | Bacteria | 1402 |
| 951 | Ga0495614_0023802 | 3300048089 | Bacteria | 2643 |
| 952 | Ga0496100_0000283 | 3300048903 | Bacteria | 25773 |
| 953 | Ga0496100_0062330 | 3300048903 | Bacteria | 2460 |
| 954 | Ga0496101_0000434 | 3300048904 | Bacteria | 26751 |
| 955 | Ga0496101_0034822 | 3300048904 | Bacteria | 3559 |
| 956 | Ga0496102_0067010 | 3300048905 | Bacteria | 3291 |
| 957 | Ga0496102_0078004 | 3300048905 | Bacteria | 3049 |
| 958 | Ga0496102_0098203 | 3300048905 | Bacteria | 2717 |
| 959 | Ga0496102_0131327 | 3300048905 | Bacteria | 2344 |
| 960 | Ga0496103_0000686 | 3300048906 | Bacteria | 25269 |
| 961 | Ga0496103_0011234 | 3300048906 | Bacteria | 5303 |
| 962 | Ga0496103_0040115 | 3300048906 | Bacteria | 2877 |
| 963 | Ga0496104_0000273 | 3300048907 | Bacteria | 45919 |
| 964 | Ga0496104_0038056 | 3300048907 | Bacteria | 4499 |
| 965 | Ga0496104_0075907 | 3300048907 | Bacteria | 3200 |
| 966 | Ga0496104_0083230 | 3300048907 | Bacteria | 3052 |
| 967 | Ga0496104_0125327 | 3300048907 | Bacteria | 2466 |
| 968 | Ga0496104_0358508 | 3300048907 | Bacteria | 1370 |
| 969 | Ga0496105_0004529 | 3300048908 | Bacteria | 10472 |
| 970 | Ga0496105_0006140 | 3300048908 | Bacteria | 9205 |
| 971 | Ga0496105_0013298 | 3300048908 | Bacteria | 6531 |
| 972 | Ga0496105_0033860 | 3300048908 | Bacteria | 4198 |
| 973 | Ga0496105_0146919 | 3300048908 | Bacteria | 1938 |
| 974 | Ga0496106_0028030 | 3300048909 | Bacteria | 4193 |
| 975 | Ga0496106_0035075 | 3300048909 | Bacteria | 3749 |
| 976 | Ga0496106_0042232 | 3300048909 | Bacteria | 3419 |
| 977 | Ga0496106_0113553 | 3300048909 | Bacteria | 2111 |
| 978 | Ga0496107_0000297 | 3300048910 | Bacteria | 26478 |
| 979 | Ga0496107_0015675 | 3300048910 | Bacteria | 5313 |
| 980 | Ga0496107_0042340 | 3300048910 | Bacteria | 3271 |
| 981 | Ga0496107_0058895 | 3300048910 | Bacteria | 2778 |
| 982 | Ga0496108_0000614 | 3300048911 | Bacteria | 27954 |
| 983 | Ga0496108_0013337 | 3300048911 | Bacteria | 6701 |
| 984 | Ga0496108_0016150 | 3300048911 | Bacteria | 6086 |
| 985 | Ga0496108_0025961 | 3300048911 | Bacteria | 4831 |
| 986 | Ga0496108_0079761 | 3300048911 | Bacteria | 2771 |
| 987 | Ga0496108_0098184 | 3300048911 | Bacteria | 2496 |
| 988 | Ga0496108_0125325 | 3300048911 | Bacteria | 2205 |
| 989 | Ga0496109_0000296 | 3300048912 | Bacteria | 47206 |
| 990 | Ga0496109_0020129 | 3300048912 | Bacteria | 5894 |
| 991 | Ga0496109_0063918 | 3300048912 | Bacteria | 3366 |
| 992 | Ga0496109_0137891 | 3300048912 | Bacteria | 2280 |
| 993 | Ga0496109_0141381 | 3300048912 | Bacteria | 2250 |
| 994 | Ga0496109_0168800 | 3300048912 | Bacteria | 2052 |
| 995 | Ga0496110_0008408 | 3300048913 | Bacteria | 8303 |
| 996 | Ga0496110_0065699 | 3300048913 | Bacteria | 3208 |
| 997 | Ga0496110_0067933 | 3300048913 | Bacteria | 3154 |
| 998 | Ga0496110_0191999 | 3300048913 | Bacteria | 1854 |
| 999 | Ga0496111_0037785 | 3300048914 | Bacteria | 3456 |
| 1000 | Ga0496111_0060753 | 3300048914 | Bacteria | 2739 |
| 1001 | Ga0496111_0071599 | 3300048914 | Bacteria | 2523 |
| 1002 | Ga0496111_0078017 | 3300048914 | Bacteria | 2415 |
| 1003 | Ga0496112_0035364 | 3300048915 | Bacteria | 4866 |
| 1004 | Ga0496112_0087825 | 3300048915 | Bacteria | 3076 |
| 1005 | Ga0496112_0109652 | 3300048915 | Bacteria | 2730 |
| 1006 | Ga0496112_0173484 | 3300048915 | Bacteria | 2122 |
| 1007 | Ga0496112_0192343 | 3300048915 | Bacteria | 2001 |
| 1008 | Ga0496112_0243974 | 3300048915 | Bacteria | 1748 |
| 1009 | Ga0496113_0009386 | 3300048916 | Bacteria | 6415 |
| 1010 | Ga0496113_0012944 | 3300048916 | Bacteria | 5627 |
| 1011 | Ga0496113_0076618 | 3300048916 | Bacteria | 2555 |
| 1012 | Ga0496114_0001211 | 3300048917 | Bacteria | 19508 |
| 1013 | Ga0496114_0022869 | 3300048917 | Bacteria | 5095 |
| 1014 | Ga0496114_0034114 | 3300048917 | Bacteria | 4196 |
| 1015 | Ga0496115_0001319 | 3300048918 | Bacteria | 17692 |
| 1016 | Ga0496115_0034865 | 3300048918 | Bacteria | 3977 |
| 1017 | Ga0496115_0100422 | 3300048918 | Bacteria | 2372 |
| 1018 | Ga0496115_0111038 | 3300048918 | Bacteria | 2252 |
| 1019 | Ga0496115_0300754 | 3300048918 | Bacteria | 1315 |
| 1020 | Ga0501034_0004028 | 3300049571 | Bacteria | 16487 |
| 1021 | Ga0501034_0020632 | 3300049571 | Bacteria | 6730 |
| 1022 | Ga0501036_0016699 | 3300049572 | Bacteria | 6130 |
| 1023 | Ga0501036_0025862 | 3300049572 | Bacteria | 4953 |
| 1024 | Ga0501038_0031016 | 3300049574 | Bacteria | 4725 |
| 1025 | Ga0501039_0077028 | 3300049575 | Bacteria | 2593 |
| 1026 | Ga0501043_0019155 | 3300049579 | Bacteria | 5372 |
| 1027 | Ga0501043_0031259 | 3300049579 | Bacteria | 4186 |
| 1028 | Ga0501046_0018676 | 3300049580 | Bacteria | 5763 |
| 1029 | Ga0501046_0050708 | 3300049580 | Bacteria | 3278 |
| 1030 | Ga0501047_0000179 | 3300049581 | Bacteria | 77520 |
| 1031 | Ga0501047_0183702 | 3300049581 | Bacteria | 1957 |
| 1032 | Ga0501048_0002734 | 3300049582 | Bacteria | 13445 |
| 1033 | Ga0501067_0114846 | 3300049583 | Bacteria | 1497 |
| 1034 | Ga0501068_0045526 | 3300049584 | Bacteria | 2643 |
| 1035 | Ga0501069_0029347 | 3300049585 | Bacteria | 3018 |
| 1036 | Ga0501070_0011503 | 3300049586 | Bacteria | 7473 |
| 1037 | Ga0501070_0031154 | 3300049586 | Bacteria | 4468 |
| 1038 | Ga0501071_0043948 | 3300049587 | Bacteria | 3205 |
| 1039 | Ga0501071_0057739 | 3300049587 | Bacteria | 2805 |
| 1040 | Ga0501075_0049434 | 3300049591 | Bacteria | 3161 |
| 1041 | Ga0501076_0145372 | 3300049592 | Bacteria | 1928 |
| 1042 | Ga0501076_0174581 | 3300049592 | Bacteria | 1752 |
| 1043 | Ga0501077_0024109 | 3300049593 | Bacteria | 3862 |
| 1044 | Ga0501079_0199153 | 3300049741 | Bacteria | 1564 |
| 1045 | Ga0501080_0001318 | 3300049742 | Bacteria | 20663 |
| 1046 | Ga0501080_0031286 | 3300049742 | Bacteria | 4959 |
| 1047 | Ga0501080_0040847 | 3300049742 | Bacteria | 4325 |
| 1048 | Ga0501081_0000809 | 3300049743 | Bacteria | 18456 |
| 1049 | Ga0501081_0058736 | 3300049743 | Bacteria | 2662 |
| 1050 | Ga0501083_0104261 | 3300049744 | Bacteria | 1868 |
| 1051 | Ga0501035_0007682 | 3300049822 | Bacteria | 10074 |
| 1052 | Ga0501044_0005728 | 3300049823 | Bacteria | 13769 |
| 1053 | Ga0501044_0049636 | 3300049823 | Bacteria | 4331 |
| 1054 | Ga0501045_0040673 | 3300049824 | Bacteria | 3382 |
| 1055 | nmdc:mga0yw44_1089_c1 | 3300050492 | Bacteria | 10440 |
| 1056 | nmdc:mga06z11_9135_c1 | 3300050494 | Bacteria | 4163 |
| 1057 | nmdc:mga05p37_12654_c1 | 3300050507 | Bacteria | 10079 |
| 1058 | nmdc:mga05p37_35_c1 | 3300050507 | Bacteria | 110751 |
| 1059 | nmdc:mga09592_127507_c1 | 3300050508 | Bacteria | 2188 |
| 1060 | nmdc:mga09592_22512_c1 | 3300050508 | Bacteria | 5201 |
| 1061 | nmdc:mga09592_4780_c1 | 3300050508 | Bacteria | 10973 |
| 1062 | nmdc:mga0qj67_14976_c1 | 3300050509 | Bacteria | 5867 |
| 1063 | nmdc:mga0qj67_16122_c1 | 3300050509 | Bacteria | 5662 |
| 1064 | nmdc:mga0qj67_381142_c1 | 3300050509 | Bacteria | 1139 |
| 1065 | nmdc:mga0qj67_7319_c1 | 3300050509 | Bacteria | 8160 |
| 1066 | nmdc:mga06r32_27981_c1 | 3300050510 | Bacteria | 5273 |
| 1067 | nmdc:mga06r32_32011_c1 | 3300050510 | Bacteria | 4943 |
| 1068 | nmdc:mga06r32_774_c1 | 3300050510 | Bacteria | 28232 |
| 1069 | nmdc:mga08y16_356_c1 | 3300050511 | Bacteria | 41239 |
| 1070 | nmdc:mga08y16_42596_c1 | 3300050511 | Bacteria | 4755 |
| 1071 | nmdc:mga0n895_16080_c1 | 3300050512 | Bacteria | 6856 |
| 1072 | nmdc:mga0n895_2421_c1 | 3300050512 | Bacteria | 14552 |
| 1073 | nmdc:mga0n895_46489_c1 | 3300050512 | Bacteria | 4241 |
| 1074 | nmdc:mga0n895_725_c1 | 3300050512 | Bacteria | 23201 |
| 1075 | nmdc:mga0rr50_11637_c1 | 3300050513 | Bacteria | 5643 |
| 1076 | nmdc:mga0rr50_26607_c2 | 3300050513 | Bacteria | 2952 |
| 1077 | nmdc:mga0a205_400_c1 | 3300050515 | Bacteria | 33140 |
| 1078 | nmdc:mga0a205_91_c2 | 3300050515 | Bacteria | 18098 |
| 1079 | Ga0495601_0000081 | 3300053077 | Bacteria | 51417 |
| 1080 | Ga0495601_0015420 | 3300053077 | Bacteria | 4618 |
| 1081 | Ga0495601_0035667 | 3300053077 | Bacteria | 3105 |
| 1082 | Ga0495601_0045615 | 3300053077 | Bacteria | 2757 |
| 1083 | Ga0495601_0072671 | 3300053077 | Bacteria | 2197 |
| 1084 | Ga0495601_0108030 | 3300053077 | Bacteria | 1800 |
| 1085 | Ga0495601_0118715 | 3300053077 | Bacteria | 1716 |
| 1086 | Ga0495612_0000315 | 3300053078 | Bacteria | 19515 |
| 1087 | Ga0495612_0008832 | 3300053078 | Bacteria | 4084 |
| 1088 | Ga0495612_0014269 | 3300053078 | Bacteria | 3197 |
| 1089 | Ga0495612_0034735 | 3300053078 | Bacteria | 2042 |
| 1090 | Ga0495595_0001073 | 3300053084 | Bacteria | 10579 |
| 1091 | Ga0495595_0004290 | 3300053084 | Bacteria | 5735 |
| 1092 | Ga0495595_0004961 | 3300053084 | Bacteria | 5368 |
| 1093 | Ga0495595_0007889 | 3300053084 | Bacteria | 4357 |
| 1094 | Ga0495595_0009362 | 3300053084 | Bacteria | 4052 |
| 1095 | Ga0495619_0000270 | 3300053085 | Bacteria | 37699 |
| 1096 | Ga0495619_0001648 | 3300053085 | Bacteria | 14730 |
| 1097 | Ga0495619_0001786 | 3300053085 | Bacteria | 14305 |
| 1098 | Ga0495619_0001885 | 3300053085 | Bacteria | 13966 |
| 1099 | Ga0495619_0004104 | 3300053085 | Bacteria | 9322 |
| 1100 | Ga0495619_0034874 | 3300053085 | Bacteria | 3271 |
| 1101 | Ga0495619_0064373 | 3300053085 | Bacteria | 2444 |
| 1102 | Ga0495619_0269712 | 3300053085 | Bacteria | 1179 |
| 1103 | Ga0500643_001479 | 3300053087 | Bacteria | 13483 |
| 1104 | Ga0500651_0035480 | 3300053093 | Bacteria | 3143 |
| 1105 | Ga0500641_0048570 | 3300053096 | Bacteria | 1739 |
| 1106 | Ga0500595_000055 | 3300053119 | Bacteria | 84205 |
| 1107 | Ga0500652_010527 | 3300053131 | Bacteria | 3172 |
| 1108 | Ga0500658_0006831 | 3300053134 | Bacteria | 4221 |
| 1109 | Ga0500616_0000001 | 3300053153 | Bacteria | 1986011 |
| 1110 | Ga0500616_0030853 | 3300053153 | Bacteria | 2940 |
| 1111 | Ga0500645_000216 | 3300053730 | Bacteria | 43997 |
| 1112 | Ga0501084_0116472 | 3300054114 | Bacteria | 2246 |
| 1113 | Ga0501082_0025039 | 3300060353 | Bacteria | 5141 |
| 1114 | Ga0501082_0116059 | 3300060353 | Bacteria | 2319 |
| 1115 | Ga0530510_0053318 | 3300061734 | Bacteria | 2923 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005354 | Ga0070675_100382113 | Ga0070675_1003821131 | 356 |
| 2 | 3300035119 | Ga0373956_0013448 | Ga0373956_0013448_17_1096 | 359 |
| 3 | 3300046519 | Ga0495632_0124590 | Ga0495632_0124590_14_1093 | 359 |
| 4 | 3300046691 | Ga0495670_0008346 | Ga0495670_0008346_23_1102 | 359 |
| 5 | 3300050509 | nmdc:mga0qj67_381142_c1 | nmdc:mga0qj67_381142_c1_37_1128 | 363 |
| 6 | 3300039437 | Ga0436365_0324214 | Ga0436365_0324214_51_1169 | 371 |
| 7 | 3300048908 | Ga0496105_0004529 | Ga0496105_0004529_3050_4222 | 372 |
| 8 | 3300031731 | Ga0307405_10020655 | Ga0307405_100206552 | 382 |
| 9 | 3300031911 | Ga0307412_10029585 | Ga0307412_100295853 | 382 |
| 10 | 3300032126 | Ga0307415_100026145 | Ga0307415_1000261453 | 382 |
| 11 | 3300053085 | Ga0495619_0269712 | Ga0495619_0269712_14_1162 | 382 |
| 12 | 3300031903 | Ga0307407_10053886 | Ga0307407_100538861 | 384 |
| 13 | 3300032002 | Ga0307416_100138845 | Ga0307416_1001388452 | 384 |
| 14 | 3300032005 | Ga0307411_10004217 | Ga0307411_100042175 | 384 |
| 15 | 3300020081 | Ga0206354_10333486 | Ga0206354_103334862 | 385 |
| 16 | 3300020082 | Ga0206353_10140861 | Ga0206353_101408612 | 385 |
| 17 | 3300005617 | Ga0068859_100006115 | Ga0068859_1000061157 | 386 |
| 18 | 3300006931 | Ga0097620_100006115 | Ga0097620_1000061157 | 386 |
| 19 | 3300006880 | Ga0075429_100014311 | Ga0075429_1000143114 | 389 |
| 20 | 3300013296 | Ga0157374_10066905 | Ga0157374_100669053 | 389 |
| 21 | 3300031507 | Ga0307509_10087436 | Ga0307509_100874363 | 389 |
| 22 | 3300050508 | nmdc:mga09592_22512_c1 | nmdc:mga09592_22512_c1_2897_4138 | 389 |
| 23 | 3300050510 | nmdc:mga06r32_32011_c1 | nmdc:mga06r32_32011_c1_2637_3878 | 389 |
| 24 | 3300048914 | Ga0496111_0078017 | Ga0496111_0078017_521_1693 | 390 |
| 25 | 3300005344 | Ga0070661_100049720 | Ga0070661_1000497202 | 391 |
| 26 | 3300005366 | Ga0070659_100074082 | Ga0070659_1000740823 | 391 |
| 27 | 3300005547 | Ga0070693_100002630 | Ga0070693_1000026306 | 391 |
| 28 | 3300005548 | Ga0070665_100026013 | Ga0070665_1000260132 | 391 |
| 29 | 3300005564 | Ga0070664_100141972 | Ga0070664_1001419722 | 391 |
| 30 | 3300009551 | Ga0105238_10090689 | Ga0105238_100906891 | 391 |
| 31 | 3300013104 | Ga0157370_10189456 | Ga0157370_101894562 | 391 |
| 32 | 3300025920 | Ga0207649_10049398 | Ga0207649_100493981 | 391 |
| 33 | 3300025924 | Ga0207694_10066479 | Ga0207694_100664792 | 391 |
| 34 | 3300025942 | Ga0207689_10215997 | Ga0207689_102159972 | 391 |
| 35 | 3300025945 | Ga0207679_10153391 | Ga0207679_101533911 | 391 |
| 36 | 3300028379 | Ga0268266_10008645 | Ga0268266_100086453 | 391 |
| 37 | 3300028379 | Ga0268266_10252219 | Ga0268266_102522192 | 391 |
| 38 | 3300031824 | Ga0307413_10003015 | Ga0307413_100030154 | 391 |
| 39 | 3300035170 | Ga0373943_0071472 | Ga0373943_0071472_337_1512 | 391 |
| 40 | 3300037312 | Ga0395899_0061738 | Ga0395899_0061738_859_2043 | 391 |
| 41 | 3300037418 | Ga0395900_0026333 | Ga0395900_0026333_3952_5136 | 391 |
| 42 | 3300037418 | Ga0395900_0270156 | Ga0395900_0270156_112_1296 | 391 |
| 43 | 3300037466 | Ga0395898_0057320 | Ga0395898_0057320_1669_2853 | 391 |
| 44 | 3300037471 | Ga0395905_0006676 | Ga0395905_0006676_5355_6539 | 391 |
| 45 | 3300038443 | Ga0395901_0140635 | Ga0395901_0140635_1266_2450 | 391 |
| 46 | 3300001979 | JGI24740J21852_10001716 | JGI24740J21852_1000171612 | 392 |
| 47 | 3300001989 | JGI24739J22299_10000568 | JGI24739J22299_100005689 | 392 |
| 48 | 3300001990 | JGI24737J22298_10000646 | JGI24737J22298_1000064614 | 392 |
| 49 | 3300002126 | JGI24035J26624_1000883 | JGI24035J26624_10008832 | 392 |
| 50 | 3300005328 | Ga0070676_10001885 | Ga0070676_1000188511 | 392 |
| 51 | 3300005330 | Ga0070690_100049547 | Ga0070690_1000495472 | 392 |
| 52 | 3300005334 | Ga0068869_100000057 | Ga0068869_10000005713 | 392 |
| 53 | 3300005335 | Ga0070666_10015494 | Ga0070666_100154945 | 392 |
| 54 | 3300005338 | Ga0068868_100000231 | Ga0068868_10000023110 | 392 |
| 55 | 3300005339 | Ga0070660_100005299 | Ga0070660_10000529910 | 392 |
| 56 | 3300005353 | Ga0070669_100000916 | Ga0070669_10000091618 | 392 |
| 57 | 3300005354 | Ga0070675_100008496 | Ga0070675_1000084962 | 392 |
| 58 | 3300005355 | Ga0070671_100003872 | Ga0070671_1000038725 | 392 |
| 59 | 3300005364 | Ga0070673_100000696 | Ga0070673_10000069615 | 392 |
| 60 | 3300005366 | Ga0070659_100000240 | Ga0070659_10000024029 | 392 |
| 61 | 3300005367 | Ga0070667_100001628 | Ga0070667_10000162814 | 392 |
| 62 | 3300005457 | Ga0070662_100000268 | Ga0070662_10000026813 | 392 |
| 63 | 3300005459 | Ga0068867_100000660 | Ga0068867_10000066017 | 392 |
| 64 | 3300005539 | Ga0068853_100003212 | Ga0068853_10000321212 | 392 |
| 65 | 3300005543 | Ga0070672_100003438 | Ga0070672_1000034389 | 392 |
| 66 | 3300005548 | Ga0070665_100060381 | Ga0070665_1000603813 | 392 |
| 67 | 3300005563 | Ga0068855_100005134 | Ga0068855_10000513414 | 392 |
| 68 | 3300005577 | Ga0068857_100008676 | Ga0068857_10000867610 | 392 |
| 69 | 3300005578 | Ga0068854_100000210 | Ga0068854_10000021029 | 392 |
| 70 | 3300005616 | Ga0068852_100000628 | Ga0068852_10000062816 | 392 |
| 71 | 3300005617 | Ga0068859_100002303 | Ga0068859_10000230318 | 392 |
| 72 | 3300005618 | Ga0068864_100000338 | Ga0068864_10000033816 | 392 |
| 73 | 3300005719 | Ga0068861_100009236 | Ga0068861_1000092366 | 392 |
| 74 | 3300005834 | Ga0068851_10009297 | Ga0068851_100092972 | 392 |
| 75 | 3300005841 | Ga0068863_100000409 | Ga0068863_10000040937 | 392 |
| 76 | 3300005842 | Ga0068858_100004175 | Ga0068858_1000041754 | 392 |
| 77 | 3300005843 | Ga0068860_100010676 | Ga0068860_10001067610 | 392 |
| 78 | 3300005844 | Ga0068862_100070033 | Ga0068862_1000700331 | 392 |
| 79 | 3300006881 | Ga0068865_100000947 | Ga0068865_1000009478 | 392 |
| 80 | 3300006931 | Ga0097620_100002303 | Ga0097620_10000230318 | 392 |
| 81 | 3300009098 | Ga0105245_10003932 | Ga0105245_1000393215 | 392 |
| 82 | 3300009148 | Ga0105243_10075117 | Ga0105243_100751172 | 392 |
| 83 | 3300009177 | Ga0105248_10001205 | Ga0105248_1000120520 | 392 |
| 84 | 3300009551 | Ga0105238_10204990 | Ga0105238_102049902 | 392 |
| 85 | 3300013102 | Ga0157371_10003004 | Ga0157371_1000300415 | 392 |
| 86 | 3300013297 | Ga0157378_10000417 | Ga0157378_1000041730 | 392 |
| 87 | 3300013306 | Ga0163162_10030784 | Ga0163162_100307847 | 392 |
| 88 | 3300013308 | Ga0157375_10024976 | Ga0157375_100249765 | 392 |
| 89 | 3300025315 | Ga0207697_10000093 | Ga0207697_1000009327 | 392 |
| 90 | 3300025321 | Ga0207656_10006616 | Ga0207656_100066162 | 392 |
| 91 | 3300025901 | Ga0207688_10000061 | Ga0207688_1000006118 | 392 |
| 92 | 3300025903 | Ga0207680_10014546 | Ga0207680_100145463 | 392 |
| 93 | 3300025904 | Ga0207647_10000393 | Ga0207647_1000039318 | 392 |
| 94 | 3300025907 | Ga0207645_10003852 | Ga0207645_100038524 | 392 |
| 95 | 3300025919 | Ga0207657_10003953 | Ga0207657_1000395310 | 392 |
| 96 | 3300025923 | Ga0207681_10001615 | Ga0207681_100016158 | 392 |
| 97 | 3300025927 | Ga0207687_10003367 | Ga0207687_100033679 | 392 |
| 98 | 3300025932 | Ga0207690_10001140 | Ga0207690_100011408 | 392 |
| 99 | 3300025933 | Ga0207706_10000185 | Ga0207706_1000018531 | 392 |
| 100 | 3300025936 | Ga0207670_10025321 | Ga0207670_100253212 | 392 |
| 101 | 3300025938 | Ga0207704_10002888 | Ga0207704_100028888 | 392 |
| 102 | 3300025940 | Ga0207691_10000114 | Ga0207691_1000011461 | 392 |
| 103 | 3300025941 | Ga0207711_10000784 | Ga0207711_1000078416 | 392 |
| 104 | 3300025942 | Ga0207689_10000014 | Ga0207689_1000001417 | 392 |
| 105 | 3300025945 | Ga0207679_10013763 | Ga0207679_100137637 | 392 |
| 106 | 3300025949 | Ga0207667_10030878 | Ga0207667_100308789 | 392 |
| 107 | 3300025960 | Ga0207651_10000396 | Ga0207651_1000039616 | 392 |
| 108 | 3300025972 | Ga0207668_10050698 | Ga0207668_100506983 | 392 |
| 109 | 3300025981 | Ga0207640_10003009 | Ga0207640_1000300911 | 392 |
| 110 | 3300025986 | Ga0207658_10018209 | Ga0207658_100182092 | 392 |
| 111 | 3300026035 | Ga0207703_10001589 | Ga0207703_1000158917 | 392 |
| 112 | 3300026041 | Ga0207639_10000767 | Ga0207639_1000076714 | 392 |
| 113 | 3300026088 | Ga0207641_10001563 | Ga0207641_100015636 | 392 |
| 114 | 3300026089 | Ga0207648_10002021 | Ga0207648_1000202115 | 392 |
| 115 | 3300026095 | Ga0207676_10002489 | Ga0207676_100024898 | 392 |
| 116 | 3300026116 | Ga0207674_10003948 | Ga0207674_1000394817 | 392 |
| 117 | 3300026118 | Ga0207675_100011322 | Ga0207675_1000113226 | 392 |
| 118 | 3300026142 | Ga0207698_10001676 | Ga0207698_1000167614 | 392 |
| 119 | 3300026142 | Ga0207698_10146935 | Ga0207698_101469352 | 392 |
| 120 | 3300028379 | Ga0268266_10161494 | Ga0268266_101614941 | 392 |
| 121 | 3300028380 | Ga0268265_10308277 | Ga0268265_103082772 | 392 |
| 122 | 3300028381 | Ga0268264_10008522 | Ga0268264_100085228 | 392 |
| 123 | 3300037471 | Ga0395905_0102372 | Ga0395905_0102372_1337_2521 | 392 |
| 124 | 3300042461 | Ga0439460_0032422 | Ga0439460_0032422_115_1302 | 392 |
| 125 | 3300046491 | Ga0495584_0076113 | Ga0495584_0076113_10_1188 | 392 |
| 126 | 3300046616 | Ga0495668_0065159 | Ga0495668_0065159_180_1367 | 392 |
| 127 | 3300046678 | Ga0495599_0040862 | Ga0495599_0040862_42_1220 | 392 |
| 128 | 3300046684 | Ga0495669_0000269 | Ga0495669_0000269_4965_6152 | 392 |
| 129 | 3300046684 | Ga0495669_0003175 | Ga0495669_0003175_337_1524 | 392 |
| 130 | 3300046684 | Ga0495669_0022078 | Ga0495669_0022078_1428_2615 | 392 |
| 131 | 3300048911 | Ga0496108_0000614 | Ga0496108_0000614_9805_10992 | 392 |
| 132 | 3300048913 | Ga0496110_0191999 | Ga0496110_0191999_21_1199 | 392 |
| 133 | 3300013102 | Ga0157371_10024995 | Ga0157371_100249954 | 393 |
| 134 | 3300042005 | Ga0439448_0000630 | Ga0439448_0000630_4184_5374 | 393 |
| 135 | 3300042012 | Ga0439455_0009233 | Ga0439455_0009233_44_1234 | 393 |
| 136 | 3300042157 | Ga0439458_0000029 | Ga0439458_0000029_9277_10467 | 393 |
| 137 | 3300005366 | Ga0070659_100080097 | Ga0070659_1000800973 | 394 |
| 138 | 3300005455 | Ga0070663_100082816 | Ga0070663_1000828162 | 394 |
| 139 | 3300005578 | Ga0068854_100095380 | Ga0068854_1000953802 | 394 |
| 140 | 3300005616 | Ga0068852_100112314 | Ga0068852_1001123142 | 394 |
| 141 | 3300005834 | Ga0068851_10005731 | Ga0068851_100057312 | 394 |
| 142 | 3300013296 | Ga0157374_10241691 | Ga0157374_102416912 | 394 |
| 143 | 3300025909 | Ga0207705_10006449 | Ga0207705_100064492 | 394 |
| 144 | 3300025919 | Ga0207657_10030980 | Ga0207657_100309804 | 394 |
| 145 | 3300025932 | Ga0207690_10061933 | Ga0207690_100619332 | 394 |
| 146 | 3300026067 | Ga0207678_10014392 | Ga0207678_100143925 | 394 |
| 147 | 3300026142 | Ga0207698_10018583 | Ga0207698_100185833 | 394 |
| 148 | 3300046460 | Ga0495638_0001274 | Ga0495638_0001274_16969_18192 | 394 |
| 149 | 3300053134 | Ga0500658_0006831 | Ga0500658_0006831_1568_2791 | 394 |
| 150 | 3300001979 | JGI24740J21852_10003446 | JGI24740J21852_100034467 | 395 |
| 151 | 3300005327 | Ga0070658_10082892 | Ga0070658_100828922 | 395 |
| 152 | 3300005331 | Ga0070670_100076461 | Ga0070670_1000764613 | 395 |
| 153 | 3300005344 | Ga0070661_100033954 | Ga0070661_1000339543 | 395 |
| 154 | 3300005355 | Ga0070671_100010172 | Ga0070671_1000101722 | 395 |
| 155 | 3300005364 | Ga0070673_100042154 | Ga0070673_1000421542 | 395 |
| 156 | 3300005435 | Ga0070714_100020397 | Ga0070714_1000203972 | 395 |
| 157 | 3300005435 | Ga0070714_100044663 | Ga0070714_1000446632 | 395 |
| 158 | 3300005456 | Ga0070678_100003017 | Ga0070678_1000030178 | 395 |
| 159 | 3300005543 | Ga0070672_100197903 | Ga0070672_1001979032 | 395 |
| 160 | 3300005564 | Ga0070664_100001618 | Ga0070664_10000161812 | 395 |
| 161 | 3300005577 | Ga0068857_100342704 | Ga0068857_1003427041 | 395 |
| 162 | 3300005618 | Ga0068864_100015515 | Ga0068864_1000155154 | 395 |
| 163 | 3300005841 | Ga0068863_100089977 | Ga0068863_1000899772 | 395 |
| 164 | 3300025893 | Ga0207682_10054763 | Ga0207682_100547631 | 395 |
| 165 | 3300025909 | Ga0207705_10025205 | Ga0207705_100252053 | 395 |
| 166 | 3300025925 | Ga0207650_10010118 | Ga0207650_100101186 | 395 |
| 167 | 3300025929 | Ga0207664_10021035 | Ga0207664_100210352 | 395 |
| 168 | 3300025931 | Ga0207644_10012135 | Ga0207644_100121353 | 395 |
| 169 | 3300025933 | Ga0207706_10010598 | Ga0207706_100105986 | 395 |
| 170 | 3300025933 | Ga0207706_10010688 | Ga0207706_100106887 | 395 |
| 171 | 3300025940 | Ga0207691_10015203 | Ga0207691_100152036 | 395 |
| 172 | 3300025941 | Ga0207711_10031680 | Ga0207711_100316803 | 395 |
| 173 | 3300025944 | Ga0207661_10109985 | Ga0207661_101099852 | 395 |
| 174 | 3300025944 | Ga0207661_10299682 | Ga0207661_102996821 | 395 |
| 175 | 3300025945 | Ga0207679_10017311 | Ga0207679_100173112 | 395 |
| 176 | 3300025981 | Ga0207640_10068763 | Ga0207640_100687632 | 395 |
| 177 | 3300026088 | Ga0207641_10007922 | Ga0207641_100079228 | 395 |
| 178 | 3300026116 | Ga0207674_10176694 | Ga0207674_101766942 | 395 |
| 179 | 3300026121 | Ga0207683_10036600 | Ga0207683_100366003 | 395 |
| 180 | 3300026121 | Ga0207683_10245217 | Ga0207683_102452172 | 395 |
| 181 | 3300031824 | Ga0307413_10103932 | Ga0307413_101039322 | 395 |
| 182 | 3300037312 | Ga0395899_0021386 | Ga0395899_0021386_1463_2659 | 395 |
| 183 | 3300037418 | Ga0395900_0017741 | Ga0395900_0017741_3746_4942 | 395 |
| 184 | 3300037466 | Ga0395898_0067291 | Ga0395898_0067291_1001_2197 | 395 |
| 185 | 3300038443 | Ga0395901_0068130 | Ga0395901_0068130_1240_2436 | 395 |
| 186 | 3300048911 | Ga0496108_0025961 | Ga0496108_0025961_3096_4292 | 395 |
| 187 | 3300048911 | Ga0496108_0125325 | Ga0496108_0125325_88_1293 | 395 |
| 188 | 3300048912 | Ga0496109_0137891 | Ga0496109_0137891_1056_2252 | 395 |
| 189 | 3300048915 | Ga0496112_0035364 | Ga0496112_0035364_3061_4257 | 395 |
| 190 | 3300048916 | Ga0496113_0012944 | Ga0496113_0012944_3187_4383 | 395 |
| 191 | 3300031731 | Ga0307405_10127102 | Ga0307405_101271022 | 396 |
| 192 | 3300031824 | Ga0307413_10005295 | Ga0307413_100052953 | 396 |
| 193 | 3300031852 | Ga0307410_10046452 | Ga0307410_100464521 | 396 |
| 194 | 3300031901 | Ga0307406_10016842 | Ga0307406_100168424 | 396 |
| 195 | 3300031903 | Ga0307407_10003274 | Ga0307407_100032742 | 396 |
| 196 | 3300031911 | Ga0307412_10046214 | Ga0307412_100462141 | 396 |
| 197 | 3300031995 | Ga0307409_100043973 | Ga0307409_1000439733 | 396 |
| 198 | 3300032002 | Ga0307416_100053613 | Ga0307416_1000536131 | 396 |
| 199 | 3300032004 | Ga0307414_10167317 | Ga0307414_101673171 | 396 |
| 200 | 3300032005 | Ga0307411_10176369 | Ga0307411_101763692 | 396 |
| 201 | 3300032126 | Ga0307415_100047261 | Ga0307415_1000472611 | 396 |
| 202 | 3300044684 | Ga0466966_0065097 | Ga0466966_0065097_813_2012 | 396 |
| 203 | 3300005327 | Ga0070658_10000571 | Ga0070658_1000057127 | 397 |
| 204 | 3300005327 | Ga0070658_10003718 | Ga0070658_100037182 | 397 |
| 205 | 3300005327 | Ga0070658_10028885 | Ga0070658_100288853 | 397 |
| 206 | 3300005331 | Ga0070670_100000445 | Ga0070670_10000044522 | 397 |
| 207 | 3300005331 | Ga0070670_100009008 | Ga0070670_1000090089 | 397 |
| 208 | 3300005339 | Ga0070660_100002696 | Ga0070660_1000026966 | 397 |
| 209 | 3300005339 | Ga0070660_100042224 | Ga0070660_1000422241 | 397 |
| 210 | 3300005345 | Ga0070692_10000543 | Ga0070692_100005437 | 397 |
| 211 | 3300005354 | Ga0070675_100002803 | Ga0070675_10000280313 | 397 |
| 212 | 3300005354 | Ga0070675_100004652 | Ga0070675_1000046529 | 397 |
| 213 | 3300005355 | Ga0070671_100000865 | Ga0070671_1000008653 | 397 |
| 214 | 3300005356 | Ga0070674_100251547 | Ga0070674_1002515471 | 397 |
| 215 | 3300005367 | Ga0070667_100005520 | Ga0070667_1000055205 | 397 |
| 216 | 3300005455 | Ga0070663_100101441 | Ga0070663_1001014412 | 397 |
| 217 | 3300005543 | Ga0070672_100000401 | Ga0070672_10000040118 | 397 |
| 218 | 3300005543 | Ga0070672_100010268 | Ga0070672_1000102682 | 397 |
| 219 | 3300005548 | Ga0070665_100052989 | Ga0070665_1000529893 | 397 |
| 220 | 3300005563 | Ga0068855_100000129 | Ga0068855_1000001296 | 397 |
| 221 | 3300005564 | Ga0070664_100009369 | Ga0070664_1000093693 | 397 |
| 222 | 3300005564 | Ga0070664_100094009 | Ga0070664_1000940092 | 397 |
| 223 | 3300005577 | Ga0068857_100174739 | Ga0068857_1001747393 | 397 |
| 224 | 3300005719 | Ga0068861_100001124 | Ga0068861_10000112410 | 397 |
| 225 | 3300005985 | Ga0081539_10016110 | Ga0081539_100161107 | 397 |
| 226 | 3300009177 | Ga0105248_10110580 | Ga0105248_101105801 | 397 |
| 227 | 3300013102 | Ga0157371_10008818 | Ga0157371_100088187 | 397 |
| 228 | 3300013102 | Ga0157371_10030452 | Ga0157371_100304525 | 397 |
| 229 | 3300013104 | Ga0157370_10033382 | Ga0157370_100333825 | 397 |
| 230 | 3300025903 | Ga0207680_10018129 | Ga0207680_100181292 | 397 |
| 231 | 3300025904 | Ga0207647_10043767 | Ga0207647_100437671 | 397 |
| 232 | 3300025909 | Ga0207705_10000091 | Ga0207705_1000009146 | 397 |
| 233 | 3300025909 | Ga0207705_10001555 | Ga0207705_1000155513 | 397 |
| 234 | 3300025909 | Ga0207705_10024056 | Ga0207705_100240562 | 397 |
| 235 | 3300025909 | Ga0207705_10042460 | Ga0207705_100424603 | 397 |
| 236 | 3300025919 | Ga0207657_10000092 | Ga0207657_1000009219 | 397 |
| 237 | 3300025919 | Ga0207657_10001122 | Ga0207657_1000112217 | 397 |
| 238 | 3300025921 | Ga0207652_10031422 | Ga0207652_100314223 | 397 |
| 239 | 3300025925 | Ga0207650_10004633 | Ga0207650_1000463310 | 397 |
| 240 | 3300025925 | Ga0207650_10257962 | Ga0207650_102579621 | 397 |
| 241 | 3300025926 | Ga0207659_10015849 | Ga0207659_100158492 | 397 |
| 242 | 3300025931 | Ga0207644_10007001 | Ga0207644_100070013 | 397 |
| 243 | 3300025931 | Ga0207644_10073760 | Ga0207644_100737602 | 397 |
| 244 | 3300025933 | Ga0207706_10010902 | Ga0207706_100109022 | 397 |
| 245 | 3300025933 | Ga0207706_10017204 | Ga0207706_100172046 | 397 |
| 246 | 3300025933 | Ga0207706_10126787 | Ga0207706_101267871 | 397 |
| 247 | 3300025940 | Ga0207691_10002093 | Ga0207691_1000209322 | 397 |
| 248 | 3300025941 | Ga0207711_10067676 | Ga0207711_100676763 | 397 |
| 249 | 3300025945 | Ga0207679_10008134 | Ga0207679_100081347 | 397 |
| 250 | 3300025945 | Ga0207679_10095038 | Ga0207679_100950381 | 397 |
| 251 | 3300025949 | Ga0207667_10001226 | Ga0207667_1000122611 | 397 |
| 252 | 3300025960 | Ga0207651_10093902 | Ga0207651_100939022 | 397 |
| 253 | 3300025960 | Ga0207651_10259870 | Ga0207651_102598701 | 397 |
| 254 | 3300025986 | Ga0207658_10005866 | Ga0207658_100058663 | 397 |
| 255 | 3300026116 | Ga0207674_10028442 | Ga0207674_100284422 | 397 |
| 256 | 3300026118 | Ga0207675_100000264 | Ga0207675_1000002649 | 397 |
| 257 | 3300028379 | Ga0268266_10045085 | Ga0268266_100450853 | 397 |
| 258 | 3300031824 | Ga0307413_10222493 | Ga0307413_102224931 | 397 |
| 259 | 3300031852 | Ga0307410_10002760 | Ga0307410_100027602 | 397 |
| 260 | 3300031852 | Ga0307410_10006820 | Ga0307410_100068202 | 397 |
| 261 | 3300031852 | Ga0307410_10084197 | Ga0307410_100841972 | 397 |
| 262 | 3300031901 | Ga0307406_10125060 | Ga0307406_101250602 | 397 |
| 263 | 3300031903 | Ga0307407_10111753 | Ga0307407_101117532 | 397 |
| 264 | 3300031911 | Ga0307412_10080182 | Ga0307412_100801822 | 397 |
| 265 | 3300031911 | Ga0307412_10123349 | Ga0307412_101233492 | 397 |
| 266 | 3300031995 | Ga0307409_100000453 | Ga0307409_10000045317 | 397 |
| 267 | 3300031995 | Ga0307409_100008366 | Ga0307409_1000083669 | 397 |
| 268 | 3300031995 | Ga0307409_100083805 | Ga0307409_1000838052 | 397 |
| 269 | 3300031995 | Ga0307409_100086027 | Ga0307409_1000860271 | 397 |
| 270 | 3300032002 | Ga0307416_100053277 | Ga0307416_1000532772 | 397 |
| 271 | 3300032004 | Ga0307414_10015188 | Ga0307414_100151883 | 397 |
| 272 | 3300032004 | Ga0307414_10106385 | Ga0307414_101063852 | 397 |
| 273 | 3300032005 | Ga0307411_10004056 | Ga0307411_100040563 | 397 |
| 274 | 3300032005 | Ga0307411_10040280 | Ga0307411_100402802 | 397 |
| 275 | 3300032005 | Ga0307411_10076722 | Ga0307411_100767222 | 397 |
| 276 | 3300032126 | Ga0307415_100000325 | Ga0307415_10000032514 | 397 |
| 277 | 3300032126 | Ga0307415_100045372 | Ga0307415_1000453723 | 397 |
| 278 | 3300032126 | Ga0307415_100066483 | Ga0307415_1000664831 | 397 |
| 279 | 3300037312 | Ga0395899_0000132 | Ga0395899_0000132_77880_79082 | 397 |
| 280 | 3300037418 | Ga0395900_0000359 | Ga0395900_0000359_6622_7824 | 397 |
| 281 | 3300037418 | Ga0395900_0119293 | Ga0395900_0119293_1246_2448 | 397 |
| 282 | 3300037466 | Ga0395898_0012491 | Ga0395898_0012491_1174_2376 | 397 |
| 283 | 3300037471 | Ga0395905_0109263 | Ga0395905_0109263_121_1323 | 397 |
| 284 | 3300038443 | Ga0395901_0000275 | Ga0395901_0000275_33084_34286 | 397 |
| 285 | 3300042007 | Ga0439449_0012796 | Ga0439449_0012796_1732_2934 | 397 |
| 286 | 3300046525 | Ga0495663_0002965 | Ga0495663_0002965_1201_2403 | 397 |
| 287 | 3300046539 | Ga0495621_0000388 | Ga0495621_0000388_3142_4344 | 397 |
| 288 | 3300046558 | Ga0495633_0002898 | Ga0495633_0002898_8238_9440 | 397 |
| 289 | 3300046665 | Ga0495661_0086829 | Ga0495661_0086829_422_1624 | 397 |
| 290 | 3300046684 | Ga0495669_0001684 | Ga0495669_0001684_286_1488 | 397 |
| 291 | 3300046684 | Ga0495669_0005515 | Ga0495669_0005515_915_2117 | 397 |
| 292 | 3300046691 | Ga0495670_0026936 | Ga0495670_0026936_987_2189 | 397 |
| 293 | 3300048914 | Ga0496111_0071599 | Ga0496111_0071599_657_1859 | 397 |
| 294 | 3300005439 | Ga0070711_100008446 | Ga0070711_1000084464 | 398 |
| 295 | 3300025931 | Ga0207644_10148990 | Ga0207644_101489902 | 398 |
| 296 | 3300031616 | Ga0307508_10003330 | Ga0307508_100033306 | 398 |
| 297 | 3300035725 | Ga0373947_0039873 | Ga0373947_0039873_18_1214 | 398 |
| 298 | 3300035170 | Ga0373943_0011002 | Ga0373943_0011002_20_1219 | 399 |
| 299 | 3300035725 | Ga0373947_0177609 | Ga0373947_0177609_166_1365 | 399 |
| 300 | 3300053077 | Ga0495601_0118715 | Ga0495601_0118715_498_1697 | 399 |
| 301 | 3300005535 | Ga0070684_100059496 | Ga0070684_1000594962 | 400 |
| 302 | 3300013307 | Ga0157372_10165227 | Ga0157372_101652271 | 400 |
| 303 | 3300021377 | Ga0213874_10003678 | Ga0213874_100036783 | 400 |
| 304 | 3300039450 | Ga0436363_1491361 | Ga0436363_1491361_303_1505 | 400 |
| 305 | 3300021384 | Ga0213876_10017509 | Ga0213876_100175092 | 402 |
| 306 | 3300039437 | Ga0436365_0664268 | Ga0436365_0664268_1939_3147 | 402 |
| 307 | 3300025915 | Ga0207693_10035663 | Ga0207693_100356632 | 403 |
| 308 | 3300039438 | Ga0436360_0723710 | Ga0436360_0723710_342_1565 | 403 |
| 309 | iso_pu_bacteria | 2990265787 | 2990266174 | 404 |
| 310 | iso_pu_bacteria | 2993693658 | 2993696032 | 404 |
| 311 | iso_pu_bacteria | 2946787523 | 2946789574 | 405 |
| 312 | 3300005330 | Ga0070690_100049986 | Ga0070690_1000499863 | 406 |
| 313 | 3300005617 | Ga0068859_100179115 | Ga0068859_1001791151 | 406 |
| 314 | 3300006931 | Ga0097620_100179116 | Ga0097620_1001791162 | 406 |
| 315 | 3300039450 | Ga0436363_0060576 | Ga0436363_0060576_64_1299 | 406 |
| 316 | 3300049571 | Ga0501034_0020632 | Ga0501034_0020632_4266_5486 | 406 |
| 317 | 3300049581 | Ga0501047_0183702 | Ga0501047_0183702_634_1854 | 406 |
| 318 | 3300053153 | Ga0500616_0030853 | Ga0500616_0030853_1629_2849 | 406 |
| 319 | 3300005327 | Ga0070658_10000199 | Ga0070658_1000019919 | 407 |
| 320 | 3300005345 | Ga0070692_10003256 | Ga0070692_100032567 | 407 |
| 321 | 3300005366 | Ga0070659_100003410 | Ga0070659_1000034103 | 407 |
| 322 | 3300005366 | Ga0070659_100024132 | Ga0070659_1000241322 | 407 |
| 323 | 3300013105 | Ga0157369_10001231 | Ga0157369_1000123123 | 407 |
| 324 | 3300021384 | Ga0213876_10001649 | Ga0213876_100016495 | 407 |
| 325 | 3300025904 | Ga0207647_10013938 | Ga0207647_100139384 | 407 |
| 326 | 3300025909 | Ga0207705_10000002 | Ga0207705_10000002716 | 407 |
| 327 | 3300025932 | Ga0207690_10006879 | Ga0207690_100068792 | 407 |
| 328 | 3300025932 | Ga0207690_10018172 | Ga0207690_100181725 | 407 |
| 329 | 3300039437 | Ga0436365_0794411 | Ga0436365_0794411_42838_44067 | 407 |
| 330 | 3300048918 | Ga0496115_0300754 | Ga0496115_0300754_18_1259 | 407 |
| 331 | 3300005842 | Ga0068858_100000897 | Ga0068858_1000008973 | 408 |
| 332 | 3300025924 | Ga0207694_10030859 | Ga0207694_100308591 | 408 |
| 333 | 3300026035 | Ga0207703_10000483 | Ga0207703_1000048330 | 408 |
| 334 | 3300039437 | Ga0436365_1151519 | Ga0436365_1151519_222_1448 | 408 |
| 335 | 3300025272 | Ga0209455_1007486 | Ga0209455_10074862 | 409 |
| 336 | iso_pu_bacteria | 2643221547 | 2643755083 | 409 |
| 337 | iso_pu_bacteria | 2883291878 | 2883297197 | 409 |
| 338 | 3300003214 | JGI25165J46597_1000007 | JGI25165J46597_100000711 | 410 |
| 339 | 3300005544 | Ga0070686_100000336 | Ga0070686_10000033618 | 410 |
| 340 | 3300021388 | Ga0213875_10005756 | Ga0213875_100057565 | 410 |
| 341 | 3300025261 | Ga0209233_1000026 | Ga0209233_100002612 | 410 |
| 342 | 3300037853 | Ga0436364_0461445 | Ga0436364_0461445_1188_2420 | 410 |
| 343 | 3300005435 | Ga0070714_100010583 | Ga0070714_1000105837 | 411 |
| 344 | 3300005437 | Ga0070710_10014787 | Ga0070710_100147874 | 411 |
| 345 | 3300005439 | Ga0070711_100110803 | Ga0070711_1001108032 | 411 |
| 346 | 3300006028 | Ga0070717_10043671 | Ga0070717_100436714 | 411 |
| 347 | 3300006175 | Ga0070712_100015217 | Ga0070712_1000152175 | 411 |
| 348 | 3300006175 | Ga0070712_100023430 | Ga0070712_1000234302 | 411 |
| 349 | 3300009551 | Ga0105238_10001421 | Ga0105238_100014217 | 411 |
| 350 | 3300025906 | Ga0207699_10025362 | Ga0207699_100253624 | 411 |
| 351 | 3300025915 | Ga0207693_10016177 | Ga0207693_100161774 | 411 |
| 352 | 3300025915 | Ga0207693_10030868 | Ga0207693_100308685 | 411 |
| 353 | 3300025916 | Ga0207663_10021669 | Ga0207663_100216694 | 411 |
| 354 | 3300025924 | Ga0207694_10001995 | Ga0207694_100019954 | 411 |
| 355 | 3300025928 | Ga0207700_10057915 | Ga0207700_100579153 | 411 |
| 356 | 3300025929 | Ga0207664_10117024 | Ga0207664_101170243 | 411 |
| 357 | 3300025939 | Ga0207665_10107454 | Ga0207665_101074543 | 411 |
| 358 | 3300031247 | Ga0265340_10007678 | Ga0265340_100076782 | 411 |
| 359 | 3300037418 | Ga0395900_0160060 | Ga0395900_0160060_496_1731 | 411 |
| 360 | 3300039438 | Ga0436360_0451948 | Ga0436360_0451948_1488_2747 | 411 |
| 361 | 3300039450 | Ga0436363_1100437 | Ga0436363_1100437_3199_4434 | 411 |
| 362 | 3300000041 | ARcpr5oldR_c000094 | ARcpr5oldR_0000943 | 413 |
| 363 | 3300000042 | ARSoilYngRDRAFT_c00429 | ARSoilYngRDRAFT_004295 | 413 |
| 364 | 3300000043 | ARcpr5yngRDRAFT_c000310 | ARcpr5yngRDRAFT_0003105 | 413 |
| 365 | 3300000045 | ARCol0oldRDRAFT_c00220 | ARCol0oldRDRAFT_002202 | 413 |
| 366 | 3300001989 | JGI24739J22299_10000147 | JGI24739J22299_100001471 | 413 |
| 367 | 3300001990 | JGI24737J22298_10000225 | JGI24737J22298_100002253 | 413 |
| 368 | 3300002073 | JGI24745J21846_1000198 | JGI24745J21846_10001982 | 413 |
| 369 | 3300002075 | JGI24738J21930_10000274 | JGI24738J21930_1000027411 | 413 |
| 370 | 3300002076 | JGI24749J21850_1000977 | JGI24749J21850_10009772 | 413 |
| 371 | 3300002077 | JGI24744J21845_10002039 | JGI24744J21845_100020394 | 413 |
| 372 | 3300002126 | JGI24035J26624_1000334 | JGI24035J26624_10003341 | 413 |
| 373 | 3300002244 | JGI24742J22300_10000166 | JGI24742J22300_100001662 | 413 |
| 374 | 3300003544 | Ga0007417J51691_1019057 | Ga0007417J51691_10190571 | 413 |
| 375 | 3300005293 | Ga0065715_10001130 | Ga0065715_100011307 | 413 |
| 376 | 3300005327 | Ga0070658_10003259 | Ga0070658_100032599 | 413 |
| 377 | 3300005327 | Ga0070658_10053493 | Ga0070658_100534931 | 413 |
| 378 | 3300005328 | Ga0070676_10003713 | Ga0070676_100037134 | 413 |
| 379 | 3300005329 | Ga0070683_100000177 | Ga0070683_10000017719 | 413 |
| 380 | 3300005329 | Ga0070683_100128519 | Ga0070683_1001285192 | 413 |
| 381 | 3300005330 | Ga0070690_100000693 | Ga0070690_10000069313 | 413 |
| 382 | 3300005330 | Ga0070690_100054743 | Ga0070690_1000547433 | 413 |
| 383 | 3300005331 | Ga0070670_100076830 | Ga0070670_1000768303 | 413 |
| 384 | 3300005333 | Ga0070677_10000012 | Ga0070677_100000127 | 413 |
| 385 | 3300005334 | Ga0068869_100000008 | Ga0068869_1000000087 | 413 |
| 386 | 3300005334 | Ga0068869_100079904 | Ga0068869_1000799042 | 413 |
| 387 | 3300005335 | Ga0070666_10012332 | Ga0070666_100123325 | 413 |
| 388 | 3300005335 | Ga0070666_10043038 | Ga0070666_100430382 | 413 |
| 389 | 3300005336 | Ga0070680_100004044 | Ga0070680_1000040442 | 413 |
| 390 | 3300005336 | Ga0070680_100013240 | Ga0070680_1000132407 | 413 |
| 391 | 3300005336 | Ga0070680_100016591 | Ga0070680_1000165914 | 413 |
| 392 | 3300005336 | Ga0070680_100040597 | Ga0070680_1000405973 | 413 |
| 393 | 3300005337 | Ga0070682_100000132 | Ga0070682_10000013217 | 413 |
| 394 | 3300005337 | Ga0070682_100080940 | Ga0070682_1000809402 | 413 |
| 395 | 3300005338 | Ga0068868_100000705 | Ga0068868_1000007057 | 413 |
| 396 | 3300005338 | Ga0068868_100002032 | Ga0068868_10000203210 | 413 |
| 397 | 3300005338 | Ga0068868_100042434 | Ga0068868_1000424343 | 413 |
| 398 | 3300005339 | Ga0070660_100003369 | Ga0070660_1000033693 | 413 |
| 399 | 3300005340 | Ga0070689_100001829 | Ga0070689_10000182910 | 413 |
| 400 | 3300005340 | Ga0070689_100004446 | Ga0070689_10000444611 | 413 |
| 401 | 3300005341 | Ga0070691_10001308 | Ga0070691_100013081 | 413 |
| 402 | 3300005341 | Ga0070691_10027579 | Ga0070691_100275793 | 413 |
| 403 | 3300005343 | Ga0070687_100000446 | Ga0070687_1000004465 | 413 |
| 404 | 3300005343 | Ga0070687_100008694 | Ga0070687_1000086944 | 413 |
| 405 | 3300005343 | Ga0070687_100015318 | Ga0070687_1000153182 | 413 |
| 406 | 3300005344 | Ga0070661_100000107 | Ga0070661_10000010715 | 413 |
| 407 | 3300005345 | Ga0070692_10000375 | Ga0070692_100003757 | 413 |
| 408 | 3300005345 | Ga0070692_10013333 | Ga0070692_100133332 | 413 |
| 409 | 3300005345 | Ga0070692_10120110 | Ga0070692_101201101 | 413 |
| 410 | 3300005347 | Ga0070668_100000419 | Ga0070668_10000041921 | 413 |
| 411 | 3300005347 | Ga0070668_100077950 | Ga0070668_1000779503 | 413 |
| 412 | 3300005353 | Ga0070669_100002478 | Ga0070669_10000247812 | 413 |
| 413 | 3300005353 | Ga0070669_100035118 | Ga0070669_1000351183 | 413 |
| 414 | 3300005353 | Ga0070669_100070854 | Ga0070669_1000708543 | 413 |
| 415 | 3300005354 | Ga0070675_100000032 | Ga0070675_10000003213 | 413 |
| 416 | 3300005355 | Ga0070671_100000519 | Ga0070671_1000005196 | 413 |
| 417 | 3300005355 | Ga0070671_100005241 | Ga0070671_1000052415 | 413 |
| 418 | 3300005356 | Ga0070674_100000288 | Ga0070674_10000028818 | 413 |
| 419 | 3300005364 | Ga0070673_100000024 | Ga0070673_10000002464 | 413 |
| 420 | 3300005364 | Ga0070673_100024738 | Ga0070673_1000247385 | 413 |
| 421 | 3300005365 | Ga0070688_100000281 | Ga0070688_10000028117 | 413 |
| 422 | 3300005365 | Ga0070688_100014752 | Ga0070688_1000147522 | 413 |
| 423 | 3300005366 | Ga0070659_100000238 | Ga0070659_10000023814 | 413 |
| 424 | 3300005366 | Ga0070659_100024978 | Ga0070659_1000249785 | 413 |
| 425 | 3300005366 | Ga0070659_100040446 | Ga0070659_1000404463 | 413 |
| 426 | 3300005367 | Ga0070667_100000994 | Ga0070667_1000009943 | 413 |
| 427 | 3300005367 | Ga0070667_100035728 | Ga0070667_1000357283 | 413 |
| 428 | 3300005367 | Ga0070667_100180535 | Ga0070667_1001805352 | 413 |
| 429 | 3300005406 | Ga0070703_10002021 | Ga0070703_100020212 | 413 |
| 430 | 3300005434 | Ga0070709_10002849 | Ga0070709_100028493 | 413 |
| 431 | 3300005434 | Ga0070709_10065813 | Ga0070709_100658132 | 413 |
| 432 | 3300005435 | Ga0070714_100157313 | Ga0070714_1001573132 | 413 |
| 433 | 3300005435 | Ga0070714_100158649 | Ga0070714_1001586492 | 413 |
| 434 | 3300005436 | Ga0070713_100016386 | Ga0070713_1000163863 | 413 |
| 435 | 3300005436 | Ga0070713_100037000 | Ga0070713_1000370004 | 413 |
| 436 | 3300005436 | Ga0070713_100061529 | Ga0070713_1000615292 | 413 |
| 437 | 3300005437 | Ga0070710_10003252 | Ga0070710_100032526 | 413 |
| 438 | 3300005437 | Ga0070710_10015872 | Ga0070710_100158723 | 413 |
| 439 | 3300005437 | Ga0070710_10039820 | Ga0070710_100398203 | 413 |
| 440 | 3300005438 | Ga0070701_10009447 | Ga0070701_100094472 | 413 |
| 441 | 3300005438 | Ga0070701_10039755 | Ga0070701_100397551 | 413 |
| 442 | 3300005439 | Ga0070711_100002902 | Ga0070711_10000290211 | 413 |
| 443 | 3300005439 | Ga0070711_100106117 | Ga0070711_1001061171 | 413 |
| 444 | 3300005440 | Ga0070705_100027305 | Ga0070705_1000273052 | 413 |
| 445 | 3300005440 | Ga0070705_100084445 | Ga0070705_1000844452 | 413 |
| 446 | 3300005441 | Ga0070700_100000615 | Ga0070700_1000006158 | 413 |
| 447 | 3300005441 | Ga0070700_100031506 | Ga0070700_1000315063 | 413 |
| 448 | 3300005444 | Ga0070694_100000181 | Ga0070694_10000018132 | 413 |
| 449 | 3300005444 | Ga0070694_100000250 | Ga0070694_10000025019 | 413 |
| 450 | 3300005444 | Ga0070694_100005598 | Ga0070694_1000055985 | 413 |
| 451 | 3300005444 | Ga0070694_100073258 | Ga0070694_1000732582 | 413 |
| 452 | 3300005455 | Ga0070663_100009797 | Ga0070663_1000097973 | 413 |
| 453 | 3300005455 | Ga0070663_100079443 | Ga0070663_1000794431 | 413 |
| 454 | 3300005456 | Ga0070678_100000211 | Ga0070678_10000021116 | 413 |
| 455 | 3300005457 | Ga0070662_100006788 | Ga0070662_1000067884 | 413 |
| 456 | 3300005457 | Ga0070662_100007668 | Ga0070662_1000076687 | 413 |
| 457 | 3300005458 | Ga0070681_10004709 | Ga0070681_100047093 | 413 |
| 458 | 3300005458 | Ga0070681_10022513 | Ga0070681_100225136 | 413 |
| 459 | 3300005458 | Ga0070681_10188923 | Ga0070681_101889232 | 413 |
| 460 | 3300005459 | Ga0068867_100001143 | Ga0068867_1000011433 | 413 |
| 461 | 3300005466 | Ga0070685_10001436 | Ga0070685_100014365 | 413 |
| 462 | 3300005466 | Ga0070685_10031604 | Ga0070685_100316042 | 413 |
| 463 | 3300005518 | Ga0070699_100002292 | Ga0070699_1000022929 | 413 |
| 464 | 3300005530 | Ga0070679_100000352 | Ga0070679_10000035217 | 413 |
| 465 | 3300005530 | Ga0070679_100056192 | Ga0070679_1000561923 | 413 |
| 466 | 3300005530 | Ga0070679_100061622 | Ga0070679_1000616222 | 413 |
| 467 | 3300005530 | Ga0070679_100128118 | Ga0070679_1001281182 | 413 |
| 468 | 3300005530 | Ga0070679_100153310 | Ga0070679_1001533102 | 413 |
| 469 | 3300005535 | Ga0070684_100000022 | Ga0070684_10000002244 | 413 |
| 470 | 3300005536 | Ga0070697_100115247 | Ga0070697_1001152472 | 413 |
| 471 | 3300005539 | Ga0068853_100006604 | Ga0068853_1000066043 | 413 |
| 472 | 3300005539 | Ga0068853_100117866 | Ga0068853_1001178662 | 413 |
| 473 | 3300005543 | Ga0070672_100000226 | Ga0070672_10000022629 | 413 |
| 474 | 3300005543 | Ga0070672_100114508 | Ga0070672_1001145083 | 413 |
| 475 | 3300005544 | Ga0070686_100000395 | Ga0070686_10000039512 | 413 |
| 476 | 3300005544 | Ga0070686_100020030 | Ga0070686_1000200304 | 413 |
| 477 | 3300005544 | Ga0070686_100051814 | Ga0070686_1000518142 | 413 |
| 478 | 3300005545 | Ga0070695_100000242 | Ga0070695_10000024210 | 413 |
| 479 | 3300005545 | Ga0070695_100031056 | Ga0070695_1000310562 | 413 |
| 480 | 3300005546 | Ga0070696_100000885 | Ga0070696_10000088511 | 413 |
| 481 | 3300005546 | Ga0070696_100004160 | Ga0070696_1000041603 | 413 |
| 482 | 3300005546 | Ga0070696_100017360 | Ga0070696_1000173604 | 413 |
| 483 | 3300005547 | Ga0070693_100000428 | Ga0070693_1000004286 | 413 |
| 484 | 3300005548 | Ga0070665_100071224 | Ga0070665_1000712242 | 413 |
| 485 | 3300005549 | Ga0070704_100001996 | Ga0070704_1000019969 | 413 |
| 486 | 3300005549 | Ga0070704_100004811 | Ga0070704_1000048118 | 413 |
| 487 | 3300005549 | Ga0070704_100007538 | Ga0070704_1000075388 | 413 |
| 488 | 3300005563 | Ga0068855_100004217 | Ga0068855_1000042177 | 413 |
| 489 | 3300005563 | Ga0068855_100032137 | Ga0068855_1000321372 | 413 |
| 490 | 3300005564 | Ga0070664_100000248 | Ga0070664_10000024821 | 413 |
| 491 | 3300005564 | Ga0070664_100018098 | Ga0070664_1000180983 | 413 |
| 492 | 3300005577 | Ga0068857_100000393 | Ga0068857_10000039322 | 413 |
| 493 | 3300005577 | Ga0068857_100124372 | Ga0068857_1001243722 | 413 |
| 494 | 3300005578 | Ga0068854_100000806 | Ga0068854_1000008063 | 413 |
| 495 | 3300005614 | Ga0068856_100000990 | Ga0068856_10000099017 | 413 |
| 496 | 3300005614 | Ga0068856_100054786 | Ga0068856_1000547863 | 413 |
| 497 | 3300005615 | Ga0070702_100000029 | Ga0070702_10000002928 | 413 |
| 498 | 3300005615 | Ga0070702_100091057 | Ga0070702_1000910572 | 413 |
| 499 | 3300005616 | Ga0068852_100004350 | Ga0068852_1000043506 | 413 |
| 500 | 3300005616 | Ga0068852_100029528 | Ga0068852_1000295284 | 413 |
| 501 | 3300005616 | Ga0068852_100096276 | Ga0068852_1000962763 | 413 |
| 502 | 3300005617 | Ga0068859_100002192 | Ga0068859_1000021925 | 413 |
| 503 | 3300005617 | Ga0068859_100015921 | Ga0068859_1000159212 | 413 |
| 504 | 3300005617 | Ga0068859_100132287 | Ga0068859_1001322873 | 413 |
| 505 | 3300005618 | Ga0068864_100000492 | Ga0068864_10000049218 | 413 |
| 506 | 3300005618 | Ga0068864_100013256 | Ga0068864_1000132565 | 413 |
| 507 | 3300005718 | Ga0068866_10000179 | Ga0068866_1000017912 | 413 |
| 508 | 3300005719 | Ga0068861_100000140 | Ga0068861_10000014026 | 413 |
| 509 | 3300005719 | Ga0068861_100025604 | Ga0068861_1000256042 | 413 |
| 510 | 3300005719 | Ga0068861_100040904 | Ga0068861_1000409043 | 413 |
| 511 | 3300005719 | Ga0068861_100123253 | Ga0068861_1001232532 | 413 |
| 512 | 3300005840 | Ga0068870_10000001 | Ga0068870_100000013 | 413 |
| 513 | 3300005840 | Ga0068870_10036649 | Ga0068870_100366492 | 413 |
| 514 | 3300005841 | Ga0068863_100000246 | Ga0068863_10000024617 | 413 |
| 515 | 3300005841 | Ga0068863_100018899 | Ga0068863_1000188992 | 413 |
| 516 | 3300005842 | Ga0068858_100001644 | Ga0068858_1000016447 | 413 |
| 517 | 3300005842 | Ga0068858_100008307 | Ga0068858_1000083075 | 413 |
| 518 | 3300005843 | Ga0068860_100001266 | Ga0068860_10000126612 | 413 |
| 519 | 3300005843 | Ga0068860_100014184 | Ga0068860_1000141841 | 413 |
| 520 | 3300005843 | Ga0068860_100014402 | Ga0068860_1000144028 | 413 |
| 521 | 3300005843 | Ga0068860_100046274 | Ga0068860_1000462744 | 413 |
| 522 | 3300005844 | Ga0068862_100001531 | Ga0068862_10000153117 | 413 |
| 523 | 3300005844 | Ga0068862_100001891 | Ga0068862_1000018917 | 413 |
| 524 | 3300005844 | Ga0068862_100034983 | Ga0068862_1000349833 | 413 |
| 525 | 3300005844 | Ga0068862_100137749 | Ga0068862_1001377492 | 413 |
| 526 | 3300005937 | Ga0081455_10007245 | Ga0081455_100072452 | 413 |
| 527 | 3300005937 | Ga0081455_10027309 | Ga0081455_100273094 | 413 |
| 528 | 3300005937 | Ga0081455_10062384 | Ga0081455_100623843 | 413 |
| 529 | 3300006028 | Ga0070717_10000215 | Ga0070717_1000021532 | 413 |
| 530 | 3300006028 | Ga0070717_10041913 | Ga0070717_100419132 | 413 |
| 531 | 3300006038 | Ga0075365_10002820 | Ga0075365_100028203 | 413 |
| 532 | 3300006038 | Ga0075365_10173359 | Ga0075365_101733592 | 413 |
| 533 | 3300006042 | Ga0075368_10015431 | Ga0075368_100154313 | 413 |
| 534 | 3300006048 | Ga0075363_100154618 | Ga0075363_1001546181 | 413 |
| 535 | 3300006051 | Ga0075364_10129279 | Ga0075364_101292792 | 413 |
| 536 | 3300006058 | Ga0075432_10002730 | Ga0075432_100027304 | 413 |
| 537 | 3300006173 | Ga0070716_100000605 | Ga0070716_1000006058 | 413 |
| 538 | 3300006173 | Ga0070716_100073071 | Ga0070716_1000730712 | 413 |
| 539 | 3300006175 | Ga0070712_100005387 | Ga0070712_1000053877 | 413 |
| 540 | 3300006175 | Ga0070712_100032573 | Ga0070712_1000325732 | 413 |
| 541 | 3300006237 | Ga0097621_100001299 | Ga0097621_1000012992 | 413 |
| 542 | 3300006237 | Ga0097621_100059032 | Ga0097621_1000590323 | 413 |
| 543 | 3300006237 | Ga0097621_100073302 | Ga0097621_1000733023 | 413 |
| 544 | 3300006237 | Ga0097621_100089756 | Ga0097621_1000897562 | 413 |
| 545 | 3300006353 | Ga0075370_10033860 | Ga0075370_100338603 | 413 |
| 546 | 3300006358 | Ga0068871_100000007 | Ga0068871_10000000720 | 413 |
| 547 | 3300006358 | Ga0068871_100071392 | Ga0068871_1000713923 | 413 |
| 548 | 3300006844 | Ga0075428_100016903 | Ga0075428_1000169035 | 413 |
| 549 | 3300006844 | Ga0075428_100035713 | Ga0075428_1000357135 | 413 |
| 550 | 3300006844 | Ga0075428_100043146 | Ga0075428_1000431465 | 413 |
| 551 | 3300006846 | Ga0075430_100000128 | Ga0075430_10000012841 | 413 |
| 552 | 3300006846 | Ga0075430_100020523 | Ga0075430_1000205233 | 413 |
| 553 | 3300006847 | Ga0075431_100000557 | Ga0075431_1000005573 | 413 |
| 554 | 3300006847 | Ga0075431_100011821 | Ga0075431_1000118215 | 413 |
| 555 | 3300006852 | Ga0075433_10000103 | Ga0075433_100001035 | 413 |
| 556 | 3300006852 | Ga0075433_10032108 | Ga0075433_100321083 | 413 |
| 557 | 3300006871 | Ga0075434_100003002 | Ga0075434_10000300213 | 413 |
| 558 | 3300006871 | Ga0075434_100005851 | Ga0075434_10000585110 | 413 |
| 559 | 3300006871 | Ga0075434_100090618 | Ga0075434_1000906182 | 413 |
| 560 | 3300006880 | Ga0075429_100004986 | Ga0075429_10000498613 | 413 |
| 561 | 3300006881 | Ga0068865_100000091 | Ga0068865_10000009121 | 413 |
| 562 | 3300006881 | Ga0068865_100067561 | Ga0068865_1000675613 | 413 |
| 563 | 3300006914 | Ga0075436_100141693 | Ga0075436_1001416932 | 413 |
| 564 | 3300006931 | Ga0097620_100002192 | Ga0097620_10000219217 | 413 |
| 565 | 3300006931 | Ga0097620_100015921 | Ga0097620_1000159218 | 413 |
| 566 | 3300006931 | Ga0097620_100132286 | Ga0097620_1001322862 | 413 |
| 567 | 3300007076 | Ga0075435_100050157 | Ga0075435_1000501573 | 413 |
| 568 | 3300007076 | Ga0075435_100052637 | Ga0075435_1000526373 | 413 |
| 569 | 3300009094 | Ga0111539_10000265 | Ga0111539_1000026517 | 413 |
| 570 | 3300009094 | Ga0111539_10003594 | Ga0111539_1000359417 | 413 |
| 571 | 3300009094 | Ga0111539_10006865 | Ga0111539_1000686511 | 413 |
| 572 | 3300009094 | Ga0111539_10179216 | Ga0111539_101792162 | 413 |
| 573 | 3300009098 | Ga0105245_10000187 | Ga0105245_1000018719 | 413 |
| 574 | 3300009098 | Ga0105245_10053267 | Ga0105245_100532673 | 413 |
| 575 | 3300009101 | Ga0105247_10003235 | Ga0105247_1000323512 | 413 |
| 576 | 3300009101 | Ga0105247_10047964 | Ga0105247_100479642 | 413 |
| 577 | 3300009147 | Ga0114129_10037638 | Ga0114129_100376386 | 413 |
| 578 | 3300009148 | Ga0105243_10001870 | Ga0105243_1000187017 | 413 |
| 579 | 3300009148 | Ga0105243_10024775 | Ga0105243_100247753 | 413 |
| 580 | 3300009148 | Ga0105243_10061475 | Ga0105243_100614753 | 413 |
| 581 | 3300009174 | Ga0105241_10000958 | Ga0105241_1000095812 | 413 |
| 582 | 3300009176 | Ga0105242_10000633 | Ga0105242_1000063323 | 413 |
| 583 | 3300009177 | Ga0105248_10002490 | Ga0105248_1000249011 | 413 |
| 584 | 3300009177 | Ga0105248_10010094 | Ga0105248_100100942 | 413 |
| 585 | 3300009177 | Ga0105248_10091898 | Ga0105248_100918984 | 413 |
| 586 | 3300009545 | Ga0105237_10002942 | Ga0105237_100029426 | 413 |
| 587 | 3300009551 | Ga0105238_10093032 | Ga0105238_100930323 | 413 |
| 588 | 3300009551 | Ga0105238_10396989 | Ga0105238_103969891 | 413 |
| 589 | 3300009553 | Ga0105249_10000564 | Ga0105249_1000056424 | 413 |
| 590 | 3300009553 | Ga0105249_10007631 | Ga0105249_100076313 | 413 |
| 591 | 3300009553 | Ga0105249_10027715 | Ga0105249_100277155 | 413 |
| 592 | 3300010375 | Ga0105239_10003234 | Ga0105239_1000323417 | 413 |
| 593 | 3300010375 | Ga0105239_10227438 | Ga0105239_102274381 | 413 |
| 594 | 3300011119 | Ga0105246_10000316 | Ga0105246_1000031619 | 413 |
| 595 | 3300012492 | Ga0157335_1000272 | Ga0157335_10002722 | 413 |
| 596 | 3300013104 | Ga0157370_10027127 | Ga0157370_100271272 | 413 |
| 597 | 3300013104 | Ga0157370_10075953 | Ga0157370_100759532 | 413 |
| 598 | 3300013105 | Ga0157369_10164746 | Ga0157369_101647462 | 413 |
| 599 | 3300013296 | Ga0157374_10053572 | Ga0157374_100535722 | 413 |
| 600 | 3300013297 | Ga0157378_10001984 | Ga0157378_100019846 | 413 |
| 601 | 3300013297 | Ga0157378_10035180 | Ga0157378_100351804 | 413 |
| 602 | 3300013306 | Ga0163162_10002975 | Ga0163162_1000297510 | 413 |
| 603 | 3300013306 | Ga0163162_10011395 | Ga0163162_1001139510 | 413 |
| 604 | 3300013308 | Ga0157375_10000430 | Ga0157375_1000043021 | 413 |
| 605 | 3300013308 | Ga0157375_10067479 | Ga0157375_100674793 | 413 |
| 606 | 3300013308 | Ga0157375_10084835 | Ga0157375_100848352 | 413 |
| 607 | 3300014325 | Ga0163163_10119598 | Ga0163163_101195982 | 413 |
| 608 | 3300014326 | Ga0157380_10000203 | Ga0157380_1000020323 | 413 |
| 609 | 3300014326 | Ga0157380_10204499 | Ga0157380_102044992 | 413 |
| 610 | 3300014745 | Ga0157377_10000290 | Ga0157377_100002905 | 413 |
| 611 | 3300014745 | Ga0157377_10014739 | Ga0157377_100147394 | 413 |
| 612 | 3300014968 | Ga0157379_10003225 | Ga0157379_100032253 | 413 |
| 613 | 3300014968 | Ga0157379_10033973 | Ga0157379_100339735 | 413 |
| 614 | 3300014969 | Ga0157376_10000104 | Ga0157376_1000010433 | 413 |
| 615 | 3300014969 | Ga0157376_10034976 | Ga0157376_100349762 | 413 |
| 616 | 3300014969 | Ga0157376_10086330 | Ga0157376_100863302 | 413 |
| 617 | 3300017792 | Ga0163161_10000724 | Ga0163161_100007243 | 413 |
| 618 | 3300017792 | Ga0163161_10066684 | Ga0163161_100666842 | 413 |
| 619 | 3300025261 | Ga0209233_1005712 | Ga0209233_10057123 | 413 |
| 620 | 3300025271 | Ga0207666_1000008 | Ga0207666_10000088 | 413 |
| 621 | 3300025290 | Ga0207673_1000195 | Ga0207673_10001953 | 413 |
| 622 | 3300025315 | Ga0207697_10000972 | Ga0207697_100009727 | 413 |
| 623 | 3300025885 | Ga0207653_10000374 | Ga0207653_1000037419 | 413 |
| 624 | 3300025885 | Ga0207653_10029472 | Ga0207653_100294722 | 413 |
| 625 | 3300025893 | Ga0207682_10000002 | Ga0207682_1000000217 | 413 |
| 626 | 3300025898 | Ga0207692_10033347 | Ga0207692_100333471 | 413 |
| 627 | 3300025899 | Ga0207642_10000064 | Ga0207642_1000006415 | 413 |
| 628 | 3300025900 | Ga0207710_10015153 | Ga0207710_100151533 | 413 |
| 629 | 3300025900 | Ga0207710_10031104 | Ga0207710_100311043 | 413 |
| 630 | 3300025901 | Ga0207688_10000850 | Ga0207688_1000085010 | 413 |
| 631 | 3300025901 | Ga0207688_10136516 | Ga0207688_101365161 | 413 |
| 632 | 3300025903 | Ga0207680_10145866 | Ga0207680_101458662 | 413 |
| 633 | 3300025903 | Ga0207680_10153937 | Ga0207680_101539371 | 413 |
| 634 | 3300025904 | Ga0207647_10002907 | Ga0207647_1000290711 | 413 |
| 635 | 3300025906 | Ga0207699_10005831 | Ga0207699_100058316 | 413 |
| 636 | 3300025906 | Ga0207699_10023468 | Ga0207699_100234682 | 413 |
| 637 | 3300025907 | Ga0207645_10000026 | Ga0207645_1000002613 | 413 |
| 638 | 3300025908 | Ga0207643_10000090 | Ga0207643_1000009042 | 413 |
| 639 | 3300025908 | Ga0207643_10006777 | Ga0207643_100067775 | 413 |
| 640 | 3300025909 | Ga0207705_10011264 | Ga0207705_100112646 | 413 |
| 641 | 3300025912 | Ga0207707_10060256 | Ga0207707_100602563 | 413 |
| 642 | 3300025912 | Ga0207707_10156931 | Ga0207707_101569312 | 413 |
| 643 | 3300025912 | Ga0207707_10326852 | Ga0207707_103268521 | 413 |
| 644 | 3300025913 | Ga0207695_10073797 | Ga0207695_100737973 | 413 |
| 645 | 3300025914 | Ga0207671_10031527 | Ga0207671_100315274 | 413 |
| 646 | 3300025915 | Ga0207693_10006780 | Ga0207693_100067806 | 413 |
| 647 | 3300025915 | Ga0207693_10007813 | Ga0207693_100078132 | 413 |
| 648 | 3300025915 | Ga0207693_10014507 | Ga0207693_100145074 | 413 |
| 649 | 3300025915 | Ga0207693_10020815 | Ga0207693_100208153 | 413 |
| 650 | 3300025917 | Ga0207660_10000374 | Ga0207660_1000037410 | 413 |
| 651 | 3300025917 | Ga0207660_10030691 | Ga0207660_100306914 | 413 |
| 652 | 3300025917 | Ga0207660_10053001 | Ga0207660_100530013 | 413 |
| 653 | 3300025918 | Ga0207662_10000244 | Ga0207662_100002447 | 413 |
| 654 | 3300025918 | Ga0207662_10000473 | Ga0207662_1000047311 | 413 |
| 655 | 3300025918 | Ga0207662_10001021 | Ga0207662_1000102112 | 413 |
| 656 | 3300025919 | Ga0207657_10001644 | Ga0207657_100016447 | 413 |
| 657 | 3300025919 | Ga0207657_10008488 | Ga0207657_100084884 | 413 |
| 658 | 3300025919 | Ga0207657_10097515 | Ga0207657_100975152 | 413 |
| 659 | 3300025919 | Ga0207657_10124392 | Ga0207657_101243922 | 413 |
| 660 | 3300025920 | Ga0207649_10000143 | Ga0207649_1000014354 | 413 |
| 661 | 3300025921 | Ga0207652_10003863 | Ga0207652_1000386310 | 413 |
| 662 | 3300025923 | Ga0207681_10000457 | Ga0207681_1000045712 | 413 |
| 663 | 3300025923 | Ga0207681_10118699 | Ga0207681_101186992 | 413 |
| 664 | 3300025924 | Ga0207694_10053905 | Ga0207694_100539052 | 413 |
| 665 | 3300025925 | Ga0207650_10081524 | Ga0207650_100815242 | 413 |
| 666 | 3300025926 | Ga0207659_10000015 | Ga0207659_1000001582 | 413 |
| 667 | 3300025926 | Ga0207659_10048394 | Ga0207659_100483942 | 413 |
| 668 | 3300025927 | Ga0207687_10000543 | Ga0207687_100005436 | 413 |
| 669 | 3300025927 | Ga0207687_10019356 | Ga0207687_100193565 | 413 |
| 670 | 3300025928 | Ga0207700_10012884 | Ga0207700_100128845 | 413 |
| 671 | 3300025928 | Ga0207700_10130082 | Ga0207700_101300822 | 413 |
| 672 | 3300025931 | Ga0207644_10000463 | Ga0207644_1000046313 | 413 |
| 673 | 3300025931 | Ga0207644_10024447 | Ga0207644_100244473 | 413 |
| 674 | 3300025931 | Ga0207644_10092329 | Ga0207644_100923292 | 413 |
| 675 | 3300025932 | Ga0207690_10000397 | Ga0207690_1000039720 | 413 |
| 676 | 3300025933 | Ga0207706_10001387 | Ga0207706_100013877 | 413 |
| 677 | 3300025933 | Ga0207706_10008224 | Ga0207706_100082249 | 413 |
| 678 | 3300025933 | Ga0207706_10028751 | Ga0207706_100287515 | 413 |
| 679 | 3300025934 | Ga0207686_10000065 | Ga0207686_1000006553 | 413 |
| 680 | 3300025934 | Ga0207686_10019330 | Ga0207686_100193303 | 413 |
| 681 | 3300025934 | Ga0207686_10027500 | Ga0207686_100275002 | 413 |
| 682 | 3300025935 | Ga0207709_10000081 | Ga0207709_1000008169 | 413 |
| 683 | 3300025935 | Ga0207709_10002863 | Ga0207709_100028637 | 413 |
| 684 | 3300025936 | Ga0207670_10000056 | Ga0207670_1000005626 | 413 |
| 685 | 3300025936 | Ga0207670_10009248 | Ga0207670_100092483 | 413 |
| 686 | 3300025936 | Ga0207670_10032470 | Ga0207670_100324702 | 413 |
| 687 | 3300025937 | Ga0207669_10000008 | Ga0207669_1000000880 | 413 |
| 688 | 3300025938 | Ga0207704_10000031 | Ga0207704_1000003196 | 413 |
| 689 | 3300025938 | Ga0207704_10012582 | Ga0207704_100125822 | 413 |
| 690 | 3300025938 | Ga0207704_10018925 | Ga0207704_100189253 | 413 |
| 691 | 3300025940 | Ga0207691_10001398 | Ga0207691_100013987 | 413 |
| 692 | 3300025940 | Ga0207691_10003704 | Ga0207691_100037047 | 413 |
| 693 | 3300025941 | Ga0207711_10001138 | Ga0207711_100011382 | 413 |
| 694 | 3300025941 | Ga0207711_10076645 | Ga0207711_100766453 | 413 |
| 695 | 3300025942 | Ga0207689_10000772 | Ga0207689_1000077222 | 413 |
| 696 | 3300025942 | Ga0207689_10002348 | Ga0207689_100023485 | 413 |
| 697 | 3300025942 | Ga0207689_10018494 | Ga0207689_100184943 | 413 |
| 698 | 3300025942 | Ga0207689_10071406 | Ga0207689_100714062 | 413 |
| 699 | 3300025944 | Ga0207661_10000255 | Ga0207661_1000025528 | 413 |
| 700 | 3300025945 | Ga0207679_10000014 | Ga0207679_1000001421 | 413 |
| 701 | 3300025945 | Ga0207679_10133870 | Ga0207679_101338702 | 413 |
| 702 | 3300025949 | Ga0207667_10010693 | Ga0207667_100106936 | 413 |
| 703 | 3300025949 | Ga0207667_10039605 | Ga0207667_100396052 | 413 |
| 704 | 3300025960 | Ga0207651_10000055 | Ga0207651_1000005538 | 413 |
| 705 | 3300025960 | Ga0207651_10077553 | Ga0207651_100775532 | 413 |
| 706 | 3300025961 | Ga0207712_10002119 | Ga0207712_100021198 | 413 |
| 707 | 3300025961 | Ga0207712_10002532 | Ga0207712_100025322 | 413 |
| 708 | 3300025961 | Ga0207712_10033210 | Ga0207712_100332103 | 413 |
| 709 | 3300025961 | Ga0207712_10040509 | Ga0207712_100405093 | 413 |
| 710 | 3300025961 | Ga0207712_10071181 | Ga0207712_100711813 | 413 |
| 711 | 3300025972 | Ga0207668_10000037 | Ga0207668_1000003785 | 413 |
| 712 | 3300025972 | Ga0207668_10026112 | Ga0207668_100261123 | 413 |
| 713 | 3300025981 | Ga0207640_10001137 | Ga0207640_1000113710 | 413 |
| 714 | 3300025986 | Ga0207658_10002855 | Ga0207658_100028552 | 413 |
| 715 | 3300026023 | Ga0207677_10000363 | Ga0207677_1000036315 | 413 |
| 716 | 3300026023 | Ga0207677_10017614 | Ga0207677_100176143 | 413 |
| 717 | 3300026023 | Ga0207677_10246966 | Ga0207677_102469662 | 413 |
| 718 | 3300026035 | Ga0207703_10000858 | Ga0207703_1000085826 | 413 |
| 719 | 3300026035 | Ga0207703_10033233 | Ga0207703_100332334 | 413 |
| 720 | 3300026041 | Ga0207639_10000903 | Ga0207639_1000090316 | 413 |
| 721 | 3300026067 | Ga0207678_10000372 | Ga0207678_100003727 | 413 |
| 722 | 3300026067 | Ga0207678_10069749 | Ga0207678_100697493 | 413 |
| 723 | 3300026067 | Ga0207678_10078943 | Ga0207678_100789432 | 413 |
| 724 | 3300026075 | Ga0207708_10000460 | Ga0207708_1000046017 | 413 |
| 725 | 3300026075 | Ga0207708_10001478 | Ga0207708_1000147810 | 413 |
| 726 | 3300026075 | Ga0207708_10002409 | Ga0207708_100024097 | 413 |
| 727 | 3300026075 | Ga0207708_10089575 | Ga0207708_100895752 | 413 |
| 728 | 3300026078 | Ga0207702_10001048 | Ga0207702_1000104815 | 413 |
| 729 | 3300026078 | Ga0207702_10070691 | Ga0207702_100706913 | 413 |
| 730 | 3300026088 | Ga0207641_10002957 | Ga0207641_1000295715 | 413 |
| 731 | 3300026088 | Ga0207641_10057553 | Ga0207641_100575532 | 413 |
| 732 | 3300026089 | Ga0207648_10001536 | Ga0207648_100015368 | 413 |
| 733 | 3300026089 | Ga0207648_10004845 | Ga0207648_1000484510 | 413 |
| 734 | 3300026095 | Ga0207676_10000483 | Ga0207676_1000048327 | 413 |
| 735 | 3300026095 | Ga0207676_10006265 | Ga0207676_100062654 | 413 |
| 736 | 3300026095 | Ga0207676_10012844 | Ga0207676_100128445 | 413 |
| 737 | 3300026116 | Ga0207674_10002391 | Ga0207674_1000239112 | 413 |
| 738 | 3300026116 | Ga0207674_10012453 | Ga0207674_100124535 | 413 |
| 739 | 3300026118 | Ga0207675_100000231 | Ga0207675_10000023135 | 413 |
| 740 | 3300026118 | Ga0207675_100007144 | Ga0207675_1000071448 | 413 |
| 741 | 3300026118 | Ga0207675_100039730 | Ga0207675_1000397302 | 413 |
| 742 | 3300026118 | Ga0207675_100150405 | Ga0207675_1001504053 | 413 |
| 743 | 3300026121 | Ga0207683_10000002 | Ga0207683_10000002204 | 413 |
| 744 | 3300026121 | Ga0207683_10006794 | Ga0207683_1000679411 | 413 |
| 745 | 3300026121 | Ga0207683_10020956 | Ga0207683_100209564 | 413 |
| 746 | 3300026121 | Ga0207683_10023336 | Ga0207683_100233364 | 413 |
| 747 | 3300026142 | Ga0207698_10009377 | Ga0207698_100093776 | 413 |
| 748 | 3300026142 | Ga0207698_10056437 | Ga0207698_100564373 | 413 |
| 749 | 3300027617 | Ga0210002_1000756 | Ga0210002_10007562 | 413 |
| 750 | 3300027695 | Ga0209966_1000521 | Ga0209966_10005216 | 413 |
| 751 | 3300027717 | Ga0209998_10002232 | Ga0209998_100022323 | 413 |
| 752 | 3300027717 | Ga0209998_10006254 | Ga0209998_100062542 | 413 |
| 753 | 3300027876 | Ga0209974_10001820 | Ga0209974_100018208 | 413 |
| 754 | 3300027907 | Ga0207428_10000011 | Ga0207428_1000001198 | 413 |
| 755 | 3300027907 | Ga0207428_10000046 | Ga0207428_1000004682 | 413 |
| 756 | 3300027907 | Ga0207428_10000058 | Ga0207428_1000005818 | 413 |
| 757 | 3300027907 | Ga0207428_10002321 | Ga0207428_1000232117 | 413 |
| 758 | 3300028379 | Ga0268266_10041930 | Ga0268266_100419304 | 413 |
| 759 | 3300028379 | Ga0268266_10146264 | Ga0268266_101462642 | 413 |
| 760 | 3300028379 | Ga0268266_10153726 | Ga0268266_101537262 | 413 |
| 761 | 3300028380 | Ga0268265_10000117 | Ga0268265_1000011753 | 413 |
| 762 | 3300028380 | Ga0268265_10003608 | Ga0268265_100036087 | 413 |
| 763 | 3300028380 | Ga0268265_10043471 | Ga0268265_100434714 | 413 |
| 764 | 3300028381 | Ga0268264_10000487 | Ga0268264_1000048717 | 413 |
| 765 | 3300028381 | Ga0268264_10001467 | Ga0268264_100014679 | 413 |
| 766 | 3300028381 | Ga0268264_10086083 | Ga0268264_100860832 | 413 |
| 767 | 3300031235 | Ga0265330_10017416 | Ga0265330_100174163 | 413 |
| 768 | 3300031235 | Ga0265330_10048501 | Ga0265330_100485011 | 413 |
| 769 | 3300031241 | Ga0265325_10000062 | Ga0265325_1000006251 | 413 |
| 770 | 3300031241 | Ga0265325_10003451 | Ga0265325_100034515 | 413 |
| 771 | 3300031250 | Ga0265331_10005011 | Ga0265331_100050119 | 413 |
| 772 | 3300031344 | Ga0265316_10095710 | Ga0265316_100957103 | 413 |
| 773 | 3300031344 | Ga0265316_10209046 | Ga0265316_102090461 | 413 |
| 774 | 3300031595 | Ga0265313_10000524 | Ga0265313_100005242 | 413 |
| 775 | 3300031595 | Ga0265313_10047917 | Ga0265313_100479173 | 413 |
| 776 | 3300031711 | Ga0265314_10000419 | Ga0265314_100004191 | 413 |
| 777 | 3300031711 | Ga0265314_10008641 | Ga0265314_100086413 | 413 |
| 778 | 3300031712 | Ga0265342_10000256 | Ga0265342_1000025646 | 413 |
| 779 | 3300031712 | Ga0265342_10056280 | Ga0265342_100562802 | 413 |
| 780 | 3300034816 | Ga0373930_0000298 | Ga0373930_0000298_905_2146 | 413 |
| 781 | 3300034817 | Ga0373948_0000018 | Ga0373948_0000018_4342_5583 | 413 |
| 782 | 3300034817 | Ga0373948_0008122 | Ga0373948_0008122_185_1426 | 413 |
| 783 | 3300034820 | Ga0373959_0001867 | Ga0373959_0001867_1779_3020 | 413 |
| 784 | 3300034820 | Ga0373959_0002399 | Ga0373959_0002399_1150_2391 | 413 |
| 785 | 3300034957 | Ga0373938_0002615 | Ga0373938_0002615_1422_2663 | 413 |
| 786 | 3300035083 | Ga0373926_0001552 | Ga0373926_0001552_3995_5257 | 413 |
| 787 | 3300035084 | Ga0373928_0002316 | Ga0373928_0002316_1326_2567 | 413 |
| 788 | 3300035084 | Ga0373928_0004518 | Ga0373928_0004518_327_1568 | 413 |
| 789 | 3300035085 | Ga0373929_0008373 | Ga0373929_0008373_529_1770 | 413 |
| 790 | 3300035086 | Ga0373934_0002917 | Ga0373934_0002917_3242_4483 | 413 |
| 791 | 3300035088 | Ga0373940_0000354 | Ga0373940_0000354_1841_3082 | 413 |
| 792 | 3300035089 | Ga0373944_0005358 | Ga0373944_0005358_1533_2774 | 413 |
| 793 | 3300035090 | Ga0373949_0000408 | Ga0373949_0000408_13336_14577 | 413 |
| 794 | 3300035090 | Ga0373949_0004126 | Ga0373949_0004126_1525_2793 | 413 |
| 795 | 3300035091 | Ga0373951_0003513 | Ga0373951_0003513_273_1514 | 413 |
| 796 | 3300035092 | Ga0373952_0000056 | Ga0373952_0000056_11290_12531 | 413 |
| 797 | 3300035092 | Ga0373952_0000964 | Ga0373952_0000964_3576_4817 | 413 |
| 798 | 3300035111 | Ga0373923_0005076 | Ga0373923_0005076_57_1319 | 413 |
| 799 | 3300035112 | Ga0373932_0000734 | Ga0373932_0000734_3988_5229 | 413 |
| 800 | 3300035112 | Ga0373932_0001197 | Ga0373932_0001197_954_2222 | 413 |
| 801 | 3300035112 | Ga0373932_0013506 | Ga0373932_0013506_565_1806 | 413 |
| 802 | 3300035113 | Ga0373936_0008301 | Ga0373936_0008301_2579_3820 | 413 |
| 803 | 3300035114 | Ga0373939_0000559 | Ga0373939_0000559_3279_4520 | 413 |
| 804 | 3300035115 | Ga0373941_0000709 | Ga0373941_0000709_3988_5229 | 413 |
| 805 | 3300035116 | Ga0373945_0003571 | Ga0373945_0003571_2804_4045 | 413 |
| 806 | 3300035116 | Ga0373945_0009489 | Ga0373945_0009489_654_1916 | 413 |
| 807 | 3300035117 | Ga0373953_0006521 | Ga0373953_0006521_567_1844 | 413 |
| 808 | 3300035117 | Ga0373953_0023897 | Ga0373953_0023897_248_1489 | 413 |
| 809 | 3300035118 | Ga0373954_0003029 | Ga0373954_0003029_3250_4491 | 413 |
| 810 | 3300035118 | Ga0373954_0004278 | Ga0373954_0004278_3217_4494 | 413 |
| 811 | 3300035118 | Ga0373954_0040237 | Ga0373954_0040237_159_1400 | 413 |
| 812 | 3300035119 | Ga0373956_0002599 | Ga0373956_0002599_52_1293 | 413 |
| 813 | 3300035119 | Ga0373956_0004206 | Ga0373956_0004206_3439_4716 | 413 |
| 814 | 3300035120 | Ga0373957_0003413 | Ga0373957_0003413_2746_4023 | 413 |
| 815 | 3300035121 | Ga0373960_0001479 | Ga0373960_0001479_3473_4714 | 413 |
| 816 | 3300035121 | Ga0373960_0002840 | Ga0373960_0002840_1771_3039 | 413 |
| 817 | 3300035170 | Ga0373943_0000352 | Ga0373943_0000352_9781_11022 | 413 |
| 818 | 3300035171 | Ga0373946_0001249 | Ga0373946_0001249_1575_2816 | 413 |
| 819 | 3300035171 | Ga0373946_0006482 | Ga0373946_0006482_2092_3333 | 413 |
| 820 | 3300035171 | Ga0373946_0023711 | Ga0373946_0023711_589_1830 | 413 |
| 821 | 3300035207 | Ga0373942_0000491 | Ga0373942_0000491_3240_4508 | 413 |
| 822 | 3300035207 | Ga0373942_0002258 | Ga0373942_0002258_1460_2701 | 413 |
| 823 | 3300035241 | Ga0373961_0001829 | Ga0373961_0001829_2986_4227 | 413 |
| 824 | 3300035241 | Ga0373961_0004217 | Ga0373961_0004217_1737_3005 | 413 |
| 825 | 3300035242 | Ga0373962_0000574 | Ga0373962_0000574_2908_4176 | 413 |
| 826 | 3300035691 | Ga0373931_0000087 | Ga0373931_0000087_14722_15963 | 413 |
| 827 | 3300035692 | Ga0373935_0018763 | Ga0373935_0018763_1615_2856 | 413 |
| 828 | 3300035695 | Ga0373927_0004615 | Ga0373927_0004615_3080_4321 | 413 |
| 829 | 3300035695 | Ga0373927_0034470 | Ga0373927_0034470_1684_2946 | 413 |
| 830 | 3300035724 | Ga0373933_0003625 | Ga0373933_0003625_6293_7534 | 413 |
| 831 | 3300035724 | Ga0373933_0066951 | Ga0373933_0066951_758_2041 | 413 |
| 832 | 3300035725 | Ga0373947_0002498 | Ga0373947_0002498_7442_8683 | 413 |
| 833 | 3300035725 | Ga0373947_0003411 | Ga0373947_0003411_2963_4204 | 413 |
| 834 | 3300036401 | Ga0373937_0000851 | Ga0373937_0000851_15388_16629 | 413 |
| 835 | 3300036401 | Ga0373937_0000862 | Ga0373937_0000862_19882_21123 | 413 |
| 836 | 3300036401 | Ga0373937_0006835 | Ga0373937_0006835_2784_4025 | 413 |
| 837 | 3300036401 | Ga0373937_0009142 | Ga0373937_0009142_1500_2777 | 413 |
| 838 | 3300036401 | Ga0373937_0009393 | Ga0373937_0009393_1496_2737 | 413 |
| 839 | 3300036401 | Ga0373937_0093118 | Ga0373937_0093118_1512_2753 | 413 |
| 840 | 3300036401 | Ga0373937_0224279 | Ga0373937_0224279_384_1637 | 413 |
| 841 | 3300037068 | Ga0373925_0005584 | Ga0373925_0005584_5256_6497 | 413 |
| 842 | 3300037068 | Ga0373925_0013965 | Ga0373925_0013965_2570_3811 | 413 |
| 843 | 3300037418 | Ga0395900_0002893 | Ga0395900_0002893_8806_10047 | 413 |
| 844 | 3300037418 | Ga0395900_0045160 | Ga0395900_0045160_1777_3018 | 413 |
| 845 | 3300037466 | Ga0395898_0003726 | Ga0395898_0003726_6855_8096 | 413 |
| 846 | 3300038443 | Ga0395901_0074904 | Ga0395901_0074904_2066_3307 | 413 |
| 847 | 3300039450 | Ga0436363_1497978 | Ga0436363_1497978_278_1534 | 413 |
| 848 | 3300042436 | Ga0439435_0032346 | Ga0439435_0032346_70_1311 | 413 |
| 849 | 3300044693 | Ga0466961_0067381 | Ga0466961_0067381_461_1702 | 413 |
| 850 | 3300044694 | Ga0466963_0040007 | Ga0466963_0040007_1175_2416 | 413 |
| 851 | 3300044712 | Ga0453684_0036104 | Ga0453684_0036104_382_1623 | 413 |
| 852 | 3300044842 | Ga0466957_0051056 | Ga0466957_0051056_80_1321 | 413 |
| 853 | 3300045049 | Ga0466959_0054770 | Ga0466959_0054770_600_1841 | 413 |
| 854 | 3300045051 | Ga0451576_0061573 | Ga0451576_0061573_304_1545 | 413 |
| 855 | 3300045976 | Ga0466967_0001672 | Ga0466967_0001672_2412_3653 | 413 |
| 856 | 3300046454 | Ga0495592_0010297 | Ga0495592_0010297_3933_5174 | 413 |
| 857 | 3300046454 | Ga0495592_0011377 | Ga0495592_0011377_3476_4717 | 413 |
| 858 | 3300046454 | Ga0495592_0032282 | Ga0495592_0032282_410_1687 | 413 |
| 859 | 3300046454 | Ga0495592_0118130 | Ga0495592_0118130_604_1845 | 413 |
| 860 | 3300046459 | Ga0495629_0003086 | Ga0495629_0003086_5495_6736 | 413 |
| 861 | 3300046461 | Ga0495641_0030804 | Ga0495641_0030804_792_2033 | 413 |
| 862 | 3300046462 | Ga0495651_0007457 | Ga0495651_0007457_2299_3576 | 413 |
| 863 | 3300046462 | Ga0495651_0021404 | Ga0495651_0021404_523_1764 | 413 |
| 864 | 3300046462 | Ga0495651_0038247 | Ga0495651_0038247_185_1426 | 413 |
| 865 | 3300046463 | Ga0495653_0002676 | Ga0495653_0002676_10718_11995 | 413 |
| 866 | 3300046463 | Ga0495653_0013738 | Ga0495653_0013738_30_1271 | 413 |
| 867 | 3300046463 | Ga0495653_0023498 | Ga0495653_0023498_3633_4874 | 413 |
| 868 | 3300046472 | Ga0495580_0014862 | Ga0495580_0014862_4615_5856 | 413 |
| 869 | 3300046472 | Ga0495580_0025839 | Ga0495580_0025839_2911_4173 | 413 |
| 870 | 3300046472 | Ga0495580_0028983 | Ga0495580_0028983_62_1303 | 413 |
| 871 | 3300046473 | Ga0495582_0001834 | Ga0495582_0001834_3215_4456 | 413 |
| 872 | 3300046474 | Ga0495605_0045697 | Ga0495605_0045697_95_1369 | 413 |
| 873 | 3300046475 | Ga0495639_0011034 | Ga0495639_0011034_2102_3364 | 413 |
| 874 | 3300046475 | Ga0495639_0038415 | Ga0495639_0038415_870_2111 | 413 |
| 875 | 3300046476 | Ga0495662_0007015 | Ga0495662_0007015_2751_3992 | 413 |
| 876 | 3300046476 | Ga0495662_0007266 | Ga0495662_0007266_3875_5137 | 413 |
| 877 | 3300046476 | Ga0495662_0080640 | Ga0495662_0080640_24_1265 | 413 |
| 878 | 3300046477 | Ga0495664_0000398 | Ga0495664_0000398_12257_13498 | 413 |
| 879 | 3300046477 | Ga0495664_0001582 | Ga0495664_0001582_3628_4905 | 413 |
| 880 | 3300046491 | Ga0495584_0014313 | Ga0495584_0014313_2207_3448 | 413 |
| 881 | 3300046491 | Ga0495584_0129666 | Ga0495584_0129666_13_1254 | 413 |
| 882 | 3300046492 | Ga0495585_0012227 | Ga0495585_0012227_2706_3947 | 413 |
| 883 | 3300046492 | Ga0495585_0068626 | Ga0495585_0068626_452_1747 | 413 |
| 884 | 3300046511 | Ga0495608_0006901 | Ga0495608_0006901_3916_5157 | 413 |
| 885 | 3300046511 | Ga0495608_0030439 | Ga0495608_0030439_494_1735 | 413 |
| 886 | 3300046513 | Ga0495616_0065451 | Ga0495616_0065451_166_1461 | 413 |
| 887 | 3300046514 | Ga0495618_0001798 | Ga0495618_0001798_1031_2272 | 413 |
| 888 | 3300046514 | Ga0495618_0004894 | Ga0495618_0004894_1047_2324 | 413 |
| 889 | 3300046516 | Ga0495628_0021800 | Ga0495628_0021800_324_1565 | 413 |
| 890 | 3300046516 | Ga0495628_0076649 | Ga0495628_0076649_477_1754 | 413 |
| 891 | 3300046516 | Ga0495628_0133533 | Ga0495628_0133533_496_1737 | 413 |
| 892 | 3300046517 | Ga0495630_0005356 | Ga0495630_0005356_2525_3766 | 413 |
| 893 | 3300046518 | Ga0495631_0056938 | Ga0495631_0056938_95_1390 | 413 |
| 894 | 3300046520 | Ga0495637_0016284 | Ga0495637_0016284_720_1961 | 413 |
| 895 | 3300046526 | Ga0495666_0004260 | Ga0495666_0004260_3852_5114 | 413 |
| 896 | 3300046526 | Ga0495666_0045386 | Ga0495666_0045386_572_1813 | 413 |
| 897 | 3300046529 | Ga0495652_0000531 | Ga0495652_0000531_20396_21637 | 413 |
| 898 | 3300046529 | Ga0495652_0108200 | Ga0495652_0108200_106_1368 | 413 |
| 899 | 3300046531 | Ga0495665_0001228 | Ga0495665_0001228_289_1530 | 413 |
| 900 | 3300046531 | Ga0495665_0009811 | Ga0495665_0009811_1831_3093 | 413 |
| 901 | 3300046531 | Ga0495665_0027512 | Ga0495665_0027512_69_1310 | 413 |
| 902 | 3300046531 | Ga0495665_0058379 | Ga0495665_0058379_242_1483 | 413 |
| 903 | 3300046533 | Ga0495640_0001922 | Ga0495640_0001922_2968_4209 | 413 |
| 904 | 3300046533 | Ga0495640_0013247 | Ga0495640_0013247_4478_5740 | 413 |
| 905 | 3300046533 | Ga0495640_0058291 | Ga0495640_0058291_813_2054 | 413 |
| 906 | 3300046535 | Ga0495586_0012528 | Ga0495586_0012528_1750_3012 | 413 |
| 907 | 3300046535 | Ga0495586_0026452 | Ga0495586_0026452_901_2142 | 413 |
| 908 | 3300046535 | Ga0495586_0033699 | Ga0495586_0033699_1087_2328 | 413 |
| 909 | 3300046536 | Ga0495587_0016396 | Ga0495587_0016396_1293_2534 | 413 |
| 910 | 3300046536 | Ga0495587_0016549 | Ga0495587_0016549_2349_3590 | 413 |
| 911 | 3300046536 | Ga0495587_0032503 | Ga0495587_0032503_477_1754 | 413 |
| 912 | 3300046536 | Ga0495587_0037736 | Ga0495587_0037736_1557_2840 | 413 |
| 913 | 3300046536 | Ga0495587_0053294 | Ga0495587_0053294_70_1311 | 413 |
| 914 | 3300046537 | Ga0495598_0001181 | Ga0495598_0001181_1150_2445 | 413 |
| 915 | 3300046539 | Ga0495621_0020185 | Ga0495621_0020185_600_1841 | 413 |
| 916 | 3300046543 | Ga0495645_0001513 | Ga0495645_0001513_9060_10337 | 413 |
| 917 | 3300046543 | Ga0495645_0002097 | Ga0495645_0002097_6079_7320 | 413 |
| 918 | 3300046543 | Ga0495645_0003462 | Ga0495645_0003462_423_1664 | 413 |
| 919 | 3300046557 | Ga0495622_0017216 | Ga0495622_0017216_1787_3028 | 413 |
| 920 | 3300046557 | Ga0495622_0026865 | Ga0495622_0026865_37_1299 | 413 |
| 921 | 3300046558 | Ga0495633_0013739 | Ga0495633_0013739_428_1723 | 413 |
| 922 | 3300046558 | Ga0495633_0027931 | Ga0495633_0027931_601_1842 | 413 |
| 923 | 3300046559 | Ga0495667_0003336 | Ga0495667_0003336_7909_9186 | 413 |
| 924 | 3300046559 | Ga0495667_0004207 | Ga0495667_0004207_7508_8749 | 413 |
| 925 | 3300046559 | Ga0495667_0009091 | Ga0495667_0009091_1550_2791 | 413 |
| 926 | 3300046559 | Ga0495667_0023502 | Ga0495667_0023502_2043_3284 | 413 |
| 927 | 3300046615 | Ga0495656_0000729 | Ga0495656_0000729_537_1778 | 413 |
| 928 | 3300046615 | Ga0495656_0004585 | Ga0495656_0004585_1283_2578 | 413 |
| 929 | 3300046642 | Ga0495634_0004091 | Ga0495634_0004091_9081_10322 | 413 |
| 930 | 3300046642 | Ga0495634_0006411 | Ga0495634_0006411_6967_8208 | 413 |
| 931 | 3300046663 | Ga0495635_0003726 | Ga0495635_0003726_7227_8504 | 413 |
| 932 | 3300046663 | Ga0495635_0006571 | Ga0495635_0006571_851_2092 | 413 |
| 933 | 3300046663 | Ga0495635_0006850 | Ga0495635_0006850_1370_2611 | 413 |
| 934 | 3300046664 | Ga0495659_0016235 | Ga0495659_0016235_719_2014 | 413 |
| 935 | 3300046664 | Ga0495659_0018915 | Ga0495659_0018915_915_2156 | 413 |
| 936 | 3300046674 | Ga0495588_0046617 | Ga0495588_0046617_688_1929 | 413 |
| 937 | 3300046675 | Ga0495657_0002845 | Ga0495657_0002845_3735_5012 | 413 |
| 938 | 3300046675 | Ga0495657_0010336 | Ga0495657_0010336_2853_4094 | 413 |
| 939 | 3300046675 | Ga0495657_0024564 | Ga0495657_0024564_2789_4030 | 413 |
| 940 | 3300046678 | Ga0495599_0001644 | Ga0495599_0001644_6711_7988 | 413 |
| 941 | 3300046678 | Ga0495599_0096207 | Ga0495599_0096207_83_1324 | 413 |
| 942 | 3300046679 | Ga0495623_0000187 | Ga0495623_0000187_20111_21388 | 413 |
| 943 | 3300046681 | Ga0495647_0003806 | Ga0495647_0003806_1480_2742 | 413 |
| 944 | 3300046681 | Ga0495647_0026338 | Ga0495647_0026338_820_2061 | 413 |
| 945 | 3300046683 | Ga0495658_0001330 | Ga0495658_0001330_4512_5753 | 413 |
| 946 | 3300046689 | Ga0495613_0046701 | Ga0495613_0046701_751_1992 | 413 |
| 947 | 3300046690 | Ga0495624_0001710 | Ga0495624_0001710_15494_16735 | 413 |
| 948 | 3300046690 | Ga0495624_0014147 | Ga0495624_0014147_4011_5252 | 413 |
| 949 | 3300046794 | Ga0495589_0045992 | Ga0495589_0045992_588_1883 | 413 |
| 950 | 3300046809 | Ga0495600_0012966 | Ga0495600_0012966_57_1340 | 413 |
| 951 | 3300046809 | Ga0495600_0065394 | Ga0495600_0065394_677_1918 | 413 |
| 952 | 3300047315 | Ga0495581_0036727 | Ga0495581_0036727_526_1767 | 413 |
| 953 | 3300047317 | Ga0495604_0002167 | Ga0495604_0002167_8271_9512 | 413 |
| 954 | 3300047317 | Ga0495604_0004215 | Ga0495604_0004215_7784_9061 | 413 |
| 955 | 3300047319 | Ga0495674_0012504 | Ga0495674_0012504_934_2175 | 413 |
| 956 | 3300047321 | Ga0495676_0048198 | Ga0495676_0048198_334_1596 | 413 |
| 957 | 3300047322 | Ga0495680_0001596 | Ga0495680_0001596_17177_18418 | 413 |
| 958 | 3300047322 | Ga0495680_0007052 | Ga0495680_0007052_8411_9688 | 413 |
| 959 | 3300047322 | Ga0495680_0025820 | Ga0495680_0025820_251_1534 | 413 |
| 960 | 3300047322 | Ga0495680_0110221 | Ga0495680_0110221_398_1639 | 413 |
| 961 | 3300047444 | Ga0495675_0000781 | Ga0495675_0000781_10170_11447 | 413 |
| 962 | 3300047444 | Ga0495675_0013134 | Ga0495675_0013134_1259_2500 | 413 |
| 963 | 3300047471 | Ga0495684_0002371 | Ga0495684_0002371_9657_10898 | 413 |
| 964 | 3300047471 | Ga0495684_0007415 | Ga0495684_0007415_5271_6512 | 413 |
| 965 | 3300047471 | Ga0495684_0044558 | Ga0495684_0044558_802_2043 | 413 |
| 966 | 3300047471 | Ga0495684_0131914 | Ga0495684_0131914_407_1648 | 413 |
| 967 | 3300047471 | Ga0495684_0168033 | Ga0495684_0168033_54_1337 | 413 |
| 968 | 3300047673 | Ga0495593_0008885 | Ga0495593_0008885_706_1947 | 413 |
| 969 | 3300047673 | Ga0495593_0013963 | Ga0495593_0013963_1595_2857 | 413 |
| 970 | 3300047673 | Ga0495593_0014466 | Ga0495593_0014466_2730_3971 | 413 |
| 971 | 3300047673 | Ga0495593_0078618 | Ga0495593_0078618_78_1361 | 413 |
| 972 | 3300048088 | Ga0495602_0004816 | Ga0495602_0004816_2672_3949 | 413 |
| 973 | 3300048088 | Ga0495602_0013239 | Ga0495602_0013239_4547_5788 | 413 |
| 974 | 3300048088 | Ga0495602_0104729 | Ga0495602_0104729_592_1848 | 413 |
| 975 | 3300048088 | Ga0495602_0227881 | Ga0495602_0227881_101_1342 | 413 |
| 976 | 3300048089 | Ga0495614_0023802 | Ga0495614_0023802_835_2097 | 413 |
| 977 | 3300048903 | Ga0496100_0000283 | Ga0496100_0000283_23833_25074 | 413 |
| 978 | 3300048903 | Ga0496100_0062330 | Ga0496100_0062330_855_2150 | 413 |
| 979 | 3300048904 | Ga0496101_0000434 | Ga0496101_0000434_21575_22816 | 413 |
| 980 | 3300048904 | Ga0496101_0034822 | Ga0496101_0034822_319_1596 | 413 |
| 981 | 3300048905 | Ga0496102_0067010 | Ga0496102_0067010_1479_2720 | 413 |
| 982 | 3300048905 | Ga0496102_0078004 | Ga0496102_0078004_601_1875 | 413 |
| 983 | 3300048905 | Ga0496102_0098203 | Ga0496102_0098203_105_1367 | 413 |
| 984 | 3300048905 | Ga0496102_0131327 | Ga0496102_0131327_733_2010 | 413 |
| 985 | 3300048906 | Ga0496103_0000686 | Ga0496103_0000686_14635_15903 | 413 |
| 986 | 3300048906 | Ga0496103_0011234 | Ga0496103_0011234_2376_3671 | 413 |
| 987 | 3300048906 | Ga0496103_0040115 | Ga0496103_0040115_1623_2864 | 413 |
| 988 | 3300048907 | Ga0496104_0000273 | Ga0496104_0000273_31455_32696 | 413 |
| 989 | 3300048907 | Ga0496104_0038056 | Ga0496104_0038056_2188_3429 | 413 |
| 990 | 3300048907 | Ga0496104_0075907 | Ga0496104_0075907_1574_2815 | 413 |
| 991 | 3300048907 | Ga0496104_0083230 | Ga0496104_0083230_318_1574 | 413 |
| 992 | 3300048907 | Ga0496104_0125327 | Ga0496104_0125327_381_1658 | 413 |
| 993 | 3300048907 | Ga0496104_0358508 | Ga0496104_0358508_101_1342 | 413 |
| 994 | 3300048908 | Ga0496105_0006140 | Ga0496105_0006140_5821_7116 | 413 |
| 995 | 3300048908 | Ga0496105_0013298 | Ga0496105_0013298_3033_4310 | 413 |
| 996 | 3300048908 | Ga0496105_0033860 | Ga0496105_0033860_2781_4022 | 413 |
| 997 | 3300048908 | Ga0496105_0146919 | Ga0496105_0146919_521_1762 | 413 |
| 998 | 3300048909 | Ga0496106_0028030 | Ga0496106_0028030_809_2104 | 413 |
| 999 | 3300048909 | Ga0496106_0035075 | Ga0496106_0035075_402_1679 | 413 |
| 1000 | 3300048909 | Ga0496106_0042232 | Ga0496106_0042232_545_1813 | 413 |
| 1001 | 3300048909 | Ga0496106_0113553 | Ga0496106_0113553_747_2009 | 413 |
| 1002 | 3300048910 | Ga0496107_0000297 | Ga0496107_0000297_1679_2947 | 413 |
| 1003 | 3300048910 | Ga0496107_0015675 | Ga0496107_0015675_2649_3890 | 413 |
| 1004 | 3300048910 | Ga0496107_0042340 | Ga0496107_0042340_977_2218 | 413 |
| 1005 | 3300048910 | Ga0496107_0058895 | Ga0496107_0058895_878_2152 | 413 |
| 1006 | 3300048911 | Ga0496108_0013337 | Ga0496108_0013337_1098_2339 | 413 |
| 1007 | 3300048911 | Ga0496108_0016150 | Ga0496108_0016150_2024_3319 | 413 |
| 1008 | 3300048911 | Ga0496108_0079761 | Ga0496108_0079761_818_2059 | 413 |
| 1009 | 3300048911 | Ga0496108_0098184 | Ga0496108_0098184_242_1498 | 413 |
| 1010 | 3300048912 | Ga0496109_0000296 | Ga0496109_0000296_15027_16295 | 413 |
| 1011 | 3300048912 | Ga0496109_0020129 | Ga0496109_0020129_1014_2309 | 413 |
| 1012 | 3300048912 | Ga0496109_0063918 | Ga0496109_0063918_511_1752 | 413 |
| 1013 | 3300048912 | Ga0496109_0141381 | Ga0496109_0141381_721_1962 | 413 |
| 1014 | 3300048912 | Ga0496109_0168800 | Ga0496109_0168800_456_1733 | 413 |
| 1015 | 3300048913 | Ga0496110_0008408 | Ga0496110_0008408_2373_3614 | 413 |
| 1016 | 3300048913 | Ga0496110_0065699 | Ga0496110_0065699_1484_2725 | 413 |
| 1017 | 3300048913 | Ga0496110_0067933 | Ga0496110_0067933_386_1627 | 413 |
| 1018 | 3300048914 | Ga0496111_0037785 | Ga0496111_0037785_1503_2744 | 413 |
| 1019 | 3300048914 | Ga0496111_0060753 | Ga0496111_0060753_753_2048 | 413 |
| 1020 | 3300048915 | Ga0496112_0087825 | Ga0496112_0087825_689_1930 | 413 |
| 1021 | 3300048915 | Ga0496112_0109652 | Ga0496112_0109652_1238_2479 | 413 |
| 1022 | 3300048915 | Ga0496112_0173484 | Ga0496112_0173484_320_1588 | 413 |
| 1023 | 3300048915 | Ga0496112_0192343 | Ga0496112_0192343_311_1606 | 413 |
| 1024 | 3300048915 | Ga0496112_0243974 | Ga0496112_0243974_28_1269 | 413 |
| 1025 | 3300048916 | Ga0496113_0009386 | Ga0496113_0009386_2995_4236 | 413 |
| 1026 | 3300048916 | Ga0496113_0076618 | Ga0496113_0076618_330_1571 | 413 |
| 1027 | 3300048917 | Ga0496114_0001211 | Ga0496114_0001211_7911_9152 | 413 |
| 1028 | 3300048917 | Ga0496114_0022869 | Ga0496114_0022869_639_1934 | 413 |
| 1029 | 3300048917 | Ga0496114_0034114 | Ga0496114_0034114_1446_2687 | 413 |
| 1030 | 3300048918 | Ga0496115_0001319 | Ga0496115_0001319_4877_6145 | 413 |
| 1031 | 3300048918 | Ga0496115_0034865 | Ga0496115_0034865_2498_3793 | 413 |
| 1032 | 3300048918 | Ga0496115_0100422 | Ga0496115_0100422_76_1338 | 413 |
| 1033 | 3300048918 | Ga0496115_0111038 | Ga0496115_0111038_509_1750 | 413 |
| 1034 | 3300049571 | Ga0501034_0004028 | Ga0501034_0004028_14964_16205 | 413 |
| 1035 | 3300049572 | Ga0501036_0016699 | Ga0501036_0016699_3981_5222 | 413 |
| 1036 | 3300049572 | Ga0501036_0025862 | Ga0501036_0025862_923_2170 | 413 |
| 1037 | 3300049574 | Ga0501038_0031016 | Ga0501038_0031016_246_1487 | 413 |
| 1038 | 3300049575 | Ga0501039_0077028 | Ga0501039_0077028_406_1668 | 413 |
| 1039 | 3300049579 | Ga0501043_0019155 | Ga0501043_0019155_3215_4456 | 413 |
| 1040 | 3300049579 | Ga0501043_0031259 | Ga0501043_0031259_596_1837 | 413 |
| 1041 | 3300049580 | Ga0501046_0018676 | Ga0501046_0018676_4377_5618 | 413 |
| 1042 | 3300049580 | Ga0501046_0050708 | Ga0501046_0050708_1885_3126 | 413 |
| 1043 | 3300049581 | Ga0501047_0000179 | Ga0501047_0000179_37609_38850 | 413 |
| 1044 | 3300049582 | Ga0501048_0002734 | Ga0501048_0002734_3766_5007 | 413 |
| 1045 | 3300049583 | Ga0501067_0114846 | Ga0501067_0114846_16_1257 | 413 |
| 1046 | 3300049584 | Ga0501068_0045526 | Ga0501068_0045526_706_1953 | 413 |
| 1047 | 3300049585 | Ga0501069_0029347 | Ga0501069_0029347_628_1869 | 413 |
| 1048 | 3300049586 | Ga0501070_0011503 | Ga0501070_0011503_125_1366 | 413 |
| 1049 | 3300049586 | Ga0501070_0031154 | Ga0501070_0031154_2357_3598 | 413 |
| 1050 | 3300049587 | Ga0501071_0043948 | Ga0501071_0043948_756_1997 | 413 |
| 1051 | 3300049587 | Ga0501071_0057739 | Ga0501071_0057739_1180_2442 | 413 |
| 1052 | 3300049591 | Ga0501075_0049434 | Ga0501075_0049434_352_1593 | 413 |
| 1053 | 3300049592 | Ga0501076_0145372 | Ga0501076_0145372_15_1256 | 413 |
| 1054 | 3300049592 | Ga0501076_0174581 | Ga0501076_0174581_162_1403 | 413 |
| 1055 | 3300049593 | Ga0501077_0024109 | Ga0501077_0024109_2607_3848 | 413 |
| 1056 | 3300049741 | Ga0501079_0199153 | Ga0501079_0199153_287_1528 | 413 |
| 1057 | 3300049742 | Ga0501080_0001318 | Ga0501080_0001318_2978_4219 | 413 |
| 1058 | 3300049742 | Ga0501080_0031286 | Ga0501080_0031286_1661_2902 | 413 |
| 1059 | 3300049742 | Ga0501080_0040847 | Ga0501080_0040847_2259_3506 | 413 |
| 1060 | 3300049743 | Ga0501081_0000809 | Ga0501081_0000809_3866_5107 | 413 |
| 1061 | 3300049743 | Ga0501081_0058736 | Ga0501081_0058736_11_1252 | 413 |
| 1062 | 3300049744 | Ga0501083_0104261 | Ga0501083_0104261_584_1825 | 413 |
| 1063 | 3300049822 | Ga0501035_0007682 | Ga0501035_0007682_5898_7139 | 413 |
| 1064 | 3300049823 | Ga0501044_0005728 | Ga0501044_0005728_4248_5489 | 413 |
| 1065 | 3300049823 | Ga0501044_0049636 | Ga0501044_0049636_1341_2588 | 413 |
| 1066 | 3300049824 | Ga0501045_0040673 | Ga0501045_0040673_391_1653 | 413 |
| 1067 | 3300050492 | nmdc:mga0yw44_1089_c1 | nmdc:mga0yw44_1089_c1_6366_7607 | 413 |
| 1068 | 3300050494 | nmdc:mga06z11_9135_c1 | nmdc:mga06z11_9135_c1_552_1820 | 413 |
| 1069 | 3300050507 | nmdc:mga05p37_12654_c1 | nmdc:mga05p37_12654_c1_189_1466 | 413 |
| 1070 | 3300050507 | nmdc:mga05p37_35_c1 | nmdc:mga05p37_35_c1_103640_104881 | 413 |
| 1071 | 3300050508 | nmdc:mga09592_127507_c1 | nmdc:mga09592_127507_c1_330_1607 | 413 |
| 1072 | 3300050508 | nmdc:mga09592_4780_c1 | nmdc:mga09592_4780_c1_197_1438 | 413 |
| 1073 | 3300050509 | nmdc:mga0qj67_14976_c1 | nmdc:mga0qj67_14976_c1_1441_2682 | 413 |
| 1074 | 3300050509 | nmdc:mga0qj67_16122_c1 | nmdc:mga0qj67_16122_c1_1722_2963 | 413 |
| 1075 | 3300050509 | nmdc:mga0qj67_7319_c1 | nmdc:mga0qj67_7319_c1_5880_7157 | 413 |
| 1076 | 3300050510 | nmdc:mga06r32_27981_c1 | nmdc:mga06r32_27981_c1_3710_4987 | 413 |
| 1077 | 3300050510 | nmdc:mga06r32_774_c1 | nmdc:mga06r32_774_c1_3213_4454 | 413 |
| 1078 | 3300050511 | nmdc:mga08y16_356_c1 | nmdc:mga08y16_356_c1_32112_33353 | 413 |
| 1079 | 3300050511 | nmdc:mga08y16_42596_c1 | nmdc:mga08y16_42596_c1_1366_2607 | 413 |
| 1080 | 3300050512 | nmdc:mga0n895_16080_c1 | nmdc:mga0n895_16080_c1_701_1978 | 413 |
| 1081 | 3300050512 | nmdc:mga0n895_2421_c1 | nmdc:mga0n895_2421_c1_4573_5814 | 413 |
| 1082 | 3300050512 | nmdc:mga0n895_46489_c1 | nmdc:mga0n895_46489_c1_461_1702 | 413 |
| 1083 | 3300050512 | nmdc:mga0n895_725_c1 | nmdc:mga0n895_725_c1_2574_3815 | 413 |
| 1084 | 3300050513 | nmdc:mga0rr50_11637_c1 | nmdc:mga0rr50_11637_c1_1001_2242 | 413 |
| 1085 | 3300050513 | nmdc:mga0rr50_26607_c2 | nmdc:mga0rr50_26607_c2_332_1573 | 413 |
| 1086 | 3300050515 | nmdc:mga0a205_400_c1 | nmdc:mga0a205_400_c1_18164_19405 | 413 |
| 1087 | 3300050515 | nmdc:mga0a205_91_c2 | nmdc:mga0a205_91_c2_5304_6572 | 413 |
| 1088 | 3300053077 | Ga0495601_0000081 | Ga0495601_0000081_25449_26690 | 413 |
| 1089 | 3300053077 | Ga0495601_0015420 | Ga0495601_0015420_2726_3967 | 413 |
| 1090 | 3300053077 | Ga0495601_0035667 | Ga0495601_0035667_1079_2362 | 413 |
| 1091 | 3300053077 | Ga0495601_0045615 | Ga0495601_0045615_975_2249 | 413 |
| 1092 | 3300053077 | Ga0495601_0072671 | Ga0495601_0072671_883_2124 | 413 |
| 1093 | 3300053077 | Ga0495601_0108030 | Ga0495601_0108030_373_1614 | 413 |
| 1094 | 3300053078 | Ga0495612_0000315 | Ga0495612_0000315_7495_8736 | 413 |
| 1095 | 3300053078 | Ga0495612_0008832 | Ga0495612_0008832_1198_2475 | 413 |
| 1096 | 3300053078 | Ga0495612_0014269 | Ga0495612_0014269_947_2188 | 413 |
| 1097 | 3300053078 | Ga0495612_0034735 | Ga0495612_0034735_152_1393 | 413 |
| 1098 | 3300053084 | Ga0495595_0001073 | Ga0495595_0001073_7774_9051 | 413 |
| 1099 | 3300053084 | Ga0495595_0004290 | Ga0495595_0004290_3283_4524 | 413 |
| 1100 | 3300053084 | Ga0495595_0004961 | Ga0495595_0004961_295_1536 | 413 |
| 1101 | 3300053084 | Ga0495595_0007889 | Ga0495595_0007889_679_1920 | 413 |
| 1102 | 3300053084 | Ga0495595_0009362 | Ga0495595_0009362_2720_3997 | 413 |
| 1103 | 3300053085 | Ga0495619_0000270 | Ga0495619_0000270_17817_19100 | 413 |
| 1104 | 3300053085 | Ga0495619_0001648 | Ga0495619_0001648_6339_7601 | 413 |
| 1105 | 3300053085 | Ga0495619_0001786 | Ga0495619_0001786_3727_4968 | 413 |
| 1106 | 3300053085 | Ga0495619_0001885 | Ga0495619_0001885_12143_13384 | 413 |
| 1107 | 3300053085 | Ga0495619_0004104 | Ga0495619_0004104_2607_3848 | 413 |
| 1108 | 3300053085 | Ga0495619_0034874 | Ga0495619_0034874_79_1335 | 413 |
| 1109 | 3300053085 | Ga0495619_0064373 | Ga0495619_0064373_251_1492 | 413 |
| 1110 | 3300053087 | Ga0500643_001479 | Ga0500643_001479_7580_8821 | 413 |
| 1111 | 3300053093 | Ga0500651_0035480 | Ga0500651_0035480_1357_2598 | 413 |
| 1112 | 3300053096 | Ga0500641_0048570 | Ga0500641_0048570_113_1408 | 413 |
| 1113 | 3300053119 | Ga0500595_000055 | Ga0500595_000055_58926_60167 | 413 |
| 1114 | 3300053131 | Ga0500652_010527 | Ga0500652_010527_557_1798 | 413 |
| 1115 | 3300053153 | Ga0500616_0000001 | Ga0500616_0000001_141785_143026 | 413 |
| 1116 | 3300053730 | Ga0500645_000216 | Ga0500645_000216_35453_36694 | 413 |
| 1117 | 3300054114 | Ga0501084_0116472 | Ga0501084_0116472_757_1998 | 413 |
| 1118 | 3300060353 | Ga0501082_0025039 | Ga0501082_0025039_1619_2860 | 413 |
| 1119 | 3300060353 | Ga0501082_0116059 | Ga0501082_0116059_346_1608 | 413 |
| 1120 | 3300061734 | Ga0530510_0053318 | Ga0530510_0053318_858_2099 | 413 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2c2b-assembly2.cif.gz_C | crystallographic structure of arabidopsis thaliana threonine synthase complexed with pyridoxal phosphate and s-adenosylmethionine | 0.9323 | 14 | 390 |
| 6cgq-assembly1.cif.gz_B-2 | threonine synthase from bacillus subtilis atcc 6633 with plp and plp-ala | 0.9268 | 65 | 392 |
| 6cgq-assembly1.cif.gz_A | threonine synthase from bacillus subtilis atcc 6633 with plp and plp-ala | 0.9263 | 69 | 390 |
| 2zsj-assembly2.cif.gz_D | crystal structure of threonine synthase from aquifex aeolicus vf5 | 0.9201 | 64 | 390 |
| 2zsj-assembly2.cif.gz_C | crystal structure of threonine synthase from aquifex aeolicus vf5 | 0.9175 | 64 | 390 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4d9gB02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9422 | 138 | 212 | 3.40.50.1100 |
| af_A0A1D6M0B0_306_515_3.40.50.1100 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9411 | 228 | 390 | 3.40.50.1100 |
| af_Q9SSP5_269_516_3.40.50.1100 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9221 | 194 | 390 | 3.40.50.1100 |
| af_O43061_57_367_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9157 | 161 | 188 | 3.90.550.10 |
| 1pwhA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9125 | 136 | 213 | 3.40.50.1100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A535BMY9-F1-model_v4 | Pyridoxal-phosphate dependent enzyme | 0.9934 | 230 | 336 |
|
| AF-A0A2V5Q374-F1-model_v4 | Threonine synthase | 0.9859 | 132 | 329 |
GO:0003941
GO:0004794 GO:0006565 GO:0006567 GO:0009097 |
| AF-A0A3N5QL49-F1-model_v4 | Threonine synthase (EC 4.2.3.1) | 0.9853 | 13 | 343 |
GO:0003941
GO:0004794 GO:0004795 GO:0006565 GO:0006567 GO:0009097 GO:0030170 |
| AF-A0A2U3D9E5-F1-model_v4 | Threonine synthase | 0.9839 | 11 | 390 |
GO:0003941
GO:0004794 GO:0006565 GO:0006567 GO:0009097 |
| AF-A0A3N5TSH5-F1-model_v4 | deleted | 0.9828 | 195 | 390 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar