F490388

General Info

Members Datasets Scaffolds Average Seq Length
1120 858 2240 365

Family's Representative Sequence

Representative Sequence 3300031251|Ga0265327_10042421|Ga0265327_100424211
Length 402
Sequence MYVAVKGGEAAISNAHRLLADRRRGDRSVPALRLDQIIEQLGLAVDRCMGEGSLYDRELAALAITQARGDLIEAIFLVRAYRTTLPRFGYSMPIDTGDMLIERRVSATFKDLPGGQLLGPTFDYTHRLLDPSIAEGGEVEGGERRDAPAEQAPRVTDLLAGEGLIEADGRREVDEVGDLTRSPLEFPLDRDLRLQALARGDEGFLLGLAYSTQRGYARSHPFVGEIRIGEVEVELDIPELGFAVSLGRIRVTECQMVNQFKGSAKAPPQFTRGYGLAFGQAERKGMAMALCDRALRAREFGEDMAGIAQDEEFVISHLDNVQSTGFVEHLKLPHYVDFQAELDLVRRMRGEYERKLQSETARGVPGSDGGSTFPQTRPDTLPLAGTDGEGGAADADVTEGAE

Samples

Sample ID Description Type Environment
1 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
12 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
65 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
66 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
87 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
88 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
89 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
90 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
91 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
92 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
93 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
94 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
97 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
98 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
100 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
102 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
104 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
133 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
134 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
135 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
136 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
142 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
143 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
144 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
145 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
146 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
147 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
148 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
149 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
150 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
151 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
152 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
153 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
154 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
155 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
156 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
157 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
158 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
159 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
160 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
161 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
162 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
163 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
164 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
165 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
166 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
167 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
168 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
169 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
170 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
171 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
172 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
173 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
175 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
176 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
177 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
178 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
179 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
180 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
181 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
182 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
183 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
184 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
185 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
186 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
187 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
189 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
190 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
191 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
192 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
193 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
194 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
195 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
196 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
197 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
198 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
199 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
200 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
201 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
202 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
203 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
204 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
205 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
206 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
207 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
208 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
209 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
210 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
211 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
212 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
213 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
214 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
215 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
216 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
217 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
218 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
219 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
220 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
221 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
222 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
223 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
224 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
225 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
226 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
227 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
228 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
229 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
230 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
231 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
232 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
233 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
234 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
235 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
236 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
237 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
238 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
239 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
240 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
241 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
242 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
243 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
244 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
245 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
246 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
247 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
248 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
249 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
250 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
251 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
252 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
253 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
254 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
255 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
256 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
257 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
258 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
259 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
260 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
261 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
262 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
263 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
264 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
265 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
266 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
267 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
268 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
269 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
270 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
271 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
272 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
273 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
274 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
275 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
276 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
277 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
278 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
279 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
280 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
281 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
282 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
283 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
284 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
285 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
286 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
287 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
288 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
289 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
290 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
291 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
292 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
293 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
301 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
302 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
303 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
305 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
306 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
307 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
308 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
309 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
310 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
311 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
312 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
313 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
314 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
315 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
316 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
317 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
318 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
319 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
320 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
321 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
322 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
323 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
324 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
325 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
326 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
327 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
328 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
329 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
330 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
331 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
332 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
333 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
334 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
335 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
336 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
337 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
338 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
339 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
340 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
341 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
342 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
343 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
344 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
345 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
346 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
347 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
348 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
349 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
350 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
351 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
352 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
353 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
354 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
355 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
356 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
357 2508501050 Microvirga lupini Lut6 Isolate Nodule
358 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
359 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
360 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
361 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
362 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
363 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
364 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
365 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
366 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
367 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
368 2512875024
369 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
370 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
371 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
372 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
373 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
374 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
375 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
376 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
377 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
378 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
379 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
380 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
381 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
382 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
383 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
384 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
385 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
386 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
387 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
388 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
389 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
390 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
391 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
392 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
393 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
394 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
395 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
396 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
397 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
398 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
399 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
400 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
401 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
402 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
403 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
404 2643221558 Rhizobium sp. Root149 Isolate Unclassified
405 2643221580 Devosia sp. Root635 Isolate Unclassified
406 2643221591 Devosia sp. Root685 Isolate Unclassified
407 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
408 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
409 2643221629 Devosia sp. Root105 Isolate Unclassified
410 2643221662 Devosia sp. Root413D1 Isolate Unclassified
411 2643221674 Devosia sp. Root436 Isolate Unclassified
412 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
413 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
414 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
415 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
416 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
417 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
418 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
419 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
420 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
421 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
422 2738543024 Aminobacter sp. AP02 Isolate Unclassified
423 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
424 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
425 2751185800 Brucella pituitosa AA2 Isolate Unclassified
426 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
427 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
428 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
429 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
430 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
431 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
432 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
433 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
434 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
435 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
436 2791355199
437 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
438 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
439 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
440 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
441 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
442 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
443 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
444 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
445 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
446 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
447 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
448 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
449 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
450 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
451 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
452 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
453 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
454 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
455 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
456 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
457 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
458 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
459 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
460 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
461 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
462 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
463 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
464 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
465 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
466 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
467 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
468 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
469 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
470 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
471 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
472 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
473 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
474 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
475 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
476 2854911287 Brucella lupini LUP21 Isolate Unclassified
477 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
478 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
479 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
480 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
481 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
482 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
483 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
484 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
485 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
486 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
487 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
488 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
489 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
490 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
491 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
492 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
493 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
494 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
495 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
496 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
497 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
498 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
499 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
500 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
501 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
502 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
503 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
504 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
505 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
506 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
507 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
508 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
509 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
510 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
511 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
512 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
513 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
514 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
515 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
516 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
517 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
518 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
519 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
520 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
521 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
522 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
523 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
524 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
525 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
526 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
527 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
528 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
529 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
530 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
531 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
532 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
533 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
534 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
535 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
536 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
537 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
538 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
539 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
540 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
541 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
542 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
543 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
544 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
545 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
546 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
547 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
548 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
549 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
550 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
551 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
552 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
553 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
554 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
555 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
556 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
557 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
558 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
559 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
560 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
561 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
562 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
563 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
564 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
565 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
566 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
567 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
568 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
569 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
570 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
571 2902330777 Methylobacterium sp. 2A Isolate Unclassified
572 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
573 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
574 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
575 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
576 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
577 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
578 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
579 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
580 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
581 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
582 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
583 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
584 2904699407
585 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
586 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
587 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
588 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
589 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
590 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
591 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
592 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
593 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
594 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
595 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
596 2906610324
597 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
598 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
599 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
600 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
601 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
602 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
603 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
604 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
605 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
606 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
607 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
608 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
609 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
610 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
611 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
612 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
613 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
614 2922368715
615 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
616 2922425934
617 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
618 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
619 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
620 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
621 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
622 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
623 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
624 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
625 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
626 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
627 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
628 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
629 2932401849 Devosia sp. 2618 Isolate Rhizosphere
630 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
631 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
632 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
633 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
634 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
635 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
636 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
637 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
638 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
639 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
640 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
641 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
642 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
643 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
644 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
645 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
646 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
647 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
648 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
649 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
650 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
651 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
652 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
653 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
654 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
655 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
656 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
657 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
658 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
659 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
660 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
661 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
662 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
663 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
664 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
665 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
666 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
667 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
668 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
669 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
670 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
671 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
672 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
673 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
674 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
675 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
676 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
677 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
678 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
679 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
680 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
681 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
682 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
683 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
684 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
685 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
686 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
687 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
688 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
689 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
690 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
691 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
692 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
693 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
694 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
695 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
696 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
697 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
698 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
699 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
700 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
701 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
702 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
703 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
704 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
705 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
706 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
707 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
708 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
709 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
710 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
711 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
712 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
713 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
714 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
715 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
716 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
717 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
718 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
719 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
720 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
721 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
722 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
723 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
724 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
725 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
726 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
727 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
728 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
729 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
730 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
731 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
732 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
733 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
734 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
735 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
736 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
737 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
738 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
739 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
740 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
741 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
742 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
743 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
744 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
745 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
746 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
747 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
748 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
749 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
750 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
751 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
752 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
753 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
754 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
755 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
756 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
757 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
758 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
759 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
760 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
761 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
762 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
763 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
764 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
765 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
766 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
767 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
768 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
769 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
770 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
771 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
772 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
773 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
774 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
775 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
776 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
777 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
778 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
779 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
780 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
781 3004167301 Mesorhizobium loti 582 Isolate Unclassified
782 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
783 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
784 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
785 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
786 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
787 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
788 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
789 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
790 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
791 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
792 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
793 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
794 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
795 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
796 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
797 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
798 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
799 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
800 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
801 641522639 Methylobacterium sp. 4-46 Isolate Nodule
802 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
803 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
804 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
805 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
806 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
807 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
808 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
809 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
810 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
811 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
812 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
813 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
814 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
815 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
816 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
817 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
818 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
819 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
820 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
821 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
822 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
823 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
824 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
825 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
826 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
827 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
828 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
829 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
830 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
831 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
832 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
833 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
834 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
835 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
836 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
837 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
838 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
839 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
840 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
841 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
842 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
843 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
844 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
845 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
846 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
847 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
848 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
849 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
850 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
851 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
852 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
853 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
854 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
855 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
856 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
857 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
858 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 54.71
Metatranscriptomes 0
Isolates 45.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.64
Nodule 35.09
Rhizoplane 3.3
Rhizosphere 34.55
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265327_10042421 3300031251 Bacteria 2442
2 JGI25155J39150_1000075 3300002704 Bacteria 62215
3 JGI25156J39149_1000103 3300002705 Bacteria 62289
4 JGI25156J39149_1003452 3300002705 Bacteria 5172
5 JGI25154J39366_1000018 3300002738 Bacteria 251612
6 JGI25158J39367_1000444 3300002739 Bacteria 8576
7 JGI25157J39369_1000074 3300002741 Bacteria 88240
8 JGI25157J39369_1001580 3300002741 Bacteria 8032
9 JGI25406J46586_10008474 3300003203 Bacteria 4653
10 JGI25406J46586_10023695 3300003203 Bacteria 2423
11 JGI25165J46597_1000034 3300003214 Bacteria 292458
12 JGI25153J46596_10001090 3300003215 Bacteria 16506
13 JGI25153J46596_10001143 3300003215 Bacteria 16067
14 JGI25153J46596_10005592 3300003215 Bacteria 6572
15 JGI25153J46596_10012228 3300003215 Bacteria 3725
16 JGI25160J50197_1002884 3300003354 Bacteria 7867
17 JGI25404J52841_10010319 3300003659 Bacteria 2009
18 JGI25404J52841_10010756 3300003659 Bacteria 1969
19 Ga0055542_1000299 3300003762 Bacteria 55023
20 Ga0055526_1040170 3300003771 Bacteria 1182
21 Ga0055531_10003992 3300003794 Bacteria 9151
22 Ga0055543_1007797 3300004625 Bacteria 2438
23 Ga0065165_1012943 3300005262 Bacteria 3353
24 Ga0068869_100158835 3300005334 Bacteria 1758
25 Ga0068868_100109188 3300005338 Bacteria 2246
26 Ga0068868_100337670 3300005338 Bacteria 1287
27 Ga0070661_100050376 3300005344 Bacteria 3047
28 Ga0070668_100092837 3300005347 Bacteria 2381
29 Ga0070671_100022839 3300005355 Bacteria 5111
30 Ga0070671_100112444 3300005355 Bacteria 2288
31 Ga0070674_100070988 3300005356 Bacteria 2462
32 Ga0070674_100133761 3300005356 Bacteria 1852
33 Ga0070667_100151146 3300005367 Bacteria 2040
34 Ga0070713_100009248 3300005436 Bacteria 7040
35 Ga0070710_10011668 3300005437 Bacteria 4347
36 Ga0070711_100001929 3300005439 Bacteria 11615
37 Ga0070711_100021315 3300005439 Bacteria 4188
38 Ga0070663_100064671 3300005455 Bacteria 2644
39 Ga0070663_100090239 3300005455 Bacteria 2269
40 Ga0070663_100129382 3300005455 Bacteria 1916
41 Ga0070663_100312388 3300005455 Bacteria 1261
42 Ga0070678_100043779 3300005456 Bacteria 3192
43 Ga0070678_100193042 3300005456 Bacteria 1675
44 Ga0070662_100244316 3300005457 Bacteria 1441
45 Ga0070681_10038588 3300005458 Bacteria 4788
46 Ga0070681_10160369 3300005458 Bacteria 2173
47 Ga0070697_100158811 3300005536 Bacteria 1909
48 Ga0068853_100000498 3300005539 Bacteria 26895
49 Ga0068853_100016508 3300005539 Bacteria 6078
50 Ga0070693_100076134 3300005547 Bacteria 1989
51 Ga0070665_100017223 3300005548 Bacteria 7251
52 Ga0070665_100023023 3300005548 Bacteria 6273
53 Ga0070665_100139449 3300005548 Bacteria 2428
54 Ga0070665_100157159 3300005548 Bacteria 2275
55 Ga0070665_100238447 3300005548 Bacteria 1819
56 Ga0070665_100402154 3300005548 Bacteria 1377
57 Ga0068855_100082169 3300005563 Bacteria 3734
58 Ga0068857_100180946 3300005577 Bacteria 1919
59 Ga0068857_100312271 3300005577 Bacteria 1450
60 Ga0068854_100275987 3300005578 Bacteria 1351
61 Ga0068856_100000255 3300005614 Bacteria 58233
62 Ga0070702_100091872 3300005615 Bacteria 1842
63 Ga0070702_100098070 3300005615 Bacteria 1792
64 Ga0068852_100005223 3300005616 Bacteria 9260
65 Ga0068852_100035512 3300005616 Bacteria 4160
66 Ga0068859_100114267 3300005617 Bacteria 2763
67 Ga0068864_100070386 3300005618 Bacteria 3044
68 Ga0068861_100115929 3300005719 Bacteria 2153
69 Ga0068861_100285695 3300005719 Bacteria 1422
70 Ga0068858_100312611 3300005842 Bacteria 1500
71 Ga0068860_100159492 3300005843 Bacteria 2174
72 Ga0068862_100155150 3300005844 Bacteria 2040
73 Ga0081455_10005028 3300005937 Bacteria 14622
74 Ga0081455_10014229 3300005937 Bacteria 7808
75 Ga0081455_10040052 3300005937 Bacteria 4136
76 Ga0081538_10024381 3300005981 Bacteria 4311
77 Ga0081540_1006026 3300005983 Bacteria 8920
78 Ga0081540_1007191 3300005983 Bacteria 7987
79 Ga0081540_1023299 3300005983 Bacteria 3625
80 Ga0081540_1027385 3300005983 Bacteria 3230
81 Ga0081540_1053052 3300005983 Bacteria 1991
82 Ga0081540_1061172 3300005983 Bacteria 1797
83 Ga0081540_1079418 3300005983 Bacteria 1483
84 Ga0081540_1084822 3300005983 Bacteria 1413
85 Ga0081539_10000486 3300005985 Bacteria 84009
86 Ga0081539_10004610 3300005985 Bacteria 15022
87 Ga0070717_10002386 3300006028 Bacteria 13244
88 Ga0075364_10126627 3300006051 Bacteria 1713
89 Ga0075364_10127897 3300006051 Bacteria 1704
90 Ga0070716_100069246 3300006173 Bacteria 2067
91 Ga0070712_100018183 3300006175 Bacteria 4561
92 Ga0075367_10030741 3300006178 Bacteria 3081
93 Ga0075367_10045507 3300006178 Bacteria 2575
94 Ga0075367_10050058 3300006178 Bacteria 2465
95 Ga0075367_10117429 3300006178 Bacteria 1637
96 Ga0075367_10122590 3300006178 Bacteria 1602
97 Ga0075367_10145204 3300006178 Bacteria 1471
98 Ga0075369_10015745 3300006186 Bacteria 3040
99 Ga0075369_10051919 3300006186 Bacteria 1776
100 Ga0097621_100278226 3300006237 Bacteria 1473
101 Ga0075370_10048535 3300006353 Bacteria 2405
102 Ga0075370_10074967 3300006353 Bacteria 1939
103 Ga0075428_100145528 3300006844 Bacteria 2575
104 Ga0075434_100189007 3300006871 Bacteria 2079
105 Ga0068865_100082407 3300006881 Bacteria 2312
106 Ga0075436_100177300 3300006914 Bacteria 1506
107 Ga0097620_100114265 3300006931 Bacteria 2763
108 Ga0099825_1024907 3300006941 Bacteria 3415
109 Ga0099824_1013226 3300006942 Bacteria 8656
110 Ga0099824_1015712 3300006942 Bacteria 7077
111 Ga0099822_1009022 3300006943 Bacteria 12657
112 Ga0075435_100165644 3300007076 Bacteria 1864
113 Ga0099794_10031949 3300007265 Bacteria 2468
114 Ga0105240_10005052 3300009093 Bacteria 19785
115 Ga0105240_10041316 3300009093 Bacteria 5887
116 Ga0111539_10011199 3300009094 Bacteria 11272
117 Ga0105245_10211767 3300009098 Bacteria 1866
118 Ga0105245_10230094 3300009098 Bacteria 1793
119 Ga0105247_10193583 3300009101 Bacteria 1363
120 Ga0114129_10463324 3300009147 Bacteria 1661
121 Ga0105241_10083955 3300009174 Bacteria 2500
122 Ga0105241_10262395 3300009174 Bacteria 1468
123 Ga0105241_10383117 3300009174 Bacteria 1229
124 Ga0105242_10133367 3300009176 Bacteria 2147
125 Ga0105248_10039124 3300009177 Bacteria 5311
126 Ga0105248_10230015 3300009177 Bacteria 2087
127 Ga0105248_10446522 3300009177 Bacteria 1457
128 Ga0105237_10000122 3300009545 Bacteria 108419
129 Ga0105237_10001825 3300009545 Bacteria 27462
130 Ga0105237_10090656 3300009545 Bacteria 3046
131 Ga0105237_10108122 3300009545 Bacteria 2773
132 Ga0105237_10193891 3300009545 Bacteria 2031
133 Ga0123341_1000017 3300009765 Bacteria 82963
134 Ga0105239_10001981 3300010375 Bacteria 26629
135 Ga0157370_10130345 3300013104 Bacteria 2346
136 Ga0157374_10097063 3300013296 Bacteria 2819
137 Ga0157374_10368964 3300013296 Bacteria 1428
138 Ga0157375_10027437 3300013308 Bacteria 5322
139 Ga0157375_10289812 3300013308 Bacteria 1800
140 Ga0163163_10030129 3300014325 Bacteria 5224
141 Ga0163163_10162858 3300014325 Bacteria 2276
142 Ga0163163_10279454 3300014325 Bacteria 1721
143 Ga0163163_10408282 3300014325 Bacteria 1417
144 Ga0157380_10170725 3300014326 Bacteria 1900
145 Ga0157377_10100300 3300014745 Bacteria 1724
146 Ga0214544_1000007 3300021320 Bacteria 379989
147 Ga0214542_1000007 3300021321 Bacteria 291816
148 Ga0214545_1000006 3300021324 Bacteria 291693
149 Ga0214543_1000009 3300021327 Bacteria 384302
150 Ga0213876_10000961 3300021384 Bacteria 18959
151 Ga0213876_10105914 3300021384 Bacteria 1492
152 Ga0209435_100044 3300025206 Bacteria 99051
153 Ga0209646_1000151 3300025246 Bacteria 99050
154 Ga0209646_1007796 3300025246 Bacteria 1737
155 Ga0209026_1000100 3300025250 Bacteria 156131
156 Ga0209026_1000170 3300025250 Bacteria 99050
157 Ga0209677_100810 3300025253 Bacteria 15627
158 Ga0209677_102269 3300025253 Bacteria 7433
159 Ga0209148_1000069 3300025254 Bacteria 334444
160 Ga0209148_1000216 3300025254 Bacteria 98209
161 Ga0209148_1002619 3300025254 Bacteria 5876
162 Ga0209148_1003399 3300025254 Bacteria 4433
163 Ga0209759_1000186 3300025256 Bacteria 100413
164 Ga0209759_1000899 3300025256 Bacteria 22224
165 Ga0209233_1000028 3300025261 Bacteria 642062
166 Ga0209233_1000444 3300025261 Bacteria 28489
167 Ga0209233_1001353 3300025261 Bacteria 9774
168 Ga0209233_1004829 3300025261 Bacteria 4539
169 Ga0209455_1000135 3300025272 Bacteria 148007
170 Ga0209455_1010145 3300025272 Bacteria 2416
171 Ga0209025_1038969 3300025294 Bacteria 2081
172 Ga0209564_1004831 3300025295 Bacteria 8022
173 Ga0209564_1005422 3300025295 Bacteria 7296
174 Ga0209758_1000015 3300025297 Bacteria 851943
175 Ga0209758_1000161 3300025297 Bacteria 154278
176 Ga0209758_1001304 3300025297 Bacteria 30476
177 Ga0209758_1004767 3300025297 Bacteria 10988
178 Ga0209758_1008017 3300025297 Bacteria 6982
179 Ga0209758_1010265 3300025297 Bacteria 5638
180 Ga0209758_1029217 3300025297 Bacteria 2310
181 Ga0209256_1011080 3300025299 Bacteria 3661
182 Ga0207426_1000186 3300025302 Bacteria 154130
183 Ga0207426_1011226 3300025302 Bacteria 3427
184 Ga0209257_1004903 3300025304 Bacteria 9865
185 Ga0207697_10031083 3300025315 Bacteria 2185
186 Ga0207647_10037379 3300025904 Bacteria 3079
187 Ga0207647_10038846 3300025904 Bacteria 3007
188 Ga0207643_10041639 3300025908 Bacteria 2589
189 Ga0207654_10055561 3300025911 Bacteria 2293
190 Ga0207654_10060498 3300025911 Bacteria 2213
191 Ga0207707_10028930 3300025912 Bacteria 4843
192 Ga0207707_10137533 3300025912 Bacteria 2136
193 Ga0207695_10000006 3300025913 Bacteria 1135309
194 Ga0207671_10000249 3300025914 Bacteria 80726
195 Ga0207671_10005136 3300025914 Bacteria 12194
196 Ga0207663_10003769 3300025916 Bacteria 7476
197 Ga0207662_10079545 3300025918 Bacteria 1997
198 Ga0207657_10020311 3300025919 Bacteria 6280
199 Ga0207657_10165756 3300025919 Bacteria 1792
200 Ga0207649_10040043 3300025920 Bacteria 2845
201 Ga0207687_10207988 3300025927 Bacteria 1533
202 Ga0207709_10163676 3300025935 Bacteria 1554
203 Ga0207669_10012355 3300025937 Bacteria 4195
204 Ga0207704_10009681 3300025938 Bacteria 4663
205 Ga0207704_10259770 3300025938 Bacteria 1309
206 Ga0207691_10135945 3300025940 Bacteria 2168
207 Ga0207691_10163203 3300025940 Bacteria 1953
208 Ga0207667_10133289 3300025949 Bacteria 2559
209 Ga0207667_10155000 3300025949 Bacteria 2357
210 Ga0207651_10061013 3300025960 Bacteria 2621
211 Ga0207712_10071081 3300025961 Bacteria 2502
212 Ga0207668_10034451 3300025972 Bacteria 3363
213 Ga0207668_10068046 3300025972 Bacteria 2530
214 Ga0207639_10001845 3300026041 Bacteria 14263
215 Ga0207639_10127327 3300026041 Bacteria 2102
216 Ga0207639_10197025 3300026041 Bacteria 1725
217 Ga0207678_10043187 3300026067 Bacteria 3901
218 Ga0207678_10064643 3300026067 Bacteria 3143
219 Ga0207708_10225338 3300026075 Bacteria 1503
220 Ga0207702_10009007 3300026078 Bacteria 8404
221 Ga0207702_10080290 3300026078 Bacteria 2829
222 Ga0207702_10245181 3300026078 Bacteria 1680
223 Ga0207676_10286888 3300026095 Bacteria 1497
224 Ga0207674_10155512 3300026116 Bacteria 2242
225 Ga0207674_10326862 3300026116 Bacteria 1483
226 Ga0207683_10014673 3300026121 Bacteria 6672
227 Ga0207683_10056387 3300026121 Bacteria 3446
228 Ga0207683_10103819 3300026121 Bacteria 2539
229 Ga0209389_1000062 3300027296 Bacteria 102842
230 Ga0209389_1000072 3300027296 Bacteria 96795
231 Ga0209589_1000006 3300027357 Bacteria 436292
232 Ga0209589_1000270 3300027357 Bacteria 65577
233 Ga0209489_100007 3300027361 Bacteria 436292
234 Ga0209489_100160 3300027361 Bacteria 102842
235 Ga0209489_100206 3300027361 Bacteria 96866
236 Ga0209700_100008 3300027363 Bacteria 436292
237 Ga0209700_101128 3300027363 Bacteria 54168
238 Ga0209179_1009064 3300027512 Bacteria 1695
239 Ga0209588_1000381 3300027671 Bacteria 11518
240 Ga0268266_10006046 3300028379 Bacteria 11157
241 Ga0268266_10034996 3300028379 Bacteria 4272
242 Ga0268266_10423863 3300028379 Bacteria 1261
243 Ga0268265_10071657 3300028380 Bacteria 2700
244 Ga0268264_10188575 3300028381 Bacteria 1878
245 Ga0265326_10002903 3300028558 Bacteria 5725
246 Ga0265319_1004654 3300028563 Bacteria 6742
247 Ga0265334_10000614 3300028573 Bacteria 17940
248 Ga0265318_10016980 3300028577 Bacteria 2996
249 Ga0265323_10000644 3300028653 Bacteria 19022
250 Ga0265336_10000259 3300028666 Bacteria 37606
251 Ga0307515_10001758 3300028794 Bacteria 48278
252 Ga0307515_10261180 3300028794 Bacteria 1467
253 Ga0265338_10000013 3300028800 Bacteria 379065
254 Ga0265338_10000133 3300028800 Bacteria 136570
255 Ga0265324_10003265 3300029957 Bacteria 7804
256 Ga0265332_10012314 3300031238 Bacteria 3795
257 Ga0265328_10017452 3300031239 Bacteria 2779
258 Ga0265325_10020621 3300031241 Bacteria 3631
259 Ga0265329_10027630 3300031242 Bacteria 1864
260 Ga0265339_10000410 3300031249 Bacteria 33832
261 Ga0265339_10012260 3300031249 Bacteria 5241
262 Ga0265339_10094869 3300031249 Bacteria 1559
263 Ga0265331_10004867 3300031250 Bacteria 8268
264 Ga0265331_10010918 3300031250 Bacteria 4994
265 Ga0265331_10044049 3300031250 Bacteria 2159
266 Ga0265316_10082459 3300031344 Bacteria 2464
267 Ga0307513_10214661 3300031456 Bacteria 1751
268 Ga0307509_10040596 3300031507 Bacteria 5060
269 Ga0307509_10240472 3300031507 Bacteria 1604
270 Ga0307508_10000025 3300031616 Bacteria 174642
271 Ga0307508_10121933 3300031616 Bacteria 2210
272 Ga0265314_10000997 3300031711 Bacteria 33206
273 Ga0265314_10058645 3300031711 Bacteria 2637
274 Ga0265314_10080713 3300031711 Bacteria 2146
275 Ga0265342_10000024 3300031712 Bacteria 171500
276 Ga0265342_10024976 3300031712 Bacteria 3763
277 Ga0316578_10018689 3300031728 Bacteria 3803
278 Ga0307516_10001162 3300031730 Bacteria 36834
279 Ga0307405_10216247 3300031731 Bacteria 1403
280 Ga0307413_10026740 3300031824 Bacteria 3185
281 Ga0307406_10052882 3300031901 Bacteria 2585
282 Ga0307412_10044132 3300031911 Bacteria 2908
283 Ga0307409_100027125 3300031995 Bacteria 4054
284 Ga0307414_10015318 3300032004 Bacteria 4628
285 Ga0307414_10118945 3300032004 Bacteria 2027
286 Ga0307414_10237052 3300032004 Bacteria 1508
287 Ga0307510_10008205 3300033180 Bacteria 12438
288 Ga0307510_10049166 3300033180 Bacteria 4489
289 Ga0307510_10100571 3300033180 Bacteria 2684
290 Ga0315911_1000003 3300033442 Bacteria 502217
291 Ga0373944_0040929 3300035089 Bacteria 1432
292 Ga0373923_0002937 3300035111 Bacteria 5365
293 Ga0373945_0018468 3300035116 Bacteria 2373
294 Ga0373953_0012150 3300035117 Bacteria 3042
295 Ga0373954_0070728 3300035118 Bacteria 1658
296 Ga0373956_0001024 3300035119 Bacteria 11548
297 Ga0373943_0017025 3300035170 Bacteria 3323
298 Ga0373943_0022973 3300035170 Bacteria 2896
299 Ga0373955_0003604 3300035172 Bacteria 6808
300 Ga0373955_0139342 3300035172 Bacteria 1421
301 Ga0373924_0006755 3300035410 Bacteria 4121
302 Ga0373935_0003185 3300035692 Bacteria 9467
303 Ga0373935_0120111 3300035692 Bacteria 1755
304 Ga0373927_0002909 3300035695 Bacteria 12452
305 Ga0373927_0027238 3300035695 Bacteria 3733
306 Ga0373927_0041912 3300035695 Bacteria 2968
307 Ga0373933_0000112 3300035724 Bacteria 52335
308 Ga0373933_0221624 3300035724 Bacteria 1214
309 Ga0373947_0016491 3300035725 Bacteria 4244
310 Ga0373937_0032959 3300036401 Bacteria 4700
311 Ga0316584_0026677 3300036712 Bacteria 4248
312 Ga0373925_0004474 3300037068 Bacteria 10564
313 Ga0395899_0056699 3300037312 Bacteria 2895
314 Ga0395900_0098252 3300037418 Bacteria 3008
315 Ga0395900_0111141 3300037418 Bacteria 2815
316 Ga0395900_0126510 3300037418 Bacteria 2621
317 Ga0395900_0145596 3300037418 Bacteria 2423
318 Ga0395898_0130036 3300037466 Bacteria 2412
319 Ga0395905_0000710 3300037471 Bacteria 44148
320 Ga0395905_0164250 3300037471 Bacteria 2086
321 Ga0395901_0105336 3300038443 Bacteria 2960
322 Ga0395901_0135579 3300038443 Bacteria 2588
323 Ga0400483_002736 3300039062 Bacteria 4799
324 Ga0400483_035839 3300039062 Bacteria 4059
325 Ga0400483_201614 3300039062 Bacteria 9252
326 Ga0400483_217519 3300039062 Bacteria 2355
327 Ga0400483_223068 3300039062 Bacteria 2639
328 Ga0400483_233607 3300039062 Bacteria 2134
329 Ga0400483_267556 3300039062 Bacteria 1494
330 Ga0400489_41176 3300039093 Bacteria 2538
331 Ga0436365_0875841 3300039437 Bacteria 48187
332 Ga0436365_1114449 3300039437 Bacteria 1519
333 Ga0436361_0869946 3300039447 Bacteria 1435
334 Ga0436361_1217182 3300039447 Bacteria 15864
335 Ga0439465_0049005 3300041413 Bacteria 1379
336 Ga0466972_0004978 3300044658 Bacteria 6669
337 Ga0466972_0043214 3300044658 Bacteria 2189
338 Ga0466965_0050503 3300044683 Bacteria 2062
339 Ga0466961_0000324 3300044693 Bacteria 31518
340 Ga0466964_0060701 3300044706 Bacteria 1573
341 Ga0466968_0040069 3300044735 Bacteria 1974
342 Ga0466968_0077535 3300044735 Bacteria 1456
343 Ga0466970_0046053 3300044765 Bacteria 2323
344 Ga0466957_0145531 3300044842 Bacteria 1529
345 Ga0466957_0167741 3300044842 Bacteria 1429
346 Ga0466960_0050037 3300044901 Bacteria 2014
347 Ga0466960_0062506 3300044901 Bacteria 1830
348 Ga0466959_0031894 3300045049 Bacteria 3900
349 Ga0451576_0002274 3300045051 Bacteria 29318
350 Ga0466958_0097217 3300045836 Bacteria 1827
351 Ga0466967_0356498 3300045976 Bacteria 1416
352 Ga0495617_002973 3300046452 Bacteria 6490
353 Ga0495592_0009908 3300046454 Bacteria 7175
354 Ga0495592_0033024 3300046454 Bacteria 3904
355 Ga0495603_0005569 3300046455 Bacteria 7520
356 Ga0495603_0032536 3300046455 Bacteria 3138
357 Ga0495603_0064458 3300046455 Bacteria 2160
358 Ga0495629_0001327 3300046459 Bacteria 19440
359 Ga0495629_0008439 3300046459 Bacteria 7584
360 Ga0495629_0021465 3300046459 Bacteria 4608
361 Ga0495638_0005323 3300046460 Bacteria 9597
362 Ga0495638_0005713 3300046460 Bacteria 9163
363 Ga0495638_0024652 3300046460 Bacteria 3918
364 Ga0495641_0009191 3300046461 Bacteria 5907
365 Ga0495653_0135984 3300046463 Bacteria 1734
366 Ga0495650_0014040 3300046471 Bacteria 4196
367 Ga0495580_0009555 3300046472 Bacteria 7619
368 Ga0495582_0147170 3300046473 Bacteria 1336
369 Ga0495605_0030567 3300046474 Bacteria 2760
370 Ga0495662_0001936 3300046476 Bacteria 10396
371 Ga0495664_0009126 3300046477 Bacteria 5544
372 Ga0495594_0008915 3300046499 Bacteria 5173
373 Ga0495594_0244168 3300046499 Bacteria 1023
374 Ga0495606_0016267 3300046507 Bacteria 5680
375 Ga0495608_0029953 3300046511 Bacteria 3687
376 Ga0495628_0026291 3300046516 Bacteria 4748
377 Ga0495628_0140484 3300046516 Bacteria 1843
378 Ga0495630_0004453 3300046517 Bacteria 9826
379 Ga0495631_0017362 3300046518 Bacteria 3406
380 Ga0495643_0132747 3300046522 Bacteria 1248
381 Ga0495648_0008452 3300046524 Bacteria 8099
382 Ga0495648_0019531 3300046524 Bacteria 4762
383 Ga0495666_0015568 3300046526 Bacteria 3786
384 Ga0495652_0003976 3300046529 Bacteria 14326
385 Ga0495652_0052875 3300046529 Bacteria 3463
386 Ga0495665_0107478 3300046531 Bacteria 1464
387 Ga0495640_0007922 3300046533 Bacteria 8355
388 Ga0495640_0011122 3300046533 Bacteria 6928
389 Ga0495640_0026155 3300046533 Bacteria 4221
390 Ga0495640_0070832 3300046533 Bacteria 2341
391 Ga0495587_0004748 3300046536 Bacteria 8921
392 Ga0495587_0020515 3300046536 Bacteria 4078
393 Ga0495645_0008214 3300046543 Bacteria 7280
394 Ga0495622_0013980 3300046557 Bacteria 3725
395 Ga0495667_0008395 3300046559 Bacteria 7007
396 Ga0495667_0011515 3300046559 Bacteria 5987
397 Ga0495667_0118860 3300046559 Bacteria 1707
398 Ga0495668_0013606 3300046616 Bacteria 4792
399 Ga0495668_0020578 3300046616 Bacteria 3793
400 Ga0495668_0056058 3300046616 Bacteria 2176
401 Ga0495668_0083033 3300046616 Bacteria 1757
402 Ga0495634_0002499 3300046642 Bacteria 15239
403 Ga0495634_0045727 3300046642 Bacteria 2958
404 Ga0495625_0040133 3300046660 Bacteria 3416
405 Ga0495625_0074722 3300046660 Bacteria 2373
406 Ga0495625_0126547 3300046660 Bacteria 1734
407 Ga0495625_0157354 3300046660 Bacteria 1524
408 Ga0495635_0004129 3300046663 Bacteria 10063
409 Ga0495635_0012056 3300046663 Bacteria 6059
410 Ga0495635_0044086 3300046663 Bacteria 3077
411 Ga0495657_0003208 3300046675 Bacteria 13463
412 Ga0495657_0021398 3300046675 Bacteria 4640
413 Ga0495599_0033031 3300046678 Bacteria 3250
414 Ga0495623_0052789 3300046679 Bacteria 2568
415 Ga0495646_0048275 3300046680 Bacteria 2587
416 Ga0495647_0009732 3300046681 Bacteria 3262
417 Ga0495669_0004055 3300046684 Bacteria 6024
418 Ga0495613_0004290 3300046689 Bacteria 10684
419 Ga0495613_0035933 3300046689 Bacteria 3675
420 Ga0495613_0047018 3300046689 Bacteria 3188
421 Ga0495624_0011028 3300046690 Bacteria 6221
422 Ga0495624_0182572 3300046690 Bacteria 1278
423 Ga0495649_0035085 3300046694 Bacteria 2758
424 Ga0495600_0034056 3300046809 Bacteria 3307
425 Ga0495600_0045317 3300046809 Bacteria 2869
426 Ga0495581_0003922 3300047315 Bacteria 8564
427 Ga0495604_0002083 3300047317 Bacteria 16121
428 Ga0495604_0057448 3300047317 Bacteria 2991
429 Ga0495636_0077612 3300047318 Bacteria 1426
430 Ga0495674_0010440 3300047319 Bacteria 8792
431 Ga0495674_0013370 3300047319 Bacteria 7719
432 Ga0495674_0026570 3300047319 Bacteria 5296
433 Ga0495672_0018994 3300047320 Bacteria 4546
434 Ga0495676_0056387 3300047321 Bacteria 3107
435 Ga0495683_0023280 3300047323 Bacteria 3184
436 Ga0495675_0007148 3300047444 Bacteria 6873
437 Ga0495677_0072587 3300047445 Bacteria 1284
438 Ga0495684_0003716 3300047471 Bacteria 11899
439 Ga0495684_0032067 3300047471 Bacteria 4033
440 Ga0495684_0075214 3300047471 Bacteria 2566
441 Ga0495686_0073768 3300047472 Bacteria 2095
442 Ga0495593_0001221 3300047673 Bacteria 15023
443 Ga0495593_0019277 3300047673 Bacteria 3824
444 Ga0495602_0061213 3300048088 Bacteria 3275
445 Ga0495602_0095096 3300048088 Bacteria 2461
446 Ga0496100_0155306 3300048903 Bacteria 1636
447 Ga0496102_0001499 3300048905 Bacteria 20618
448 Ga0496102_0021801 3300048905 Bacteria 5669
449 Ga0496102_0030037 3300048905 Bacteria 4864
450 Ga0496103_0008170 3300048906 Bacteria 6211
451 Ga0496103_0008315 3300048906 Bacteria 6166
452 Ga0496104_0006502 3300048907 Bacteria 10279
453 Ga0496104_0075649 3300048907 Bacteria 3206
454 Ga0496105_0010284 3300048908 Bacteria 7354
455 Ga0496105_0043793 3300048908 Bacteria 3691
456 Ga0496106_0012833 3300048909 Bacteria 6185
457 Ga0496106_0069193 3300048909 Bacteria 2694
458 Ga0496107_0013894 3300048910 Bacteria 5629
459 Ga0496107_0089761 3300048910 Bacteria 2244
460 Ga0496108_0071328 3300048911 Bacteria 2931
461 Ga0496109_0023208 3300048912 Bacteria 5504
462 Ga0496109_0276161 3300048912 Bacteria 1583
463 Ga0496110_0091686 3300048913 Bacteria 2718
464 Ga0496110_0295706 3300048913 Bacteria 1475
465 Ga0496111_0027772 3300048914 Bacteria 4007
466 Ga0496111_0073120 3300048914 Bacteria 2496
467 Ga0496112_0267417 3300048915 Bacteria 1658
468 Ga0496112_0285282 3300048915 Bacteria 1597
469 Ga0496113_0039170 3300048916 Bacteria 3488
470 Ga0496113_0103136 3300048916 Bacteria 2212
471 Ga0496114_0206150 3300048917 Bacteria 1723
472 Ga0496114_0230095 3300048917 Bacteria 1629
473 Ga0496115_0000715 3300048918 Bacteria 24587
474 Ga0496115_0052515 3300048918 Bacteria 3270
475 Ga0496115_0098453 3300048918 Bacteria 2395
476 Ga0496115_0311524 3300048918 Bacteria 1289
477 Ga0496116_0007150 3300048919 Bacteria 9980
478 Ga0496116_0114225 3300048919 Bacteria 1578
479 Ga0496117_0011279 3300048920 Bacteria 8014
480 Ga0496118_0024434 3300048921 Bacteria 5213
481 Ga0496118_0040603 3300048921 Bacteria 3697
482 Ga0496118_0052837 3300048921 Bacteria 3094
483 Ga0496119_0001582 3300048922 Bacteria 27081
484 Ga0496119_0030537 3300048922 Bacteria 3630
485 Ga0496119_0033561 3300048922 Bacteria 3400
486 Ga0496119_0034542 3300048922 Bacteria 3327
487 Ga0496119_0044694 3300048922 Bacteria 2785
488 Ga0496119_0065246 3300048922 Bacteria 2157
489 Ga0496120_0002855 3300048923 Bacteria 16629
490 Ga0496120_0012942 3300048923 Bacteria 5647
491 Ga0496120_0013372 3300048923 Bacteria 5530
492 Ga0496120_0051037 3300048923 Bacteria 2365
493 Ga0496121_0000001 3300048924 Bacteria 1830318
494 Ga0496121_0001954 3300048924 Bacteria 32835
495 Ga0496121_0005996 3300048924 Bacteria 15351
496 Ga0496121_0024199 3300048924 Bacteria 5817
497 Ga0496121_0025848 3300048924 Bacteria 5554
498 Ga0496121_0031877 3300048924 Bacteria 4806
499 Ga0496121_0115163 3300048924 Bacteria 2042
500 Ga0496121_0178540 3300048924 Bacteria 1535
501 Ga0496121_0183876 3300048924 Bacteria 1505
502 Ga0496121_0251503 3300048924 Bacteria 1225
503 Ga0496121_0323857 3300048924 Bacteria 1037
504 Ga0496122_0001551 3300048925 Bacteria 36439
505 Ga0496123_0000831 3300048926 Bacteria 49501
506 Ga0496123_0036085 3300048926 Bacteria 3512
507 Ga0496124_0004291 3300048927 Bacteria 16748
508 Ga0496124_0097855 3300048927 Bacteria 2382
509 Ga0496124_0126479 3300048927 Bacteria 2035
510 Ga0496124_0152603 3300048927 Bacteria 1810
511 Ga0496124_0161562 3300048927 Bacteria 1745
512 Ga0496125_0000306 3300048928 Bacteria 96360
513 Ga0496125_0009867 3300048928 Bacteria 9715
514 Ga0496125_0045890 3300048928 Bacteria 3672
515 Ga0496125_0084247 3300048928 Bacteria 2415
516 Ga0496126_0000212 3300048929 Bacteria 128871
517 Ga0496126_0001402 3300048929 Bacteria 38138
518 Ga0496126_0005972 3300048929 Bacteria 13691
519 Ga0496126_0010566 3300048929 Bacteria 9656
520 Ga0496126_0011325 3300048929 Bacteria 9248
521 Ga0496126_0042417 3300048929 Bacteria 4202
522 Ga0496126_0079781 3300048929 Bacteria 2897
523 Ga0496126_0084603 3300048929 Bacteria 2797
524 Ga0496126_0111101 3300048929 Bacteria 2387
525 Ga0496126_0252096 3300048929 Bacteria 1470
526 Ga0495682_0011948 3300049460 Bacteria 3337
527 Ga0501033_0051139 3300049570 Bacteria 3063
528 Ga0501033_0073963 3300049570 Bacteria 2501
529 Ga0501034_0020745 3300049571 Bacteria 6707
530 Ga0501034_0023398 3300049571 Bacteria 6296
531 Ga0501034_0108024 3300049571 Bacteria 2774
532 Ga0501036_0272987 3300049572 Bacteria 1415
533 Ga0501038_0059138 3300049574 Bacteria 3284
534 Ga0501043_0061826 3300049579 Bacteria 2940
535 Ga0501046_0067511 3300049580 Bacteria 2785
536 Ga0501047_0188867 3300049581 Bacteria 1925
537 Ga0501047_0272468 3300049581 Bacteria 1539
538 Ga0501068_0046555 3300049584 Bacteria 2616
539 Ga0501072_0323870 3300049588 Bacteria 1225
540 Ga0501077_0090907 3300049593 Bacteria 1934
541 Ga0501035_0002632 3300049822 Bacteria 17501
542 Ga0501035_0141733 3300049822 Bacteria 2089
543 Ga0501035_0239575 3300049822 Bacteria 1543
544 Ga0501044_0030335 3300049823 Bacteria 5700
545 Ga0501044_0047516 3300049823 Bacteria 4439
546 nmdc:mga03n38_55758_c1 3300050490 Bacteria 1781
547 nmdc:mga00v17_16546_c1 3300050491 Bacteria 4156
548 nmdc:mga0yw44_128257_c1 3300050492 Bacteria 1640
549 nmdc:mga0yw44_13907_c1 3300050492 Bacteria 4254
550 nmdc:mga0yw44_88925_c1 3300050492 Bacteria 1948
551 nmdc:mga0k408_30833_c1 3300050493 Bacteria 3059
552 nmdc:mga06z11_138247_c1 3300050494 Bacteria 1374
553 nmdc:mga06z11_22736_c1 3300050494 Bacteria 2933
554 nmdc:mga05p37_226592_c1 3300050507 Bacteria 2253
555 nmdc:mga0n895_146690_c1 3300050512 Bacteria 2389
556 nmdc:mga0sz30_1939_c2 3300050516 Bacteria 7086
557 Ga0495601_0106155 3300053077 Bacteria 1816
558 Ga0495655_0007496 3300053083 Bacteria 2032
559 Ga0495595_0003580 3300053084 Bacteria 6167
560 Ga0495619_0239213 3300053085 Bacteria 1258
561 Ga0500578_0083002 3300053086 Bacteria 2037
562 Ga0500578_0193654 3300053086 Bacteria 1247
563 Ga0500643_013394 3300053087 Bacteria 2896
564 Ga0500651_0002542 3300053093 Bacteria 9673
565 Ga0500566_0000384 3300053094 Bacteria 24438
566 Ga0500566_0000929 3300053094 Bacteria 16757
567 Ga0500640_000112 3300053095 Bacteria 14867
568 Ga0500641_0040083 3300053096 Bacteria 1889
569 Ga0500650_0088215 3300053098 Bacteria 1452
570 Ga0500556_0000120 3300053104 Bacteria 68449
571 Ga0500557_000034 3300053105 Bacteria 71225
572 Ga0500572_000360 3300053111 Bacteria 16170
573 Ga0500593_000509 3300053117 Bacteria 15242
574 Ga0500595_001385 3300053119 Bacteria 12987
575 Ga0500595_001913 3300053119 Bacteria 10731
576 Ga0500595_011617 3300053119 Bacteria 3436
577 Ga0500595_014126 3300053119 Bacteria 3037
578 Ga0500595_022416 3300053119 Bacteria 2237
579 Ga0500595_038919 3300053119 Bacteria 1542
580 Ga0500607_014605 3300053121 Bacteria 4547
581 Ga0500608_003619 3300053122 Bacteria 5831
582 Ga0500614_000592 3300053123 Bacteria 9255
583 Ga0500642_0000053 3300053130 Bacteria 71632
584 Ga0500642_0049665 3300053130 Bacteria 1847
585 Ga0500652_020574 3300053131 Bacteria 2470
586 Ga0500559_0001112 3300053136 Bacteria 16206
587 Ga0500573_0130459 3300053140 Bacteria 1392
588 Ga0500577_0027888 3300053142 Bacteria 1939
589 Ga0500588_0062569 3300053146 Bacteria 1197
590 Ga0500590_038493 3300053148 Bacteria 2468
591 Ga0500603_000179 3300053150 Bacteria 16240
592 Ga0500603_003618 3300053150 Bacteria 3310
593 Ga0500603_038080 3300053150 Bacteria 1271
594 Ga0500604_0021810 3300053151 Bacteria 1813
595 Ga0500620_000299 3300053155 Bacteria 9433
596 Ga0500627_0058623 3300053158 Bacteria 1690
597 Ga0500627_0164495 3300053158 Bacteria 1001
598 Ga0500634_0000008 3300053161 Bacteria 152203
599 Ga0500638_003972 3300053162 Bacteria 5600
600 Ga0500638_092427 3300053162 Bacteria 1422
601 Ga0500639_000136 3300053163 Bacteria 35338
602 Ga0500639_089321 3300053163 Bacteria 1538
603 Ga0500636_0000057 3300053177 Bacteria 53579
604 Ga0500636_0201840 3300053177 Bacteria 1051
605 Ga0500637_0000193 3300053178 Bacteria 22721
606 Ga0500645_022894 3300053730 Bacteria 1917
607 Ga0500609_005993 3300053731 Bacteria 1657
608 Ga0500601_000010 3300053737 Bacteria 45442
609 Ga0500661_000775 3300055283 Bacteria 5968
610 Ga0501082_0250852 3300060353 Bacteria 1540
611 2503199745 2503198000 Bacteria 6884444
612 2507504597 2507262055 Bacteria 8048963
613 2508546025 2508501009 Bacteria 7784016
614 2508694875 2508501042 Bacteria 8719808
615 2508734831 2508501050 Bacteria 9633614
616 2509116686 2508501123 Bacteria 6283661
617 2509142437 2508501127 Bacteria 7037543
618 2509152075 2508501128 Bacteria 8613869
619 2509372024 2509276018 Bacteria 6910194
620 2509389020 2509276021 Bacteria 7634384
621 2509394672 2509276022 Bacteria 6200534
622 2510318745 2510065059 Bacteria 6847884
623 2511137198 2510917022 Bacteria 6504556
624 2511389658 2511231027 Bacteria 5013807
625 2512932835 2512875016 Bacteria 6529530
626 2512960856 2512875024 Bacteria 7195110
627 2513591550 2513237087 Bacteria 5817514
628 2513595584 2513237088 Bacteria 6927906
629 2513608947 2513237090 Bacteria 7096802
630 2513626534 2513237092 Bacteria 8341956
631 2513638467 2513237094 Bacteria 8789602
632 2513649380 2513237095 Bacteria 8976980
633 2513657339 2513237096 Bacteria 8722461
634 2513675193 2513237098 Bacteria 9902361
635 2513699396 2513237102 Bacteria 7703324
636 2513714769 2513237104 Bacteria 10034502
637 2513857810 2513237137 Bacteria 9558895
638 2513875576 2513237139 Bacteria 8737671
639 2513919347 2513237145 Bacteria 8979722
640 2514011033 2513237161 Bacteria 8871253
641 2514036627 2513237164 Bacteria 7563725
642 2514417439 2513237305 Bacteria 7293571
643 2514586904 2513237351 Bacteria 6968952
644 2515624193 2515154112 Bacteria 8294334
645 2517102896 2517093001 Bacteria 9002274
646 2517890961 2517572143 Bacteria 9484767
647 2524438712 2524023205 Bacteria 8918781
648 2524441681 2524023205 Bacteria 8918781
649 2524468494 2524023210 Bacteria 9029266
650 2524537593 2524023228 Bacteria 10118060
651 2528854430 2528768022 Bacteria 10457665
652 2545678540 2545555834 Bacteria 8130841
653 2588518889 2588253730 Bacteria 6881675
654 2596377394 2595698237 Bacteria 6712432
655 2597811048 2597489875 Bacteria 7010078
656 2599332594 2599185156 Bacteria 5403036
657 2599939827 2599185301 Bacteria 6161860
658 2603859969 2602042107 Bacteria 6226103
659 2617347577 2617270735 Bacteria 9163226
660 2617377010 2617270741 Bacteria 8201522
661 2643777937 2643221551 Bacteria 3750538
662 2643796385 2643221555 Bacteria 3749717
663 2643814329 2643221558 Bacteria 5460675
664 2643909560 2643221580 Bacteria 3816678
665 2643964818 2643221591 Bacteria 4397626
666 2643987578 2643221595 Bacteria 6565519
667 2644157901 2643221627 Bacteria 6761570
668 2644169500 2643221629 Bacteria 5850260
669 2644350900 2643221662 Bacteria 5851492
670 2644411137 2643221674 Bacteria 3919126
671 2671120122 2667528175 Bacteria 7532676
672 2688596998 2687453392 Bacteria 6880454
673 2694630260 2693429783 Bacteria 7019804
674 2694635594 2693429784 Bacteria 7241525
675 2715500879 2713897090 Bacteria 3353799
676 2723574150 2721755686 Bacteria 7343952
677 2723846852 2721755755 Bacteria 8322773
678 2728752611 2728368998 Bacteria 8720350
679 2738747349 2738541281 Bacteria 5112672
680 2739037379 2738541333 Bacteria 7106503
681 2739307373 2738543024 Bacteria 5603683
682 2739356578 2738543032 Bacteria 5115625
683 2745075754 2744054633 Bacteria 8678936
684 2745080500 2744054633 Bacteria 8678936
685 2753359443 2751185800 Bacteria 5467370
686 2756670965 2756170246 Bacteria 7451806
687 2757571183 2757320392 Bacteria 3737298
688 2758641704 2758568016 Bacteria 5645291
689 2765464829 2765235802 Bacteria 5618596
690 2770195246 2767802442 Bacteria 5747986
691 2776270809 2775506902 Bacteria 6208009
692 2776280368 2775506904 Bacteria 5954060
693 2792748249 2791355123 Bacteria 8049106
694 2793063554 2791355196 Bacteria 7323613
695 2793066316 2791355197 Bacteria 8420563
696 2793076388
697 2805921069 2802429603 Bacteria 8777136
698 2818237060 2816332527 Bacteria 8933356
699 2824619234 2824617872 Bacteria 8814715
700 2824628117 2824626560 Bacteria 8813858
701 2824636921 2824635225 Bacteria 8785348
702 2824651834 2824644064 Bacteria 8743947
703 2824668020 2824661429 Bacteria 9877870
704 2824676777 2824671348 Bacteria 8369588
705 2824683226 2824679649 Bacteria 8248951
706 2824695427 2824687955 Bacteria 8360029
707 2824701584 2824696289 Bacteria 8335049
708 2824712260 2824704595 Bacteria 9667483
709 2824725384 2824723954 Bacteria 8758240
710 2824736854 2824732956 Bacteria 7810675
711 2824747581 2824746037 Bacteria 7911610
712 2824760928 2824753945 Bacteria 9787441
713 2824767693 2824763712 Bacteria 9792355
714 2824777082 2824773399 Bacteria 8360218
715 2834579032 2834578030 Bacteria 3530182
716 2838129168 2838122688 Bacteria 8803140
717 2839994751 2839993093 Bacteria 5512535
718 2840767610 2840764183 Bacteria 6358399
719 2840884226 2840878972 Bacteria 5483153
720 2841737494 2841734538 Bacteria 6784580
721 2841944205 2841941048 Bacteria 8688029
722 2841954621 2841949485 Bacteria 8680857
723 2841963052 2841957949 Bacteria 8652217
724 2841968986 2841966195 Bacteria 8673214
725 2841979761 2841974524 Bacteria 8931498
726 2841989644 2841983080 Bacteria 8395090
727 2842044161 2842038055 Bacteria 8002051
728 2842051850 2842045827 Bacteria 8006841
729 2842871753 2842871566 Bacteria 4827117
730 2842922867 2842922631 Bacteria 5824079
731 2844008942 2844002411 Bacteria 7168230
732 2844012343 2844009547 Bacteria 6728125
733 2844316117 2844315083 Bacteria 8138177
734 2847941501 2847939898 Bacteria 8606328
735 2849082411 2849076700 Bacteria 7039503
736 2854911932 2854911287 Bacteria 5582813
737 2856322838 2856320880 Bacteria 7263508
738 2856334617 2856328259 Bacteria 6528202
739 2856341701 2856334872 Bacteria 7037011
740 2856349129 2856342000 Bacteria 7176905
741 2856349783 2856349417 Bacteria 6230045
742 2856366888 2856364286 Bacteria 6939991
743 2857352224 2857349434 Bacteria 7926032
744 2857370189 2857367948 Bacteria 6965560
745 2857516547 2857509624 Bacteria 7472071
746 2869172522 2869169390 Bacteria 6659796
747 2869239910 2869234852 Bacteria 6654993
748 2869246111 2869242130 Bacteria 6609239
749 2869250158 2869249662 Bacteria 6868783
750 2869262945 2869256925 Bacteria 6981691
751 2869270017 2869264136 Bacteria 6880765
752 2869272036 2869271264 Bacteria 6908218
753 2869285619 2869278585 Bacteria 7077053
754 2869287700 2869285874 Bacteria 6901219
755 2871435648 2871429161 Bacteria 6547891
756 2871452684 2871451962 Bacteria 7336357
757 2871463911 2871459585 Bacteria 6866887
758 2871472721 2871466892 Bacteria 6923287
759 2871476977 2871474448 Bacteria 6806570
760 2871485525 2871481445 Bacteria 6700002
761 2871493483 2871488783 Bacteria 6929816
762 2871496512 2871495908 Bacteria 6935695
763 2874110933 2874109183 Bacteria 6517025
764 2874122739 2874116593 Bacteria 6674494
765 2874128976 2874123672 Bacteria 7238285
766 2874136639 2874131515 Bacteria 6820270
767 2874142043 2874139085 Bacteria 7021506
768 2874151331 2874146452 Bacteria 7533118
769 2874158965 2874155637 Bacteria 6724144
770 2874163068 2874162495 Bacteria 6174670
771 2874175041 2874168670 Bacteria 8062617
772 2874595522 2874590934 Bacteria 8299676
773 2874611188 2874604998 Bacteria 7834745
774 2874615918 2874612657 Bacteria 8252029
775 2874621504 2874620515 Bacteria 8290088
776 2874647067 2874645413 Bacteria 8214782
777 2876364915 2876363079 Bacteria 6544991
778 2876374707 2876369609 Bacteria 6807521
779 2876383957 2876377896 Bacteria 6565995
780 2876387273 2876386047 Bacteria 6698674
781 2876397740 2876392853 Bacteria 6660880
782 2876417384 2876413966 Bacteria 6831344
783 2876421622 2876420981 Bacteria 6687741
784 2876763788 2876761206 Bacteria 10111113
785 2876775716 2876771140 Bacteria 8287509
786 2876810541 2876808645 Bacteria 8824342
787 2876823708 2876818435 Bacteria 8274608
788 2878735116 2878730984 Bacteria 6380721
789 2878744774 2878738818 Bacteria 7136951
790 2878749211 2878745973 Bacteria 6867388
791 2878757526 2878753008 Bacteria 6922523
792 2878760740 2878760144 Bacteria 6823465
793 2878767635 2878767105 Bacteria 6898628
794 2878777505 2878774303 Bacteria 6108671
795 2878784799 2878781027 Bacteria 6834456
796 2879079807 2879074833 Bacteria 8279565
797 2879091277 2879083081 Bacteria 8587928
798 2879103057 2879099564 Bacteria 10442239
799 2879114399 2879110137 Bacteria 8907982
800 2879131114 2879127579 Bacteria 8294491
801 2879150320 2879142872 Bacteria 8267021
802 2881149622 2881147464 Bacteria 7779814
803 2881160806 2881155292 Bacteria 6461656
804 2881166502 2881161766 Bacteria 7127907
805 2881364839 2881364244 Bacteria 7710352
806 2881855194 2881853255 Bacteria 6698367
807 2881863189 2881861095 Bacteria 7128710
808 2882639419 2882632389 Bacteria 8154593
809 2882915691 2882912400 Bacteria 6801539
810 2885307986 2885305155 Bacteria 7348390
811 2885313098 2885312484 Bacteria 6415165
812 2885331723 2885326080 Bacteria 7134805
813 2885339695 2885334103 Bacteria 7216818
814 2885344705 2885342637 Bacteria 7011821
815 2885357913 2885350715 Bacteria 6787678
816 2885368253 2885366525 Bacteria 8326213
817 2885387005 2885383462 Bacteria 9473874
818 2885413143 2885409591 Bacteria 9235467
819 2888338062 2888337043 Bacteria 6629336
820 2888345408 2888343758 Bacteria 6611049
821 2888354726 2888350351 Bacteria 7372807
822 2888380233 2888378607 Bacteria 9652610
823 2888391262 2888388044 Bacteria 7304136
824 2888427173 2888419890 Bacteria 7857137
825 2889016343 2889010040 Bacteria 6749192
826 2889018636 2889016732 Bacteria 6700763
827 2889038352 2889033259 Bacteria 9099371
828 2889308860 2889306138 Bacteria 6358934
829 2894656185 2894652903 Bacteria 4587256
830 2899279545 2899275550 Bacteria 3958688
831 2902334977 2902330777 Bacteria 6395352
832 2902405706 2902405164 Bacteria 6784948
833 2903449623 2903448605 Bacteria 7357801
834 2903498675 2903492973 Bacteria 13473544
835 2903501255 2903492973 Bacteria 13473544
836 2903522349 2903521522 Bacteria 6525694
837 2903528728 2903528002 Bacteria 6586099
838 2903541306 2903540706 Bacteria 7062119
839 2903729481 2903727486 Bacteria 8281579
840 2903771675 2903768456 Bacteria 9749579
841 2904580819 2904578770 Bacteria 5302906
842 2904664391 2904659560 Bacteria 6685615
843 2904668173 2904666416 Bacteria 8226587
844 2904693963 2904690495 Bacteria 9412302
845 2904705806
846 2904719956 2904711408 Bacteria 9771557
847 2906310249 2906308376 Bacteria 6841989
848 2906324314 2906321335 Bacteria 6579571
849 2906368734 2906363423 Bacteria 6856682
850 2906376279 2906370794 Bacteria 6881062
851 2906389807 2906386501 Bacteria 5977019
852 2906395831 2906393657 Bacteria 6790866
853 2906403215 2906401398 Bacteria 6693206
854 2906409127 2906408224 Bacteria 6162342
855 2906428833 2906427513 Bacteria 6375796
856 2906606691 2906602504 Bacteria 8295279
857 2906616159
858 2906634540 2906626472 Bacteria 8826946
859 2906642208 2906635258 Bacteria 8601019
860 2906650022 2906643746 Bacteria 8722424
861 2906664503 2906660503 Bacteria 8595048
862 2908741225 2908739725 Bacteria 8628932
863 2908764679 2908756301 Bacteria 8864324
864 2908782919 2908775508 Bacteria 8092255
865 2913296556 2913295892 Bacteria 6333755
866 2915653848 2915650412 Bacteria 4288180
867 2919121467 2919119836 Bacteria 5208557
868 2919451890 2919450847 Bacteria 5631160
869 2922134574 2922130491 Bacteria 7173936
870 2922156582 2922151315 Bacteria 6902399
871 2922178392 2922172374 Bacteria 6167644
872 2922185228 2922178524 Bacteria 6025201
873 2922191905 2922185730 Bacteria 7113964
874 2922362543 2922361189 Bacteria 7436256
875 2922369798
876 2922392888 2922386360 Bacteria 7017218
877 2922431865
878 2924739020 2924733363 Bacteria 7574837
879 2924744866 2924741084 Bacteria 6661321
880 2924753820 2924748358 Bacteria 6154725
881 2924760149 2924754689 Bacteria 6774424
882 2924768461 2924762789 Bacteria 6561353
883 2924782805 2924776078 Bacteria 7492003
884 2924786822 2924784321 Bacteria 7416538
885 2925334494 2925326138 Bacteria 9652120
886 2928129683 2928125067 Bacteria 5937560
887 2928523690 2928521798 Bacteria 4960112
888 2929622843 2929615660 Bacteria 9193770
889 2929632053 2929624759 Bacteria 9339455
890 2932404289 2932401849 Bacteria 4262978
891 2932789837 2932784394 Bacteria 9704911
892 2932799617 2932794094 Bacteria 7915132
893 2932805096 2932801729 Bacteria 7987968
894 2932815394 2932809354 Bacteria 9135765
895 2932825167 2932818245 Bacteria 9955613
896 2932829335 2932828146 Bacteria 9745859
897 2933584525 2933577622 Bacteria 9116884
898 2935614203 2935608549 Bacteria 8203142
899 2935617768 2935616580 Bacteria 9032984
900 2935643813 2935638405 Bacteria 10015038
901 2935651428 2935648319 Bacteria 8801166
902 2935659804 2935656913 Bacteria 8965014
903 2935670877 2935665750 Bacteria 9571747
904 2935678210 2935675223 Bacteria 9928132
905 2935692498 2935684952 Bacteria 9590419
906 2935699288 2935694250 Bacteria 9291695
907 2935710095 2935703347 Bacteria 10242284
908 2935721116 2935713505 Bacteria 9608509
909 2935730891 2935722832 Bacteria 9608746
910 2935739805 2935732158 Bacteria 9706831
911 2935748843 2935741537 Bacteria 9707219
912 2935758713 2935750917 Bacteria 9590372
913 2935767775 2935760218 Bacteria 9817913
914 2935775569 2935769743 Bacteria 7878163
915 2935779826 2935777560 Bacteria 8077691
916 2935790097 2935785616 Bacteria 7962367
917 2935798532 2935793552 Bacteria 8012592
918 2935806741 2935801545 Bacteria 9301974
919 2935819217 2935810662 Bacteria 9401221
920 2935826454 2935819856 Bacteria 8261050
921 2935834498 2935827899 Bacteria 10038562
922 2935843777 2935837841 Bacteria 9454360
923 2935851351 2935847175 Bacteria 8228321
924 2935856733 2935855204 Bacteria 9035059
925 2935868212 2935864058 Bacteria 9784707
926 2935879570 2935873716 Bacteria 9632195
927 2935887488 2935883170 Bacteria 7964738
928 2935913315 2935908558 Bacteria 8568796
929 2935922719 2935916978 Bacteria 9113783
930 2935930760 2935926038 Bacteria 8601059
931 2935939906 2935934488 Bacteria 8602579
932 2935946855 2935942939 Bacteria 8599779
933 2935955944 2935951376 Bacteria 8602333
934 2935966241 2935959822 Bacteria 7869783
935 2935972737 2935967501 Bacteria 8603075
936 2935982526 2935975950 Bacteria 8347125
937 2935984532 2935984226 Bacteria 8302647
938 2935997076 2935992306 Bacteria 9802711
939 2936009812 2936002035 Bacteria 9362176
940 2936014220 2936011229 Bacteria 8801034
941 2936022871 2936019824 Bacteria 8804134
942 2936031008 2936028420 Bacteria 8965941
943 2936045781 2936037263 Bacteria 9446081
944 2936049129 2936046547 Bacteria 8903709
945 2936055576 2936055302 Bacteria 8785755
946 2937817073 2937813078 Bacteria 7783518
947 2937822515 2937822353 Bacteria 7290551
948 2937840269 2937836603 Bacteria 6811263
949 2937843431 2937843397 Bacteria 5256375
950 2937852452 2937848649 Bacteria 6983481
951 2937867009 2937861824 Bacteria 6660327
952 2937881540 2937877337 Bacteria 7246526
953 2937977536 2937972304 Bacteria 7532020
954 2937985695 2937980651 Bacteria 6517427
955 2937995162 2937994558 Bacteria 7036190
956 2938018242 2938014810 Bacteria 6700592
957 2939670334 2939669807 Bacteria 5028511
958 2940564697 2940556831 Bacteria 9590747
959 2941534865 2941531003 Bacteria 7653939
960 2941545025 2941538514 Bacteria 9402094
961 2954015973 2954011201 Bacteria 4762601
962 2958041634 2958034702 Bacteria 6989922
963 2958043357 2958041894 Bacteria 13082850
964 2958047984 2958041894 Bacteria 13082850
965 2958070383 2958064165 Bacteria 7158582
966 2958071479 2958071322 Bacteria 6815895
967 2958087903 2958084443 Bacteria 7312792
968 2958095600 2958092219 Bacteria 6861151
969 2958101288 2958100919 Bacteria 6800575
970 2958113635 2958108152 Bacteria 6681128
971 2958128948 2958122699 Bacteria 7280457
972 2958132102 2958130278 Bacteria 6897202
973 2958148619 2958144490 Bacteria 6677056
974 2958163426 2958158011 Bacteria 6058449
975 2958165573 2958165035 Bacteria 6906348
976 2958181916 2958179912 Bacteria 6874908
977 2961079760 2961077736 Bacteria 7079850
978 2961119390 2961114664 Bacteria 6680456
979 2961164032 2961163497 Bacteria 6901077
980 2961175146 2961170736 Bacteria 7072258
981 2961184012 2961183825 Bacteria 6688536
982 2963646371 2963644680 Bacteria 6530403
983 2965018902 2965018300 Bacteria 6883036
984 2965027068 2965025482 Bacteria 6532201
985 2965035982 2965032056 Bacteria 6887443
986 2965044711 2965040258 Bacteria 6855979
987 2965052030 2965047637 Bacteria 6623551
988 2965068066 2965062239 Bacteria 7412989
989 2965091323 2965089291 Bacteria 6866420
990 2965119145 2965110997 Bacteria 6693150
991 2967999852 2967996073 Bacteria 6787468
992 2968008211 2968003550 Bacteria 6929263
993 2968020494 2968016561 Bacteria 7022047
994 2968087103 2968083720 Bacteria 7351627
995 2968115645 2968110612 Bacteria 6814636
996 2968119015 2968117919 Bacteria 6536078
997 2968134594 2968128360 Bacteria 6270294
998 2968172435 2968171901 Bacteria 6894245
999 2970473791 2970469710 Bacteria 6969209
1000 2970490398 2970489779 Bacteria 6517260
1001 2970507734 2970503327 Bacteria 7099517
1002 2970518117 2970510686 Bacteria 7006402
1003 2970527125 2970524798 Bacteria 6840927
1004 2970534008 2970532167 Bacteria 6553173
1005 2970545069 2970540015 Bacteria 6977556
1006 2970554522 2970547951 Bacteria 6931819
1007 2970555593 2970554993 Bacteria 6814252
1008 2970600235 2970593180 Bacteria 7073582
1009 2970625126 2970619444 Bacteria 6986144
1010 2970630837 2970627176 Bacteria 6680862
1011 2977826684 2977821940 Bacteria 6906439
1012 2977832159 2977828996 Bacteria 7007971
1013 2977847364 2977843712 Bacteria 6753583
1014 2977854191 2977851361 Bacteria 6694324
1015 2977870133 2977864932 Bacteria 7534097
1016 2977880193 2977872689 Bacteria 7270173
1017 2977908514 2977907340 Bacteria 6577984
1018 2977918087 2977915119 Bacteria 6829656
1019 2977925308 2977922695 Bacteria 6956781
1020 2977940678 2977935797 Bacteria 6252826
1021 2977945183 2977942078 Bacteria 7570577
1022 2977956366 2977950692 Bacteria 6893264
1023 2977964676 2977957713 Bacteria 6877875
1024 2977991323 2977986579 Bacteria 6581278
1025 2979747284 2979742915 Bacteria 7301278
1026 2979768169 2979764755 Bacteria 6610066
1027 2979774137 2979772303 Bacteria 6618277
1028 2979796985 2979793036 Bacteria 6808957
1029 2979812918 2979808191 Bacteria 7179355
1030 2987639408 2987636660 Bacteria 8088555
1031 2987647633 2987645492 Bacteria 6117018
1032 2987659007 2987652177 Bacteria 6969023
1033 2987660040 2987659509 Bacteria 6966464
1034 2987672358 2987666974 Bacteria 6509233
1035 2987680336 2987673487 Bacteria 6884027
1036 2996337069 2996336353 Bacteria 5511628
1037 2996352886 2996348954 Bacteria 7239054
1038 2996387205 2996386984 Bacteria 6978667
1039 3000139346 3000135777 Bacteria 6891109
1040 3000406202 3000405567 Bacteria 3779330
1041 3002144559 3002141150 Bacteria 5254435
1042 3003671387 3003665799 Bacteria 7279786
1043 3004167388 3004167301 Bacteria 8330599
1044 3004189088 3004188549 Bacteria 6952365
1045 3004198890 3004195979 Bacteria 6776956
1046 3004204348 3004203850 Bacteria 7307914
1047 3004217806 3004211236 Bacteria 7417683
1048 3004221146 3004218560 Bacteria 7421728
1049 3004239634 3004232784 Bacteria 6662140
1050 3004242309 3004239961 Bacteria 6892290
1051 3004253069 3004248173 Bacteria 6563236
1052 3004274170 3004268573 Bacteria 7043476
1053 3004279568 3004275668 Bacteria 7114440
1054 3004294160 3004289098 Bacteria 6135450
1055 3004336024 3004334049 Bacteria 8449246
1056 3005490404 3005483717 Bacteria 7877331
1057 3005509790 3005506211 Bacteria 6943378
1058 3005591107 3005587118 Bacteria 7794411
1059 3005595701 3005594810 Bacteria 8716512
1060 3005711683 3005710791 Bacteria 7622528
1061 3005718947 3005718088 Bacteria 8283608
1062 637075917 637000159 Bacteria 7596297
1063 641643106 641522639 Bacteria 7737025
1064 643601861 643348564 Bacteria 8839022
1065 649871555 649633066 Bacteria 6690028
1066 8001850019 8001845381 Bacteria 5804942
1067 8002289465 8002285264 Bacteria 6717907
1068 8004307102 8004300914 Bacteria 6132239
1069 8004316892 8004312739 Bacteria 7444653
1070 8004366506 8004361976 Bacteria 6858373
1071 8004379100 8004374579 Bacteria 6898112
1072 8004389485 8004387939 Bacteria 7049250
1073 8004402950 8004395343 Bacteria 6620908
1074 8004637438 8004633249 Bacteria 6723080
1075 8004643313 8004640170 Bacteria 6723001
1076 8004701976 8004695233 Bacteria 6731676
1077 8004717883 8004714634 Bacteria 6776161
1078 8004729859 8004727605 Bacteria 6643904
1079 8006939058 8006933436 Bacteria 10410654
1080 8006969039 8006964411 Bacteria 8966052
1081 8006978716 8006973647 Bacteria 10679141
1082 8006987514 8006984368 Bacteria 9651211
1083 8006995015 8006994254 Bacteria 8309700
1084 8016518911 8016511872 Bacteria 9921665
1085 8016525554 8016522445 Bacteria 8156687
1086 8016539149 8016530956 Bacteria 8155261
1087 8016549861 8016548790 Bacteria 8155074
1088 8016558273 8016557553 Bacteria 8154380
1089 8016568837 8016566248 Bacteria 8158151
1090 8016581482 8016575299 Bacteria 8154085
1091 8016587180 8016583857 Bacteria 10421953
1092 8016596271 8016595262 Bacteria 8149947
1093 8016607180 8016603502 Bacteria 8731218
1094 8016619080 8016613128 Bacteria 8794220
1095 8016630505 8016622563 Bacteria 7999408
1096 8016636580 8016630954 Bacteria 9217207
1097 8017057777 8017057580 Bacteria 10023680
1098 8018132511 8018127388 Bacteria 7351159
1099 8018153644 8018150411 Bacteria 5549903
1100 8019538816 8019530166 Bacteria 8155624
1101 8019541166 8019538911 Bacteria 7872763
1102 8019559990 8019555841 Bacteria 9642137
1103 8019570089 8019565922 Bacteria 9639779
1104 8019605655 8019597564 Bacteria 10041141
1105 8019612879 8019608314 Bacteria 10042931
1106 8019623562 8019619141 Bacteria 9218857
1107 8019638588 8019629233 Bacteria 8687553
1108 8019641156 8019638758 Bacteria 9062356
1109 8019653287 8019648815 Bacteria 10014479
1110 8019666389 8019659431 Bacteria 8577854
1111 8019676051 8019668869 Bacteria 8791617
1112 8019693427 8019687851 Bacteria 8712826
1113 8045867586 8045864390 Bacteria 5043873
1114 8046768723 8046767195 Bacteria 7547379
1115 8055619212 8055617313 Bacteria 7548464
1116 8055750746 8055742211 Bacteria 9226248
1117 8056685761 8056681323 Bacteria 8472857
1118 8056690457 8056689827 Bacteria 6712655
1119 8056970574 8056967851 Bacteria 9038162
1120 8057582509 8057575449 Bacteria 7367519
1121 Ga0265327_10042421
1122 JGI25155J39150_1000075
1123 JGI25156J39149_1000103
1124 JGI25156J39149_1003452
1125 JGI25154J39366_1000018
1126 JGI25158J39367_1000444
1127 JGI25157J39369_1000074
1128 JGI25157J39369_1001580
1129 JGI25406J46586_10008474
1130 JGI25406J46586_10023695
1131 JGI25165J46597_1000034
1132 JGI25153J46596_10001090
1133 JGI25153J46596_10001143
1134 JGI25153J46596_10005592
1135 JGI25153J46596_10012228
1136 JGI25160J50197_1002884
1137 JGI25404J52841_10010319
1138 JGI25404J52841_10010756
1139 Ga0055542_1000299
1140 Ga0055526_1040170
1141 Ga0055531_10003992
1142 Ga0055543_1007797
1143 Ga0065165_1012943
1144 Ga0068869_100158835
1145 Ga0068868_100109188
1146 Ga0068868_100337670
1147 Ga0070661_100050376
1148 Ga0070668_100092837
1149 Ga0070671_100022839
1150 Ga0070671_100112444
1151 Ga0070674_100070988
1152 Ga0070674_100133761
1153 Ga0070667_100151146
1154 Ga0070713_100009248
1155 Ga0070710_10011668
1156 Ga0070711_100001929
1157 Ga0070711_100021315
1158 Ga0070663_100064671
1159 Ga0070663_100090239
1160 Ga0070663_100129382
1161 Ga0070663_100312388
1162 Ga0070678_100043779
1163 Ga0070678_100193042
1164 Ga0070662_100244316
1165 Ga0070681_10038588
1166 Ga0070681_10160369
1167 Ga0070697_100158811
1168 Ga0068853_100000498
1169 Ga0068853_100016508
1170 Ga0070693_100076134
1171 Ga0070665_100017223
1172 Ga0070665_100023023
1173 Ga0070665_100139449
1174 Ga0070665_100157159
1175 Ga0070665_100238447
1176 Ga0070665_100402154
1177 Ga0068855_100082169
1178 Ga0068857_100180946
1179 Ga0068857_100312271
1180 Ga0068854_100275987
1181 Ga0068856_100000255
1182 Ga0070702_100091872
1183 Ga0070702_100098070
1184 Ga0068852_100005223
1185 Ga0068852_100035512
1186 Ga0068859_100114267
1187 Ga0068864_100070386
1188 Ga0068861_100115929
1189 Ga0068861_100285695
1190 Ga0068858_100312611
1191 Ga0068860_100159492
1192 Ga0068862_100155150
1193 Ga0081455_10005028
1194 Ga0081455_10014229
1195 Ga0081455_10040052
1196 Ga0081538_10024381
1197 Ga0081540_1006026
1198 Ga0081540_1007191
1199 Ga0081540_1023299
1200 Ga0081540_1027385
1201 Ga0081540_1053052
1202 Ga0081540_1061172
1203 Ga0081540_1079418
1204 Ga0081540_1084822
1205 Ga0081539_10000486
1206 Ga0081539_10004610
1207 Ga0070717_10002386
1208 Ga0075364_10126627
1209 Ga0075364_10127897
1210 Ga0070716_100069246
1211 Ga0070712_100018183
1212 Ga0075367_10030741
1213 Ga0075367_10045507
1214 Ga0075367_10050058
1215 Ga0075367_10117429
1216 Ga0075367_10122590
1217 Ga0075367_10145204
1218 Ga0075369_10015745
1219 Ga0075369_10051919
1220 Ga0097621_100278226
1221 Ga0075370_10048535
1222 Ga0075370_10074967
1223 Ga0075428_100145528
1224 Ga0075434_100189007
1225 Ga0068865_100082407
1226 Ga0075436_100177300
1227 Ga0097620_100114265
1228 Ga0099825_1024907
1229 Ga0099824_1013226
1230 Ga0099824_1015712
1231 Ga0099822_1009022
1232 Ga0075435_100165644
1233 Ga0099794_10031949
1234 Ga0105240_10005052
1235 Ga0105240_10041316
1236 Ga0111539_10011199
1237 Ga0105245_10211767
1238 Ga0105245_10230094
1239 Ga0105247_10193583
1240 Ga0114129_10463324
1241 Ga0105241_10083955
1242 Ga0105241_10262395
1243 Ga0105241_10383117
1244 Ga0105242_10133367
1245 Ga0105248_10039124
1246 Ga0105248_10230015
1247 Ga0105248_10446522
1248 Ga0105237_10000122
1249 Ga0105237_10001825
1250 Ga0105237_10090656
1251 Ga0105237_10108122
1252 Ga0105237_10193891
1253 Ga0123341_1000017
1254 Ga0105239_10001981
1255 Ga0157370_10130345
1256 Ga0157374_10097063
1257 Ga0157374_10368964
1258 Ga0157375_10027437
1259 Ga0157375_10289812
1260 Ga0163163_10030129
1261 Ga0163163_10162858
1262 Ga0163163_10279454
1263 Ga0163163_10408282
1264 Ga0157380_10170725
1265 Ga0157377_10100300
1266 Ga0214544_1000007
1267 Ga0214542_1000007
1268 Ga0214545_1000006
1269 Ga0214543_1000009
1270 Ga0213876_10000961
1271 Ga0213876_10105914
1272 Ga0209435_100044
1273 Ga0209646_1000151
1274 Ga0209646_1007796
1275 Ga0209026_1000100
1276 Ga0209026_1000170
1277 Ga0209677_100810
1278 Ga0209677_102269
1279 Ga0209148_1000069
1280 Ga0209148_1000216
1281 Ga0209148_1002619
1282 Ga0209148_1003399
1283 Ga0209759_1000186
1284 Ga0209759_1000899
1285 Ga0209233_1000028
1286 Ga0209233_1000444
1287 Ga0209233_1001353
1288 Ga0209233_1004829
1289 Ga0209455_1000135
1290 Ga0209455_1010145
1291 Ga0209025_1038969
1292 Ga0209564_1004831
1293 Ga0209564_1005422
1294 Ga0209758_1000015
1295 Ga0209758_1000161
1296 Ga0209758_1001304
1297 Ga0209758_1004767
1298 Ga0209758_1008017
1299 Ga0209758_1010265
1300 Ga0209758_1029217
1301 Ga0209256_1011080
1302 Ga0207426_1000186
1303 Ga0207426_1011226
1304 Ga0209257_1004903
1305 Ga0207697_10031083
1306 Ga0207647_10037379
1307 Ga0207647_10038846
1308 Ga0207643_10041639
1309 Ga0207654_10055561
1310 Ga0207654_10060498
1311 Ga0207707_10028930
1312 Ga0207707_10137533
1313 Ga0207695_10000006
1314 Ga0207671_10000249
1315 Ga0207671_10005136
1316 Ga0207663_10003769
1317 Ga0207662_10079545
1318 Ga0207657_10020311
1319 Ga0207657_10165756
1320 Ga0207649_10040043
1321 Ga0207687_10207988
1322 Ga0207709_10163676
1323 Ga0207669_10012355
1324 Ga0207704_10009681
1325 Ga0207704_10259770
1326 Ga0207691_10135945
1327 Ga0207691_10163203
1328 Ga0207667_10133289
1329 Ga0207667_10155000
1330 Ga0207651_10061013
1331 Ga0207712_10071081
1332 Ga0207668_10034451
1333 Ga0207668_10068046
1334 Ga0207639_10001845
1335 Ga0207639_10127327
1336 Ga0207639_10197025
1337 Ga0207678_10043187
1338 Ga0207678_10064643
1339 Ga0207708_10225338
1340 Ga0207702_10009007
1341 Ga0207702_10080290
1342 Ga0207702_10245181
1343 Ga0207676_10286888
1344 Ga0207674_10155512
1345 Ga0207674_10326862
1346 Ga0207683_10014673
1347 Ga0207683_10056387
1348 Ga0207683_10103819
1349 Ga0209389_1000062
1350 Ga0209389_1000072
1351 Ga0209589_1000006
1352 Ga0209589_1000270
1353 Ga0209489_100007
1354 Ga0209489_100160
1355 Ga0209489_100206
1356 Ga0209700_100008
1357 Ga0209700_101128
1358 Ga0209179_1009064
1359 Ga0209588_1000381
1360 Ga0268266_10006046
1361 Ga0268266_10034996
1362 Ga0268266_10423863
1363 Ga0268265_10071657
1364 Ga0268264_10188575
1365 Ga0265326_10002903
1366 Ga0265319_1004654
1367 Ga0265334_10000614
1368 Ga0265318_10016980
1369 Ga0265323_10000644
1370 Ga0265336_10000259
1371 Ga0307515_10001758
1372 Ga0307515_10261180
1373 Ga0265338_10000013
1374 Ga0265338_10000133
1375 Ga0265324_10003265
1376 Ga0265332_10012314
1377 Ga0265328_10017452
1378 Ga0265325_10020621
1379 Ga0265329_10027630
1380 Ga0265339_10000410
1381 Ga0265339_10012260
1382 Ga0265339_10094869
1383 Ga0265331_10004867
1384 Ga0265331_10010918
1385 Ga0265331_10044049
1386 Ga0265316_10082459
1387 Ga0307513_10214661
1388 Ga0307509_10040596
1389 Ga0307509_10240472
1390 Ga0307508_10000025
1391 Ga0307508_10121933
1392 Ga0265314_10000997
1393 Ga0265314_10058645
1394 Ga0265314_10080713
1395 Ga0265342_10000024
1396 Ga0265342_10024976
1397 Ga0316578_10018689
1398 Ga0307516_10001162
1399 Ga0307405_10216247
1400 Ga0307413_10026740
1401 Ga0307406_10052882
1402 Ga0307412_10044132
1403 Ga0307409_100027125
1404 Ga0307414_10015318
1405 Ga0307414_10118945
1406 Ga0307414_10237052
1407 Ga0307510_10008205
1408 Ga0307510_10049166
1409 Ga0307510_10100571
1410 Ga0315911_1000003
1411 Ga0373944_0040929
1412 Ga0373923_0002937
1413 Ga0373945_0018468
1414 Ga0373953_0012150
1415 Ga0373954_0070728
1416 Ga0373956_0001024
1417 Ga0373943_0017025
1418 Ga0373943_0022973
1419 Ga0373955_0003604
1420 Ga0373955_0139342
1421 Ga0373924_0006755
1422 Ga0373935_0003185
1423 Ga0373935_0120111
1424 Ga0373927_0002909
1425 Ga0373927_0027238
1426 Ga0373927_0041912
1427 Ga0373933_0000112
1428 Ga0373933_0221624
1429 Ga0373947_0016491
1430 Ga0373937_0032959
1431 Ga0316584_0026677
1432 Ga0373925_0004474
1433 Ga0395899_0056699
1434 Ga0395900_0098252
1435 Ga0395900_0111141
1436 Ga0395900_0126510
1437 Ga0395900_0145596
1438 Ga0395898_0130036
1439 Ga0395905_0000710
1440 Ga0395905_0164250
1441 Ga0395901_0105336
1442 Ga0395901_0135579
1443 Ga0400483_002736
1444 Ga0400483_035839
1445 Ga0400483_201614
1446 Ga0400483_217519
1447 Ga0400483_223068
1448 Ga0400483_233607
1449 Ga0400483_267556
1450 Ga0400489_41176
1451 Ga0436365_0875841
1452 Ga0436365_1114449
1453 Ga0436361_0869946
1454 Ga0436361_1217182
1455 Ga0439465_0049005
1456 Ga0466972_0004978
1457 Ga0466972_0043214
1458 Ga0466965_0050503
1459 Ga0466961_0000324
1460 Ga0466964_0060701
1461 Ga0466968_0040069
1462 Ga0466968_0077535
1463 Ga0466970_0046053
1464 Ga0466957_0145531
1465 Ga0466957_0167741
1466 Ga0466960_0050037
1467 Ga0466960_0062506
1468 Ga0466959_0031894
1469 Ga0451576_0002274
1470 Ga0466958_0097217
1471 Ga0466967_0356498
1472 Ga0495617_002973
1473 Ga0495592_0009908
1474 Ga0495592_0033024
1475 Ga0495603_0005569
1476 Ga0495603_0032536
1477 Ga0495603_0064458
1478 Ga0495629_0001327
1479 Ga0495629_0008439
1480 Ga0495629_0021465
1481 Ga0495638_0005323
1482 Ga0495638_0005713
1483 Ga0495638_0024652
1484 Ga0495641_0009191
1485 Ga0495653_0135984
1486 Ga0495650_0014040
1487 Ga0495580_0009555
1488 Ga0495582_0147170
1489 Ga0495605_0030567
1490 Ga0495662_0001936
1491 Ga0495664_0009126
1492 Ga0495594_0008915
1493 Ga0495594_0244168
1494 Ga0495606_0016267
1495 Ga0495608_0029953
1496 Ga0495628_0026291
1497 Ga0495628_0140484
1498 Ga0495630_0004453
1499 Ga0495631_0017362
1500 Ga0495643_0132747
1501 Ga0495648_0008452
1502 Ga0495648_0019531
1503 Ga0495666_0015568
1504 Ga0495652_0003976
1505 Ga0495652_0052875
1506 Ga0495665_0107478
1507 Ga0495640_0007922
1508 Ga0495640_0011122
1509 Ga0495640_0026155
1510 Ga0495640_0070832
1511 Ga0495587_0004748
1512 Ga0495587_0020515
1513 Ga0495645_0008214
1514 Ga0495622_0013980
1515 Ga0495667_0008395
1516 Ga0495667_0011515
1517 Ga0495667_0118860
1518 Ga0495668_0013606
1519 Ga0495668_0020578
1520 Ga0495668_0056058
1521 Ga0495668_0083033
1522 Ga0495634_0002499
1523 Ga0495634_0045727
1524 Ga0495625_0040133
1525 Ga0495625_0074722
1526 Ga0495625_0126547
1527 Ga0495625_0157354
1528 Ga0495635_0004129
1529 Ga0495635_0012056
1530 Ga0495635_0044086
1531 Ga0495657_0003208
1532 Ga0495657_0021398
1533 Ga0495599_0033031
1534 Ga0495623_0052789
1535 Ga0495646_0048275
1536 Ga0495647_0009732
1537 Ga0495669_0004055
1538 Ga0495613_0004290
1539 Ga0495613_0035933
1540 Ga0495613_0047018
1541 Ga0495624_0011028
1542 Ga0495624_0182572
1543 Ga0495649_0035085
1544 Ga0495600_0034056
1545 Ga0495600_0045317
1546 Ga0495581_0003922
1547 Ga0495604_0002083
1548 Ga0495604_0057448
1549 Ga0495636_0077612
1550 Ga0495674_0010440
1551 Ga0495674_0013370
1552 Ga0495674_0026570
1553 Ga0495672_0018994
1554 Ga0495676_0056387
1555 Ga0495683_0023280
1556 Ga0495675_0007148
1557 Ga0495677_0072587
1558 Ga0495684_0003716
1559 Ga0495684_0032067
1560 Ga0495684_0075214
1561 Ga0495686_0073768
1562 Ga0495593_0001221
1563 Ga0495593_0019277
1564 Ga0495602_0061213
1565 Ga0495602_0095096
1566 Ga0496100_0155306
1567 Ga0496102_0001499
1568 Ga0496102_0021801
1569 Ga0496102_0030037
1570 Ga0496103_0008170
1571 Ga0496103_0008315
1572 Ga0496104_0006502
1573 Ga0496104_0075649
1574 Ga0496105_0010284
1575 Ga0496105_0043793
1576 Ga0496106_0012833
1577 Ga0496106_0069193
1578 Ga0496107_0013894
1579 Ga0496107_0089761
1580 Ga0496108_0071328
1581 Ga0496109_0023208
1582 Ga0496109_0276161
1583 Ga0496110_0091686
1584 Ga0496110_0295706
1585 Ga0496111_0027772
1586 Ga0496111_0073120
1587 Ga0496112_0267417
1588 Ga0496112_0285282
1589 Ga0496113_0039170
1590 Ga0496113_0103136
1591 Ga0496114_0206150
1592 Ga0496114_0230095
1593 Ga0496115_0000715
1594 Ga0496115_0052515
1595 Ga0496115_0098453
1596 Ga0496115_0311524
1597 Ga0496116_0007150
1598 Ga0496116_0114225
1599 Ga0496117_0011279
1600 Ga0496118_0024434
1601 Ga0496118_0040603
1602 Ga0496118_0052837
1603 Ga0496119_0001582
1604 Ga0496119_0030537
1605 Ga0496119_0033561
1606 Ga0496119_0034542
1607 Ga0496119_0044694
1608 Ga0496119_0065246
1609 Ga0496120_0002855
1610 Ga0496120_0012942
1611 Ga0496120_0013372
1612 Ga0496120_0051037
1613 Ga0496121_0000001
1614 Ga0496121_0001954
1615 Ga0496121_0005996
1616 Ga0496121_0024199
1617 Ga0496121_0025848
1618 Ga0496121_0031877
1619 Ga0496121_0115163
1620 Ga0496121_0178540
1621 Ga0496121_0183876
1622 Ga0496121_0251503
1623 Ga0496121_0323857
1624 Ga0496122_0001551
1625 Ga0496123_0000831
1626 Ga0496123_0036085
1627 Ga0496124_0004291
1628 Ga0496124_0097855
1629 Ga0496124_0126479
1630 Ga0496124_0152603
1631 Ga0496124_0161562
1632 Ga0496125_0000306
1633 Ga0496125_0009867
1634 Ga0496125_0045890
1635 Ga0496125_0084247
1636 Ga0496126_0000212
1637 Ga0496126_0001402
1638 Ga0496126_0005972
1639 Ga0496126_0010566
1640 Ga0496126_0011325
1641 Ga0496126_0042417
1642 Ga0496126_0079781
1643 Ga0496126_0084603
1644 Ga0496126_0111101
1645 Ga0496126_0252096
1646 Ga0495682_0011948
1647 Ga0501033_0051139
1648 Ga0501033_0073963
1649 Ga0501034_0020745
1650 Ga0501034_0023398
1651 Ga0501034_0108024
1652 Ga0501036_0272987
1653 Ga0501038_0059138
1654 Ga0501043_0061826
1655 Ga0501046_0067511
1656 Ga0501047_0188867
1657 Ga0501047_0272468
1658 Ga0501068_0046555
1659 Ga0501072_0323870
1660 Ga0501077_0090907
1661 Ga0501035_0002632
1662 Ga0501035_0141733
1663 Ga0501035_0239575
1664 Ga0501044_0030335
1665 Ga0501044_0047516
1666 nmdc:mga03n38_55758_c1
1667 nmdc:mga00v17_16546_c1
1668 nmdc:mga0yw44_128257_c1
1669 nmdc:mga0yw44_13907_c1
1670 nmdc:mga0yw44_88925_c1
1671 nmdc:mga0k408_30833_c1
1672 nmdc:mga06z11_138247_c1
1673 nmdc:mga06z11_22736_c1
1674 nmdc:mga05p37_226592_c1
1675 nmdc:mga0n895_146690_c1
1676 nmdc:mga0sz30_1939_c2
1677 Ga0495601_0106155
1678 Ga0495655_0007496
1679 Ga0495595_0003580
1680 Ga0495619_0239213
1681 Ga0500578_0083002
1682 Ga0500578_0193654
1683 Ga0500643_013394
1684 Ga0500651_0002542
1685 Ga0500566_0000384
1686 Ga0500566_0000929
1687 Ga0500640_000112
1688 Ga0500641_0040083
1689 Ga0500650_0088215
1690 Ga0500556_0000120
1691 Ga0500557_000034
1692 Ga0500572_000360
1693 Ga0500593_000509
1694 Ga0500595_001385
1695 Ga0500595_001913
1696 Ga0500595_011617
1697 Ga0500595_014126
1698 Ga0500595_022416
1699 Ga0500595_038919
1700 Ga0500607_014605
1701 Ga0500608_003619
1702 Ga0500614_000592
1703 Ga0500642_0000053
1704 Ga0500642_0049665
1705 Ga0500652_020574
1706 Ga0500559_0001112
1707 Ga0500573_0130459
1708 Ga0500577_0027888
1709 Ga0500588_0062569
1710 Ga0500590_038493
1711 Ga0500603_000179
1712 Ga0500603_003618
1713 Ga0500603_038080
1714 Ga0500604_0021810
1715 Ga0500620_000299
1716 Ga0500627_0058623
1717 Ga0500627_0164495
1718 Ga0500634_0000008
1719 Ga0500638_003972
1720 Ga0500638_092427
1721 Ga0500639_000136
1722 Ga0500639_089321
1723 Ga0500636_0000057
1724 Ga0500636_0201840
1725 Ga0500637_0000193
1726 Ga0500645_022894
1727 Ga0500609_005993
1728 Ga0500601_000010
1729 Ga0500661_000775
1730 Ga0501082_0250852
1731 2503199745
1732 2507504597
1733 2508546025
1734 2508694875
1735 2508734831
1736 2509116686
1737 2509142437
1738 2509152075
1739 2509372024
1740 2509389020
1741 2509394672
1742 2510318745
1743 2511137198
1744 2511389658
1745 2512932835
1746 2512960856
1747 2513591550
1748 2513595584
1749 2513608947
1750 2513626534
1751 2513638467
1752 2513649380
1753 2513657339
1754 2513675193
1755 2513699396
1756 2513714769
1757 2513857810
1758 2513875576
1759 2513919347
1760 2514011033
1761 2514036627
1762 2514417439
1763 2514586904
1764 2515624193
1765 2517102896
1766 2517890961
1767 2524438712
1768 2524441681
1769 2524468494
1770 2524537593
1771 2528854430
1772 2545678540
1773 2588518889
1774 2596377394
1775 2597811048
1776 2599332594
1777 2599939827
1778 2603859969
1779 2617347577
1780 2617377010
1781 2643777937
1782 2643796385
1783 2643814329
1784 2643909560
1785 2643964818
1786 2643987578
1787 2644157901
1788 2644169500
1789 2644350900
1790 2644411137
1791 2671120122
1792 2688596998
1793 2694630260
1794 2694635594
1795 2715500879
1796 2723574150
1797 2723846852
1798 2728752611
1799 2738747349
1800 2739037379
1801 2739307373
1802 2739356578
1803 2745075754
1804 2745080500
1805 2753359443
1806 2756670965
1807 2757571183
1808 2758641704
1809 2765464829
1810 2770195246
1811 2776270809
1812 2776280368
1813 2792748249
1814 2793063554
1815 2793066316
1816 2793076388
1817 2805921069
1818 2818237060
1819 2824619234
1820 2824628117
1821 2824636921
1822 2824651834
1823 2824668020
1824 2824676777
1825 2824683226
1826 2824695427
1827 2824701584
1828 2824712260
1829 2824725384
1830 2824736854
1831 2824747581
1832 2824760928
1833 2824767693
1834 2824777082
1835 2834579032
1836 2838129168
1837 2839994751
1838 2840767610
1839 2840884226
1840 2841737494
1841 2841944205
1842 2841954621
1843 2841963052
1844 2841968986
1845 2841979761
1846 2841989644
1847 2842044161
1848 2842051850
1849 2842871753
1850 2842922867
1851 2844008942
1852 2844012343
1853 2844316117
1854 2847941501
1855 2849082411
1856 2854911932
1857 2856322838
1858 2856334617
1859 2856341701
1860 2856349129
1861 2856349783
1862 2856366888
1863 2857352224
1864 2857370189
1865 2857516547
1866 2869172522
1867 2869239910
1868 2869246111
1869 2869250158
1870 2869262945
1871 2869270017
1872 2869272036
1873 2869285619
1874 2869287700
1875 2871435648
1876 2871452684
1877 2871463911
1878 2871472721
1879 2871476977
1880 2871485525
1881 2871493483
1882 2871496512
1883 2874110933
1884 2874122739
1885 2874128976
1886 2874136639
1887 2874142043
1888 2874151331
1889 2874158965
1890 2874163068
1891 2874175041
1892 2874595522
1893 2874611188
1894 2874615918
1895 2874621504
1896 2874647067
1897 2876364915
1898 2876374707
1899 2876383957
1900 2876387273
1901 2876397740
1902 2876417384
1903 2876421622
1904 2876763788
1905 2876775716
1906 2876810541
1907 2876823708
1908 2878735116
1909 2878744774
1910 2878749211
1911 2878757526
1912 2878760740
1913 2878767635
1914 2878777505
1915 2878784799
1916 2879079807
1917 2879091277
1918 2879103057
1919 2879114399
1920 2879131114
1921 2879150320
1922 2881149622
1923 2881160806
1924 2881166502
1925 2881364839
1926 2881855194
1927 2881863189
1928 2882639419
1929 2882915691
1930 2885307986
1931 2885313098
1932 2885331723
1933 2885339695
1934 2885344705
1935 2885357913
1936 2885368253
1937 2885387005
1938 2885413143
1939 2888338062
1940 2888345408
1941 2888354726
1942 2888380233
1943 2888391262
1944 2888427173
1945 2889016343
1946 2889018636
1947 2889038352
1948 2889308860
1949 2894656185
1950 2899279545
1951 2902334977
1952 2902405706
1953 2903449623
1954 2903498675
1955 2903501255
1956 2903522349
1957 2903528728
1958 2903541306
1959 2903729481
1960 2903771675
1961 2904580819
1962 2904664391
1963 2904668173
1964 2904693963
1965 2904705806
1966 2904719956
1967 2906310249
1968 2906324314
1969 2906368734
1970 2906376279
1971 2906389807
1972 2906395831
1973 2906403215
1974 2906409127
1975 2906428833
1976 2906606691
1977 2906616159
1978 2906634540
1979 2906642208
1980 2906650022
1981 2906664503
1982 2908741225
1983 2908764679
1984 2908782919
1985 2913296556
1986 2915653848
1987 2919121467
1988 2919451890
1989 2922134574
1990 2922156582
1991 2922178392
1992 2922185228
1993 2922191905
1994 2922362543
1995 2922369798
1996 2922392888
1997 2922431865
1998 2924739020
1999 2924744866
2000 2924753820
2001 2924760149
2002 2924768461
2003 2924782805
2004 2924786822
2005 2925334494
2006 2928129683
2007 2928523690
2008 2929622843
2009 2929632053
2010 2932404289
2011 2932789837
2012 2932799617
2013 2932805096
2014 2932815394
2015 2932825167
2016 2932829335
2017 2933584525
2018 2935614203
2019 2935617768
2020 2935643813
2021 2935651428
2022 2935659804
2023 2935670877
2024 2935678210
2025 2935692498
2026 2935699288
2027 2935710095
2028 2935721116
2029 2935730891
2030 2935739805
2031 2935748843
2032 2935758713
2033 2935767775
2034 2935775569
2035 2935779826
2036 2935790097
2037 2935798532
2038 2935806741
2039 2935819217
2040 2935826454
2041 2935834498
2042 2935843777
2043 2935851351
2044 2935856733
2045 2935868212
2046 2935879570
2047 2935887488
2048 2935913315
2049 2935922719
2050 2935930760
2051 2935939906
2052 2935946855
2053 2935955944
2054 2935966241
2055 2935972737
2056 2935982526
2057 2935984532
2058 2935997076
2059 2936009812
2060 2936014220
2061 2936022871
2062 2936031008
2063 2936045781
2064 2936049129
2065 2936055576
2066 2937817073
2067 2937822515
2068 2937840269
2069 2937843431
2070 2937852452
2071 2937867009
2072 2937881540
2073 2937977536
2074 2937985695
2075 2937995162
2076 2938018242
2077 2939670334
2078 2940564697
2079 2941534865
2080 2941545025
2081 2954015973
2082 2958041634
2083 2958043357
2084 2958047984
2085 2958070383
2086 2958071479
2087 2958087903
2088 2958095600
2089 2958101288
2090 2958113635
2091 2958128948
2092 2958132102
2093 2958148619
2094 2958163426
2095 2958165573
2096 2958181916
2097 2961079760
2098 2961119390
2099 2961164032
2100 2961175146
2101 2961184012
2102 2963646371
2103 2965018902
2104 2965027068
2105 2965035982
2106 2965044711
2107 2965052030
2108 2965068066
2109 2965091323
2110 2965119145
2111 2967999852
2112 2968008211
2113 2968020494
2114 2968087103
2115 2968115645
2116 2968119015
2117 2968134594
2118 2968172435
2119 2970473791
2120 2970490398
2121 2970507734
2122 2970518117
2123 2970527125
2124 2970534008
2125 2970545069
2126 2970554522
2127 2970555593
2128 2970600235
2129 2970625126
2130 2970630837
2131 2977826684
2132 2977832159
2133 2977847364
2134 2977854191
2135 2977870133
2136 2977880193
2137 2977908514
2138 2977918087
2139 2977925308
2140 2977940678
2141 2977945183
2142 2977956366
2143 2977964676
2144 2977991323
2145 2979747284
2146 2979768169
2147 2979774137
2148 2979796985
2149 2979812918
2150 2987639408
2151 2987647633
2152 2987659007
2153 2987660040
2154 2987672358
2155 2987680336
2156 2996337069
2157 2996352886
2158 2996387205
2159 3000139346
2160 3000406202
2161 3002144559
2162 3003671387
2163 3004167388
2164 3004189088
2165 3004198890
2166 3004204348
2167 3004217806
2168 3004221146
2169 3004239634
2170 3004242309
2171 3004253069
2172 3004274170
2173 3004279568
2174 3004294160
2175 3004336024
2176 3005490404
2177 3005509790
2178 3005591107
2179 3005595701
2180 3005711683
2181 3005718947
2182 637075917
2183 641643106
2184 643601861
2185 649871555
2186 8001850019
2187 8002289465
2188 8004307102
2189 8004316892
2190 8004366506
2191 8004379100
2192 8004389485
2193 8004402950
2194 8004637438
2195 8004643313
2196 8004701976
2197 8004717883
2198 8004729859
2199 8006939058
2200 8006969039
2201 8006978716
2202 8006987514
2203 8006995015
2204 8016518911
2205 8016525554
2206 8016539149
2207 8016549861
2208 8016558273
2209 8016568837
2210 8016581482
2211 8016587180
2212 8016596271
2213 8016607180
2214 8016619080
2215 8016630505
2216 8016636580
2217 8017057777
2218 8018132511
2219 8018153644
2220 8019538816
2221 8019541166
2222 8019559990
2223 8019570089
2224 8019605655
2225 8019612879
2226 8019623562
2227 8019638588
2228 8019641156
2229 8019653287
2230 8019666389
2231 8019676051
2232 8019693427
2233 8045867586
2234 8046768723
2235 8055619212
2236 8055750746
2237 8056685761
2238 8056690457
2239 8056970574
2240 8057582509

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05861

PhnI

Bacterial phosphonate metabolism protein (PhnI)

1

352

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7z19-assembly1.cif.gz_G e. coli c-p lyase bound to a single phnk abc domain 0.6848 1 338
7z15-assembly1.cif.gz_C e. coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi 0.6818 1 338
7z19-assembly1.cif.gz_G e. coli c-p lyase bound to a single phnk abc domain 0.6568 1 338
7z15-assembly1.cif.gz_C e. coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi 0.6539 1 338
7t8j-assembly1.cif.gz_A the ubiquitin-associated domain of human thirty-eight negative kinase-1 flexibly fused to the 1tel crystallization chaperone via a gsgg linker 0.6529 34 77
ID Description Score Start End Superfamily
2jy6B00 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.6422 35 73 1.10.8.10
2qhoF00 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.6299 32 75 1.10.8.10
af_Q4DD65_1592_1861_3.40.850.10 Alpha Beta;3-Layer(aba) Sandwich;Kinesin;Kinesin motor domain 0.6239 237 264 3.40.850.10
2qhoB00 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.6077 31 72 1.10.8.10
1ufzA01 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.598 34 82 1.10.8.10
ID Description Score Start End GO Terms
AF-A0A530GET2-F1-model_v4 Carbon-phosphorus lyase complex subunit PhnI 0.9426 198 279 GO:0016829
GO:0019634
AF-A0A530GET2-F1-model_v4 Carbon-phosphorus lyase complex subunit PhnI 0.9213 198 279 GO:0016829
GO:0019634
AF-F3FWT9-F1-model_v4 Phosphonate metabolism protein PhnI 0.9155 187 268 GO:0019634
AF-F3FWT9-F1-model_v4 Phosphonate metabolism protein PhnI 0.9053 187 268 GO:0019634
AF-A0A367LXN8-F1-model_v4 Carbon-phosphorus lyase complex subunit PhnI 0.9041 190 311 GO:0016829
GO:0019634

Map