F490392
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1120 | 511 | 2240 | 267 |
Family's Representative Sequence
| Representative Sequence | 3300042185|Ga0450909_001760|Ga0450909_001760_1900_2676 |
| Length | 258 |
| Sequence | MKLVLKQPFERLWAGRDAFTEVEALQGQVYRELEGRRTLRTEVEGRGYFVKIHRGIGWGEIAKNLLTAKVPVLGAGQEWTAIQRLHQAGSNPAQQHSFIVTEELAPTISLEDFCVDWLRNPPPPRLKWALIGEVARMTGTMHRAGVNHRDCYICHFLLHTERPVTADDFKLSLIDLHRAQTRAHTPRRWRDKDLAGLYFSALNIGLTQRDKLRFLKAYFRQPLRDVLRDEIGLLAWLEQKAASLMSRYERKYAGGEDA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 5 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 6 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 7 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 8 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 10 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 11 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 26 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 29 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 30 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 31 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 32 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 33 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 34 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 35 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 36 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 37 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 46 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 54 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 55 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 56 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 57 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 59 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 69 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 70 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 72 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 73 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 75 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 94 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 95 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 100 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 102 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 103 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 104 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 105 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 106 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 107 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 108 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 109 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 110 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 111 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 112 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 113 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 114 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 115 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 116 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 117 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 118 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 119 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 120 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 121 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 122 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 123 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 124 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 125 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 126 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 127 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 128 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 129 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 130 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 131 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 132 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 133 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 134 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 135 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 136 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 137 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 138 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 139 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 140 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 141 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 142 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 143 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 144 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 145 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 146 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 147 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 148 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 149 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 150 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 151 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 152 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 153 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 154 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 155 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 228 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 229 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 230 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 231 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 232 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 233 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 234 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 235 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 236 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 237 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 238 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 239 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 240 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 241 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 242 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 243 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 244 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 252 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 253 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 254 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 255 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 256 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 257 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 258 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 259 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 260 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 261 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 262 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 263 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 264 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 265 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 266 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 267 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 268 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 269 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 270 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 271 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 272 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 273 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 274 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 275 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 276 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 277 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 278 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 279 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 280 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 281 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 282 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 283 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 284 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 285 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 286 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 287 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 288 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 289 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 290 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 291 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 292 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 293 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 294 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 295 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 296 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 297 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 298 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 299 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 300 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 301 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 302 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 303 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 304 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 305 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 306 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 307 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 308 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 309 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 310 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 311 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 312 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 313 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 314 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 315 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 316 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 317 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 318 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 319 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 320 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 321 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 322 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 323 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 324 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 325 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 326 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 327 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 328 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 329 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 330 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 331 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 332 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 333 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 334 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 335 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 336 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 337 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 338 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 339 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 340 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 341 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 342 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 343 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 344 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 345 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 346 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 347 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 348 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 349 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 350 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 351 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 352 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 353 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 354 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 355 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 356 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 357 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 358 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 359 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 360 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 361 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 362 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 363 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 364 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 365 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 366 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 367 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 368 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 369 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 370 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 371 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 372 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 373 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 374 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 375 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 376 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 377 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 378 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 379 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 380 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 381 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 382 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 383 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 384 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 385 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 386 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 387 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 388 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 389 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 390 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 391 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 392 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 393 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 394 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 395 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 396 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 397 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 398 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 399 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 400 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 401 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 402 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 403 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 404 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 405 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 406 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 407 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 408 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 409 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 410 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 411 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 412 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 413 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 414 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 415 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 416 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 417 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 418 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 419 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 420 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 421 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 422 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 423 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 424 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 425 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 426 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 427 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 428 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 429 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 430 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 431 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 432 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 433 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 434 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 435 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 436 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 437 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 438 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 439 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 440 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 441 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 442 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 443 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 444 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 445 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 446 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 447 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 448 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 449 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 450 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 451 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 452 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 453 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 454 | 2935625433 | Kosakonia sp. 1610 | Isolate | Rhizosphere |
| 455 | 2939617950 | Kosakonia cowanii 2056 | Isolate | Rhizosphere |
| 456 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 457 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 458 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 459 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 460 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 461 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 462 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 463 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 464 | 2974435778 | Kosakonia cowanii SORGH_AS 304 | Isolate | Unclassified |
| 465 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 466 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 467 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 468 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 469 | 2990196909 | Pseudomonas mangrovi TC-11 | Isolate | Unclassified |
| 470 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 471 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 472 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 473 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 474 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 475 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 476 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 477 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 478 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 479 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 480 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 481 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 482 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 483 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 484 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 485 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 486 | 8016728285 | Pseudomonas psychrotolerans SORGH_AS 227 | Isolate | Unclassified |
| 487 | 8019504834 | Atlantibacter hermannii 1903 | Isolate | Rhizosphere |
| 488 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 489 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 490 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 491 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 492 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 493 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 494 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 495 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 496 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 497 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 498 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 499 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 500 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 501 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 502 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 503 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 504 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 505 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 506 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 507 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 508 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 509 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 510 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 511 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 77.05 |
| Metatranscriptomes | 0 |
| Isolates | 22.95 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.18 |
| Bulb | 0 |
| Endosphere | 5.27 |
| Nodule | 2.77 |
| Rhizoplane | 6.79 |
| Rhizosphere | 71.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0450909_001760 | 3300042185 | Bacteria | 3048 |
| 2 | MRS2a_Contig_87 | 2124908027 | Bacteria | 56496 |
| 3 | SwRhRL2b_contig_288416 | 2162886007 | Bacteria | 2720 |
| 4 | SwRhRL2b_contig_487482 | 2162886007 | Bacteria | 2856 |
| 5 | JGI24741J21665_1006446 | 3300001915 | Bacteria | 2356 |
| 6 | JGI25163J39215_1000534 | 3300002771 | Bacteria | 11173 |
| 7 | JGI25163J39215_1001084 | 3300002771 | Bacteria | 5649 |
| 8 | JGI25164J39214_1000145 | 3300002772 | Bacteria | 68307 |
| 9 | JGI25164J39214_1000148 | 3300002772 | Bacteria | 67382 |
| 10 | JGI25165J46597_1000266 | 3300003214 | Bacteria | 68307 |
| 11 | JGI25165J46597_1000268 | 3300003214 | Bacteria | 67382 |
| 12 | Ga0055539_1000048 | 3300003752 | Bacteria | 190238 |
| 13 | Ga0055533_1000059 | 3300003756 | Bacteria | 190238 |
| 14 | Ga0055532_1000096 | 3300003758 | Bacteria | 98889 |
| 15 | Ga0055525_1000189 | 3300003759 | Bacteria | 75207 |
| 16 | Ga0055536_1000615 | 3300003781 | Bacteria | 24257 |
| 17 | Ga0055536_1002223 | 3300003781 | Bacteria | 11047 |
| 18 | Ga0055530_10000374 | 3300003791 | Bacteria | 40490 |
| 19 | Ga0055530_10000913 | 3300003791 | Bacteria | 24257 |
| 20 | Ga0055540_1000337 | 3300003792 | Bacteria | 40512 |
| 21 | Ga0055540_1000646 | 3300003792 | Bacteria | 24561 |
| 22 | Ga0055540_1000657 | 3300003792 | Bacteria | 24257 |
| 23 | Ga0055531_10000375 | 3300003794 | Bacteria | 43113 |
| 24 | Ga0055541_1000035 | 3300003841 | Bacteria | 190238 |
| 25 | Ga0065714_10000248 | 3300005288 | Bacteria | 6677 |
| 26 | Ga0065714_10004567 | 3300005288 | Bacteria | 6014 |
| 27 | Ga0065714_10016358 | 3300005288 | Bacteria | 1945 |
| 28 | Ga0065714_10066037 | 3300005288 | Bacteria | 7777 |
| 29 | Ga0065714_10067559 | 3300005288 | Bacteria | 5377 |
| 30 | Ga0065714_10069151 | 3300005288 | Bacteria | 4367 |
| 31 | Ga0065714_10075356 | 3300005288 | Bacteria | 2916 |
| 32 | Ga0065714_10172978 | 3300005288 | Bacteria | 996 |
| 33 | Ga0065704_10000791 | 3300005289 | Bacteria | 18680 |
| 34 | Ga0065704_10001014 | 3300005289 | Bacteria | 15257 |
| 35 | Ga0065704_10020956 | 3300005289 | Bacteria | 1076 |
| 36 | Ga0065704_10090218 | 3300005289 | Bacteria | 2803 |
| 37 | Ga0065712_10067752 | 3300005290 | Bacteria | 56880 |
| 38 | Ga0065712_10069162 | 3300005290 | Bacteria | 7852 |
| 39 | Ga0070670_100001434 | 3300005331 | Bacteria | 19186 |
| 40 | Ga0070670_100014428 | 3300005331 | Bacteria | 6781 |
| 41 | Ga0070661_100000078 | 3300005344 | Bacteria | 77449 |
| 42 | Ga0070669_100001899 | 3300005353 | Bacteria | 15087 |
| 43 | Ga0070714_100424047 | 3300005435 | Bacteria | 1261 |
| 44 | Ga0070662_100003973 | 3300005457 | Bacteria | 9269 |
| 45 | Ga0068853_100000210 | 3300005539 | Bacteria | 41425 |
| 46 | Ga0070665_100370287 | 3300005548 | Bacteria | 1439 |
| 47 | Ga0070665_100619819 | 3300005548 | Bacteria | 1095 |
| 48 | Ga0070664_100007381 | 3300005564 | Bacteria | 8868 |
| 49 | Ga0070664_100017832 | 3300005564 | Bacteria | 5830 |
| 50 | Ga0068854_100002209 | 3300005578 | Bacteria | 11976 |
| 51 | Ga0068851_10000004 | 3300005834 | Bacteria | 269685 |
| 52 | Ga0075364_10056823 | 3300006051 | Bacteria | 2563 |
| 53 | Ga0075364_10120441 | 3300006051 | Bacteria | 1756 |
| 54 | Ga0075432_10001130 | 3300006058 | Bacteria | 8534 |
| 55 | Ga0075432_10003524 | 3300006058 | Bacteria | 5305 |
| 56 | Ga0075432_10037538 | 3300006058 | Bacteria | 1687 |
| 57 | Ga0075432_10085681 | 3300006058 | Bacteria | 1147 |
| 58 | Ga0075362_10009085 | 3300006177 | Bacteria | 3828 |
| 59 | Ga0075362_10231875 | 3300006177 | Bacteria | 904 |
| 60 | Ga0075436_100099306 | 3300006914 | Bacteria | 2026 |
| 61 | Ga0099823_1013050 | 3300006944 | Bacteria | 8383 |
| 62 | Ga0079104_1000638 | 3300006946 | Bacteria | 34050 |
| 63 | Ga0079104_1000654 | 3300006946 | Bacteria | 33184 |
| 64 | Ga0079104_1002562 | 3300006946 | Bacteria | 9569 |
| 65 | Ga0079104_1033089 | 3300006946 | Bacteria | 1268 |
| 66 | Ga0099826_10018533 | 3300006948 | Bacteria | 5251 |
| 67 | Ga0105251_10001807 | 3300009011 | Bacteria | 17747 |
| 68 | Ga0105251_10002054 | 3300009011 | Bacteria | 16284 |
| 69 | Ga0105251_10003211 | 3300009011 | Bacteria | 12053 |
| 70 | Ga0105251_10003431 | 3300009011 | Bacteria | 11494 |
| 71 | Ga0105251_10004126 | 3300009011 | Bacteria | 10143 |
| 72 | Ga0105251_10004337 | 3300009011 | Bacteria | 9705 |
| 73 | Ga0105251_10020559 | 3300009011 | Bacteria | 3465 |
| 74 | Ga0105251_10027160 | 3300009011 | Bacteria | 2906 |
| 75 | Ga0105251_10125409 | 3300009011 | Bacteria | 1165 |
| 76 | Ga0105244_10000133 | 3300009036 | Bacteria | 76114 |
| 77 | Ga0105244_10002007 | 3300009036 | Bacteria | 15687 |
| 78 | Ga0105244_10002116 | 3300009036 | Bacteria | 15263 |
| 79 | Ga0105244_10004326 | 3300009036 | Bacteria | 9821 |
| 80 | Ga0105244_10008580 | 3300009036 | Bacteria | 6374 |
| 81 | Ga0105244_10016377 | 3300009036 | Bacteria | 4223 |
| 82 | Ga0105244_10016789 | 3300009036 | Bacteria | 4159 |
| 83 | Ga0105244_10022008 | 3300009036 | Bacteria | 3515 |
| 84 | Ga0105244_10025650 | 3300009036 | Bacteria | 3201 |
| 85 | Ga0105244_10056930 | 3300009036 | Bacteria | 1977 |
| 86 | Ga0105244_10065634 | 3300009036 | Bacteria | 1818 |
| 87 | Ga0105244_10091443 | 3300009036 | Bacteria | 1496 |
| 88 | Ga0105244_10093117 | 3300009036 | Bacteria | 1480 |
| 89 | Ga0105250_10000423 | 3300009092 | Bacteria | 30845 |
| 90 | Ga0105250_10002533 | 3300009092 | Bacteria | 9139 |
| 91 | Ga0105250_10002789 | 3300009092 | Bacteria | 8571 |
| 92 | Ga0105250_10006222 | 3300009092 | Bacteria | 5239 |
| 93 | Ga0105250_10011389 | 3300009092 | Bacteria | 3690 |
| 94 | Ga0105250_10033549 | 3300009092 | Bacteria | 2062 |
| 95 | Ga0105243_10001058 | 3300009148 | Bacteria | 25181 |
| 96 | Ga0105243_10001664 | 3300009148 | Bacteria | 19255 |
| 97 | Ga0105243_10002290 | 3300009148 | Bacteria | 16053 |
| 98 | Ga0105243_10007323 | 3300009148 | Bacteria | 8485 |
| 99 | Ga0105243_10029807 | 3300009148 | Bacteria | 4198 |
| 100 | Ga0105243_10032432 | 3300009148 | Bacteria | 4036 |
| 101 | Ga0105243_10036011 | 3300009148 | Bacteria | 3839 |
| 102 | Ga0105242_10004878 | 3300009176 | Bacteria | 10384 |
| 103 | Ga0105237_10007904 | 3300009545 | Bacteria | 11590 |
| 104 | Ga0105237_10149704 | 3300009545 | Bacteria | 2330 |
| 105 | Ga0105249_10055939 | 3300009553 | Bacteria | 3611 |
| 106 | Ga0105246_10000489 | 3300011119 | Bacteria | 21461 |
| 107 | Ga0105246_10005406 | 3300011119 | Bacteria | 7779 |
| 108 | Ga0105246_10077933 | 3300011119 | Bacteria | 2352 |
| 109 | Ga0105246_10083769 | 3300011119 | Bacteria | 2279 |
| 110 | Ga0157345_1000037 | 3300012498 | Bacteria | 32065 |
| 111 | Ga0157373_10008180 | 3300013100 | Bacteria | 7780 |
| 112 | Ga0157373_10012146 | 3300013100 | Bacteria | 6332 |
| 113 | Ga0157373_10022539 | 3300013100 | Bacteria | 4568 |
| 114 | Ga0157373_10029077 | 3300013100 | Bacteria | 3984 |
| 115 | Ga0157373_10032871 | 3300013100 | Bacteria | 3733 |
| 116 | Ga0157373_10037056 | 3300013100 | Bacteria | 3499 |
| 117 | Ga0157373_10044899 | 3300013100 | Bacteria | 3155 |
| 118 | Ga0157373_10096805 | 3300013100 | Bacteria | 2078 |
| 119 | Ga0157373_10219535 | 3300013100 | Bacteria | 1341 |
| 120 | Ga0157373_10331575 | 3300013100 | Bacteria | 1083 |
| 121 | Ga0157371_10000839 | 3300013102 | Bacteria | 35135 |
| 122 | Ga0157371_10002020 | 3300013102 | Bacteria | 20047 |
| 123 | Ga0157371_10002513 | 3300013102 | Bacteria | 17424 |
| 124 | Ga0157371_10004811 | 3300013102 | Bacteria | 11616 |
| 125 | Ga0157371_10051956 | 3300013102 | Bacteria | 2912 |
| 126 | Ga0157371_10435411 | 3300013102 | Bacteria | 963 |
| 127 | Ga0157370_10000388 | 3300013104 | Bacteria | 55229 |
| 128 | Ga0157370_10014921 | 3300013104 | Bacteria | 7924 |
| 129 | Ga0157370_10104635 | 3300013104 | Bacteria | 2649 |
| 130 | Ga0157370_10162376 | 3300013104 | Bacteria | 2078 |
| 131 | Ga0157370_10192583 | 3300013104 | Bacteria | 1893 |
| 132 | Ga0157370_10246484 | 3300013104 | Bacteria | 1653 |
| 133 | Ga0157370_10246485 | 3300013104 | Bacteria | 1653 |
| 134 | Ga0157369_10000184 | 3300013105 | Bacteria | 86626 |
| 135 | Ga0157369_10001610 | 3300013105 | Bacteria | 27627 |
| 136 | Ga0157369_10002373 | 3300013105 | Bacteria | 22629 |
| 137 | Ga0157369_10008368 | 3300013105 | Bacteria | 11864 |
| 138 | Ga0157369_10018752 | 3300013105 | Bacteria | 7756 |
| 139 | Ga0157369_10040248 | 3300013105 | Bacteria | 5103 |
| 140 | Ga0157369_10478173 | 3300013105 | Bacteria | 1289 |
| 141 | Ga0157369_10662021 | 3300013105 | Bacteria | 1076 |
| 142 | Ga0163162_10159342 | 3300013306 | Bacteria | 2378 |
| 143 | Ga0157372_10000062 | 3300013307 | Bacteria | 119721 |
| 144 | Ga0157372_10000947 | 3300013307 | Bacteria | 31672 |
| 145 | Ga0157372_10006103 | 3300013307 | Bacteria | 12802 |
| 146 | Ga0157372_10046612 | 3300013307 | Bacteria | 4812 |
| 147 | Ga0157372_10374368 | 3300013307 | Bacteria | 1659 |
| 148 | Ga0157375_10001804 | 3300013308 | Bacteria | 18354 |
| 149 | Ga0157375_10008927 | 3300013308 | Bacteria | 8771 |
| 150 | Ga0157375_10015868 | 3300013308 | Bacteria | 6750 |
| 151 | Ga0182008_10000659 | 3300014497 | Bacteria | 25061 |
| 152 | Ga0182008_10005131 | 3300014497 | Bacteria | 7514 |
| 153 | Ga0182008_10012107 | 3300014497 | Bacteria | 4562 |
| 154 | Ga0182008_10022943 | 3300014497 | Bacteria | 3193 |
| 155 | Ga0182008_10036559 | 3300014497 | Bacteria | 2457 |
| 156 | Ga0182008_10053683 | 3300014497 | Bacteria | 1995 |
| 157 | Ga0182006_1003235 | 3300015261 | Bacteria | 8456 |
| 158 | Ga0182006_1003547 | 3300015261 | Bacteria | 7954 |
| 159 | Ga0182006_1003616 | 3300015261 | Bacteria | 7855 |
| 160 | Ga0182006_1008819 | 3300015261 | Bacteria | 4557 |
| 161 | Ga0182006_1012301 | 3300015261 | Bacteria | 3741 |
| 162 | Ga0182006_1012616 | 3300015261 | Bacteria | 3695 |
| 163 | Ga0182006_1020170 | 3300015261 | Bacteria | 2796 |
| 164 | Ga0182006_1046602 | 3300015261 | Bacteria | 1684 |
| 165 | Ga0182007_10003898 | 3300015262 | Bacteria | 6919 |
| 166 | Ga0182007_10007513 | 3300015262 | Bacteria | 4563 |
| 167 | Ga0182005_1004207 | 3300015265 | Bacteria | 4703 |
| 168 | Ga0182005_1004402 | 3300015265 | Bacteria | 4563 |
| 169 | Ga0182005_1009233 | 3300015265 | Bacteria | 2876 |
| 170 | Ga0182005_1016613 | 3300015265 | Bacteria | 2045 |
| 171 | Ga0182005_1024350 | 3300015265 | Bacteria | 1653 |
| 172 | Ga0163161_10000624 | 3300017792 | Bacteria | 28312 |
| 173 | Ga0163161_10005035 | 3300017792 | Bacteria | 9192 |
| 174 | Ga0163161_10013791 | 3300017792 | Bacteria | 5628 |
| 175 | Ga0163161_10026264 | 3300017792 | Bacteria | 4126 |
| 176 | Ga0163161_10171325 | 3300017792 | Bacteria | 1660 |
| 177 | Ga0163161_10405035 | 3300017792 | Bacteria | 1094 |
| 178 | Ga0163161_10482035 | 3300017792 | Bacteria | 1007 |
| 179 | Ga0209435_100864 | 3300025206 | Bacteria | 4664 |
| 180 | Ga0209760_100181 | 3300025207 | Bacteria | 33125 |
| 181 | Ga0209760_100215 | 3300025207 | Bacteria | 25872 |
| 182 | Ga0209784_100028 | 3300025224 | Bacteria | 357464 |
| 183 | Ga0209566_100028 | 3300025225 | Bacteria | 357464 |
| 184 | Ga0209674_100047 | 3300025226 | Bacteria | 357464 |
| 185 | Ga0209147_100031 | 3300025229 | Bacteria | 357464 |
| 186 | Ga0209563_100050 | 3300025230 | Bacteria | 357464 |
| 187 | Ga0209563_100488 | 3300025230 | Bacteria | 13416 |
| 188 | Ga0207427_100014 | 3300025231 | Bacteria | 561361 |
| 189 | Ga0207427_100016 | 3300025231 | Bacteria | 538697 |
| 190 | Ga0209437_100011 | 3300025233 | Bacteria | 818520 |
| 191 | Ga0209437_100016 | 3300025233 | Bacteria | 710118 |
| 192 | Ga0209258_100150 | 3300025242 | Bacteria | 161813 |
| 193 | Ga0207425_1001697 | 3300025245 | Bacteria | 8748 |
| 194 | Ga0209646_1000165 | 3300025246 | Bacteria | 88117 |
| 195 | Ga0209677_100029 | 3300025253 | Bacteria | 357464 |
| 196 | Ga0209759_1011972 | 3300025256 | Bacteria | 2428 |
| 197 | Ga0209129_1000021 | 3300025258 | Bacteria | 445018 |
| 198 | Ga0209233_1000019 | 3300025261 | Bacteria | 818520 |
| 199 | Ga0209233_1000036 | 3300025261 | Bacteria | 561361 |
| 200 | Ga0209675_1002284 | 3300025291 | Bacteria | 9970 |
| 201 | Ga0209676_1000025 | 3300025292 | Bacteria | 577569 |
| 202 | Ga0209676_1000032 | 3300025292 | Bacteria | 469558 |
| 203 | Ga0209676_1000326 | 3300025292 | Bacteria | 91787 |
| 204 | Ga0209676_1001232 | 3300025292 | Bacteria | 27033 |
| 205 | Ga0209676_1001980 | 3300025292 | Bacteria | 16312 |
| 206 | Ga0209676_1015080 | 3300025292 | Bacteria | 2866 |
| 207 | Ga0209050_1000025 | 3300025298 | Bacteria | 528225 |
| 208 | Ga0209050_1000028 | 3300025298 | Bacteria | 477133 |
| 209 | Ga0209050_1001079 | 3300025298 | Bacteria | 33360 |
| 210 | Ga0209050_1001508 | 3300025298 | Bacteria | 24613 |
| 211 | Ga0209051_1000026 | 3300025303 | Bacteria | 413311 |
| 212 | Ga0209051_1000080 | 3300025303 | Bacteria | 199694 |
| 213 | Ga0209051_1000334 | 3300025303 | Bacteria | 70713 |
| 214 | Ga0209051_1003650 | 3300025303 | Bacteria | 9967 |
| 215 | Ga0209257_1000034 | 3300025304 | Bacteria | 662719 |
| 216 | Ga0207656_10000007 | 3300025321 | Bacteria | 289154 |
| 217 | Ga0207696_1000020 | 3300025711 | Bacteria | 434998 |
| 218 | Ga0207696_1000057 | 3300025711 | Bacteria | 249404 |
| 219 | Ga0207696_1000064 | 3300025711 | Bacteria | 238379 |
| 220 | Ga0207696_1000229 | 3300025711 | Bacteria | 79025 |
| 221 | Ga0207696_1003169 | 3300025711 | Bacteria | 7631 |
| 222 | Ga0207696_1003440 | 3300025711 | Bacteria | 7219 |
| 223 | Ga0207696_1014985 | 3300025711 | Bacteria | 2640 |
| 224 | Ga0207696_1020002 | 3300025711 | Bacteria | 2166 |
| 225 | Ga0207655_1000014 | 3300025728 | Bacteria | 607124 |
| 226 | Ga0207655_1000406 | 3300025728 | Bacteria | 59327 |
| 227 | Ga0207655_1000565 | 3300025728 | Bacteria | 45949 |
| 228 | Ga0207655_1000815 | 3300025728 | Bacteria | 33730 |
| 229 | Ga0207655_1000922 | 3300025728 | Bacteria | 30542 |
| 230 | Ga0207655_1001160 | 3300025728 | Bacteria | 25632 |
| 231 | Ga0207655_1001818 | 3300025728 | Bacteria | 18454 |
| 232 | Ga0207655_1002188 | 3300025728 | Bacteria | 16227 |
| 233 | Ga0207655_1002787 | 3300025728 | Bacteria | 13583 |
| 234 | Ga0207655_1003594 | 3300025728 | Bacteria | 11465 |
| 235 | Ga0207655_1003980 | 3300025728 | Bacteria | 10681 |
| 236 | Ga0207655_1004144 | 3300025728 | Bacteria | 10411 |
| 237 | Ga0207655_1005546 | 3300025728 | Bacteria | 8554 |
| 238 | Ga0207655_1006369 | 3300025728 | Bacteria | 7834 |
| 239 | Ga0207655_1010151 | 3300025728 | Bacteria | 5750 |
| 240 | Ga0207655_1010822 | 3300025728 | Bacteria | 5497 |
| 241 | Ga0207655_1017130 | 3300025728 | Bacteria | 3921 |
| 242 | Ga0207655_1051225 | 3300025728 | Bacteria | 1671 |
| 243 | Ga0207655_1056487 | 3300025728 | Bacteria | 1547 |
| 244 | Ga0207655_1057153 | 3300025728 | Bacteria | 1534 |
| 245 | Ga0207655_1061236 | 3300025728 | Bacteria | 1454 |
| 246 | Ga0207655_1123231 | 3300025728 | Bacteria | 855 |
| 247 | Ga0207713_1000031 | 3300025735 | Bacteria | 283971 |
| 248 | Ga0207713_1000759 | 3300025735 | Bacteria | 30004 |
| 249 | Ga0207713_1001119 | 3300025735 | Bacteria | 22843 |
| 250 | Ga0207713_1001550 | 3300025735 | Bacteria | 18076 |
| 251 | Ga0207713_1001809 | 3300025735 | Bacteria | 16343 |
| 252 | Ga0207713_1001942 | 3300025735 | Bacteria | 15635 |
| 253 | Ga0207713_1002040 | 3300025735 | Bacteria | 15118 |
| 254 | Ga0207713_1003833 | 3300025735 | Bacteria | 10057 |
| 255 | Ga0207713_1004233 | 3300025735 | Bacteria | 9386 |
| 256 | Ga0207713_1005577 | 3300025735 | Bacteria | 7836 |
| 257 | Ga0207713_1006802 | 3300025735 | Bacteria | 6897 |
| 258 | Ga0207713_1008147 | 3300025735 | Bacteria | 6074 |
| 259 | Ga0207713_1024439 | 3300025735 | Bacteria | 2818 |
| 260 | Ga0207713_1024754 | 3300025735 | Bacteria | 2790 |
| 261 | Ga0207713_1034429 | 3300025735 | Bacteria | 2200 |
| 262 | Ga0207713_1034499 | 3300025735 | Bacteria | 2197 |
| 263 | Ga0207713_1104116 | 3300025735 | Bacteria | 975 |
| 264 | Ga0207671_10000015 | 3300025914 | Bacteria | 439607 |
| 265 | Ga0207649_10000001 | 3300025920 | Bacteria | 537851 |
| 266 | Ga0207681_10000480 | 3300025923 | Bacteria | 27941 |
| 267 | Ga0207650_10000868 | 3300025925 | Bacteria | 22902 |
| 268 | Ga0207650_10001058 | 3300025925 | Bacteria | 20465 |
| 269 | Ga0207664_10210444 | 3300025929 | Bacteria | 1682 |
| 270 | Ga0207706_10000624 | 3300025933 | Bacteria | 37622 |
| 271 | Ga0207706_10006689 | 3300025933 | Bacteria | 10660 |
| 272 | Ga0207706_10355067 | 3300025933 | Bacteria | 1274 |
| 273 | Ga0207686_10001543 | 3300025934 | Bacteria | 12987 |
| 274 | Ga0207709_10000022 | 3300025935 | Bacteria | 383573 |
| 275 | Ga0207709_10000578 | 3300025935 | Bacteria | 30734 |
| 276 | Ga0207709_10000971 | 3300025935 | Bacteria | 21405 |
| 277 | Ga0207709_10006325 | 3300025935 | Bacteria | 6648 |
| 278 | Ga0207709_10009944 | 3300025935 | Bacteria | 5239 |
| 279 | Ga0207709_10017283 | 3300025935 | Bacteria | 4024 |
| 280 | Ga0207709_10177570 | 3300025935 | Bacteria | 1500 |
| 281 | Ga0207679_10000011 | 3300025945 | Bacteria | 346112 |
| 282 | Ga0207679_10056642 | 3300025945 | Bacteria | 2895 |
| 283 | Ga0207639_10000706 | 3300026041 | Bacteria | 22900 |
| 284 | Ga0209281_1000026 | 3300027111 | Bacteria | 465877 |
| 285 | Ga0209281_1000033 | 3300027111 | Bacteria | 383539 |
| 286 | Ga0209281_1004548 | 3300027111 | Bacteria | 4125 |
| 287 | Ga0209389_1000095 | 3300027296 | Bacteria | 80518 |
| 288 | Ga0209389_1093364 | 3300027296 | Bacteria | 1218 |
| 289 | Ga0209371_1000029 | 3300027312 | Bacteria | 424797 |
| 290 | Ga0209371_1000217 | 3300027312 | Bacteria | 77949 |
| 291 | Ga0209371_1000380 | 3300027312 | Bacteria | 47577 |
| 292 | Ga0209371_1014099 | 3300027312 | Bacteria | 2207 |
| 293 | Ga0209371_1018226 | 3300027312 | Bacteria | 1790 |
| 294 | Ga0209995_1012455 | 3300027471 | Bacteria | 1388 |
| 295 | Ga0209983_1012794 | 3300027665 | Bacteria | 1723 |
| 296 | Ga0209974_10027040 | 3300027876 | Bacteria | 1898 |
| 297 | Ga0207428_10018345 | 3300027907 | Bacteria | 5979 |
| 298 | Ga0207428_10084951 | 3300027907 | Bacteria | 2466 |
| 299 | Ga0207428_10107357 | 3300027907 | Bacteria | 2151 |
| 300 | Ga0207428_10110397 | 3300027907 | Bacteria | 2118 |
| 301 | Ga0268266_10007054 | 3300028379 | Bacteria | 10203 |
| 302 | Ga0268266_10223110 | 3300028379 | Bacteria | 1733 |
| 303 | Ga0268266_10359174 | 3300028379 | Bacteria | 1370 |
| 304 | Ga0307517_10046926 | 3300028786 | Bacteria | 4493 |
| 305 | Ga0268256_1000032 | 3300030500 | Bacteria | 424603 |
| 306 | Ga0268256_1000173 | 3300030500 | Bacteria | 77949 |
| 307 | Ga0268256_1000428 | 3300030500 | Bacteria | 37773 |
| 308 | Ga0268256_1005448 | 3300030500 | Bacteria | 4988 |
| 309 | Ga0268256_1015628 | 3300030500 | Bacteria | 2207 |
| 310 | Ga0316177_1136448 | 3300030731 | Bacteria | 3328 |
| 311 | Ga0314311_1115640 | 3300030733 | Bacteria | 10318 |
| 312 | Ga0316179_1116990 | 3300030734 | Bacteria | 5843 |
| 313 | Ga0316178_1078135 | 3300030735 | Bacteria | 17093 |
| 314 | Ga0316183_1053680 | 3300030742 | Bacteria | 4925 |
| 315 | Ga0316181_1247226 | 3300030744 | Bacteria | 3249 |
| 316 | Ga0265316_10053330 | 3300031344 | Bacteria | 3169 |
| 317 | Ga0307408_100000002 | 3300031548 | Bacteria | 827227 |
| 318 | Ga0307408_100013668 | 3300031548 | Bacteria | 5391 |
| 319 | Ga0307408_100032095 | 3300031548 | Bacteria | 3661 |
| 320 | Ga0307408_100129270 | 3300031548 | Bacteria | 1968 |
| 321 | Ga0307408_100241922 | 3300031548 | Bacteria | 1483 |
| 322 | Ga0265342_10095268 | 3300031712 | Bacteria | 1702 |
| 323 | Ga0307405_10000474 | 3300031731 | Bacteria | 15078 |
| 324 | Ga0307405_10009426 | 3300031731 | Bacteria | 5005 |
| 325 | Ga0307405_10013191 | 3300031731 | Bacteria | 4402 |
| 326 | Ga0307405_10065543 | 3300031731 | Bacteria | 2312 |
| 327 | Ga0307413_10052144 | 3300031824 | Bacteria | 2469 |
| 328 | Ga0307413_10564500 | 3300031824 | Bacteria | 925 |
| 329 | Ga0307406_10357606 | 3300031901 | Bacteria | 1143 |
| 330 | Ga0307406_10417033 | 3300031901 | Bacteria | 1068 |
| 331 | Ga0307407_10038970 | 3300031903 | Bacteria | 2638 |
| 332 | Ga0307412_10006654 | 3300031911 | Bacteria | 6549 |
| 333 | Ga0307412_10012666 | 3300031911 | Bacteria | 4921 |
| 334 | Ga0307412_10014146 | 3300031911 | Bacteria | 4698 |
| 335 | Ga0307412_10016071 | 3300031911 | Bacteria | 4448 |
| 336 | Ga0307412_10108365 | 3300031911 | Bacteria | 1978 |
| 337 | Ga0307412_10202814 | 3300031911 | Bacteria | 1507 |
| 338 | Ga0307412_10474972 | 3300031911 | Bacteria | 1035 |
| 339 | Ga0307409_100015570 | 3300031995 | Bacteria | 4996 |
| 340 | Ga0307409_100017296 | 3300031995 | Bacteria | 4801 |
| 341 | Ga0307416_100070455 | 3300032002 | Bacteria | 2899 |
| 342 | Ga0307416_100456033 | 3300032002 | Bacteria | 1332 |
| 343 | Ga0307416_100941339 | 3300032002 | Bacteria | 965 |
| 344 | Ga0307414_10002568 | 3300032004 | Bacteria | 9551 |
| 345 | Ga0307414_10015030 | 3300032004 | Bacteria | 4662 |
| 346 | Ga0307414_10054038 | 3300032004 | Bacteria | 2804 |
| 347 | Ga0307414_10064819 | 3300032004 | Bacteria | 2603 |
| 348 | Ga0307411_10010536 | 3300032005 | Bacteria | 4934 |
| 349 | Ga0307411_10036524 | 3300032005 | Bacteria | 3079 |
| 350 | Ga0307510_10003578 | 3300033180 | Bacteria | 18148 |
| 351 | Ga0237819_01318 | 3300038705 | Bacteria | 6640 |
| 352 | Ga0436363_0281375 | 3300039450 | Bacteria | 2811 |
| 353 | Ga0439436_0012268 | 3300041404 | Bacteria | 2600 |
| 354 | Ga0439438_000621 | 3300041405 | Bacteria | 15979 |
| 355 | Ga0439438_001072 | 3300041405 | Bacteria | 12221 |
| 356 | Ga0439438_001956 | 3300041405 | Bacteria | 8999 |
| 357 | Ga0439438_003204 | 3300041405 | Bacteria | 6688 |
| 358 | Ga0439438_005713 | 3300041405 | Bacteria | 4527 |
| 359 | Ga0439438_006379 | 3300041405 | Bacteria | 4174 |
| 360 | Ga0439438_006390 | 3300041405 | Bacteria | 4168 |
| 361 | Ga0439438_011071 | 3300041405 | Bacteria | 2826 |
| 362 | Ga0439438_044002 | 3300041405 | Bacteria | 1151 |
| 363 | Ga0439447_000763 | 3300041407 | Bacteria | 11929 |
| 364 | Ga0439447_003053 | 3300041407 | Bacteria | 5975 |
| 365 | Ga0439447_004183 | 3300041407 | Bacteria | 5009 |
| 366 | Ga0439447_004452 | 3300041407 | Bacteria | 4813 |
| 367 | Ga0439447_054544 | 3300041407 | Bacteria | 948 |
| 368 | Ga0439466_0001219 | 3300041411 | Bacteria | 10013 |
| 369 | Ga0439466_0001604 | 3300041411 | Bacteria | 8821 |
| 370 | Ga0439466_0002254 | 3300041411 | Bacteria | 7557 |
| 371 | Ga0439466_0003680 | 3300041411 | Bacteria | 5918 |
| 372 | Ga0439466_0012145 | 3300041411 | Bacteria | 3178 |
| 373 | Ga0439466_0013185 | 3300041411 | Bacteria | 3028 |
| 374 | Ga0439466_0013468 | 3300041411 | Bacteria | 2993 |
| 375 | Ga0439466_0014147 | 3300041411 | Bacteria | 2910 |
| 376 | Ga0439466_0023139 | 3300041411 | Bacteria | 2187 |
| 377 | Ga0439466_0029925 | 3300041411 | Bacteria | 1870 |
| 378 | Ga0439432_000649 | 3300042006 | Bacteria | 13007 |
| 379 | Ga0439432_001572 | 3300042006 | Bacteria | 8573 |
| 380 | Ga0439432_001927 | 3300042006 | Bacteria | 7839 |
| 381 | Ga0439432_002096 | 3300042006 | Bacteria | 7532 |
| 382 | Ga0439432_004987 | 3300042006 | Bacteria | 4804 |
| 383 | Ga0439432_018571 | 3300042006 | Bacteria | 2322 |
| 384 | Ga0439451_002023 | 3300042009 | Bacteria | 4066 |
| 385 | Ga0439451_004014 | 3300042009 | Bacteria | 2992 |
| 386 | Ga0439451_004974 | 3300042009 | Bacteria | 2705 |
| 387 | Ga0439452_000012 | 3300042010 | Bacteria | 412478 |
| 388 | Ga0439452_000992 | 3300042010 | Bacteria | 12691 |
| 389 | Ga0439452_002398 | 3300042010 | Bacteria | 6946 |
| 390 | Ga0439452_003343 | 3300042010 | Bacteria | 5637 |
| 391 | Ga0439452_006422 | 3300042010 | Bacteria | 3683 |
| 392 | Ga0439452_006430 | 3300042010 | Bacteria | 3680 |
| 393 | Ga0439452_014092 | 3300042010 | Bacteria | 2227 |
| 394 | Ga0439455_0019459 | 3300042012 | Bacteria | 1601 |
| 395 | Ga0439456_001110 | 3300042013 | Bacteria | 5341 |
| 396 | Ga0439463_000057 | 3300042016 | Bacteria | 23866 |
| 397 | Ga0439463_001908 | 3300042016 | Bacteria | 5409 |
| 398 | Ga0439463_006113 | 3300042016 | Bacteria | 2988 |
| 399 | Ga0450911_000012 | 3300042115 | Bacteria | 129546 |
| 400 | Ga0450911_000192 | 3300042115 | Bacteria | 24155 |
| 401 | Ga0450911_001957 | 3300042115 | Bacteria | 4308 |
| 402 | Ga0450923_006474 | 3300042125 | Bacteria | 1944 |
| 403 | Ga0450890_000220 | 3300042127 | Bacteria | 8570 |
| 404 | Ga0450900_000138 | 3300042136 | Bacteria | 4361 |
| 405 | Ga0450902_000850 | 3300042137 | Bacteria | 3986 |
| 406 | Ga0450902_014050 | 3300042137 | Bacteria | 1292 |
| 407 | Ga0450902_015131 | 3300042137 | Bacteria | 1250 |
| 408 | Ga0450903_004454 | 3300042138 | Bacteria | 2387 |
| 409 | Ga0450903_016216 | 3300042138 | Bacteria | 1169 |
| 410 | Ga0450904_000331 | 3300042139 | Bacteria | 9989 |
| 411 | Ga0450904_003722 | 3300042139 | Bacteria | 1627 |
| 412 | Ga0450905_000034 | 3300042142 | Bacteria | 11627 |
| 413 | Ga0450889_009463 | 3300042144 | Bacteria | 999 |
| 414 | Ga0450906_002807 | 3300042145 | Bacteria | 3795 |
| 415 | Ga0450907_000627 | 3300042146 | Bacteria | 9351 |
| 416 | Ga0450907_000768 | 3300042146 | Bacteria | 8074 |
| 417 | Ga0450907_039522 | 3300042146 | Bacteria | 807 |
| 418 | Ga0450910_001269 | 3300042147 | Bacteria | 3146 |
| 419 | Ga0439446_0002361 | 3300042156 | Bacteria | 4519 |
| 420 | Ga0439446_0009053 | 3300042156 | Bacteria | 2657 |
| 421 | Ga0450908_007196 | 3300042184 | Bacteria | 2102 |
| 422 | Ga0450908_008314 | 3300042184 | Bacteria | 1945 |
| 423 | Ga0450909_002673 | 3300042185 | Bacteria | 2529 |
| 424 | Ga0439434_0002067 | 3300042435 | Bacteria | 5797 |
| 425 | Ga0439434_0002931 | 3300042435 | Bacteria | 4983 |
| 426 | Ga0439464_0000082 | 3300042439 | Bacteria | 13705 |
| 427 | Ga0439464_0001991 | 3300042439 | Bacteria | 4949 |
| 428 | Ga0439464_0004794 | 3300042439 | Bacteria | 3466 |
| 429 | Ga0439464_0035080 | 3300042439 | Bacteria | 1415 |
| 430 | Ga0439460_0002166 | 3300042461 | Bacteria | 4710 |
| 431 | Ga0439460_0002435 | 3300042461 | Bacteria | 4482 |
| 432 | Ga0439460_0030234 | 3300042461 | Bacteria | 1538 |
| 433 | Ga0450918_001781 | 3300042531 | Bacteria | 4199 |
| 434 | Ga0450901_000124 | 3300042533 | Bacteria | 8452 |
| 435 | Ga0439440_0000861 | 3300042993 | Bacteria | 5303 |
| 436 | Ga0439440_0004862 | 3300042993 | Bacteria | 2649 |
| 437 | Ga0451576_0490605 | 3300045051 | Bacteria | 1290 |
| 438 | Ga0495617_000900 | 3300046452 | Bacteria | 13927 |
| 439 | Ga0495617_001444 | 3300046452 | Bacteria | 10436 |
| 440 | Ga0495617_046413 | 3300046452 | Bacteria | 1447 |
| 441 | Ga0495627_000529 | 3300046453 | Bacteria | 31618 |
| 442 | Ga0495627_000662 | 3300046453 | Bacteria | 26550 |
| 443 | Ga0495627_000811 | 3300046453 | Bacteria | 22857 |
| 444 | Ga0495627_003516 | 3300046453 | Bacteria | 6866 |
| 445 | Ga0495627_007132 | 3300046453 | Bacteria | 4319 |
| 446 | Ga0495627_038585 | 3300046453 | Bacteria | 1475 |
| 447 | Ga0495603_0037506 | 3300046455 | Bacteria | 2908 |
| 448 | Ga0495590_0002060 | 3300046457 | Bacteria | 8435 |
| 449 | Ga0495590_0015849 | 3300046457 | Bacteria | 2727 |
| 450 | Ga0495591_000417 | 3300046458 | Bacteria | 35343 |
| 451 | Ga0495591_000692 | 3300046458 | Bacteria | 24631 |
| 452 | Ga0495591_002059 | 3300046458 | Bacteria | 11640 |
| 453 | Ga0495591_004076 | 3300046458 | Bacteria | 7277 |
| 454 | Ga0495591_004675 | 3300046458 | Bacteria | 6580 |
| 455 | Ga0495591_005356 | 3300046458 | Bacteria | 5961 |
| 456 | Ga0495591_006073 | 3300046458 | Bacteria | 5429 |
| 457 | Ga0495591_006221 | 3300046458 | Bacteria | 5323 |
| 458 | Ga0495591_007818 | 3300046458 | Bacteria | 4470 |
| 459 | Ga0495591_008359 | 3300046458 | Bacteria | 4248 |
| 460 | Ga0495591_028006 | 3300046458 | Bacteria | 1728 |
| 461 | Ga0495629_0021447 | 3300046459 | Bacteria | 4610 |
| 462 | Ga0495638_0006393 | 3300046460 | Bacteria | 8578 |
| 463 | Ga0495638_0019097 | 3300046460 | Bacteria | 4538 |
| 464 | Ga0495638_0029363 | 3300046460 | Bacteria | 3545 |
| 465 | Ga0495638_0062755 | 3300046460 | Bacteria | 2292 |
| 466 | Ga0495638_0066091 | 3300046460 | Bacteria | 2223 |
| 467 | Ga0495638_0124315 | 3300046460 | Bacteria | 1521 |
| 468 | Ga0495638_0165525 | 3300046460 | Bacteria | 1272 |
| 469 | Ga0495653_0008338 | 3300046463 | Bacteria | 8493 |
| 470 | Ga0495653_0023867 | 3300046463 | Bacteria | 4936 |
| 471 | Ga0495653_0095792 | 3300046463 | Bacteria | 2159 |
| 472 | Ga0495650_0008803 | 3300046471 | Bacteria | 5833 |
| 473 | Ga0495650_0012860 | 3300046471 | Bacteria | 4470 |
| 474 | Ga0495650_0037161 | 3300046471 | Bacteria | 2123 |
| 475 | Ga0495650_0059434 | 3300046471 | Bacteria | 1540 |
| 476 | Ga0495650_0079877 | 3300046471 | Bacteria | 1263 |
| 477 | Ga0495582_0029428 | 3300046473 | Bacteria | 3015 |
| 478 | Ga0495605_0000062 | 3300046474 | Bacteria | 143176 |
| 479 | Ga0495605_0001077 | 3300046474 | Bacteria | 18170 |
| 480 | Ga0495605_0001339 | 3300046474 | Bacteria | 16304 |
| 481 | Ga0495605_0001776 | 3300046474 | Bacteria | 13827 |
| 482 | Ga0495605_0006187 | 3300046474 | Bacteria | 6903 |
| 483 | Ga0495605_0009458 | 3300046474 | Bacteria | 5476 |
| 484 | Ga0495605_0018090 | 3300046474 | Bacteria | 3784 |
| 485 | Ga0495605_0120680 | 3300046474 | Bacteria | 1188 |
| 486 | Ga0495605_0129347 | 3300046474 | Bacteria | 1139 |
| 487 | Ga0495605_0173483 | 3300046474 | Bacteria | 951 |
| 488 | Ga0495639_0001422 | 3300046475 | Bacteria | 10699 |
| 489 | Ga0495584_0002039 | 3300046491 | Bacteria | 11608 |
| 490 | Ga0495584_0002652 | 3300046491 | Bacteria | 10067 |
| 491 | Ga0495584_0002719 | 3300046491 | Bacteria | 9917 |
| 492 | Ga0495584_0005232 | 3300046491 | Bacteria | 6881 |
| 493 | Ga0495584_0012017 | 3300046491 | Bacteria | 4426 |
| 494 | Ga0495585_0002838 | 3300046492 | Bacteria | 12065 |
| 495 | Ga0495585_0017841 | 3300046492 | Bacteria | 4096 |
| 496 | Ga0495585_0102598 | 3300046492 | Bacteria | 1528 |
| 497 | Ga0495594_0001089 | 3300046499 | Bacteria | 14172 |
| 498 | Ga0495594_0042261 | 3300046499 | Bacteria | 2496 |
| 499 | Ga0495607_0000535 | 3300046501 | Bacteria | 37269 |
| 500 | Ga0495607_0001879 | 3300046501 | Bacteria | 17817 |
| 501 | Ga0495607_0002217 | 3300046501 | Bacteria | 16098 |
| 502 | Ga0495607_0003116 | 3300046501 | Bacteria | 12867 |
| 503 | Ga0495607_0003678 | 3300046501 | Bacteria | 11635 |
| 504 | Ga0495607_0004041 | 3300046501 | Bacteria | 10998 |
| 505 | Ga0495607_0005538 | 3300046501 | Bacteria | 9009 |
| 506 | Ga0495607_0008397 | 3300046501 | Bacteria | 7061 |
| 507 | Ga0495607_0016897 | 3300046501 | Bacteria | 4698 |
| 508 | Ga0495607_0089273 | 3300046501 | Bacteria | 1673 |
| 509 | Ga0495607_0101039 | 3300046501 | Bacteria | 1544 |
| 510 | Ga0495607_0118852 | 3300046501 | Bacteria | 1390 |
| 511 | Ga0495607_0149014 | 3300046501 | Bacteria | 1199 |
| 512 | Ga0495583_0000015 | 3300046506 | Bacteria | 316392 |
| 513 | Ga0495583_0000821 | 3300046506 | Bacteria | 38030 |
| 514 | Ga0495583_0001917 | 3300046506 | Bacteria | 19233 |
| 515 | Ga0495583_0002771 | 3300046506 | Bacteria | 14454 |
| 516 | Ga0495583_0002903 | 3300046506 | Bacteria | 13863 |
| 517 | Ga0495583_0003231 | 3300046506 | Bacteria | 12739 |
| 518 | Ga0495583_0003968 | 3300046506 | Bacteria | 10927 |
| 519 | Ga0495583_0006370 | 3300046506 | Bacteria | 7736 |
| 520 | Ga0495583_0094592 | 3300046506 | Bacteria | 1282 |
| 521 | Ga0495606_0000214 | 3300046507 | Bacteria | 103149 |
| 522 | Ga0495606_0000352 | 3300046507 | Bacteria | 78743 |
| 523 | Ga0495606_0000892 | 3300046507 | Bacteria | 44530 |
| 524 | Ga0495606_0008494 | 3300046507 | Bacteria | 8911 |
| 525 | Ga0495606_0010283 | 3300046507 | Bacteria | 7788 |
| 526 | Ga0495606_0017442 | 3300046507 | Bacteria | 5429 |
| 527 | Ga0495606_0018966 | 3300046507 | Bacteria | 5139 |
| 528 | Ga0495606_0045423 | 3300046507 | Bacteria | 2911 |
| 529 | Ga0495606_0105917 | 3300046507 | Bacteria | 1703 |
| 530 | Ga0495606_0117649 | 3300046507 | Bacteria | 1595 |
| 531 | Ga0495610_0001409 | 3300046512 | Bacteria | 21314 |
| 532 | Ga0495610_0014812 | 3300046512 | Bacteria | 4562 |
| 533 | Ga0495610_0057894 | 3300046512 | Bacteria | 1856 |
| 534 | Ga0495610_0066729 | 3300046512 | Bacteria | 1693 |
| 535 | Ga0495616_0002776 | 3300046513 | Bacteria | 11437 |
| 536 | Ga0495616_0004870 | 3300046513 | Bacteria | 8399 |
| 537 | Ga0495616_0006934 | 3300046513 | Bacteria | 6821 |
| 538 | Ga0495616_0007447 | 3300046513 | Bacteria | 6552 |
| 539 | Ga0495616_0012671 | 3300046513 | Bacteria | 4776 |
| 540 | Ga0495616_0014475 | 3300046513 | Bacteria | 4414 |
| 541 | Ga0495616_0088491 | 3300046513 | Bacteria | 1470 |
| 542 | Ga0495620_0000033 | 3300046515 | Bacteria | 118157 |
| 543 | Ga0495620_0000050 | 3300046515 | Bacteria | 105651 |
| 544 | Ga0495620_0001299 | 3300046515 | Bacteria | 15205 |
| 545 | Ga0495620_0001883 | 3300046515 | Bacteria | 12333 |
| 546 | Ga0495620_0001955 | 3300046515 | Bacteria | 12067 |
| 547 | Ga0495620_0018478 | 3300046515 | Bacteria | 3451 |
| 548 | Ga0495620_0034133 | 3300046515 | Bacteria | 2302 |
| 549 | Ga0495630_0015738 | 3300046517 | Bacteria | 5526 |
| 550 | Ga0495631_0001124 | 3300046518 | Bacteria | 16576 |
| 551 | Ga0495631_0002205 | 3300046518 | Bacteria | 11203 |
| 552 | Ga0495631_0004919 | 3300046518 | Bacteria | 7041 |
| 553 | Ga0495631_0037240 | 3300046518 | Bacteria | 2168 |
| 554 | Ga0495632_0000919 | 3300046519 | Bacteria | 25838 |
| 555 | Ga0495632_0005948 | 3300046519 | Bacteria | 7949 |
| 556 | Ga0495632_0008767 | 3300046519 | Bacteria | 6163 |
| 557 | Ga0495632_0012508 | 3300046519 | Bacteria | 4893 |
| 558 | Ga0495632_0017772 | 3300046519 | Bacteria | 3917 |
| 559 | Ga0495632_0031838 | 3300046519 | Bacteria | 2722 |
| 560 | Ga0495632_0066278 | 3300046519 | Bacteria | 1742 |
| 561 | Ga0495632_0079607 | 3300046519 | Bacteria | 1564 |
| 562 | Ga0495632_0132364 | 3300046519 | Bacteria | 1160 |
| 563 | Ga0495632_0167143 | 3300046519 | Bacteria | 1011 |
| 564 | Ga0495637_0000020 | 3300046520 | Bacteria | 181611 |
| 565 | Ga0495637_0001280 | 3300046520 | Bacteria | 15160 |
| 566 | Ga0495637_0001968 | 3300046520 | Bacteria | 11609 |
| 567 | Ga0495637_0002004 | 3300046520 | Bacteria | 11488 |
| 568 | Ga0495637_0006061 | 3300046520 | Bacteria | 6105 |
| 569 | Ga0495637_0006923 | 3300046520 | Bacteria | 5656 |
| 570 | Ga0495637_0014561 | 3300046520 | Bacteria | 3709 |
| 571 | Ga0495637_0014633 | 3300046520 | Bacteria | 3697 |
| 572 | Ga0495637_0018213 | 3300046520 | Bacteria | 3259 |
| 573 | Ga0495637_0019161 | 3300046520 | Bacteria | 3165 |
| 574 | Ga0495637_0041022 | 3300046520 | Bacteria | 1988 |
| 575 | Ga0495637_0058463 | 3300046520 | Bacteria | 1589 |
| 576 | Ga0495637_0059719 | 3300046520 | Bacteria | 1568 |
| 577 | Ga0495637_0084697 | 3300046520 | Bacteria | 1259 |
| 578 | Ga0495643_0000320 | 3300046522 | Bacteria | 66010 |
| 579 | Ga0495643_0001218 | 3300046522 | Bacteria | 24887 |
| 580 | Ga0495643_0001318 | 3300046522 | Bacteria | 23490 |
| 581 | Ga0495643_0002020 | 3300046522 | Bacteria | 16923 |
| 582 | Ga0495643_0090811 | 3300046522 | Bacteria | 1575 |
| 583 | Ga0495644_0004800 | 3300046523 | Bacteria | 5311 |
| 584 | Ga0495644_0005221 | 3300046523 | Bacteria | 5077 |
| 585 | Ga0495644_0073001 | 3300046523 | Bacteria | 1290 |
| 586 | Ga0495648_0001594 | 3300046524 | Bacteria | 22104 |
| 587 | Ga0495648_0003563 | 3300046524 | Bacteria | 13621 |
| 588 | Ga0495648_0005817 | 3300046524 | Bacteria | 10157 |
| 589 | Ga0495648_0011636 | 3300046524 | Bacteria | 6610 |
| 590 | Ga0495648_0016613 | 3300046524 | Bacteria | 5299 |
| 591 | Ga0495648_0017390 | 3300046524 | Bacteria | 5141 |
| 592 | Ga0495648_0021864 | 3300046524 | Bacteria | 4417 |
| 593 | Ga0495648_0024558 | 3300046524 | Bacteria | 4101 |
| 594 | Ga0495648_0071572 | 3300046524 | Bacteria | 2009 |
| 595 | Ga0495648_0083163 | 3300046524 | Bacteria | 1814 |
| 596 | Ga0495666_0017492 | 3300046526 | Bacteria | 3569 |
| 597 | Ga0495666_0032216 | 3300046526 | Bacteria | 2566 |
| 598 | Ga0495642_0001037 | 3300046528 | Bacteria | 12902 |
| 599 | Ga0495642_0004922 | 3300046528 | Bacteria | 5149 |
| 600 | Ga0495654_0001141 | 3300046530 | Bacteria | 19059 |
| 601 | Ga0495654_0001487 | 3300046530 | Bacteria | 16035 |
| 602 | Ga0495654_0003927 | 3300046530 | Bacteria | 8978 |
| 603 | Ga0495654_0004238 | 3300046530 | Bacteria | 8572 |
| 604 | Ga0495654_0004593 | 3300046530 | Bacteria | 8153 |
| 605 | Ga0495654_0005161 | 3300046530 | Bacteria | 7619 |
| 606 | Ga0495654_0009894 | 3300046530 | Bacteria | 5212 |
| 607 | Ga0495654_0010887 | 3300046530 | Bacteria | 4941 |
| 608 | Ga0495654_0017900 | 3300046530 | Bacteria | 3718 |
| 609 | Ga0495654_0040169 | 3300046530 | Bacteria | 2332 |
| 610 | Ga0495654_0053300 | 3300046530 | Bacteria | 1966 |
| 611 | Ga0495654_0053304 | 3300046530 | Bacteria | 1966 |
| 612 | Ga0495654_0064706 | 3300046530 | Bacteria | 1747 |
| 613 | Ga0495587_0046123 | 3300046536 | Bacteria | 2587 |
| 614 | Ga0495609_0000143 | 3300046538 | Bacteria | 74412 |
| 615 | Ga0495609_0000372 | 3300046538 | Bacteria | 38530 |
| 616 | Ga0495609_0000461 | 3300046538 | Bacteria | 33185 |
| 617 | Ga0495609_0007912 | 3300046538 | Bacteria | 5253 |
| 618 | Ga0495609_0009727 | 3300046538 | Bacteria | 4637 |
| 619 | Ga0495609_0041131 | 3300046538 | Bacteria | 2078 |
| 620 | Ga0495597_0001205 | 3300046542 | Bacteria | 19346 |
| 621 | Ga0495597_0001312 | 3300046542 | Bacteria | 18248 |
| 622 | Ga0495597_0012872 | 3300046542 | Bacteria | 4025 |
| 623 | Ga0495597_0020876 | 3300046542 | Bacteria | 3046 |
| 624 | Ga0495597_0032407 | 3300046542 | Bacteria | 2372 |
| 625 | Ga0495597_0094475 | 3300046542 | Bacteria | 1266 |
| 626 | Ga0495645_0235516 | 3300046543 | Bacteria | 1224 |
| 627 | Ga0495622_0003131 | 3300046557 | Bacteria | 7835 |
| 628 | Ga0495622_0003397 | 3300046557 | Bacteria | 7508 |
| 629 | Ga0495622_0093076 | 3300046557 | Bacteria | 1384 |
| 630 | Ga0495633_0000084 | 3300046558 | Bacteria | 124972 |
| 631 | Ga0495633_0002008 | 3300046558 | Bacteria | 14726 |
| 632 | Ga0495656_0013901 | 3300046615 | Bacteria | 3006 |
| 633 | Ga0495668_0013703 | 3300046616 | Bacteria | 4771 |
| 634 | Ga0495668_0062086 | 3300046616 | Bacteria | 2059 |
| 635 | Ga0495668_0117973 | 3300046616 | Bacteria | 1451 |
| 636 | Ga0495634_0016154 | 3300046642 | Bacteria | 5342 |
| 637 | Ga0495634_0077836 | 3300046642 | Bacteria | 2174 |
| 638 | Ga0495611_0000246 | 3300046648 | Bacteria | 37614 |
| 639 | Ga0495611_0000318 | 3300046648 | Bacteria | 32266 |
| 640 | Ga0495611_0000910 | 3300046648 | Bacteria | 16008 |
| 641 | Ga0495611_0008333 | 3300046648 | Bacteria | 4389 |
| 642 | Ga0495625_0000133 | 3300046660 | Bacteria | 115381 |
| 643 | Ga0495625_0002266 | 3300046660 | Bacteria | 21142 |
| 644 | Ga0495625_0016901 | 3300046660 | Bacteria | 5727 |
| 645 | Ga0495635_0003150 | 3300046663 | Bacteria | 11355 |
| 646 | Ga0495659_0000898 | 3300046664 | Bacteria | 10597 |
| 647 | Ga0495661_0000027 | 3300046665 | Bacteria | 184297 |
| 648 | Ga0495661_0000065 | 3300046665 | Bacteria | 129298 |
| 649 | Ga0495661_0000370 | 3300046665 | Bacteria | 48701 |
| 650 | Ga0495661_0000542 | 3300046665 | Bacteria | 39039 |
| 651 | Ga0495661_0002713 | 3300046665 | Bacteria | 13493 |
| 652 | Ga0495661_0027979 | 3300046665 | Bacteria | 3615 |
| 653 | Ga0495661_0149018 | 3300046665 | Bacteria | 1265 |
| 654 | Ga0495588_0026370 | 3300046674 | Bacteria | 2900 |
| 655 | Ga0495588_0107371 | 3300046674 | Bacteria | 1469 |
| 656 | Ga0495623_0011845 | 3300046679 | Bacteria | 5650 |
| 657 | Ga0495623_0014638 | 3300046679 | Bacteria | 5074 |
| 658 | Ga0495646_0042505 | 3300046680 | Bacteria | 2788 |
| 659 | Ga0495669_0009945 | 3300046684 | Bacteria | 4022 |
| 660 | Ga0495613_0012854 | 3300046689 | Bacteria | 6223 |
| 661 | Ga0495670_0000196 | 3300046691 | Bacteria | 27094 |
| 662 | Ga0495670_0007919 | 3300046691 | Bacteria | 5224 |
| 663 | Ga0495670_0008804 | 3300046691 | Bacteria | 4968 |
| 664 | Ga0495670_0023771 | 3300046691 | Bacteria | 3025 |
| 665 | Ga0495671_0001993 | 3300046692 | Bacteria | 13125 |
| 666 | Ga0495671_0005998 | 3300046692 | Bacteria | 7061 |
| 667 | Ga0495671_0010036 | 3300046692 | Bacteria | 5266 |
| 668 | Ga0495671_0011636 | 3300046692 | Bacteria | 4829 |
| 669 | Ga0495671_0019714 | 3300046692 | Bacteria | 3560 |
| 670 | Ga0495671_0076149 | 3300046692 | Bacteria | 1645 |
| 671 | Ga0495671_0094070 | 3300046692 | Bacteria | 1466 |
| 672 | Ga0495671_0110951 | 3300046692 | Bacteria | 1339 |
| 673 | Ga0495671_0110977 | 3300046692 | Bacteria | 1339 |
| 674 | Ga0495649_0001378 | 3300046694 | Bacteria | 18389 |
| 675 | Ga0495649_0001797 | 3300046694 | Bacteria | 15774 |
| 676 | Ga0495649_0005095 | 3300046694 | Bacteria | 8437 |
| 677 | Ga0495649_0005670 | 3300046694 | Bacteria | 7882 |
| 678 | Ga0495649_0054487 | 3300046694 | Bacteria | 2162 |
| 679 | Ga0495589_0000779 | 3300046794 | Bacteria | 20247 |
| 680 | Ga0495589_0001384 | 3300046794 | Bacteria | 14107 |
| 681 | Ga0495589_0001986 | 3300046794 | Bacteria | 11576 |
| 682 | Ga0495589_0005362 | 3300046794 | Bacteria | 6767 |
| 683 | Ga0495589_0051631 | 3300046794 | Bacteria | 2032 |
| 684 | Ga0495589_0082943 | 3300046794 | Bacteria | 1558 |
| 685 | Ga0495600_0028678 | 3300046809 | Bacteria | 3601 |
| 686 | Ga0495600_0092650 | 3300046809 | Bacteria | 1971 |
| 687 | Ga0495660_0000797 | 3300046810 | Bacteria | 23640 |
| 688 | Ga0495660_0002243 | 3300046810 | Bacteria | 12441 |
| 689 | Ga0495660_0002803 | 3300046810 | Bacteria | 10979 |
| 690 | Ga0495660_0008873 | 3300046810 | Bacteria | 5874 |
| 691 | Ga0495660_0010257 | 3300046810 | Bacteria | 5447 |
| 692 | Ga0495660_0026092 | 3300046810 | Bacteria | 3315 |
| 693 | Ga0495660_0046539 | 3300046810 | Bacteria | 2378 |
| 694 | Ga0495660_0179948 | 3300046810 | Bacteria | 1023 |
| 695 | Ga0495604_0046093 | 3300047317 | Bacteria | 3399 |
| 696 | Ga0495636_0005482 | 3300047318 | Bacteria | 4985 |
| 697 | Ga0495636_0026308 | 3300047318 | Bacteria | 2366 |
| 698 | Ga0495674_0026203 | 3300047319 | Bacteria | 5336 |
| 699 | Ga0495672_0000763 | 3300047320 | Bacteria | 35066 |
| 700 | Ga0495672_0006798 | 3300047320 | Bacteria | 8751 |
| 701 | Ga0495672_0007247 | 3300047320 | Bacteria | 8366 |
| 702 | Ga0495672_0016835 | 3300047320 | Bacteria | 4906 |
| 703 | Ga0495672_0026376 | 3300047320 | Bacteria | 3708 |
| 704 | Ga0495672_0033865 | 3300047320 | Bacteria | 3162 |
| 705 | Ga0495672_0036556 | 3300047320 | Bacteria | 3014 |
| 706 | Ga0495672_0038784 | 3300047320 | Bacteria | 2903 |
| 707 | Ga0495672_0051139 | 3300047320 | Bacteria | 2435 |
| 708 | Ga0495672_0088989 | 3300047320 | Bacteria | 1700 |
| 709 | Ga0495672_0162519 | 3300047320 | Bacteria | 1146 |
| 710 | Ga0495672_0192815 | 3300047320 | Bacteria | 1023 |
| 711 | Ga0495676_0000181 | 3300047321 | Bacteria | 49744 |
| 712 | Ga0495676_0027747 | 3300047321 | Bacteria | 4850 |
| 713 | Ga0495676_0106745 | 3300047321 | Bacteria | 2062 |
| 714 | Ga0495680_0019387 | 3300047322 | Bacteria | 5741 |
| 715 | Ga0495680_0023975 | 3300047322 | Bacteria | 5068 |
| 716 | Ga0495680_0029539 | 3300047322 | Bacteria | 4488 |
| 717 | Ga0495680_0133411 | 3300047322 | Bacteria | 1822 |
| 718 | Ga0495683_0000044 | 3300047323 | Bacteria | 133747 |
| 719 | Ga0495683_0000109 | 3300047323 | Bacteria | 84488 |
| 720 | Ga0495683_0011206 | 3300047323 | Bacteria | 4723 |
| 721 | Ga0495683_0014543 | 3300047323 | Bacteria | 4100 |
| 722 | Ga0495683_0028365 | 3300047323 | Bacteria | 2861 |
| 723 | Ga0495687_002205 | 3300047443 | Bacteria | 16130 |
| 724 | Ga0495687_011346 | 3300047443 | Bacteria | 4801 |
| 725 | Ga0495687_011390 | 3300047443 | Bacteria | 4789 |
| 726 | Ga0495675_0022378 | 3300047444 | Bacteria | 4028 |
| 727 | Ga0495675_0023506 | 3300047444 | Bacteria | 3927 |
| 728 | Ga0495675_0069292 | 3300047444 | Bacteria | 2227 |
| 729 | Ga0495677_0007558 | 3300047445 | Bacteria | 4055 |
| 730 | Ga0495679_000132 | 3300047446 | Bacteria | 66186 |
| 731 | Ga0495679_001170 | 3300047446 | Bacteria | 15609 |
| 732 | Ga0495679_001404 | 3300047446 | Bacteria | 13752 |
| 733 | Ga0495685_006140 | 3300047447 | Bacteria | 3929 |
| 734 | Ga0495673_0001604 | 3300047469 | Bacteria | 17602 |
| 735 | Ga0495673_0002244 | 3300047469 | Bacteria | 13877 |
| 736 | Ga0495673_0002585 | 3300047469 | Bacteria | 12600 |
| 737 | Ga0495673_0002792 | 3300047469 | Bacteria | 11930 |
| 738 | Ga0495673_0002908 | 3300047469 | Bacteria | 11620 |
| 739 | Ga0495673_0003031 | 3300047469 | Bacteria | 11314 |
| 740 | Ga0495673_0007528 | 3300047469 | Bacteria | 6239 |
| 741 | Ga0495673_0010899 | 3300047469 | Bacteria | 4918 |
| 742 | Ga0495673_0012700 | 3300047469 | Bacteria | 4450 |
| 743 | Ga0495673_0017586 | 3300047469 | Bacteria | 3624 |
| 744 | Ga0495673_0030699 | 3300047469 | Bacteria | 2522 |
| 745 | Ga0495673_0037657 | 3300047469 | Bacteria | 2207 |
| 746 | Ga0495673_0127127 | 3300047469 | Bacteria | 1004 |
| 747 | Ga0495681_0000608 | 3300047470 | Bacteria | 27382 |
| 748 | Ga0495681_0001925 | 3300047470 | Bacteria | 15221 |
| 749 | Ga0495681_0004457 | 3300047470 | Bacteria | 9553 |
| 750 | Ga0495681_0005164 | 3300047470 | Bacteria | 8786 |
| 751 | Ga0495681_0006396 | 3300047470 | Bacteria | 7753 |
| 752 | Ga0495681_0009549 | 3300047470 | Bacteria | 5960 |
| 753 | Ga0495681_0010826 | 3300047470 | Bacteria | 5488 |
| 754 | Ga0495681_0013946 | 3300047470 | Bacteria | 4635 |
| 755 | Ga0495681_0024547 | 3300047470 | Bacteria | 3172 |
| 756 | Ga0495681_0035166 | 3300047470 | Bacteria | 2489 |
| 757 | Ga0495686_0042794 | 3300047472 | Bacteria | 2876 |
| 758 | Ga0495626_0000218 | 3300048091 | Bacteria | 68820 |
| 759 | Ga0495626_0002818 | 3300048091 | Bacteria | 11625 |
| 760 | Ga0495626_0002988 | 3300048091 | Bacteria | 11209 |
| 761 | Ga0495626_0003946 | 3300048091 | Bacteria | 9273 |
| 762 | Ga0495626_0004767 | 3300048091 | Bacteria | 8192 |
| 763 | Ga0495626_0006156 | 3300048091 | Bacteria | 6865 |
| 764 | Ga0495626_0007349 | 3300048091 | Bacteria | 6138 |
| 765 | Ga0495626_0008938 | 3300048091 | Bacteria | 5438 |
| 766 | Ga0496102_0022878 | 3300048905 | Bacteria | 5542 |
| 767 | Ga0496102_0134315 | 3300048905 | Bacteria | 2318 |
| 768 | Ga0496103_0014475 | 3300048906 | Bacteria | 4683 |
| 769 | Ga0496111_0072322 | 3300048914 | Bacteria | 2510 |
| 770 | Ga0496112_0514685 | 3300048915 | Bacteria | 1132 |
| 771 | Ga0496114_0037332 | 3300048917 | Bacteria | 4018 |
| 772 | Ga0496115_0196029 | 3300048918 | Bacteria | 1669 |
| 773 | Ga0496116_0000567 | 3300048919 | Bacteria | 49501 |
| 774 | Ga0496116_0000699 | 3300048919 | Bacteria | 43452 |
| 775 | Ga0496116_0005627 | 3300048919 | Bacteria | 11541 |
| 776 | Ga0496116_0018115 | 3300048919 | Bacteria | 5440 |
| 777 | Ga0496116_0021247 | 3300048919 | Bacteria | 4900 |
| 778 | Ga0496116_0069230 | 3300048919 | Bacteria | 2244 |
| 779 | Ga0496116_0070321 | 3300048919 | Bacteria | 2221 |
| 780 | Ga0496117_0000970 | 3300048920 | Bacteria | 43943 |
| 781 | Ga0496117_0003533 | 3300048920 | Bacteria | 18073 |
| 782 | Ga0496117_0004559 | 3300048920 | Bacteria | 15176 |
| 783 | Ga0496117_0005390 | 3300048920 | Bacteria | 13467 |
| 784 | Ga0496117_0005662 | 3300048920 | Bacteria | 13025 |
| 785 | Ga0496117_0019503 | 3300048920 | Bacteria | 5565 |
| 786 | Ga0496117_0047121 | 3300048920 | Bacteria | 3094 |
| 787 | Ga0496117_0140940 | 3300048920 | Bacteria | 1444 |
| 788 | Ga0496118_0003741 | 3300048921 | Bacteria | 18811 |
| 789 | Ga0496118_0005061 | 3300048921 | Bacteria | 15176 |
| 790 | Ga0496118_0013161 | 3300048921 | Bacteria | 7850 |
| 791 | Ga0496118_0083435 | 3300048921 | Bacteria | 2234 |
| 792 | Ga0496118_0128436 | 3300048921 | Bacteria | 1633 |
| 793 | Ga0496118_0145131 | 3300048921 | Bacteria | 1496 |
| 794 | Ga0496119_0000071 | 3300048922 | Bacteria | 153652 |
| 795 | Ga0496120_0001138 | 3300048923 | Bacteria | 34316 |
| 796 | Ga0496120_0010521 | 3300048923 | Bacteria | 6446 |
| 797 | Ga0496121_0001560 | 3300048924 | Bacteria | 38266 |
| 798 | Ga0496121_0001800 | 3300048924 | Bacteria | 34643 |
| 799 | Ga0496121_0002238 | 3300048924 | Bacteria | 30164 |
| 800 | Ga0496121_0017913 | 3300048924 | Bacteria | 7185 |
| 801 | Ga0496121_0145800 | 3300048924 | Bacteria | 1749 |
| 802 | Ga0496121_0179755 | 3300048924 | Bacteria | 1528 |
| 803 | Ga0496121_0195128 | 3300048924 | Bacteria | 1448 |
| 804 | Ga0496122_0001196 | 3300048925 | Bacteria | 44299 |
| 805 | Ga0496122_0002157 | 3300048925 | Bacteria | 28836 |
| 806 | Ga0496122_0010986 | 3300048925 | Bacteria | 9253 |
| 807 | Ga0496122_0013092 | 3300048925 | Bacteria | 8165 |
| 808 | Ga0496122_0018001 | 3300048925 | Bacteria | 6554 |
| 809 | Ga0496122_0086068 | 3300048925 | Bacteria | 2165 |
| 810 | Ga0496122_0099867 | 3300048925 | Bacteria | 1944 |
| 811 | Ga0496122_0179970 | 3300048925 | Bacteria | 1262 |
| 812 | Ga0496123_0000594 | 3300048926 | Bacteria | 61368 |
| 813 | Ga0496123_0001464 | 3300048926 | Bacteria | 32764 |
| 814 | Ga0496123_0010203 | 3300048926 | Bacteria | 8335 |
| 815 | Ga0496123_0014657 | 3300048926 | Bacteria | 6479 |
| 816 | Ga0496123_0014856 | 3300048926 | Bacteria | 6426 |
| 817 | Ga0496123_0052115 | 3300048926 | Bacteria | 2718 |
| 818 | Ga0496123_0139600 | 3300048926 | Bacteria | 1327 |
| 819 | Ga0496124_0001266 | 3300048927 | Bacteria | 38461 |
| 820 | Ga0496124_0004151 | 3300048927 | Bacteria | 17099 |
| 821 | Ga0496124_0007109 | 3300048927 | Bacteria | 11986 |
| 822 | Ga0496124_0011281 | 3300048927 | Bacteria | 8945 |
| 823 | Ga0496124_0013081 | 3300048927 | Bacteria | 8127 |
| 824 | Ga0496124_0015327 | 3300048927 | Bacteria | 7355 |
| 825 | Ga0496124_0054961 | 3300048927 | Bacteria | 3367 |
| 826 | Ga0496124_0058314 | 3300048927 | Bacteria | 3248 |
| 827 | Ga0496124_0066815 | 3300048927 | Bacteria | 2993 |
| 828 | Ga0496125_0003386 | 3300048928 | Bacteria | 19397 |
| 829 | Ga0496125_0005700 | 3300048928 | Bacteria | 13731 |
| 830 | Ga0496125_0006235 | 3300048928 | Bacteria | 12966 |
| 831 | Ga0496125_0015371 | 3300048928 | Bacteria | 7408 |
| 832 | Ga0496125_0015837 | 3300048928 | Bacteria | 7264 |
| 833 | Ga0496125_0016542 | 3300048928 | Bacteria | 7077 |
| 834 | Ga0496125_0041345 | 3300048928 | Bacteria | 3942 |
| 835 | Ga0496125_0113390 | 3300048928 | Bacteria | 1956 |
| 836 | Ga0496126_0017913 | 3300048929 | Bacteria | 7046 |
| 837 | Ga0496126_0033815 | 3300048929 | Bacteria | 4808 |
| 838 | Ga0496126_0045794 | 3300048929 | Bacteria | 4018 |
| 839 | Ga0496126_0072120 | 3300048929 | Bacteria | 3072 |
| 840 | Ga0496126_0234549 | 3300048929 | Bacteria | 1536 |
| 841 | Ga0495678_000017 | 3300049459 | Bacteria | 282592 |
| 842 | Ga0495678_002786 | 3300049459 | Bacteria | 11404 |
| 843 | Ga0495678_004463 | 3300049459 | Bacteria | 8083 |
| 844 | Ga0495678_004822 | 3300049459 | Bacteria | 7664 |
| 845 | Ga0495678_007223 | 3300049459 | Bacteria | 5786 |
| 846 | Ga0495678_008310 | 3300049459 | Bacteria | 5251 |
| 847 | Ga0495678_010219 | 3300049459 | Bacteria | 4574 |
| 848 | Ga0495678_022736 | 3300049459 | Bacteria | 2737 |
| 849 | Ga0495678_051856 | 3300049459 | Bacteria | 1583 |
| 850 | Ga0495682_0000235 | 3300049460 | Bacteria | 43660 |
| 851 | Ga0495682_0000375 | 3300049460 | Bacteria | 32322 |
| 852 | Ga0495682_0021362 | 3300049460 | Bacteria | 2425 |
| 853 | Ga0495682_0137032 | 3300049460 | Bacteria | 874 |
| 854 | Ga0501031_0192610 | 3300049568 | Bacteria | 1331 |
| 855 | Ga0501032_0093399 | 3300049569 | Bacteria | 1995 |
| 856 | Ga0501034_0000165 | 3300049571 | Bacteria | 123084 |
| 857 | Ga0501037_0032342 | 3300049573 | Bacteria | 3863 |
| 858 | Ga0501039_0149389 | 3300049575 | Bacteria | 1836 |
| 859 | Ga0501241_000551 | 3300049758 | Bacteria | 8051 |
| 860 | Ga0501226_000002 | 3300049853 | Bacteria | 426935 |
| 861 | Ga0501226_001319 | 3300049853 | Bacteria | 3205 |
| 862 | Ga0500618_001805 | 3300053125 | Bacteria | 9020 |
| 863 | Ga0500573_0179976 | 3300053140 | Bacteria | 1137 |
| 864 | 2510284871 | 2510065053 | Bacteria | 5005518 |
| 865 | 2510295181 | 2510065055 | Bacteria | 5037935 |
| 866 | 2510312249 | 2510065058 | Bacteria | 5005894 |
| 867 | 2511256100 | 2511231004 | Bacteria | 6669789 |
| 868 | 2511266077 | 2511231006 | Bacteria | 6794709 |
| 869 | 2511272789 | 2511231007 | Bacteria | 6306603 |
| 870 | 2511278871 | 2511231008 | Bacteria | 6624100 |
| 871 | 2511288750 | 2511231010 | Bacteria | 6373152 |
| 872 | 2511297385 | 2511231011 | Bacteria | 6149768 |
| 873 | 2511300144 | 2511231012 | Bacteria | 6738011 |
| 874 | 2511316352 | 2511231014 | Bacteria | 6462302 |
| 875 | 2511319412 | 2511231015 | Bacteria | 6598026 |
| 876 | 2511323517 | 2511231016 | Bacteria | 6704427 |
| 877 | 2511330956 | 2511231017 | Bacteria | 6503007 |
| 878 | 2511337803 | 2511231018 | Bacteria | 6436256 |
| 879 | 2511344565 | 2511231019 | Bacteria | 6520662 |
| 880 | 2511349147 | 2511231020 | Bacteria | 6115223 |
| 881 | 2511354087 | 2511231021 | Bacteria | 7302637 |
| 882 | 2511365050 | 2511231022 | Bacteria | 6719296 |
| 883 | 2511368957 | 2511231023 | Bacteria | 6808468 |
| 884 | 2511376024 | 2511231024 | Bacteria | 5835885 |
| 885 | 2511414332 | 2511231031 | Bacteria | 6558529 |
| 886 | 2511822493 | 2511231156 | Bacteria | 6845832 |
| 887 | 2512325988 | 2512047018 | Bacteria | 6663241 |
| 888 | 2554818051 | 2554235132 | Bacteria | 6772433 |
| 889 | 2555247825 | 2554235231 | Bacteria | 5215788 |
| 890 | 2555667462 | 2554235341 | Bacteria | 6867980 |
| 891 | 2583789773 | 2582580891 | Bacteria | 6800976 |
| 892 | 2597855693 | 2597489887 | Bacteria | 6666321 |
| 893 | 2597861701 | 2597489888 | Bacteria | 6179543 |
| 894 | 2599327331 | 2599185155 | Bacteria | 5827168 |
| 895 | 2599356683 | 2599185160 | Bacteria | 6844013 |
| 896 | 2599363285 | 2599185161 | Bacteria | 6960462 |
| 897 | 2599369763 | 2599185162 | Bacteria | 6957254 |
| 898 | 2599376394 | 2599185163 | Bacteria | 6995158 |
| 899 | 2599381788 | 2599185164 | Bacteria | 6841688 |
| 900 | 2599388068 | 2599185165 | Bacteria | 6843250 |
| 901 | 2599395408 | 2599185166 | Bacteria | 6959206 |
| 902 | 2599398817 | 2599185167 | Bacteria | 6353609 |
| 903 | 2599407173 | 2599185168 | Bacteria | 6997636 |
| 904 | 2599450872 | 2599185179 | Bacteria | 6611171 |
| 905 | 2599463516 | 2599185181 | Bacteria | 6844519 |
| 906 | 2599469134 | 2599185182 | Bacteria | 6883168 |
| 907 | 2599485595 | 2599185185 | Bacteria | 6652270 |
| 908 | 2599492535 | 2599185186 | Bacteria | 6831633 |
| 909 | 2599500071 | 2599185188 | Bacteria | 6164180 |
| 910 | 2599506464 | 2599185189 | Bacteria | 5862825 |
| 911 | 2599514182 | 2599185190 | Bacteria | 6285678 |
| 912 | 2599518783 | 2599185191 | Bacteria | 6297582 |
| 913 | 2599616654 | 2599185212 | Bacteria | 6765997 |
| 914 | 2599769451 | 2599185248 | Bacteria | 6696816 |
| 915 | 2599806724 | 2599185257 | Bacteria | 6492581 |
| 916 | 2599883539 | 2599185288 | Bacteria | 6666191 |
| 917 | 2599886871 | 2599185289 | Bacteria | 6778765 |
| 918 | 2599893483 | 2599185290 | Bacteria | 6289611 |
| 919 | 2599898200 | 2599185291 | Bacteria | 6775623 |
| 920 | 2599930933 | 2599185300 | Bacteria | 6062622 |
| 921 | 2599944688 | 2599185302 | Bacteria | 5954930 |
| 922 | 2599950726 | 2599185303 | Bacteria | 6512725 |
| 923 | 2599957308 | 2599185304 | Bacteria | 5951361 |
| 924 | 2599962002 | 2599185305 | Bacteria | 6748700 |
| 925 | 2599964586 | 2599185306 | Bacteria | 6637356 |
| 926 | 2599972998 | 2599185307 | Bacteria | 6194719 |
| 927 | 2599978873 | 2599185308 | Bacteria | 6621546 |
| 928 | 2599983259 | 2599185309 | Bacteria | 5969593 |
| 929 | 2599991646 | 2599185310 | Bacteria | 6014457 |
| 930 | 2599994806 | 2599185311 | Bacteria | 6354990 |
| 931 | 2600000931 | 2599185312 | Bacteria | 5912071 |
| 932 | 2600004901 | 2599185313 | Bacteria | 6658188 |
| 933 | 2600012833 | 2599185314 | Bacteria | 6621749 |
| 934 | 2600018936 | 2599185315 | Bacteria | 6771107 |
| 935 | 2600027032 | 2599185316 | Bacteria | 6320029 |
| 936 | 2600030948 | 2599185317 | Bacteria | 6435722 |
| 937 | 2600034623 | 2599185318 | Bacteria | 6961590 |
| 938 | 2600043429 | 2599185319 | Bacteria | 6637840 |
| 939 | 2600048266 | 2599185320 | Bacteria | 5963263 |
| 940 | 2600053363 | 2599185321 | Bacteria | 6764560 |
| 941 | 2600062741 | 2599185322 | Bacteria | 6763055 |
| 942 | 2600068444 | 2599185323 | Bacteria | 6688755 |
| 943 | 2600071830 | 2599185324 | Bacteria | 6590677 |
| 944 | 2600077706 | 2599185325 | Bacteria | 6324919 |
| 945 | 2600216145 | 2599185356 | Bacteria | 6843884 |
| 946 | 2600360839 | 2600254930 | Bacteria | 6431253 |
| 947 | 2600364846 | 2600254931 | Bacteria | 6734225 |
| 948 | 2600443873 | 2600254954 | Bacteria | 5100516 |
| 949 | 2601627154 | 2600255283 | Bacteria | 6061572 |
| 950 | 2601692383 | 2600255296 | Bacteria | 5784754 |
| 951 | 2601776312 | 2600255313 | Bacteria | 6842543 |
| 952 | 2601797872 | 2600255318 | Bacteria | 6383414 |
| 953 | 2602008676 | 2600255389 | Bacteria | 5275336 |
| 954 | 2606076645 | 2603880185 | Bacteria | 6379190 |
| 955 | 2606128941 | 2603880199 | Bacteria | 6377649 |
| 956 | 2608380645 | 2606217733 | Bacteria | 6360972 |
| 957 | 2621302145 | 2619619299 | Bacteria | 6649820 |
| 958 | 2624478258 | 2623620443 | Bacteria | 6427864 |
| 959 | 2624489801 | 2623620446 | Bacteria | 6500345 |
| 960 | 2643841026 | 2643221565 | Bacteria | 6216018 |
| 961 | 2643954865 | 2643221589 | Bacteria | 6250934 |
| 962 | 2644024505 | 2643221602 | Bacteria | 6249926 |
| 963 | 2644190199 | 2643221633 | Bacteria | 6733554 |
| 964 | 2644282034 | 2643221650 | Bacteria | 7029547 |
| 965 | 2644619683 | 2643221713 | Bacteria | 6554480 |
| 966 | 2652547007 | 2651869719 | Bacteria | 6047974 |
| 967 | 2671090761 | 2667528170 | Bacteria | 6786960 |
| 968 | 2671099927 | 2667528171 | Bacteria | 6900659 |
| 969 | 2671127383 | 2667528176 | Bacteria | 6724917 |
| 970 | 2671772375 | 2671180172 | Bacteria | 6495783 |
| 971 | 2678261030 | 2675903515 | Bacteria | 6580491 |
| 972 | 2715749245 | 2713897148 | Bacteria | 5883533 |
| 973 | 2715755513 | 2713897149 | Bacteria | 6506249 |
| 974 | 2718632196 | 2718217725 | Bacteria | 5758958 |
| 975 | 2723246595 | 2721755607 | Bacteria | 5841722 |
| 976 | 2729148675 | 2728369097 | Bacteria | 4333476 |
| 977 | 2738674120 | 2738541265 | Bacteria | 6594665 |
| 978 | 2738687553 | 2738541271 | Bacteria | 5657310 |
| 979 | 2738752513 | 2738541282 | Bacteria | 6593925 |
| 980 | 2738807872 | 2738541294 | Bacteria | 6925949 |
| 981 | 2738861554 | 2738541303 | Bacteria | 6591772 |
| 982 | 2738895232 | 2738541309 | Bacteria | 6926455 |
| 983 | 2739200499 | 2738543004 | Bacteria | 6381073 |
| 984 | 2739260022 | 2738543015 | Bacteria | 6750701 |
| 985 | 2739263174 | 2738543016 | Bacteria | 5657564 |
| 986 | 2739287105 | 2738543020 | Bacteria | 5718238 |
| 987 | 2739292418 | 2738543021 | Bacteria | 5718241 |
| 988 | 2739311319 | 2738543025 | Bacteria | 6600348 |
| 989 | 2743735110 | 2740892503 | Bacteria | 6855563 |
| 990 | 2745006341 | 2744054620 | Bacteria | 6551379 |
| 991 | 2765586409 | 2765235841 | Bacteria | 6137024 |
| 992 | 2774119518 | 2773857670 | Bacteria | 6407454 |
| 993 | 2774132360 | 2773857672 | Bacteria | 4993178 |
| 994 | 2774134772 | 2773857673 | Bacteria | 6513460 |
| 995 | 2784261009 | 2784132063 | Bacteria | 6262788 |
| 996 | 2784315929 | 2784132072 | Bacteria | 6596533 |
| 997 | 2794594019 | 2791355520 | Bacteria | 5948615 |
| 998 | 2807410651 | 2806310737 | Bacteria | 5751088 |
| 999 | 2807458992 | 2806310745 | Bacteria | 5742165 |
| 1000 | 2808855981 | 2808606361 | Bacteria | 6136259 |
| 1001 | 2808905391 | 2808606373 | Bacteria | 4423627 |
| 1002 | 2808922704 | 2808606376 | Bacteria | 6248667 |
| 1003 | 2808933121 | 2808606377 | Bacteria | 6646337 |
| 1004 | 2808936061 | 2808606378 | Bacteria | 6177535 |
| 1005 | 2808939655 | 2808606379 | Bacteria | 5022697 |
| 1006 | 2808944391 | 2808606380 | Bacteria | 6248705 |
| 1007 | 2808955243 | 2808606381 | Bacteria | 6646461 |
| 1008 | 2808955909 | 2808606382 | Bacteria | 6841132 |
| 1009 | 2808964442 | 2808606383 | Bacteria | 6138645 |
| 1010 | 2808976623 | 2808606385 | Bacteria | 6711065 |
| 1011 | 2808991939 | 2808606388 | Bacteria | 6706662 |
| 1012 | 2808999330 | 2808606389 | Bacteria | 6138126 |
| 1013 | 2809218016 | 2808606445 | Bacteria | 6057339 |
| 1014 | 2812370229 | 2811994881 | Bacteria | 6298475 |
| 1015 | 2817488445 | 2816332298 | Bacteria | 6852809 |
| 1016 | 2819657270 | 2818991456 | Bacteria | 6123676 |
| 1017 | 2819705257 | 2818991464 | Bacteria | 6907494 |
| 1018 | 2823425468 | 2823421272 | Bacteria | 5372474 |
| 1019 | 2825654228 | 2825651385 | Bacteria | 6715909 |
| 1020 | 2826586161 | 2826581358 | Bacteria | 5963467 |
| 1021 | 2834032178 | 2834028612 | Bacteria | 6354979 |
| 1022 | 2842809903 | 2842805378 | Bacteria | 5385175 |
| 1023 | 2842817797 | 2842815866 | Bacteria | 5947510 |
| 1024 | 2842830545 | 2842826826 | Bacteria | 5974129 |
| 1025 | 2842834199 | 2842832357 | Bacteria | 5959113 |
| 1026 | 2842838672 | 2842837860 | Bacteria | 6066181 |
| 1027 | 2842846325 | 2842843487 | Bacteria | 6004777 |
| 1028 | 2842851745 | 2842849001 | Bacteria | 5924277 |
| 1029 | 2842858685 | 2842854478 | Bacteria | 6143501 |
| 1030 | 2844667940 | 2844665904 | Bacteria | 6817974 |
| 1031 | 2852617110 | 2852612431 | Bacteria | 6885235 |
| 1032 | 2852660415 | 2852657418 | Bacteria | 6472974 |
| 1033 | 2852671901 | 2852667396 | Bacteria | 6885555 |
| 1034 | 2860343602 | 2860339153 | Bacteria | 6846989 |
| 1035 | 2878030201 | 2878029506 | Bacteria | 6418441 |
| 1036 | 2880231150 | 2880230671 | Bacteria | 6140320 |
| 1037 | 2904519606 | 2904518522 | Bacteria | 6068986 |
| 1038 | 2904555518 | 2904550169 | Bacteria | 6221258 |
| 1039 | 2908447064 | 2908446538 | Bacteria | 6829095 |
| 1040 | 2912968684 | 2912963787 | Bacteria | 5646108 |
| 1041 | 2913037321 | 2913036834 | Bacteria | 6704877 |
| 1042 | 2917071212 | 2917070673 | Bacteria | 6868303 |
| 1043 | 2917834096 | 2917832318 | Bacteria | 5346010 |
| 1044 | 2919066116 | 2919063839 | Bacteria | 6302690 |
| 1045 | 2919127675 | 2919125081 | Bacteria | 5385106 |
| 1046 | 2919155722 | 2919155634 | Bacteria | 4860545 |
| 1047 | 2919389734 | 2919385768 | Bacteria | 5897293 |
| 1048 | 2919460026 | 2919456309 | Bacteria | 6586567 |
| 1049 | 2919486938 | 2919481497 | Bacteria | 6907839 |
| 1050 | 2919488663 | 2919487758 | Bacteria | 5929766 |
| 1051 | 2919502203 | 2919501602 | Bacteria | 5286340 |
| 1052 | 2919698919 | 2919697872 | Bacteria | 6553725 |
| 1053 | 2923154105 | 2923153595 | Bacteria | 6870622 |
| 1054 | 2923524317 | 2923519811 | Bacteria | 6298479 |
| 1055 | 2923589825 | 2923586266 | Bacteria | 6565975 |
| 1056 | 2926063876 | 2926063275 | Bacteria | 5285848 |
| 1057 | 2929144855 | 2929144301 | Bacteria | 6622272 |
| 1058 | 2929190332 | 2929189879 | Bacteria | 5930554 |
| 1059 | 2931371808 | 2931369376 | Bacteria | 6847892 |
| 1060 | 2931391414 | 2931390751 | Bacteria | 6273349 |
| 1061 | 2931398880 | 2931396565 | Bacteria | 7251677 |
| 1062 | 2935359040 | 2935353572 | Unclassified | 6955622 |
| 1063 | 2935628601 | 2935625433 | Bacteria | 5042964 |
| 1064 | 2939620915 | 2939617950 | Bacteria | 4820956 |
| 1065 | 2939641147 | 2939636861 | Bacteria | 6297853 |
| 1066 | 2939654024 | 2939651529 | Bacteria | 5895393 |
| 1067 | 2945930131 | 2945928738 | Bacteria | 6053221 |
| 1068 | 2945967627 | 2945961074 | Bacteria | 7342064 |
| 1069 | 2946012475 | 2946006987 | Bacteria | 6705746 |
| 1070 | 2969304997 | 2969304461 | Bacteria | 6601805 |
| 1071 | 2974293313 | 2974289157 | Bacteria | 6080362 |
| 1072 | 2974298712 | 2974298342 | Bacteria | 4840922 |
| 1073 | 2974436105 | 2974435778 | Bacteria | 4876478 |
| 1074 | 2984291954 | 2984286254 | Bacteria | 6702062 |
| 1075 | 2984501005 | 2984499530 | Bacteria | 5020881 |
| 1076 | 2984505549 | 2984504281 | Bacteria | 5262371 |
| 1077 | 2988732243 | 2988728565 | Bacteria | 6124362 |
| 1078 | 2990198740 | 2990196909 | Bacteria | 4054280 |
| 1079 | 2998140502 | 2998139840 | Bacteria | 6073514 |
| 1080 | 3007254633 | 3007252601 | Bacteria | 4559114 |
| 1081 | 3007316584 | 3007315729 | Bacteria | 5076637 |
| 1082 | 3007399657 | 3007395558 | Bacteria | 6755444 |
| 1083 | 3007517953 | 3007511990 | Bacteria | 6481491 |
| 1084 | 3007617837 | 3007614139 | Bacteria | 6053559 |
| 1085 | 3007622006 | 3007619802 | Bacteria | 6411688 |
| 1086 | 3007720298 | 3007718800 | Bacteria | 5971527 |
| 1087 | 3007805383 | 3007803356 | Bacteria | 5931491 |
| 1088 | 3007859737 | 3007855910 | Bacteria | 5637581 |
| 1089 | 3007864291 | 3007861166 | Bacteria | 6045338 |
| 1090 | 3007872125 | 3007866637 | Bacteria | 5899198 |
| 1091 | 3007872652 | 3007872151 | Bacteria | 5268868 |
| 1092 | 637317857 | 637000220 | Bacteria | 7074893 |
| 1093 | 8011352678 | 8011350971 | Bacteria | 6158957 |
| 1094 | 8015688354 | 8015687852 | Bacteria | 6613826 |
| 1095 | 8016732530 | 8016728285 | Bacteria | 5263933 |
| 1096 | 8019507128 | 8019504834 | Bacteria | 4819156 |
| 1097 | 8019770341 | 8019769354 | Bacteria | 6924660 |
| 1098 | 8019777377 | 8019775933 | Bacteria | 6858656 |
| 1099 | 8030000237 | 8029995093 | Bacteria | 5990776 |
| 1100 | 8034963446 | 8034962539 | Bacteria | 4884839 |
| 1101 | 8052499620 | 8052494512 | Bacteria | 5765634 |
| 1102 | 8054290975 | 8054285046 | Bacteria | 6919322 |
| 1103 | 8054350096 | 8054347763 | Bacteria | 5901107 |
| 1104 | 8054503999 | 8054503363 | Bacteria | 6101651 |
| 1105 | 8054934202 | 8054929484 | Bacteria | 5599761 |
| 1106 | 8055771451 | 8055770955 | Bacteria | 6827675 |
| 1107 | 8055818399 | 8055817908 | Bacteria | 6609162 |
| 1108 | 8055879387 | 8055878733 | Bacteria | 5907058 |
| 1109 | 8056115943 | 8056115690 | Bacteria | 5527654 |
| 1110 | 8056121103 | 8056120720 | Bacteria | 5758328 |
| 1111 | 8056126511 | 8056125926 | Bacteria | 6228218 |
| 1112 | 8056132373 | 8056131705 | Bacteria | 6107031 |
| 1113 | 8056143783 | 8056143049 | Bacteria | 6307666 |
| 1114 | 8056158553 | 8056155041 | Bacteria | 6486948 |
| 1115 | 8056164379 | 8056161164 | Bacteria | 6106669 |
| 1116 | 8056170549 | 8056166840 | Bacteria | 5820959 |
| 1117 | 8056176669 | 8056172158 | Bacteria | 6133900 |
| 1118 | 8056183006 | 8056177738 | Bacteria | 6748268 |
| 1119 | 8056572357 | 8056569372 | Bacteria | 5997322 |
| 1120 | 8057802743 | 8057798959 | Bacteria | 6713499 |
| 1121 | Ga0450909_001760 | |||
| 1122 | MRS2a_Contig_87 | |||
| 1123 | SwRhRL2b_contig_288416 | |||
| 1124 | SwRhRL2b_contig_487482 | |||
| 1125 | JGI24741J21665_1006446 | |||
| 1126 | JGI25163J39215_1000534 | |||
| 1127 | JGI25163J39215_1001084 | |||
| 1128 | JGI25164J39214_1000145 | |||
| 1129 | JGI25164J39214_1000148 | |||
| 1130 | JGI25165J46597_1000266 | |||
| 1131 | JGI25165J46597_1000268 | |||
| 1132 | Ga0055539_1000048 | |||
| 1133 | Ga0055533_1000059 | |||
| 1134 | Ga0055532_1000096 | |||
| 1135 | Ga0055525_1000189 | |||
| 1136 | Ga0055536_1000615 | |||
| 1137 | Ga0055536_1002223 | |||
| 1138 | Ga0055530_10000374 | |||
| 1139 | Ga0055530_10000913 | |||
| 1140 | Ga0055540_1000337 | |||
| 1141 | Ga0055540_1000646 | |||
| 1142 | Ga0055540_1000657 | |||
| 1143 | Ga0055531_10000375 | |||
| 1144 | Ga0055541_1000035 | |||
| 1145 | Ga0065714_10000248 | |||
| 1146 | Ga0065714_10004567 | |||
| 1147 | Ga0065714_10016358 | |||
| 1148 | Ga0065714_10066037 | |||
| 1149 | Ga0065714_10067559 | |||
| 1150 | Ga0065714_10069151 | |||
| 1151 | Ga0065714_10075356 | |||
| 1152 | Ga0065714_10172978 | |||
| 1153 | Ga0065704_10000791 | |||
| 1154 | Ga0065704_10001014 | |||
| 1155 | Ga0065704_10020956 | |||
| 1156 | Ga0065704_10090218 | |||
| 1157 | Ga0065712_10067752 | |||
| 1158 | Ga0065712_10069162 | |||
| 1159 | Ga0070670_100001434 | |||
| 1160 | Ga0070670_100014428 | |||
| 1161 | Ga0070661_100000078 | |||
| 1162 | Ga0070669_100001899 | |||
| 1163 | Ga0070714_100424047 | |||
| 1164 | Ga0070662_100003973 | |||
| 1165 | Ga0068853_100000210 | |||
| 1166 | Ga0070665_100370287 | |||
| 1167 | Ga0070665_100619819 | |||
| 1168 | Ga0070664_100007381 | |||
| 1169 | Ga0070664_100017832 | |||
| 1170 | Ga0068854_100002209 | |||
| 1171 | Ga0068851_10000004 | |||
| 1172 | Ga0075364_10056823 | |||
| 1173 | Ga0075364_10120441 | |||
| 1174 | Ga0075432_10001130 | |||
| 1175 | Ga0075432_10003524 | |||
| 1176 | Ga0075432_10037538 | |||
| 1177 | Ga0075432_10085681 | |||
| 1178 | Ga0075362_10009085 | |||
| 1179 | Ga0075362_10231875 | |||
| 1180 | Ga0075436_100099306 | |||
| 1181 | Ga0099823_1013050 | |||
| 1182 | Ga0079104_1000638 | |||
| 1183 | Ga0079104_1000654 | |||
| 1184 | Ga0079104_1002562 | |||
| 1185 | Ga0079104_1033089 | |||
| 1186 | Ga0099826_10018533 | |||
| 1187 | Ga0105251_10001807 | |||
| 1188 | Ga0105251_10002054 | |||
| 1189 | Ga0105251_10003211 | |||
| 1190 | Ga0105251_10003431 | |||
| 1191 | Ga0105251_10004126 | |||
| 1192 | Ga0105251_10004337 | |||
| 1193 | Ga0105251_10020559 | |||
| 1194 | Ga0105251_10027160 | |||
| 1195 | Ga0105251_10125409 | |||
| 1196 | Ga0105244_10000133 | |||
| 1197 | Ga0105244_10002007 | |||
| 1198 | Ga0105244_10002116 | |||
| 1199 | Ga0105244_10004326 | |||
| 1200 | Ga0105244_10008580 | |||
| 1201 | Ga0105244_10016377 | |||
| 1202 | Ga0105244_10016789 | |||
| 1203 | Ga0105244_10022008 | |||
| 1204 | Ga0105244_10025650 | |||
| 1205 | Ga0105244_10056930 | |||
| 1206 | Ga0105244_10065634 | |||
| 1207 | Ga0105244_10091443 | |||
| 1208 | Ga0105244_10093117 | |||
| 1209 | Ga0105250_10000423 | |||
| 1210 | Ga0105250_10002533 | |||
| 1211 | Ga0105250_10002789 | |||
| 1212 | Ga0105250_10006222 | |||
| 1213 | Ga0105250_10011389 | |||
| 1214 | Ga0105250_10033549 | |||
| 1215 | Ga0105243_10001058 | |||
| 1216 | Ga0105243_10001664 | |||
| 1217 | Ga0105243_10002290 | |||
| 1218 | Ga0105243_10007323 | |||
| 1219 | Ga0105243_10029807 | |||
| 1220 | Ga0105243_10032432 | |||
| 1221 | Ga0105243_10036011 | |||
| 1222 | Ga0105242_10004878 | |||
| 1223 | Ga0105237_10007904 | |||
| 1224 | Ga0105237_10149704 | |||
| 1225 | Ga0105249_10055939 | |||
| 1226 | Ga0105246_10000489 | |||
| 1227 | Ga0105246_10005406 | |||
| 1228 | Ga0105246_10077933 | |||
| 1229 | Ga0105246_10083769 | |||
| 1230 | Ga0157345_1000037 | |||
| 1231 | Ga0157373_10008180 | |||
| 1232 | Ga0157373_10012146 | |||
| 1233 | Ga0157373_10022539 | |||
| 1234 | Ga0157373_10029077 | |||
| 1235 | Ga0157373_10032871 | |||
| 1236 | Ga0157373_10037056 | |||
| 1237 | Ga0157373_10044899 | |||
| 1238 | Ga0157373_10096805 | |||
| 1239 | Ga0157373_10219535 | |||
| 1240 | Ga0157373_10331575 | |||
| 1241 | Ga0157371_10000839 | |||
| 1242 | Ga0157371_10002020 | |||
| 1243 | Ga0157371_10002513 | |||
| 1244 | Ga0157371_10004811 | |||
| 1245 | Ga0157371_10051956 | |||
| 1246 | Ga0157371_10435411 | |||
| 1247 | Ga0157370_10000388 | |||
| 1248 | Ga0157370_10014921 | |||
| 1249 | Ga0157370_10104635 | |||
| 1250 | Ga0157370_10162376 | |||
| 1251 | Ga0157370_10192583 | |||
| 1252 | Ga0157370_10246484 | |||
| 1253 | Ga0157370_10246485 | |||
| 1254 | Ga0157369_10000184 | |||
| 1255 | Ga0157369_10001610 | |||
| 1256 | Ga0157369_10002373 | |||
| 1257 | Ga0157369_10008368 | |||
| 1258 | Ga0157369_10018752 | |||
| 1259 | Ga0157369_10040248 | |||
| 1260 | Ga0157369_10478173 | |||
| 1261 | Ga0157369_10662021 | |||
| 1262 | Ga0163162_10159342 | |||
| 1263 | Ga0157372_10000062 | |||
| 1264 | Ga0157372_10000947 | |||
| 1265 | Ga0157372_10006103 | |||
| 1266 | Ga0157372_10046612 | |||
| 1267 | Ga0157372_10374368 | |||
| 1268 | Ga0157375_10001804 | |||
| 1269 | Ga0157375_10008927 | |||
| 1270 | Ga0157375_10015868 | |||
| 1271 | Ga0182008_10000659 | |||
| 1272 | Ga0182008_10005131 | |||
| 1273 | Ga0182008_10012107 | |||
| 1274 | Ga0182008_10022943 | |||
| 1275 | Ga0182008_10036559 | |||
| 1276 | Ga0182008_10053683 | |||
| 1277 | Ga0182006_1003235 | |||
| 1278 | Ga0182006_1003547 | |||
| 1279 | Ga0182006_1003616 | |||
| 1280 | Ga0182006_1008819 | |||
| 1281 | Ga0182006_1012301 | |||
| 1282 | Ga0182006_1012616 | |||
| 1283 | Ga0182006_1020170 | |||
| 1284 | Ga0182006_1046602 | |||
| 1285 | Ga0182007_10003898 | |||
| 1286 | Ga0182007_10007513 | |||
| 1287 | Ga0182005_1004207 | |||
| 1288 | Ga0182005_1004402 | |||
| 1289 | Ga0182005_1009233 | |||
| 1290 | Ga0182005_1016613 | |||
| 1291 | Ga0182005_1024350 | |||
| 1292 | Ga0163161_10000624 | |||
| 1293 | Ga0163161_10005035 | |||
| 1294 | Ga0163161_10013791 | |||
| 1295 | Ga0163161_10026264 | |||
| 1296 | Ga0163161_10171325 | |||
| 1297 | Ga0163161_10405035 | |||
| 1298 | Ga0163161_10482035 | |||
| 1299 | Ga0209435_100864 | |||
| 1300 | Ga0209760_100181 | |||
| 1301 | Ga0209760_100215 | |||
| 1302 | Ga0209784_100028 | |||
| 1303 | Ga0209566_100028 | |||
| 1304 | Ga0209674_100047 | |||
| 1305 | Ga0209147_100031 | |||
| 1306 | Ga0209563_100050 | |||
| 1307 | Ga0209563_100488 | |||
| 1308 | Ga0207427_100014 | |||
| 1309 | Ga0207427_100016 | |||
| 1310 | Ga0209437_100011 | |||
| 1311 | Ga0209437_100016 | |||
| 1312 | Ga0209258_100150 | |||
| 1313 | Ga0207425_1001697 | |||
| 1314 | Ga0209646_1000165 | |||
| 1315 | Ga0209677_100029 | |||
| 1316 | Ga0209759_1011972 | |||
| 1317 | Ga0209129_1000021 | |||
| 1318 | Ga0209233_1000019 | |||
| 1319 | Ga0209233_1000036 | |||
| 1320 | Ga0209675_1002284 | |||
| 1321 | Ga0209676_1000025 | |||
| 1322 | Ga0209676_1000032 | |||
| 1323 | Ga0209676_1000326 | |||
| 1324 | Ga0209676_1001232 | |||
| 1325 | Ga0209676_1001980 | |||
| 1326 | Ga0209676_1015080 | |||
| 1327 | Ga0209050_1000025 | |||
| 1328 | Ga0209050_1000028 | |||
| 1329 | Ga0209050_1001079 | |||
| 1330 | Ga0209050_1001508 | |||
| 1331 | Ga0209051_1000026 | |||
| 1332 | Ga0209051_1000080 | |||
| 1333 | Ga0209051_1000334 | |||
| 1334 | Ga0209051_1003650 | |||
| 1335 | Ga0209257_1000034 | |||
| 1336 | Ga0207656_10000007 | |||
| 1337 | Ga0207696_1000020 | |||
| 1338 | Ga0207696_1000057 | |||
| 1339 | Ga0207696_1000064 | |||
| 1340 | Ga0207696_1000229 | |||
| 1341 | Ga0207696_1003169 | |||
| 1342 | Ga0207696_1003440 | |||
| 1343 | Ga0207696_1014985 | |||
| 1344 | Ga0207696_1020002 | |||
| 1345 | Ga0207655_1000014 | |||
| 1346 | Ga0207655_1000406 | |||
| 1347 | Ga0207655_1000565 | |||
| 1348 | Ga0207655_1000815 | |||
| 1349 | Ga0207655_1000922 | |||
| 1350 | Ga0207655_1001160 | |||
| 1351 | Ga0207655_1001818 | |||
| 1352 | Ga0207655_1002188 | |||
| 1353 | Ga0207655_1002787 | |||
| 1354 | Ga0207655_1003594 | |||
| 1355 | Ga0207655_1003980 | |||
| 1356 | Ga0207655_1004144 | |||
| 1357 | Ga0207655_1005546 | |||
| 1358 | Ga0207655_1006369 | |||
| 1359 | Ga0207655_1010151 | |||
| 1360 | Ga0207655_1010822 | |||
| 1361 | Ga0207655_1017130 | |||
| 1362 | Ga0207655_1051225 | |||
| 1363 | Ga0207655_1056487 | |||
| 1364 | Ga0207655_1057153 | |||
| 1365 | Ga0207655_1061236 | |||
| 1366 | Ga0207655_1123231 | |||
| 1367 | Ga0207713_1000031 | |||
| 1368 | Ga0207713_1000759 | |||
| 1369 | Ga0207713_1001119 | |||
| 1370 | Ga0207713_1001550 | |||
| 1371 | Ga0207713_1001809 | |||
| 1372 | Ga0207713_1001942 | |||
| 1373 | Ga0207713_1002040 | |||
| 1374 | Ga0207713_1003833 | |||
| 1375 | Ga0207713_1004233 | |||
| 1376 | Ga0207713_1005577 | |||
| 1377 | Ga0207713_1006802 | |||
| 1378 | Ga0207713_1008147 | |||
| 1379 | Ga0207713_1024439 | |||
| 1380 | Ga0207713_1024754 | |||
| 1381 | Ga0207713_1034429 | |||
| 1382 | Ga0207713_1034499 | |||
| 1383 | Ga0207713_1104116 | |||
| 1384 | Ga0207671_10000015 | |||
| 1385 | Ga0207649_10000001 | |||
| 1386 | Ga0207681_10000480 | |||
| 1387 | Ga0207650_10000868 | |||
| 1388 | Ga0207650_10001058 | |||
| 1389 | Ga0207664_10210444 | |||
| 1390 | Ga0207706_10000624 | |||
| 1391 | Ga0207706_10006689 | |||
| 1392 | Ga0207706_10355067 | |||
| 1393 | Ga0207686_10001543 | |||
| 1394 | Ga0207709_10000022 | |||
| 1395 | Ga0207709_10000578 | |||
| 1396 | Ga0207709_10000971 | |||
| 1397 | Ga0207709_10006325 | |||
| 1398 | Ga0207709_10009944 | |||
| 1399 | Ga0207709_10017283 | |||
| 1400 | Ga0207709_10177570 | |||
| 1401 | Ga0207679_10000011 | |||
| 1402 | Ga0207679_10056642 | |||
| 1403 | Ga0207639_10000706 | |||
| 1404 | Ga0209281_1000026 | |||
| 1405 | Ga0209281_1000033 | |||
| 1406 | Ga0209281_1004548 | |||
| 1407 | Ga0209389_1000095 | |||
| 1408 | Ga0209389_1093364 | |||
| 1409 | Ga0209371_1000029 | |||
| 1410 | Ga0209371_1000217 | |||
| 1411 | Ga0209371_1000380 | |||
| 1412 | Ga0209371_1014099 | |||
| 1413 | Ga0209371_1018226 | |||
| 1414 | Ga0209995_1012455 | |||
| 1415 | Ga0209983_1012794 | |||
| 1416 | Ga0209974_10027040 | |||
| 1417 | Ga0207428_10018345 | |||
| 1418 | Ga0207428_10084951 | |||
| 1419 | Ga0207428_10107357 | |||
| 1420 | Ga0207428_10110397 | |||
| 1421 | Ga0268266_10007054 | |||
| 1422 | Ga0268266_10223110 | |||
| 1423 | Ga0268266_10359174 | |||
| 1424 | Ga0307517_10046926 | |||
| 1425 | Ga0268256_1000032 | |||
| 1426 | Ga0268256_1000173 | |||
| 1427 | Ga0268256_1000428 | |||
| 1428 | Ga0268256_1005448 | |||
| 1429 | Ga0268256_1015628 | |||
| 1430 | Ga0316177_1136448 | |||
| 1431 | Ga0314311_1115640 | |||
| 1432 | Ga0316179_1116990 | |||
| 1433 | Ga0316178_1078135 | |||
| 1434 | Ga0316183_1053680 | |||
| 1435 | Ga0316181_1247226 | |||
| 1436 | Ga0265316_10053330 | |||
| 1437 | Ga0307408_100000002 | |||
| 1438 | Ga0307408_100013668 | |||
| 1439 | Ga0307408_100032095 | |||
| 1440 | Ga0307408_100129270 | |||
| 1441 | Ga0307408_100241922 | |||
| 1442 | Ga0265342_10095268 | |||
| 1443 | Ga0307405_10000474 | |||
| 1444 | Ga0307405_10009426 | |||
| 1445 | Ga0307405_10013191 | |||
| 1446 | Ga0307405_10065543 | |||
| 1447 | Ga0307413_10052144 | |||
| 1448 | Ga0307413_10564500 | |||
| 1449 | Ga0307406_10357606 | |||
| 1450 | Ga0307406_10417033 | |||
| 1451 | Ga0307407_10038970 | |||
| 1452 | Ga0307412_10006654 | |||
| 1453 | Ga0307412_10012666 | |||
| 1454 | Ga0307412_10014146 | |||
| 1455 | Ga0307412_10016071 | |||
| 1456 | Ga0307412_10108365 | |||
| 1457 | Ga0307412_10202814 | |||
| 1458 | Ga0307412_10474972 | |||
| 1459 | Ga0307409_100015570 | |||
| 1460 | Ga0307409_100017296 | |||
| 1461 | Ga0307416_100070455 | |||
| 1462 | Ga0307416_100456033 | |||
| 1463 | Ga0307416_100941339 | |||
| 1464 | Ga0307414_10002568 | |||
| 1465 | Ga0307414_10015030 | |||
| 1466 | Ga0307414_10054038 | |||
| 1467 | Ga0307414_10064819 | |||
| 1468 | Ga0307411_10010536 | |||
| 1469 | Ga0307411_10036524 | |||
| 1470 | Ga0307510_10003578 | |||
| 1471 | Ga0237819_01318 | |||
| 1472 | Ga0436363_0281375 | |||
| 1473 | Ga0439436_0012268 | |||
| 1474 | Ga0439438_000621 | |||
| 1475 | Ga0439438_001072 | |||
| 1476 | Ga0439438_001956 | |||
| 1477 | Ga0439438_003204 | |||
| 1478 | Ga0439438_005713 | |||
| 1479 | Ga0439438_006379 | |||
| 1480 | Ga0439438_006390 | |||
| 1481 | Ga0439438_011071 | |||
| 1482 | Ga0439438_044002 | |||
| 1483 | Ga0439447_000763 | |||
| 1484 | Ga0439447_003053 | |||
| 1485 | Ga0439447_004183 | |||
| 1486 | Ga0439447_004452 | |||
| 1487 | Ga0439447_054544 | |||
| 1488 | Ga0439466_0001219 | |||
| 1489 | Ga0439466_0001604 | |||
| 1490 | Ga0439466_0002254 | |||
| 1491 | Ga0439466_0003680 | |||
| 1492 | Ga0439466_0012145 | |||
| 1493 | Ga0439466_0013185 | |||
| 1494 | Ga0439466_0013468 | |||
| 1495 | Ga0439466_0014147 | |||
| 1496 | Ga0439466_0023139 | |||
| 1497 | Ga0439466_0029925 | |||
| 1498 | Ga0439432_000649 | |||
| 1499 | Ga0439432_001572 | |||
| 1500 | Ga0439432_001927 | |||
| 1501 | Ga0439432_002096 | |||
| 1502 | Ga0439432_004987 | |||
| 1503 | Ga0439432_018571 | |||
| 1504 | Ga0439451_002023 | |||
| 1505 | Ga0439451_004014 | |||
| 1506 | Ga0439451_004974 | |||
| 1507 | Ga0439452_000012 | |||
| 1508 | Ga0439452_000992 | |||
| 1509 | Ga0439452_002398 | |||
| 1510 | Ga0439452_003343 | |||
| 1511 | Ga0439452_006422 | |||
| 1512 | Ga0439452_006430 | |||
| 1513 | Ga0439452_014092 | |||
| 1514 | Ga0439455_0019459 | |||
| 1515 | Ga0439456_001110 | |||
| 1516 | Ga0439463_000057 | |||
| 1517 | Ga0439463_001908 | |||
| 1518 | Ga0439463_006113 | |||
| 1519 | Ga0450911_000012 | |||
| 1520 | Ga0450911_000192 | |||
| 1521 | Ga0450911_001957 | |||
| 1522 | Ga0450923_006474 | |||
| 1523 | Ga0450890_000220 | |||
| 1524 | Ga0450900_000138 | |||
| 1525 | Ga0450902_000850 | |||
| 1526 | Ga0450902_014050 | |||
| 1527 | Ga0450902_015131 | |||
| 1528 | Ga0450903_004454 | |||
| 1529 | Ga0450903_016216 | |||
| 1530 | Ga0450904_000331 | |||
| 1531 | Ga0450904_003722 | |||
| 1532 | Ga0450905_000034 | |||
| 1533 | Ga0450889_009463 | |||
| 1534 | Ga0450906_002807 | |||
| 1535 | Ga0450907_000627 | |||
| 1536 | Ga0450907_000768 | |||
| 1537 | Ga0450907_039522 | |||
| 1538 | Ga0450910_001269 | |||
| 1539 | Ga0439446_0002361 | |||
| 1540 | Ga0439446_0009053 | |||
| 1541 | Ga0450908_007196 | |||
| 1542 | Ga0450908_008314 | |||
| 1543 | Ga0450909_002673 | |||
| 1544 | Ga0439434_0002067 | |||
| 1545 | Ga0439434_0002931 | |||
| 1546 | Ga0439464_0000082 | |||
| 1547 | Ga0439464_0001991 | |||
| 1548 | Ga0439464_0004794 | |||
| 1549 | Ga0439464_0035080 | |||
| 1550 | Ga0439460_0002166 | |||
| 1551 | Ga0439460_0002435 | |||
| 1552 | Ga0439460_0030234 | |||
| 1553 | Ga0450918_001781 | |||
| 1554 | Ga0450901_000124 | |||
| 1555 | Ga0439440_0000861 | |||
| 1556 | Ga0439440_0004862 | |||
| 1557 | Ga0451576_0490605 | |||
| 1558 | Ga0495617_000900 | |||
| 1559 | Ga0495617_001444 | |||
| 1560 | Ga0495617_046413 | |||
| 1561 | Ga0495627_000529 | |||
| 1562 | Ga0495627_000662 | |||
| 1563 | Ga0495627_000811 | |||
| 1564 | Ga0495627_003516 | |||
| 1565 | Ga0495627_007132 | |||
| 1566 | Ga0495627_038585 | |||
| 1567 | Ga0495603_0037506 | |||
| 1568 | Ga0495590_0002060 | |||
| 1569 | Ga0495590_0015849 | |||
| 1570 | Ga0495591_000417 | |||
| 1571 | Ga0495591_000692 | |||
| 1572 | Ga0495591_002059 | |||
| 1573 | Ga0495591_004076 | |||
| 1574 | Ga0495591_004675 | |||
| 1575 | Ga0495591_005356 | |||
| 1576 | Ga0495591_006073 | |||
| 1577 | Ga0495591_006221 | |||
| 1578 | Ga0495591_007818 | |||
| 1579 | Ga0495591_008359 | |||
| 1580 | Ga0495591_028006 | |||
| 1581 | Ga0495629_0021447 | |||
| 1582 | Ga0495638_0006393 | |||
| 1583 | Ga0495638_0019097 | |||
| 1584 | Ga0495638_0029363 | |||
| 1585 | Ga0495638_0062755 | |||
| 1586 | Ga0495638_0066091 | |||
| 1587 | Ga0495638_0124315 | |||
| 1588 | Ga0495638_0165525 | |||
| 1589 | Ga0495653_0008338 | |||
| 1590 | Ga0495653_0023867 | |||
| 1591 | Ga0495653_0095792 | |||
| 1592 | Ga0495650_0008803 | |||
| 1593 | Ga0495650_0012860 | |||
| 1594 | Ga0495650_0037161 | |||
| 1595 | Ga0495650_0059434 | |||
| 1596 | Ga0495650_0079877 | |||
| 1597 | Ga0495582_0029428 | |||
| 1598 | Ga0495605_0000062 | |||
| 1599 | Ga0495605_0001077 | |||
| 1600 | Ga0495605_0001339 | |||
| 1601 | Ga0495605_0001776 | |||
| 1602 | Ga0495605_0006187 | |||
| 1603 | Ga0495605_0009458 | |||
| 1604 | Ga0495605_0018090 | |||
| 1605 | Ga0495605_0120680 | |||
| 1606 | Ga0495605_0129347 | |||
| 1607 | Ga0495605_0173483 | |||
| 1608 | Ga0495639_0001422 | |||
| 1609 | Ga0495584_0002039 | |||
| 1610 | Ga0495584_0002652 | |||
| 1611 | Ga0495584_0002719 | |||
| 1612 | Ga0495584_0005232 | |||
| 1613 | Ga0495584_0012017 | |||
| 1614 | Ga0495585_0002838 | |||
| 1615 | Ga0495585_0017841 | |||
| 1616 | Ga0495585_0102598 | |||
| 1617 | Ga0495594_0001089 | |||
| 1618 | Ga0495594_0042261 | |||
| 1619 | Ga0495607_0000535 | |||
| 1620 | Ga0495607_0001879 | |||
| 1621 | Ga0495607_0002217 | |||
| 1622 | Ga0495607_0003116 | |||
| 1623 | Ga0495607_0003678 | |||
| 1624 | Ga0495607_0004041 | |||
| 1625 | Ga0495607_0005538 | |||
| 1626 | Ga0495607_0008397 | |||
| 1627 | Ga0495607_0016897 | |||
| 1628 | Ga0495607_0089273 | |||
| 1629 | Ga0495607_0101039 | |||
| 1630 | Ga0495607_0118852 | |||
| 1631 | Ga0495607_0149014 | |||
| 1632 | Ga0495583_0000015 | |||
| 1633 | Ga0495583_0000821 | |||
| 1634 | Ga0495583_0001917 | |||
| 1635 | Ga0495583_0002771 | |||
| 1636 | Ga0495583_0002903 | |||
| 1637 | Ga0495583_0003231 | |||
| 1638 | Ga0495583_0003968 | |||
| 1639 | Ga0495583_0006370 | |||
| 1640 | Ga0495583_0094592 | |||
| 1641 | Ga0495606_0000214 | |||
| 1642 | Ga0495606_0000352 | |||
| 1643 | Ga0495606_0000892 | |||
| 1644 | Ga0495606_0008494 | |||
| 1645 | Ga0495606_0010283 | |||
| 1646 | Ga0495606_0017442 | |||
| 1647 | Ga0495606_0018966 | |||
| 1648 | Ga0495606_0045423 | |||
| 1649 | Ga0495606_0105917 | |||
| 1650 | Ga0495606_0117649 | |||
| 1651 | Ga0495610_0001409 | |||
| 1652 | Ga0495610_0014812 | |||
| 1653 | Ga0495610_0057894 | |||
| 1654 | Ga0495610_0066729 | |||
| 1655 | Ga0495616_0002776 | |||
| 1656 | Ga0495616_0004870 | |||
| 1657 | Ga0495616_0006934 | |||
| 1658 | Ga0495616_0007447 | |||
| 1659 | Ga0495616_0012671 | |||
| 1660 | Ga0495616_0014475 | |||
| 1661 | Ga0495616_0088491 | |||
| 1662 | Ga0495620_0000033 | |||
| 1663 | Ga0495620_0000050 | |||
| 1664 | Ga0495620_0001299 | |||
| 1665 | Ga0495620_0001883 | |||
| 1666 | Ga0495620_0001955 | |||
| 1667 | Ga0495620_0018478 | |||
| 1668 | Ga0495620_0034133 | |||
| 1669 | Ga0495630_0015738 | |||
| 1670 | Ga0495631_0001124 | |||
| 1671 | Ga0495631_0002205 | |||
| 1672 | Ga0495631_0004919 | |||
| 1673 | Ga0495631_0037240 | |||
| 1674 | Ga0495632_0000919 | |||
| 1675 | Ga0495632_0005948 | |||
| 1676 | Ga0495632_0008767 | |||
| 1677 | Ga0495632_0012508 | |||
| 1678 | Ga0495632_0017772 | |||
| 1679 | Ga0495632_0031838 | |||
| 1680 | Ga0495632_0066278 | |||
| 1681 | Ga0495632_0079607 | |||
| 1682 | Ga0495632_0132364 | |||
| 1683 | Ga0495632_0167143 | |||
| 1684 | Ga0495637_0000020 | |||
| 1685 | Ga0495637_0001280 | |||
| 1686 | Ga0495637_0001968 | |||
| 1687 | Ga0495637_0002004 | |||
| 1688 | Ga0495637_0006061 | |||
| 1689 | Ga0495637_0006923 | |||
| 1690 | Ga0495637_0014561 | |||
| 1691 | Ga0495637_0014633 | |||
| 1692 | Ga0495637_0018213 | |||
| 1693 | Ga0495637_0019161 | |||
| 1694 | Ga0495637_0041022 | |||
| 1695 | Ga0495637_0058463 | |||
| 1696 | Ga0495637_0059719 | |||
| 1697 | Ga0495637_0084697 | |||
| 1698 | Ga0495643_0000320 | |||
| 1699 | Ga0495643_0001218 | |||
| 1700 | Ga0495643_0001318 | |||
| 1701 | Ga0495643_0002020 | |||
| 1702 | Ga0495643_0090811 | |||
| 1703 | Ga0495644_0004800 | |||
| 1704 | Ga0495644_0005221 | |||
| 1705 | Ga0495644_0073001 | |||
| 1706 | Ga0495648_0001594 | |||
| 1707 | Ga0495648_0003563 | |||
| 1708 | Ga0495648_0005817 | |||
| 1709 | Ga0495648_0011636 | |||
| 1710 | Ga0495648_0016613 | |||
| 1711 | Ga0495648_0017390 | |||
| 1712 | Ga0495648_0021864 | |||
| 1713 | Ga0495648_0024558 | |||
| 1714 | Ga0495648_0071572 | |||
| 1715 | Ga0495648_0083163 | |||
| 1716 | Ga0495666_0017492 | |||
| 1717 | Ga0495666_0032216 | |||
| 1718 | Ga0495642_0001037 | |||
| 1719 | Ga0495642_0004922 | |||
| 1720 | Ga0495654_0001141 | |||
| 1721 | Ga0495654_0001487 | |||
| 1722 | Ga0495654_0003927 | |||
| 1723 | Ga0495654_0004238 | |||
| 1724 | Ga0495654_0004593 | |||
| 1725 | Ga0495654_0005161 | |||
| 1726 | Ga0495654_0009894 | |||
| 1727 | Ga0495654_0010887 | |||
| 1728 | Ga0495654_0017900 | |||
| 1729 | Ga0495654_0040169 | |||
| 1730 | Ga0495654_0053300 | |||
| 1731 | Ga0495654_0053304 | |||
| 1732 | Ga0495654_0064706 | |||
| 1733 | Ga0495587_0046123 | |||
| 1734 | Ga0495609_0000143 | |||
| 1735 | Ga0495609_0000372 | |||
| 1736 | Ga0495609_0000461 | |||
| 1737 | Ga0495609_0007912 | |||
| 1738 | Ga0495609_0009727 | |||
| 1739 | Ga0495609_0041131 | |||
| 1740 | Ga0495597_0001205 | |||
| 1741 | Ga0495597_0001312 | |||
| 1742 | Ga0495597_0012872 | |||
| 1743 | Ga0495597_0020876 | |||
| 1744 | Ga0495597_0032407 | |||
| 1745 | Ga0495597_0094475 | |||
| 1746 | Ga0495645_0235516 | |||
| 1747 | Ga0495622_0003131 | |||
| 1748 | Ga0495622_0003397 | |||
| 1749 | Ga0495622_0093076 | |||
| 1750 | Ga0495633_0000084 | |||
| 1751 | Ga0495633_0002008 | |||
| 1752 | Ga0495656_0013901 | |||
| 1753 | Ga0495668_0013703 | |||
| 1754 | Ga0495668_0062086 | |||
| 1755 | Ga0495668_0117973 | |||
| 1756 | Ga0495634_0016154 | |||
| 1757 | Ga0495634_0077836 | |||
| 1758 | Ga0495611_0000246 | |||
| 1759 | Ga0495611_0000318 | |||
| 1760 | Ga0495611_0000910 | |||
| 1761 | Ga0495611_0008333 | |||
| 1762 | Ga0495625_0000133 | |||
| 1763 | Ga0495625_0002266 | |||
| 1764 | Ga0495625_0016901 | |||
| 1765 | Ga0495635_0003150 | |||
| 1766 | Ga0495659_0000898 | |||
| 1767 | Ga0495661_0000027 | |||
| 1768 | Ga0495661_0000065 | |||
| 1769 | Ga0495661_0000370 | |||
| 1770 | Ga0495661_0000542 | |||
| 1771 | Ga0495661_0002713 | |||
| 1772 | Ga0495661_0027979 | |||
| 1773 | Ga0495661_0149018 | |||
| 1774 | Ga0495588_0026370 | |||
| 1775 | Ga0495588_0107371 | |||
| 1776 | Ga0495623_0011845 | |||
| 1777 | Ga0495623_0014638 | |||
| 1778 | Ga0495646_0042505 | |||
| 1779 | Ga0495669_0009945 | |||
| 1780 | Ga0495613_0012854 | |||
| 1781 | Ga0495670_0000196 | |||
| 1782 | Ga0495670_0007919 | |||
| 1783 | Ga0495670_0008804 | |||
| 1784 | Ga0495670_0023771 | |||
| 1785 | Ga0495671_0001993 | |||
| 1786 | Ga0495671_0005998 | |||
| 1787 | Ga0495671_0010036 | |||
| 1788 | Ga0495671_0011636 | |||
| 1789 | Ga0495671_0019714 | |||
| 1790 | Ga0495671_0076149 | |||
| 1791 | Ga0495671_0094070 | |||
| 1792 | Ga0495671_0110951 | |||
| 1793 | Ga0495671_0110977 | |||
| 1794 | Ga0495649_0001378 | |||
| 1795 | Ga0495649_0001797 | |||
| 1796 | Ga0495649_0005095 | |||
| 1797 | Ga0495649_0005670 | |||
| 1798 | Ga0495649_0054487 | |||
| 1799 | Ga0495589_0000779 | |||
| 1800 | Ga0495589_0001384 | |||
| 1801 | Ga0495589_0001986 | |||
| 1802 | Ga0495589_0005362 | |||
| 1803 | Ga0495589_0051631 | |||
| 1804 | Ga0495589_0082943 | |||
| 1805 | Ga0495600_0028678 | |||
| 1806 | Ga0495600_0092650 | |||
| 1807 | Ga0495660_0000797 | |||
| 1808 | Ga0495660_0002243 | |||
| 1809 | Ga0495660_0002803 | |||
| 1810 | Ga0495660_0008873 | |||
| 1811 | Ga0495660_0010257 | |||
| 1812 | Ga0495660_0026092 | |||
| 1813 | Ga0495660_0046539 | |||
| 1814 | Ga0495660_0179948 | |||
| 1815 | Ga0495604_0046093 | |||
| 1816 | Ga0495636_0005482 | |||
| 1817 | Ga0495636_0026308 | |||
| 1818 | Ga0495674_0026203 | |||
| 1819 | Ga0495672_0000763 | |||
| 1820 | Ga0495672_0006798 | |||
| 1821 | Ga0495672_0007247 | |||
| 1822 | Ga0495672_0016835 | |||
| 1823 | Ga0495672_0026376 | |||
| 1824 | Ga0495672_0033865 | |||
| 1825 | Ga0495672_0036556 | |||
| 1826 | Ga0495672_0038784 | |||
| 1827 | Ga0495672_0051139 | |||
| 1828 | Ga0495672_0088989 | |||
| 1829 | Ga0495672_0162519 | |||
| 1830 | Ga0495672_0192815 | |||
| 1831 | Ga0495676_0000181 | |||
| 1832 | Ga0495676_0027747 | |||
| 1833 | Ga0495676_0106745 | |||
| 1834 | Ga0495680_0019387 | |||
| 1835 | Ga0495680_0023975 | |||
| 1836 | Ga0495680_0029539 | |||
| 1837 | Ga0495680_0133411 | |||
| 1838 | Ga0495683_0000044 | |||
| 1839 | Ga0495683_0000109 | |||
| 1840 | Ga0495683_0011206 | |||
| 1841 | Ga0495683_0014543 | |||
| 1842 | Ga0495683_0028365 | |||
| 1843 | Ga0495687_002205 | |||
| 1844 | Ga0495687_011346 | |||
| 1845 | Ga0495687_011390 | |||
| 1846 | Ga0495675_0022378 | |||
| 1847 | Ga0495675_0023506 | |||
| 1848 | Ga0495675_0069292 | |||
| 1849 | Ga0495677_0007558 | |||
| 1850 | Ga0495679_000132 | |||
| 1851 | Ga0495679_001170 | |||
| 1852 | Ga0495679_001404 | |||
| 1853 | Ga0495685_006140 | |||
| 1854 | Ga0495673_0001604 | |||
| 1855 | Ga0495673_0002244 | |||
| 1856 | Ga0495673_0002585 | |||
| 1857 | Ga0495673_0002792 | |||
| 1858 | Ga0495673_0002908 | |||
| 1859 | Ga0495673_0003031 | |||
| 1860 | Ga0495673_0007528 | |||
| 1861 | Ga0495673_0010899 | |||
| 1862 | Ga0495673_0012700 | |||
| 1863 | Ga0495673_0017586 | |||
| 1864 | Ga0495673_0030699 | |||
| 1865 | Ga0495673_0037657 | |||
| 1866 | Ga0495673_0127127 | |||
| 1867 | Ga0495681_0000608 | |||
| 1868 | Ga0495681_0001925 | |||
| 1869 | Ga0495681_0004457 | |||
| 1870 | Ga0495681_0005164 | |||
| 1871 | Ga0495681_0006396 | |||
| 1872 | Ga0495681_0009549 | |||
| 1873 | Ga0495681_0010826 | |||
| 1874 | Ga0495681_0013946 | |||
| 1875 | Ga0495681_0024547 | |||
| 1876 | Ga0495681_0035166 | |||
| 1877 | Ga0495686_0042794 | |||
| 1878 | Ga0495626_0000218 | |||
| 1879 | Ga0495626_0002818 | |||
| 1880 | Ga0495626_0002988 | |||
| 1881 | Ga0495626_0003946 | |||
| 1882 | Ga0495626_0004767 | |||
| 1883 | Ga0495626_0006156 | |||
| 1884 | Ga0495626_0007349 | |||
| 1885 | Ga0495626_0008938 | |||
| 1886 | Ga0496102_0022878 | |||
| 1887 | Ga0496102_0134315 | |||
| 1888 | Ga0496103_0014475 | |||
| 1889 | Ga0496111_0072322 | |||
| 1890 | Ga0496112_0514685 | |||
| 1891 | Ga0496114_0037332 | |||
| 1892 | Ga0496115_0196029 | |||
| 1893 | Ga0496116_0000567 | |||
| 1894 | Ga0496116_0000699 | |||
| 1895 | Ga0496116_0005627 | |||
| 1896 | Ga0496116_0018115 | |||
| 1897 | Ga0496116_0021247 | |||
| 1898 | Ga0496116_0069230 | |||
| 1899 | Ga0496116_0070321 | |||
| 1900 | Ga0496117_0000970 | |||
| 1901 | Ga0496117_0003533 | |||
| 1902 | Ga0496117_0004559 | |||
| 1903 | Ga0496117_0005390 | |||
| 1904 | Ga0496117_0005662 | |||
| 1905 | Ga0496117_0019503 | |||
| 1906 | Ga0496117_0047121 | |||
| 1907 | Ga0496117_0140940 | |||
| 1908 | Ga0496118_0003741 | |||
| 1909 | Ga0496118_0005061 | |||
| 1910 | Ga0496118_0013161 | |||
| 1911 | Ga0496118_0083435 | |||
| 1912 | Ga0496118_0128436 | |||
| 1913 | Ga0496118_0145131 | |||
| 1914 | Ga0496119_0000071 | |||
| 1915 | Ga0496120_0001138 | |||
| 1916 | Ga0496120_0010521 | |||
| 1917 | Ga0496121_0001560 | |||
| 1918 | Ga0496121_0001800 | |||
| 1919 | Ga0496121_0002238 | |||
| 1920 | Ga0496121_0017913 | |||
| 1921 | Ga0496121_0145800 | |||
| 1922 | Ga0496121_0179755 | |||
| 1923 | Ga0496121_0195128 | |||
| 1924 | Ga0496122_0001196 | |||
| 1925 | Ga0496122_0002157 | |||
| 1926 | Ga0496122_0010986 | |||
| 1927 | Ga0496122_0013092 | |||
| 1928 | Ga0496122_0018001 | |||
| 1929 | Ga0496122_0086068 | |||
| 1930 | Ga0496122_0099867 | |||
| 1931 | Ga0496122_0179970 | |||
| 1932 | Ga0496123_0000594 | |||
| 1933 | Ga0496123_0001464 | |||
| 1934 | Ga0496123_0010203 | |||
| 1935 | Ga0496123_0014657 | |||
| 1936 | Ga0496123_0014856 | |||
| 1937 | Ga0496123_0052115 | |||
| 1938 | Ga0496123_0139600 | |||
| 1939 | Ga0496124_0001266 | |||
| 1940 | Ga0496124_0004151 | |||
| 1941 | Ga0496124_0007109 | |||
| 1942 | Ga0496124_0011281 | |||
| 1943 | Ga0496124_0013081 | |||
| 1944 | Ga0496124_0015327 | |||
| 1945 | Ga0496124_0054961 | |||
| 1946 | Ga0496124_0058314 | |||
| 1947 | Ga0496124_0066815 | |||
| 1948 | Ga0496125_0003386 | |||
| 1949 | Ga0496125_0005700 | |||
| 1950 | Ga0496125_0006235 | |||
| 1951 | Ga0496125_0015371 | |||
| 1952 | Ga0496125_0015837 | |||
| 1953 | Ga0496125_0016542 | |||
| 1954 | Ga0496125_0041345 | |||
| 1955 | Ga0496125_0113390 | |||
| 1956 | Ga0496126_0017913 | |||
| 1957 | Ga0496126_0033815 | |||
| 1958 | Ga0496126_0045794 | |||
| 1959 | Ga0496126_0072120 | |||
| 1960 | Ga0496126_0234549 | |||
| 1961 | Ga0495678_000017 | |||
| 1962 | Ga0495678_002786 | |||
| 1963 | Ga0495678_004463 | |||
| 1964 | Ga0495678_004822 | |||
| 1965 | Ga0495678_007223 | |||
| 1966 | Ga0495678_008310 | |||
| 1967 | Ga0495678_010219 | |||
| 1968 | Ga0495678_022736 | |||
| 1969 | Ga0495678_051856 | |||
| 1970 | Ga0495682_0000235 | |||
| 1971 | Ga0495682_0000375 | |||
| 1972 | Ga0495682_0021362 | |||
| 1973 | Ga0495682_0137032 | |||
| 1974 | Ga0501031_0192610 | |||
| 1975 | Ga0501032_0093399 | |||
| 1976 | Ga0501034_0000165 | |||
| 1977 | Ga0501037_0032342 | |||
| 1978 | Ga0501039_0149389 | |||
| 1979 | Ga0501241_000551 | |||
| 1980 | Ga0501226_000002 | |||
| 1981 | Ga0501226_001319 | |||
| 1982 | Ga0500618_001805 | |||
| 1983 | Ga0500573_0179976 | |||
| 1984 | 2510284871 | |||
| 1985 | 2510295181 | |||
| 1986 | 2510312249 | |||
| 1987 | 2511256100 | |||
| 1988 | 2511266077 | |||
| 1989 | 2511272789 | |||
| 1990 | 2511278871 | |||
| 1991 | 2511288750 | |||
| 1992 | 2511297385 | |||
| 1993 | 2511300144 | |||
| 1994 | 2511316352 | |||
| 1995 | 2511319412 | |||
| 1996 | 2511323517 | |||
| 1997 | 2511330956 | |||
| 1998 | 2511337803 | |||
| 1999 | 2511344565 | |||
| 2000 | 2511349147 | |||
| 2001 | 2511354087 | |||
| 2002 | 2511365050 | |||
| 2003 | 2511368957 | |||
| 2004 | 2511376024 | |||
| 2005 | 2511414332 | |||
| 2006 | 2511822493 | |||
| 2007 | 2512325988 | |||
| 2008 | 2554818051 | |||
| 2009 | 2555247825 | |||
| 2010 | 2555667462 | |||
| 2011 | 2583789773 | |||
| 2012 | 2597855693 | |||
| 2013 | 2597861701 | |||
| 2014 | 2599327331 | |||
| 2015 | 2599356683 | |||
| 2016 | 2599363285 | |||
| 2017 | 2599369763 | |||
| 2018 | 2599376394 | |||
| 2019 | 2599381788 | |||
| 2020 | 2599388068 | |||
| 2021 | 2599395408 | |||
| 2022 | 2599398817 | |||
| 2023 | 2599407173 | |||
| 2024 | 2599450872 | |||
| 2025 | 2599463516 | |||
| 2026 | 2599469134 | |||
| 2027 | 2599485595 | |||
| 2028 | 2599492535 | |||
| 2029 | 2599500071 | |||
| 2030 | 2599506464 | |||
| 2031 | 2599514182 | |||
| 2032 | 2599518783 | |||
| 2033 | 2599616654 | |||
| 2034 | 2599769451 | |||
| 2035 | 2599806724 | |||
| 2036 | 2599883539 | |||
| 2037 | 2599886871 | |||
| 2038 | 2599893483 | |||
| 2039 | 2599898200 | |||
| 2040 | 2599930933 | |||
| 2041 | 2599944688 | |||
| 2042 | 2599950726 | |||
| 2043 | 2599957308 | |||
| 2044 | 2599962002 | |||
| 2045 | 2599964586 | |||
| 2046 | 2599972998 | |||
| 2047 | 2599978873 | |||
| 2048 | 2599983259 | |||
| 2049 | 2599991646 | |||
| 2050 | 2599994806 | |||
| 2051 | 2600000931 | |||
| 2052 | 2600004901 | |||
| 2053 | 2600012833 | |||
| 2054 | 2600018936 | |||
| 2055 | 2600027032 | |||
| 2056 | 2600030948 | |||
| 2057 | 2600034623 | |||
| 2058 | 2600043429 | |||
| 2059 | 2600048266 | |||
| 2060 | 2600053363 | |||
| 2061 | 2600062741 | |||
| 2062 | 2600068444 | |||
| 2063 | 2600071830 | |||
| 2064 | 2600077706 | |||
| 2065 | 2600216145 | |||
| 2066 | 2600360839 | |||
| 2067 | 2600364846 | |||
| 2068 | 2600443873 | |||
| 2069 | 2601627154 | |||
| 2070 | 2601692383 | |||
| 2071 | 2601776312 | |||
| 2072 | 2601797872 | |||
| 2073 | 2602008676 | |||
| 2074 | 2606076645 | |||
| 2075 | 2606128941 | |||
| 2076 | 2608380645 | |||
| 2077 | 2621302145 | |||
| 2078 | 2624478258 | |||
| 2079 | 2624489801 | |||
| 2080 | 2643841026 | |||
| 2081 | 2643954865 | |||
| 2082 | 2644024505 | |||
| 2083 | 2644190199 | |||
| 2084 | 2644282034 | |||
| 2085 | 2644619683 | |||
| 2086 | 2652547007 | |||
| 2087 | 2671090761 | |||
| 2088 | 2671099927 | |||
| 2089 | 2671127383 | |||
| 2090 | 2671772375 | |||
| 2091 | 2678261030 | |||
| 2092 | 2715749245 | |||
| 2093 | 2715755513 | |||
| 2094 | 2718632196 | |||
| 2095 | 2723246595 | |||
| 2096 | 2729148675 | |||
| 2097 | 2738674120 | |||
| 2098 | 2738687553 | |||
| 2099 | 2738752513 | |||
| 2100 | 2738807872 | |||
| 2101 | 2738861554 | |||
| 2102 | 2738895232 | |||
| 2103 | 2739200499 | |||
| 2104 | 2739260022 | |||
| 2105 | 2739263174 | |||
| 2106 | 2739287105 | |||
| 2107 | 2739292418 | |||
| 2108 | 2739311319 | |||
| 2109 | 2743735110 | |||
| 2110 | 2745006341 | |||
| 2111 | 2765586409 | |||
| 2112 | 2774119518 | |||
| 2113 | 2774132360 | |||
| 2114 | 2774134772 | |||
| 2115 | 2784261009 | |||
| 2116 | 2784315929 | |||
| 2117 | 2794594019 | |||
| 2118 | 2807410651 | |||
| 2119 | 2807458992 | |||
| 2120 | 2808855981 | |||
| 2121 | 2808905391 | |||
| 2122 | 2808922704 | |||
| 2123 | 2808933121 | |||
| 2124 | 2808936061 | |||
| 2125 | 2808939655 | |||
| 2126 | 2808944391 | |||
| 2127 | 2808955243 | |||
| 2128 | 2808955909 | |||
| 2129 | 2808964442 | |||
| 2130 | 2808976623 | |||
| 2131 | 2808991939 | |||
| 2132 | 2808999330 | |||
| 2133 | 2809218016 | |||
| 2134 | 2812370229 | |||
| 2135 | 2817488445 | |||
| 2136 | 2819657270 | |||
| 2137 | 2819705257 | |||
| 2138 | 2823425468 | |||
| 2139 | 2825654228 | |||
| 2140 | 2826586161 | |||
| 2141 | 2834032178 | |||
| 2142 | 2842809903 | |||
| 2143 | 2842817797 | |||
| 2144 | 2842830545 | |||
| 2145 | 2842834199 | |||
| 2146 | 2842838672 | |||
| 2147 | 2842846325 | |||
| 2148 | 2842851745 | |||
| 2149 | 2842858685 | |||
| 2150 | 2844667940 | |||
| 2151 | 2852617110 | |||
| 2152 | 2852660415 | |||
| 2153 | 2852671901 | |||
| 2154 | 2860343602 | |||
| 2155 | 2878030201 | |||
| 2156 | 2880231150 | |||
| 2157 | 2904519606 | |||
| 2158 | 2904555518 | |||
| 2159 | 2908447064 | |||
| 2160 | 2912968684 | |||
| 2161 | 2913037321 | |||
| 2162 | 2917071212 | |||
| 2163 | 2917834096 | |||
| 2164 | 2919066116 | |||
| 2165 | 2919127675 | |||
| 2166 | 2919155722 | |||
| 2167 | 2919389734 | |||
| 2168 | 2919460026 | |||
| 2169 | 2919486938 | |||
| 2170 | 2919488663 | |||
| 2171 | 2919502203 | |||
| 2172 | 2919698919 | |||
| 2173 | 2923154105 | |||
| 2174 | 2923524317 | |||
| 2175 | 2923589825 | |||
| 2176 | 2926063876 | |||
| 2177 | 2929144855 | |||
| 2178 | 2929190332 | |||
| 2179 | 2931371808 | |||
| 2180 | 2931391414 | |||
| 2181 | 2931398880 | |||
| 2182 | 2935359040 | |||
| 2183 | 2935628601 | |||
| 2184 | 2939620915 | |||
| 2185 | 2939641147 | |||
| 2186 | 2939654024 | |||
| 2187 | 2945930131 | |||
| 2188 | 2945967627 | |||
| 2189 | 2946012475 | |||
| 2190 | 2969304997 | |||
| 2191 | 2974293313 | |||
| 2192 | 2974298712 | |||
| 2193 | 2974436105 | |||
| 2194 | 2984291954 | |||
| 2195 | 2984501005 | |||
| 2196 | 2984505549 | |||
| 2197 | 2988732243 | |||
| 2198 | 2990198740 | |||
| 2199 | 2998140502 | |||
| 2200 | 3007254633 | |||
| 2201 | 3007316584 | |||
| 2202 | 3007399657 | |||
| 2203 | 3007517953 | |||
| 2204 | 3007617837 | |||
| 2205 | 3007622006 | |||
| 2206 | 3007720298 | |||
| 2207 | 3007805383 | |||
| 2208 | 3007859737 | |||
| 2209 | 3007864291 | |||
| 2210 | 3007872125 | |||
| 2211 | 3007872652 | |||
| 2212 | 637317857 | |||
| 2213 | 8011352678 | |||
| 2214 | 8015688354 | |||
| 2215 | 8016732530 | |||
| 2216 | 8019507128 | |||
| 2217 | 8019770341 | |||
| 2218 | 8019777377 | |||
| 2219 | 8030000237 | |||
| 2220 | 8034963446 | |||
| 2221 | 8052499620 | |||
| 2222 | 8054290975 | |||
| 2223 | 8054350096 | |||
| 2224 | 8054503999 | |||
| 2225 | 8054934202 | |||
| 2226 | 8055771451 | |||
| 2227 | 8055818399 | |||
| 2228 | 8055879387 | |||
| 2229 | 8056115943 | |||
| 2230 | 8056121103 | |||
| 2231 | 8056126511 | |||
| 2232 | 8056132373 | |||
| 2233 | 8056143783 | |||
| 2234 | 8056158553 | |||
| 2235 | 8056164379 | |||
| 2236 | 8056170549 | |||
| 2237 | 8056176669 | |||
| 2238 | 8056183006 | |||
| 2239 | 8056572357 | |||
| 2240 | 8057802743 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6dfl-assembly1.cif.gz_A | waap in complex with acyl carrier protein | 0.9661 | 1 | 256 |
| 6dfl-assembly1.cif.gz_A | waap in complex with acyl carrier protein | 0.9582 | 1 | 256 |
| 7szb-assembly2.cif.gz_C | crystal structure analysis of human prpk complex with a compound | 0.7364 | 20 | 231 |
| 7sza-assembly2.cif.gz_C | crystal structure analysis of human prpk complex with a compound | 0.7047 | 9 | 231 |
| 3umx-assembly1.cif.gz_A | crystal structure of pim1 kinase in complex with inhibitor (z)-2-[(1h-indol-3-yl)methylene]-7-(azepan-1-ylmethyl)-6-hydroxybenzofuran-3(2h)-one | 0.6993 | 27 | 192 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P25741_19_230_1.10.510.10 | Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 | 0.9454 | 21 | 229 | 1.10.510.10 |
| af_P25741_19_230_1.10.510.10 | Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 | 0.9281 | 21 | 229 | 1.10.510.10 |
| 1lwjB03 | Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II | 0.7767 | 28 | 53 | 2.60.40.1180 |
| af_A4I0J0_34_185_2.40.128.110 | Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like | 0.739 | 29 | 58 | 2.40.128.110 |
| 4aefB04 | Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II | 0.7224 | 25 | 55 | 2.60.40.1180 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2D6J7S4-F1-model_v4 | deleted | 0.9872 | 118 | 264 |
|
| AF-A4VR68-F1-model_v4 | Lipopolysaccharide core biosynthesis protein WaaP | 0.9751 | 2 | 264 |
GO:0009103
GO:0016301 |
| AF-A0A1G8PDH5-F1-model_v4 | Heptose I phosphotransferase | 0.9739 | 2 | 265 |
GO:0009103
GO:0016301 |
| AF-A0A6Y3K5W5-F1-model_v4 | Lipopolysaccharide core heptose(I) kinase RfaP (EC 2.7.1.-) | 0.9636 | 2 | 241 |
GO:0009103
GO:0016301 |
| AF-A0A1G8PDH5-F1-model_v4 | Heptose I phosphotransferase | 0.9631 | 2 | 265 |
GO:0009103
GO:0016301 |