F490393
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1120 | 444 | 2230 | 352 |
Family's Representative Sequence
| Representative Sequence | 3300046492|Ga0495585_0004431|Ga0495585_0004431_3923_5149 |
| Length | 408 |
| Sequence | MAGAGRLLSRRKLLKAVAALPLAYAAPLCAEPPPAQAITPALIAAATKEGQLTWYTSADSQLAEKVGKAFEQKFRGVRVRVERAGGERIFARVAQEYASGLHVADAVSTGDAAQFLAWKRQELLAPYVPEDVARYIPPEHRDPDGFYASVRSSLCVIAYNTAMVKREDAPKSFANLLDLKWKGKIVKAHPSYSGTIMTSTYQMVRELSWSYLEQLARQQVLQVQSATDTPKKVVLGERPVMADGNESNVLLLKEAGGPIEVVYAAEGTPSIVQPSAIFVAAPHPNAARLFQNYLFGVEGQELFVNLGGLRSLHALVKDKPGRTPLSAIKVWKDDPAAVETQGEDIKRRYSLWCLITRSRGSTPRLHMKQLKQVLLSVSWVHDCRYKPSAGQPLPRFDLSRSQLVSGLR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 6 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 9 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 10 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 11 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 12 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 13 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 14 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 15 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 16 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 17 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 25 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 59 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 62 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 65 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 73 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 75 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 76 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 77 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 79 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 80 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 81 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 82 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 83 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 84 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 85 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 86 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 87 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 88 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 89 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 90 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 92 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 93 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 94 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 95 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 96 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 97 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 98 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 99 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 100 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 102 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 103 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 104 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 105 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 106 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 107 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 108 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 109 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 110 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 111 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 113 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 114 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 214 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 216 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 220 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 221 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 222 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 223 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 224 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 225 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 226 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 227 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 228 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 229 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 230 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 231 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 232 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 233 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 234 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 235 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 236 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 237 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 238 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 239 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 240 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 241 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 242 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 243 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 244 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 245 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 246 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 247 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 248 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 249 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 250 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 251 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 252 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 253 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 254 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 255 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 256 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 257 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 258 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 259 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 260 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 261 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 262 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 263 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 264 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 265 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 266 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 267 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 268 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 269 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 270 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 271 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 272 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 273 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 274 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 275 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 276 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 277 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 278 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 340 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 341 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 342 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 343 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 344 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 345 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 346 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 347 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 348 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 349 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 350 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 351 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 352 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 353 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 354 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 355 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 356 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 357 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 358 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 359 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 360 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 361 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 362 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 363 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 379 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 380 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 381 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 382 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 383 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 397 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 398 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 399 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 400 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 401 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 402 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 403 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 404 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 405 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 406 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 407 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 408 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 409 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 410 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 411 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 412 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 413 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 414 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 415 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 416 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 417 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 418 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 419 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 420 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 421 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 422 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 423 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 424 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 425 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 426 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 427 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 428 | 2904699407 | |||
| 429 | 2906610324 | |||
| 430 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 431 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 432 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 433 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 434 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 435 | 2922425934 | |||
| 436 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 437 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 438 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 439 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 440 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 441 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 442 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 443 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 444 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.58 |
| Metatranscriptomes | 0 |
| Isolates | 2.42 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.02 |
| Nodule | 1.96 |
| Rhizoplane | 8.75 |
| Rhizosphere | 81.61 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.09 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495585_0004431 | 3300046492 | Bacteria | 9107 |
| 2 | JGI24746J21847_1004478 | 3300001977 | Bacteria | 2202 |
| 3 | JGI24739J22299_10004105 | 3300001989 | Bacteria | 5568 |
| 4 | JGI24737J22298_10002708 | 3300001990 | Bacteria | 6265 |
| 5 | JGI24750J21931_1000175 | 3300002070 | Bacteria | 10684 |
| 6 | JGI24748J21848_1000514 | 3300002074 | Bacteria | 4251 |
| 7 | JGI24738J21930_10001046 | 3300002075 | Bacteria | 7887 |
| 8 | JGI24749J21850_1001064 | 3300002076 | Bacteria | 3908 |
| 9 | JGI24744J21845_10000566 | 3300002077 | Bacteria | 6684 |
| 10 | JGI24034J26672_10000462 | 3300002239 | Bacteria | 5246 |
| 11 | JGI24742J22300_10000420 | 3300002244 | Bacteria | 6269 |
| 12 | JGI24751J29686_10016485 | 3300002459 | Bacteria | 1523 |
| 13 | JGI25406J46586_10000028 | 3300003203 | Bacteria | 70247 |
| 14 | JGI25404J52841_10015339 | 3300003659 | Bacteria | 1662 |
| 15 | JGI25405J52794_10009101 | 3300003911 | Bacteria | 1869 |
| 16 | Ga0065712_10029709 | 3300005290 | Bacteria | 1233 |
| 17 | Ga0065712_10113471 | 3300005290 | Bacteria | 1782 |
| 18 | Ga0065712_10135995 | 3300005290 | Bacteria | 1489 |
| 19 | Ga0065715_10037919 | 3300005293 | Bacteria | 1156 |
| 20 | Ga0065715_10137549 | 3300005293 | Bacteria | 1903 |
| 21 | Ga0070658_10101559 | 3300005327 | Bacteria | 2378 |
| 22 | Ga0070676_10006058 | 3300005328 | Bacteria | 6455 |
| 23 | Ga0070676_10024678 | 3300005328 | Bacteria | 3390 |
| 24 | Ga0070676_10088731 | 3300005328 | Bacteria | 1890 |
| 25 | Ga0070676_10131041 | 3300005328 | Bacteria | 1585 |
| 26 | Ga0070683_100000836 | 3300005329 | Bacteria | 22825 |
| 27 | Ga0070683_100011738 | 3300005329 | Bacteria | 7585 |
| 28 | Ga0070683_100067592 | 3300005329 | Bacteria | 3329 |
| 29 | Ga0070683_100075014 | 3300005329 | Bacteria | 3159 |
| 30 | Ga0070690_100000700 | 3300005330 | Bacteria | 17192 |
| 31 | Ga0070690_100063572 | 3300005330 | Bacteria | 2382 |
| 32 | Ga0070690_100171286 | 3300005330 | Bacteria | 1494 |
| 33 | Ga0070670_100006794 | 3300005331 | Bacteria | 9685 |
| 34 | Ga0070670_100031028 | 3300005331 | Bacteria | 4602 |
| 35 | Ga0070670_100046472 | 3300005331 | Bacteria | 3733 |
| 36 | Ga0070670_100086754 | 3300005331 | Bacteria | 2689 |
| 37 | Ga0070677_10000406 | 3300005333 | Bacteria | 14999 |
| 38 | Ga0070677_10002338 | 3300005333 | Bacteria | 6059 |
| 39 | Ga0070677_10028755 | 3300005333 | Bacteria | 2102 |
| 40 | Ga0070677_10036854 | 3300005333 | Bacteria | 1905 |
| 41 | Ga0070677_10037432 | 3300005333 | Bacteria | 1892 |
| 42 | Ga0068869_100000653 | 3300005334 | Bacteria | 19619 |
| 43 | Ga0068869_100106003 | 3300005334 | Bacteria | 2132 |
| 44 | Ga0070666_10005529 | 3300005335 | Bacteria | 7752 |
| 45 | Ga0070666_10031827 | 3300005335 | Bacteria | 3483 |
| 46 | Ga0070680_100005042 | 3300005336 | Bacteria | 9963 |
| 47 | Ga0070680_100043949 | 3300005336 | Bacteria | 3630 |
| 48 | Ga0070680_100069523 | 3300005336 | Bacteria | 2891 |
| 49 | Ga0070680_100073871 | 3300005336 | Bacteria | 2805 |
| 50 | Ga0070682_100005253 | 3300005337 | Bacteria | 7206 |
| 51 | Ga0070682_100020427 | 3300005337 | Bacteria | 3895 |
| 52 | Ga0070682_100090951 | 3300005337 | Bacteria | 1997 |
| 53 | Ga0068868_100005815 | 3300005338 | Bacteria | 8692 |
| 54 | Ga0068868_100010958 | 3300005338 | Bacteria | 6584 |
| 55 | Ga0068868_100097041 | 3300005338 | Bacteria | 2381 |
| 56 | Ga0068868_100114377 | 3300005338 | Bacteria | 2195 |
| 57 | Ga0070660_100023548 | 3300005339 | Bacteria | 4562 |
| 58 | Ga0070660_100214228 | 3300005339 | Bacteria | 1564 |
| 59 | Ga0070689_100010029 | 3300005340 | Bacteria | 6743 |
| 60 | Ga0070689_100045887 | 3300005340 | Bacteria | 3366 |
| 61 | Ga0070691_10004006 | 3300005341 | Bacteria | 6669 |
| 62 | Ga0070687_100000387 | 3300005343 | Bacteria | 14981 |
| 63 | Ga0070661_100001217 | 3300005344 | Bacteria | 18141 |
| 64 | Ga0070692_10003662 | 3300005345 | Bacteria | 6283 |
| 65 | Ga0070668_100019465 | 3300005347 | Bacteria | 5109 |
| 66 | Ga0070668_100093673 | 3300005347 | Bacteria | 2371 |
| 67 | Ga0070669_100009354 | 3300005353 | Bacteria | 6980 |
| 68 | Ga0070675_100021874 | 3300005354 | Bacteria | 5109 |
| 69 | Ga0070675_100125571 | 3300005354 | Bacteria | 2182 |
| 70 | Ga0070671_100005891 | 3300005355 | Bacteria | 9767 |
| 71 | Ga0070671_100020315 | 3300005355 | Bacteria | 5415 |
| 72 | Ga0070671_100031898 | 3300005355 | Bacteria | 4355 |
| 73 | Ga0070671_100172306 | 3300005355 | Bacteria | 1831 |
| 74 | Ga0070671_100202708 | 3300005355 | Bacteria | 1683 |
| 75 | Ga0070671_100288270 | 3300005355 | Bacteria | 1397 |
| 76 | Ga0070674_100001918 | 3300005356 | Bacteria | 11324 |
| 77 | Ga0070674_100003371 | 3300005356 | Bacteria | 8951 |
| 78 | Ga0070674_100011258 | 3300005356 | Bacteria | 5439 |
| 79 | Ga0070674_100074811 | 3300005356 | Bacteria | 2404 |
| 80 | Ga0070674_100358750 | 3300005356 | Bacteria | 1179 |
| 81 | Ga0070674_100374632 | 3300005356 | Bacteria | 1156 |
| 82 | Ga0070673_100001086 | 3300005364 | Bacteria | 15555 |
| 83 | Ga0070673_100122369 | 3300005364 | Bacteria | 2173 |
| 84 | Ga0070673_100262418 | 3300005364 | Bacteria | 1509 |
| 85 | Ga0070688_100034076 | 3300005365 | Bacteria | 3081 |
| 86 | Ga0070688_100054495 | 3300005365 | Bacteria | 2505 |
| 87 | Ga0070688_100097415 | 3300005365 | Bacteria | 1933 |
| 88 | Ga0070688_100154625 | 3300005365 | Bacteria | 1570 |
| 89 | Ga0070659_100006583 | 3300005366 | Bacteria | 8390 |
| 90 | Ga0070667_100002687 | 3300005367 | Bacteria | 15394 |
| 91 | Ga0070667_100122297 | 3300005367 | Bacteria | 2265 |
| 92 | Ga0070667_100139796 | 3300005367 | Bacteria | 2119 |
| 93 | Ga0070667_100327348 | 3300005367 | Bacteria | 1384 |
| 94 | Ga0070709_10001257 | 3300005434 | Bacteria | 13866 |
| 95 | Ga0070709_10006522 | 3300005434 | Bacteria | 6362 |
| 96 | Ga0070709_10009430 | 3300005434 | Bacteria | 5386 |
| 97 | Ga0070714_100141720 | 3300005435 | Bacteria | 2159 |
| 98 | Ga0070714_100175934 | 3300005435 | Bacteria | 1945 |
| 99 | Ga0070713_100000374 | 3300005436 | Bacteria | 28680 |
| 100 | Ga0070713_100020428 | 3300005436 | Bacteria | 5078 |
| 101 | Ga0070713_100028156 | 3300005436 | Bacteria | 4434 |
| 102 | Ga0070710_10091766 | 3300005437 | Bacteria | 1793 |
| 103 | Ga0070701_10002820 | 3300005438 | Bacteria | 6767 |
| 104 | Ga0070701_10099733 | 3300005438 | Bacteria | 1607 |
| 105 | Ga0070701_10141958 | 3300005438 | Unclassified | 1374 |
| 106 | Ga0070711_100023758 | 3300005439 | Bacteria | 3991 |
| 107 | Ga0070711_100033722 | 3300005439 | Bacteria | 3410 |
| 108 | Ga0070711_100035137 | 3300005439 | Bacteria | 3348 |
| 109 | Ga0070711_100221046 | 3300005439 | Bacteria | 1472 |
| 110 | Ga0070705_100001711 | 3300005440 | Bacteria | 11431 |
| 111 | Ga0070705_100158085 | 3300005440 | Bacteria | 1512 |
| 112 | Ga0070700_100016369 | 3300005441 | Bacteria | 4223 |
| 113 | Ga0070694_100007442 | 3300005444 | Bacteria | 6676 |
| 114 | Ga0070708_100104737 | 3300005445 | Bacteria | 2594 |
| 115 | Ga0070708_100209862 | 3300005445 | Bacteria | 1825 |
| 116 | Ga0070663_100021845 | 3300005455 | Bacteria | 4264 |
| 117 | Ga0070663_100025326 | 3300005455 | Bacteria | 4004 |
| 118 | Ga0070663_100064000 | 3300005455 | Bacteria | 2657 |
| 119 | Ga0070663_100093309 | 3300005455 | Bacteria | 2233 |
| 120 | Ga0070678_100001680 | 3300005456 | Bacteria | 11863 |
| 121 | Ga0070678_100028582 | 3300005456 | Bacteria | 3805 |
| 122 | Ga0070678_100031777 | 3300005456 | Bacteria | 3647 |
| 123 | Ga0070678_100056209 | 3300005456 | Bacteria | 2877 |
| 124 | Ga0070678_100061286 | 3300005456 | Bacteria | 2772 |
| 125 | Ga0070678_100089587 | 3300005456 | Bacteria | 2355 |
| 126 | Ga0070678_100139062 | 3300005456 | Bacteria | 1940 |
| 127 | Ga0070662_100009816 | 3300005457 | Bacteria | 6271 |
| 128 | Ga0070662_100012878 | 3300005457 | Bacteria | 5557 |
| 129 | Ga0070662_100176492 | 3300005457 | Bacteria | 1682 |
| 130 | Ga0070662_100178517 | 3300005457 | Bacteria | 1672 |
| 131 | Ga0070681_10015832 | 3300005458 | Bacteria | 7517 |
| 132 | Ga0070681_10050414 | 3300005458 | Bacteria | 4153 |
| 133 | Ga0070681_10061500 | 3300005458 | Bacteria | 3729 |
| 134 | Ga0070681_10220683 | 3300005458 | Bacteria | 1811 |
| 135 | Ga0070681_10325796 | 3300005458 | Bacteria | 1446 |
| 136 | Ga0068867_100000874 | 3300005459 | Bacteria | 20341 |
| 137 | Ga0068867_100031810 | 3300005459 | Bacteria | 3812 |
| 138 | Ga0068867_100050648 | 3300005459 | Bacteria | 3062 |
| 139 | Ga0070685_10003079 | 3300005466 | Bacteria | 8488 |
| 140 | Ga0070685_10246411 | 3300005466 | Bacteria | 1182 |
| 141 | Ga0070707_100099390 | 3300005468 | Bacteria | 2819 |
| 142 | Ga0070679_100040768 | 3300005530 | Bacteria | 4619 |
| 143 | Ga0070679_100151164 | 3300005530 | Bacteria | 2298 |
| 144 | Ga0070679_100210850 | 3300005530 | Bacteria | 1906 |
| 145 | Ga0070684_100004467 | 3300005535 | Bacteria | 10651 |
| 146 | Ga0070684_100016286 | 3300005535 | Bacteria | 6074 |
| 147 | Ga0070684_100171967 | 3300005535 | Bacteria | 1968 |
| 148 | Ga0070697_100002564 | 3300005536 | Bacteria | 13978 |
| 149 | Ga0068853_100003110 | 3300005539 | Bacteria | 12691 |
| 150 | Ga0068853_100069092 | 3300005539 | Bacteria | 3072 |
| 151 | Ga0068853_100093456 | 3300005539 | Bacteria | 2648 |
| 152 | Ga0068853_100098738 | 3300005539 | Bacteria | 2579 |
| 153 | Ga0068853_100175699 | 3300005539 | Bacteria | 1940 |
| 154 | Ga0068853_100253732 | 3300005539 | Bacteria | 1615 |
| 155 | Ga0068853_100330674 | 3300005539 | Bacteria | 1414 |
| 156 | Ga0070672_100005379 | 3300005543 | Bacteria | 8483 |
| 157 | Ga0070672_100005531 | 3300005543 | Bacteria | 8389 |
| 158 | Ga0070672_100053092 | 3300005543 | Bacteria | 3167 |
| 159 | Ga0070672_100131220 | 3300005543 | Bacteria | 2059 |
| 160 | Ga0070672_100262842 | 3300005543 | Bacteria | 1456 |
| 161 | Ga0070686_100004079 | 3300005544 | Bacteria | 8032 |
| 162 | Ga0070695_100012339 | 3300005545 | Bacteria | 5123 |
| 163 | Ga0070695_100026443 | 3300005545 | Bacteria | 3590 |
| 164 | Ga0070695_100135344 | 3300005545 | Bacteria | 1703 |
| 165 | Ga0070696_100008243 | 3300005546 | Bacteria | 6975 |
| 166 | Ga0070696_100039848 | 3300005546 | Bacteria | 3244 |
| 167 | Ga0070693_100072635 | 3300005547 | Bacteria | 2030 |
| 168 | Ga0070693_100168400 | 3300005547 | Bacteria | 1401 |
| 169 | Ga0070665_100023550 | 3300005548 | Bacteria | 6200 |
| 170 | Ga0070665_100203213 | 3300005548 | Bacteria | 1982 |
| 171 | Ga0070665_100234436 | 3300005548 | Bacteria | 1836 |
| 172 | Ga0070665_100350418 | 3300005548 | Bacteria | 1482 |
| 173 | Ga0070704_100065568 | 3300005549 | Bacteria | 2615 |
| 174 | Ga0068855_100072645 | 3300005563 | Bacteria | 3998 |
| 175 | Ga0068855_100082241 | 3300005563 | Bacteria | 3732 |
| 176 | Ga0068855_100098486 | 3300005563 | Bacteria | 3368 |
| 177 | Ga0068855_100108293 | 3300005563 | Bacteria | 3192 |
| 178 | Ga0068855_100235299 | 3300005563 | Bacteria | 2049 |
| 179 | Ga0070664_100027792 | 3300005564 | Bacteria | 4703 |
| 180 | Ga0068857_100025732 | 3300005577 | Bacteria | 5181 |
| 181 | Ga0068857_100069181 | 3300005577 | Bacteria | 3143 |
| 182 | Ga0068854_100002509 | 3300005578 | Bacteria | 11386 |
| 183 | Ga0068854_100106576 | 3300005578 | Bacteria | 2109 |
| 184 | Ga0068856_100007430 | 3300005614 | Bacteria | 10692 |
| 185 | Ga0068856_100061086 | 3300005614 | Bacteria | 3722 |
| 186 | Ga0068856_100085445 | 3300005614 | Bacteria | 3134 |
| 187 | Ga0068856_100119327 | 3300005614 | Bacteria | 2638 |
| 188 | Ga0070702_100003283 | 3300005615 | Bacteria | 7206 |
| 189 | Ga0068852_100006607 | 3300005616 | Bacteria | 8398 |
| 190 | Ga0068852_100093916 | 3300005616 | Bacteria | 2689 |
| 191 | Ga0068852_100366140 | 3300005616 | Bacteria | 1411 |
| 192 | Ga0068859_100038170 | 3300005617 | Bacteria | 4819 |
| 193 | Ga0068859_100069054 | 3300005617 | Bacteria | 3568 |
| 194 | Ga0068859_100122021 | 3300005617 | Bacteria | 2672 |
| 195 | Ga0068859_100276898 | 3300005617 | Bacteria | 1770 |
| 196 | Ga0068864_100001321 | 3300005618 | Bacteria | 20620 |
| 197 | Ga0068864_100087223 | 3300005618 | Bacteria | 2747 |
| 198 | Ga0068864_100099414 | 3300005618 | Bacteria | 2577 |
| 199 | Ga0068864_100195682 | 3300005618 | Bacteria | 1855 |
| 200 | Ga0068866_10002168 | 3300005718 | Bacteria | 8173 |
| 201 | Ga0068866_10037249 | 3300005718 | Bacteria | 2388 |
| 202 | Ga0068866_10096173 | 3300005718 | Bacteria | 1624 |
| 203 | Ga0068870_10000716 | 3300005840 | Bacteria | 12739 |
| 204 | Ga0068863_100000965 | 3300005841 | Bacteria | 28914 |
| 205 | Ga0068863_100107159 | 3300005841 | Bacteria | 2659 |
| 206 | Ga0068863_100120246 | 3300005841 | Bacteria | 2504 |
| 207 | Ga0068858_100003017 | 3300005842 | Bacteria | 16885 |
| 208 | Ga0068858_100064343 | 3300005842 | Bacteria | 3394 |
| 209 | Ga0068858_100065499 | 3300005842 | Bacteria | 3362 |
| 210 | Ga0068858_100222549 | 3300005842 | Bacteria | 1788 |
| 211 | Ga0068860_100000577 | 3300005843 | Bacteria | 44036 |
| 212 | Ga0068860_100014200 | 3300005843 | Bacteria | 7808 |
| 213 | Ga0068860_100041961 | 3300005843 | Bacteria | 4371 |
| 214 | Ga0068860_100276217 | 3300005843 | Bacteria | 1641 |
| 215 | Ga0068860_100304064 | 3300005843 | Bacteria | 1563 |
| 216 | Ga0068862_100003246 | 3300005844 | Bacteria | 14077 |
| 217 | Ga0068862_100019155 | 3300005844 | Bacteria | 5706 |
| 218 | Ga0068862_100234364 | 3300005844 | Bacteria | 1666 |
| 219 | Ga0081455_10000327 | 3300005937 | Bacteria | 62253 |
| 220 | Ga0081455_10003093 | 3300005937 | Bacteria | 19378 |
| 221 | Ga0081455_10006033 | 3300005937 | Bacteria | 13120 |
| 222 | Ga0081455_10011459 | 3300005937 | Bacteria | 8907 |
| 223 | Ga0081455_10053413 | 3300005937 | Bacteria | 3451 |
| 224 | Ga0081455_10103105 | 3300005937 | Bacteria | 2286 |
| 225 | Ga0081455_10158909 | 3300005937 | Bacteria | 1735 |
| 226 | Ga0081455_10215824 | 3300005937 | Bacteria | 1426 |
| 227 | Ga0081540_1000102 | 3300005983 | Bacteria | 91311 |
| 228 | Ga0081540_1001430 | 3300005983 | Bacteria | 20638 |
| 229 | Ga0081540_1003410 | 3300005983 | Bacteria | 12579 |
| 230 | Ga0081540_1003755 | 3300005983 | Bacteria | 11903 |
| 231 | Ga0081540_1009790 | 3300005983 | Bacteria | 6562 |
| 232 | Ga0081540_1014713 | 3300005983 | Bacteria | 4996 |
| 233 | Ga0081540_1017229 | 3300005983 | Bacteria | 4479 |
| 234 | Ga0081540_1063111 | 3300005983 | Bacteria | 1755 |
| 235 | Ga0081539_10000048 | 3300005985 | Bacteria | 272906 |
| 236 | Ga0081539_10058707 | 3300005985 | Bacteria | 2122 |
| 237 | Ga0081539_10072824 | 3300005985 | Bacteria | 1835 |
| 238 | Ga0070717_10007141 | 3300006028 | Bacteria | 8277 |
| 239 | Ga0070717_10010868 | 3300006028 | Bacteria | 6891 |
| 240 | Ga0070717_10013303 | 3300006028 | Bacteria | 6301 |
| 241 | Ga0070717_10059267 | 3300006028 | Bacteria | 3167 |
| 242 | Ga0075365_10018199 | 3300006038 | Bacteria | 4315 |
| 243 | Ga0075365_10099182 | 3300006038 | Bacteria | 1993 |
| 244 | Ga0075363_100008259 | 3300006048 | Bacteria | 4839 |
| 245 | Ga0075363_100023705 | 3300006048 | Bacteria | 3114 |
| 246 | Ga0075432_10000765 | 3300006058 | Bacteria | 9994 |
| 247 | Ga0070716_100006717 | 3300006173 | Bacteria | 5634 |
| 248 | Ga0070712_100024348 | 3300006175 | Bacteria | 4011 |
| 249 | Ga0070712_100106270 | 3300006175 | Bacteria | 2086 |
| 250 | Ga0075362_10045225 | 3300006177 | Bacteria | 1954 |
| 251 | Ga0075367_10039381 | 3300006178 | Bacteria | 2756 |
| 252 | Ga0075367_10045981 | 3300006178 | Bacteria | 2563 |
| 253 | Ga0075367_10048843 | 3300006178 | Bacteria | 2494 |
| 254 | Ga0075369_10026031 | 3300006186 | Bacteria | 2436 |
| 255 | Ga0075366_10002375 | 3300006195 | Bacteria | 9645 |
| 256 | Ga0097621_100034122 | 3300006237 | Bacteria | 4057 |
| 257 | Ga0075370_10026132 | 3300006353 | Bacteria | 3232 |
| 258 | Ga0068871_100001025 | 3300006358 | Bacteria | 18716 |
| 259 | Ga0068871_100005428 | 3300006358 | Bacteria | 8937 |
| 260 | Ga0068871_100027579 | 3300006358 | Bacteria | 4443 |
| 261 | Ga0068871_100073854 | 3300006358 | Bacteria | 2812 |
| 262 | Ga0068871_100195067 | 3300006358 | Bacteria | 1746 |
| 263 | Ga0068871_100292928 | 3300006358 | Bacteria | 1427 |
| 264 | Ga0075428_100020912 | 3300006844 | Bacteria | 7246 |
| 265 | Ga0075428_100131629 | 3300006844 | Bacteria | 2720 |
| 266 | Ga0075428_100135424 | 3300006844 | Bacteria | 2679 |
| 267 | Ga0075430_100000026 | 3300006846 | Bacteria | 78833 |
| 268 | Ga0075430_100000222 | 3300006846 | Bacteria | 39248 |
| 269 | Ga0075430_100012924 | 3300006846 | Bacteria | 7115 |
| 270 | Ga0075431_100000451 | 3300006847 | Bacteria | 33773 |
| 271 | Ga0075431_100032904 | 3300006847 | Bacteria | 5343 |
| 272 | Ga0075433_10002991 | 3300006852 | Bacteria | 12983 |
| 273 | Ga0075433_10016718 | 3300006852 | Bacteria | 6056 |
| 274 | Ga0075434_100000110 | 3300006871 | Bacteria | 46873 |
| 275 | Ga0075434_100001174 | 3300006871 | Bacteria | 21706 |
| 276 | Ga0075429_100000247 | 3300006880 | Bacteria | 37266 |
| 277 | Ga0075429_100009429 | 3300006880 | Bacteria | 8475 |
| 278 | Ga0075429_100030873 | 3300006880 | Bacteria | 4657 |
| 279 | Ga0068865_100005281 | 3300006881 | Bacteria | 7815 |
| 280 | Ga0068865_100013742 | 3300006881 | Bacteria | 5127 |
| 281 | Ga0068865_100103441 | 3300006881 | Bacteria | 2089 |
| 282 | Ga0075436_100004698 | 3300006914 | Bacteria | 9369 |
| 283 | Ga0075436_100089836 | 3300006914 | Bacteria | 2135 |
| 284 | Ga0097620_100038166 | 3300006931 | Bacteria | 4819 |
| 285 | Ga0097620_100069047 | 3300006931 | Bacteria | 3568 |
| 286 | Ga0097620_100122027 | 3300006931 | Bacteria | 2672 |
| 287 | Ga0097620_100276897 | 3300006931 | Bacteria | 1770 |
| 288 | Ga0075435_100016201 | 3300007076 | Bacteria | 5618 |
| 289 | Ga0075435_100110089 | 3300007076 | Bacteria | 2290 |
| 290 | Ga0075435_100266357 | 3300007076 | Bacteria | 1461 |
| 291 | Ga0099794_10015687 | 3300007265 | Bacteria | 3349 |
| 292 | Ga0105251_10077573 | 3300009011 | Bacteria | 1540 |
| 293 | Ga0105240_10121284 | 3300009093 | Bacteria | 3147 |
| 294 | Ga0111539_10000337 | 3300009094 | Bacteria | 57733 |
| 295 | Ga0111539_10014415 | 3300009094 | Bacteria | 9866 |
| 296 | Ga0111539_10150346 | 3300009094 | Bacteria | 2726 |
| 297 | Ga0105245_10000380 | 3300009098 | Bacteria | 41293 |
| 298 | Ga0105245_10060762 | 3300009098 | Bacteria | 3404 |
| 299 | Ga0105245_10070201 | 3300009098 | Bacteria | 3178 |
| 300 | Ga0105245_10111892 | 3300009098 | Bacteria | 2540 |
| 301 | Ga0105245_10114924 | 3300009098 | Bacteria | 2507 |
| 302 | Ga0105247_10001411 | 3300009101 | Bacteria | 17428 |
| 303 | Ga0105247_10006423 | 3300009101 | Bacteria | 7280 |
| 304 | Ga0105247_10016700 | 3300009101 | Bacteria | 4401 |
| 305 | Ga0105247_10025590 | 3300009101 | Bacteria | 3561 |
| 306 | Ga0105247_10048427 | 3300009101 | Bacteria | 2610 |
| 307 | Ga0105247_10062814 | 3300009101 | Bacteria | 2304 |
| 308 | Ga0114129_10053822 | 3300009147 | Bacteria | 5645 |
| 309 | Ga0114129_10097181 | 3300009147 | Bacteria | 4077 |
| 310 | Ga0114129_10229244 | 3300009147 | Bacteria | 2502 |
| 311 | Ga0114129_10652340 | 3300009147 | Bacteria | 1358 |
| 312 | Ga0105243_10008080 | 3300009148 | Bacteria | 8076 |
| 313 | Ga0105243_10031539 | 3300009148 | Bacteria | 4087 |
| 314 | Ga0105243_10230951 | 3300009148 | Bacteria | 1641 |
| 315 | Ga0105243_10283021 | 3300009148 | Bacteria | 1494 |
| 316 | Ga0105241_10027743 | 3300009174 | Bacteria | 4215 |
| 317 | Ga0105241_10128056 | 3300009174 | Bacteria | 2052 |
| 318 | Ga0105241_10159805 | 3300009174 | Bacteria | 1851 |
| 319 | Ga0105242_10000350 | 3300009176 | Bacteria | 37047 |
| 320 | Ga0105242_10035266 | 3300009176 | Bacteria | 4012 |
| 321 | Ga0105242_10078490 | 3300009176 | Bacteria | 2756 |
| 322 | Ga0105242_10131844 | 3300009176 | Bacteria | 2158 |
| 323 | Ga0105248_10013825 | 3300009177 | Bacteria | 8882 |
| 324 | Ga0105248_10015595 | 3300009177 | Bacteria | 8376 |
| 325 | Ga0105248_10019063 | 3300009177 | Bacteria | 7586 |
| 326 | Ga0105248_10037197 | 3300009177 | Bacteria | 5445 |
| 327 | Ga0105248_10080964 | 3300009177 | Bacteria | 3651 |
| 328 | Ga0105248_10145105 | 3300009177 | Bacteria | 2678 |
| 329 | Ga0105237_10066040 | 3300009545 | Bacteria | 3612 |
| 330 | Ga0105237_10173347 | 3300009545 | Bacteria | 2157 |
| 331 | Ga0105237_10182842 | 3300009545 | Bacteria | 2096 |
| 332 | Ga0105237_10202763 | 3300009545 | Bacteria | 1984 |
| 333 | Ga0105237_10383751 | 3300009545 | Bacteria | 1410 |
| 334 | Ga0105249_10007137 | 3300009553 | Bacteria | 9750 |
| 335 | Ga0105249_10122164 | 3300009553 | Bacteria | 2476 |
| 336 | Ga0105239_10017528 | 3300010375 | Bacteria | 7921 |
| 337 | Ga0105239_10114074 | 3300010375 | Bacteria | 2997 |
| 338 | Ga0105239_10311499 | 3300010375 | Bacteria | 1774 |
| 339 | Ga0105239_10348954 | 3300010375 | Bacteria | 1671 |
| 340 | Ga0105246_10002609 | 3300011119 | Bacteria | 10906 |
| 341 | Ga0105246_10148574 | 3300011119 | Bacteria | 1771 |
| 342 | Ga0157373_10045507 | 3300013100 | Bacteria | 3132 |
| 343 | Ga0157371_10135704 | 3300013102 | Bacteria | 1752 |
| 344 | Ga0157370_10322474 | 3300013104 | Bacteria | 1425 |
| 345 | Ga0157369_10095876 | 3300013105 | Bacteria | 3165 |
| 346 | Ga0157369_10174759 | 3300013105 | Bacteria | 2261 |
| 347 | Ga0157374_10032360 | 3300013296 | Bacteria | 4761 |
| 348 | Ga0157374_10053103 | 3300013296 | Bacteria | 3777 |
| 349 | Ga0157374_10054750 | 3300013296 | Bacteria | 3722 |
| 350 | Ga0157374_10062182 | 3300013296 | Bacteria | 3498 |
| 351 | Ga0157374_10065956 | 3300013296 | Bacteria | 3401 |
| 352 | Ga0157374_10099654 | 3300013296 | Bacteria | 2784 |
| 353 | Ga0157378_10043205 | 3300013297 | Bacteria | 4002 |
| 354 | Ga0157378_10107630 | 3300013297 | Bacteria | 2551 |
| 355 | Ga0157378_10254793 | 3300013297 | Bacteria | 1681 |
| 356 | Ga0163162_10010530 | 3300013306 | Bacteria | 8994 |
| 357 | Ga0163162_10068510 | 3300013306 | Bacteria | 3600 |
| 358 | Ga0163162_10095629 | 3300013306 | Bacteria | 3058 |
| 359 | Ga0163162_10420014 | 3300013306 | Bacteria | 1470 |
| 360 | Ga0157372_10009499 | 3300013307 | Bacteria | 10344 |
| 361 | Ga0157372_10084860 | 3300013307 | Bacteria | 3591 |
| 362 | Ga0157375_10002791 | 3300013308 | Bacteria | 15110 |
| 363 | Ga0157375_10022203 | 3300013308 | Bacteria | 5839 |
| 364 | Ga0157375_10113058 | 3300013308 | Bacteria | 2816 |
| 365 | Ga0157375_10246096 | 3300013308 | Bacteria | 1948 |
| 366 | Ga0157375_10316399 | 3300013308 | Bacteria | 1725 |
| 367 | Ga0157375_10346805 | 3300013308 | Bacteria | 1650 |
| 368 | Ga0163163_10016636 | 3300014325 | Bacteria | 6838 |
| 369 | Ga0163163_10043798 | 3300014325 | Bacteria | 4390 |
| 370 | Ga0163163_10054275 | 3300014325 | Bacteria | 3959 |
| 371 | Ga0163163_10100808 | 3300014325 | Bacteria | 2910 |
| 372 | Ga0163163_10166611 | 3300014325 | Bacteria | 2250 |
| 373 | Ga0163163_10170037 | 3300014325 | Bacteria | 2226 |
| 374 | Ga0163163_10276705 | 3300014325 | Bacteria | 1730 |
| 375 | Ga0157380_10009701 | 3300014326 | Bacteria | 6906 |
| 376 | Ga0157380_10100720 | 3300014326 | Bacteria | 2406 |
| 377 | Ga0157380_10121457 | 3300014326 | Bacteria | 2213 |
| 378 | Ga0157380_10131344 | 3300014326 | Bacteria | 2137 |
| 379 | Ga0157380_10145235 | 3300014326 | Bacteria | 2044 |
| 380 | Ga0157380_10270244 | 3300014326 | Bacteria | 1549 |
| 381 | Ga0157377_10000341 | 3300014745 | Bacteria | 20841 |
| 382 | Ga0157377_10059329 | 3300014745 | Bacteria | 2181 |
| 383 | Ga0157379_10106097 | 3300014968 | Bacteria | 2522 |
| 384 | Ga0157379_10287188 | 3300014968 | Bacteria | 1498 |
| 385 | Ga0157376_10000663 | 3300014969 | Bacteria | 22264 |
| 386 | Ga0157376_10040464 | 3300014969 | Bacteria | 3809 |
| 387 | Ga0157376_10141002 | 3300014969 | Bacteria | 2162 |
| 388 | Ga0157376_10187083 | 3300014969 | Bacteria | 1896 |
| 389 | Ga0157376_10424407 | 3300014969 | Bacteria | 1291 |
| 390 | Ga0163161_10000379 | 3300017792 | Bacteria | 37281 |
| 391 | Ga0163161_10264180 | 3300017792 | Bacteria | 1345 |
| 392 | Ga0207666_1000103 | 3300025271 | Bacteria | 13338 |
| 393 | Ga0209758_1002448 | 3300025297 | Bacteria | 18947 |
| 394 | Ga0209758_1008580 | 3300025297 | Bacteria | 6576 |
| 395 | Ga0207697_10001374 | 3300025315 | Bacteria | 13320 |
| 396 | Ga0207697_10055588 | 3300025315 | Bacteria | 1641 |
| 397 | Ga0207653_10008349 | 3300025885 | Bacteria | 3226 |
| 398 | Ga0207682_10000043 | 3300025893 | Bacteria | 52108 |
| 399 | Ga0207682_10001519 | 3300025893 | Bacteria | 10697 |
| 400 | Ga0207682_10001931 | 3300025893 | Bacteria | 9419 |
| 401 | Ga0207692_10003295 | 3300025898 | Bacteria | 6293 |
| 402 | Ga0207692_10006313 | 3300025898 | Bacteria | 4803 |
| 403 | Ga0207642_10007175 | 3300025899 | Bacteria | 3750 |
| 404 | Ga0207710_10008560 | 3300025900 | Bacteria | 4313 |
| 405 | Ga0207710_10049955 | 3300025900 | Bacteria | 1875 |
| 406 | Ga0207688_10000083 | 3300025901 | Bacteria | 36050 |
| 407 | Ga0207688_10004971 | 3300025901 | Bacteria | 7237 |
| 408 | Ga0207680_10006796 | 3300025903 | Bacteria | 5551 |
| 409 | Ga0207647_10003002 | 3300025904 | Bacteria | 12691 |
| 410 | Ga0207685_10000528 | 3300025905 | Bacteria | 6575 |
| 411 | Ga0207685_10000914 | 3300025905 | Bacteria | 5631 |
| 412 | Ga0207699_10006599 | 3300025906 | Bacteria | 5632 |
| 413 | Ga0207699_10010546 | 3300025906 | Bacteria | 4642 |
| 414 | Ga0207699_10045368 | 3300025906 | Bacteria | 2565 |
| 415 | Ga0207645_10000899 | 3300025907 | Bacteria | 24667 |
| 416 | Ga0207645_10014247 | 3300025907 | Bacteria | 5326 |
| 417 | Ga0207645_10070342 | 3300025907 | Bacteria | 2238 |
| 418 | Ga0207643_10000128 | 3300025908 | Bacteria | 51191 |
| 419 | Ga0207643_10038664 | 3300025908 | Bacteria | 2681 |
| 420 | Ga0207643_10140506 | 3300025908 | Bacteria | 1442 |
| 421 | Ga0207684_10204578 | 3300025910 | Bacteria | 1703 |
| 422 | Ga0207654_10005950 | 3300025911 | Bacteria | 6140 |
| 423 | Ga0207707_10001534 | 3300025912 | Bacteria | 21320 |
| 424 | Ga0207707_10004166 | 3300025912 | Bacteria | 12809 |
| 425 | Ga0207707_10055634 | 3300025912 | Bacteria | 3441 |
| 426 | Ga0207707_10345496 | 3300025912 | Bacteria | 1282 |
| 427 | Ga0207695_10089205 | 3300025913 | Bacteria | 3101 |
| 428 | Ga0207695_10247016 | 3300025913 | Bacteria | 1684 |
| 429 | Ga0207671_10057611 | 3300025914 | Bacteria | 2880 |
| 430 | Ga0207671_10073915 | 3300025914 | Bacteria | 2547 |
| 431 | Ga0207671_10113763 | 3300025914 | Bacteria | 2062 |
| 432 | Ga0207671_10156329 | 3300025914 | Bacteria | 1764 |
| 433 | Ga0207671_10192162 | 3300025914 | Bacteria | 1592 |
| 434 | Ga0207693_10003105 | 3300025915 | Bacteria | 14304 |
| 435 | Ga0207693_10117568 | 3300025915 | Bacteria | 2087 |
| 436 | Ga0207693_10156925 | 3300025915 | Bacteria | 1790 |
| 437 | Ga0207663_10003674 | 3300025916 | Bacteria | 7543 |
| 438 | Ga0207663_10009887 | 3300025916 | Bacteria | 5051 |
| 439 | Ga0207663_10027621 | 3300025916 | Bacteria | 3311 |
| 440 | Ga0207660_10023127 | 3300025917 | Bacteria | 4194 |
| 441 | Ga0207660_10044159 | 3300025917 | Bacteria | 3135 |
| 442 | Ga0207660_10049075 | 3300025917 | Bacteria | 2990 |
| 443 | Ga0207662_10000975 | 3300025918 | Bacteria | 13319 |
| 444 | Ga0207662_10231736 | 3300025918 | Bacteria | 1206 |
| 445 | Ga0207657_10020169 | 3300025919 | Bacteria | 6307 |
| 446 | Ga0207649_10002321 | 3300025920 | Bacteria | 10689 |
| 447 | Ga0207652_10005425 | 3300025921 | Bacteria | 10348 |
| 448 | Ga0207652_10013947 | 3300025921 | Bacteria | 6506 |
| 449 | Ga0207652_10024211 | 3300025921 | Bacteria | 5035 |
| 450 | Ga0207652_10027543 | 3300025921 | Bacteria | 4736 |
| 451 | Ga0207652_10056338 | 3300025921 | Bacteria | 3384 |
| 452 | Ga0207646_10220450 | 3300025922 | Bacteria | 1714 |
| 453 | Ga0207681_10006781 | 3300025923 | Bacteria | 7022 |
| 454 | Ga0207681_10188193 | 3300025923 | Bacteria | 1577 |
| 455 | Ga0207694_10032282 | 3300025924 | Bacteria | 4006 |
| 456 | Ga0207650_10008902 | 3300025925 | Bacteria | 6860 |
| 457 | Ga0207650_10123258 | 3300025925 | Bacteria | 2020 |
| 458 | Ga0207659_10007188 | 3300025926 | Bacteria | 6838 |
| 459 | Ga0207659_10050993 | 3300025926 | Bacteria | 2941 |
| 460 | Ga0207687_10000522 | 3300025927 | Bacteria | 25753 |
| 461 | Ga0207687_10062204 | 3300025927 | Bacteria | 2639 |
| 462 | Ga0207687_10150080 | 3300025927 | Bacteria | 1777 |
| 463 | Ga0207700_10004890 | 3300025928 | Bacteria | 7962 |
| 464 | Ga0207700_10024078 | 3300025928 | Bacteria | 4208 |
| 465 | Ga0207700_10025747 | 3300025928 | Bacteria | 4091 |
| 466 | Ga0207700_10149321 | 3300025928 | Bacteria | 1930 |
| 467 | Ga0207664_10010948 | 3300025929 | Bacteria | 6424 |
| 468 | Ga0207644_10000611 | 3300025931 | Bacteria | 22735 |
| 469 | Ga0207644_10006011 | 3300025931 | Bacteria | 7913 |
| 470 | Ga0207644_10075011 | 3300025931 | Bacteria | 2484 |
| 471 | Ga0207690_10003223 | 3300025932 | Bacteria | 9794 |
| 472 | Ga0207706_10001616 | 3300025933 | Bacteria | 22352 |
| 473 | Ga0207706_10015033 | 3300025933 | Bacteria | 7006 |
| 474 | Ga0207686_10014769 | 3300025934 | Bacteria | 4357 |
| 475 | Ga0207686_10056767 | 3300025934 | Bacteria | 2462 |
| 476 | Ga0207709_10009743 | 3300025935 | Bacteria | 5295 |
| 477 | Ga0207709_10026097 | 3300025935 | Bacteria | 3353 |
| 478 | Ga0207709_10248435 | 3300025935 | Bacteria | 1298 |
| 479 | Ga0207709_10262109 | 3300025935 | Bacteria | 1268 |
| 480 | Ga0207670_10000631 | 3300025936 | Bacteria | 18876 |
| 481 | Ga0207670_10007366 | 3300025936 | Bacteria | 6135 |
| 482 | Ga0207669_10000797 | 3300025937 | Bacteria | 13482 |
| 483 | Ga0207669_10002598 | 3300025937 | Bacteria | 7722 |
| 484 | Ga0207669_10290147 | 3300025937 | Bacteria | 1238 |
| 485 | Ga0207704_10047461 | 3300025938 | Bacteria | 2567 |
| 486 | Ga0207704_10292194 | 3300025938 | Bacteria | 1244 |
| 487 | Ga0207665_10001379 | 3300025939 | Bacteria | 16369 |
| 488 | Ga0207665_10009568 | 3300025939 | Bacteria | 6365 |
| 489 | Ga0207665_10092666 | 3300025939 | Bacteria | 2097 |
| 490 | Ga0207691_10000599 | 3300025940 | Bacteria | 35997 |
| 491 | Ga0207691_10002935 | 3300025940 | Bacteria | 16639 |
| 492 | Ga0207691_10019716 | 3300025940 | Bacteria | 6378 |
| 493 | Ga0207691_10023830 | 3300025940 | Bacteria | 5760 |
| 494 | Ga0207691_10173454 | 3300025940 | Bacteria | 1887 |
| 495 | Ga0207711_10008296 | 3300025941 | Bacteria | 8696 |
| 496 | Ga0207711_10010676 | 3300025941 | Bacteria | 7637 |
| 497 | Ga0207711_10052202 | 3300025941 | Bacteria | 3503 |
| 498 | Ga0207711_10077904 | 3300025941 | Bacteria | 2890 |
| 499 | Ga0207711_10235281 | 3300025941 | Bacteria | 1679 |
| 500 | Ga0207689_10000165 | 3300025942 | Bacteria | 57494 |
| 501 | Ga0207689_10054251 | 3300025942 | Bacteria | 3302 |
| 502 | Ga0207689_10126494 | 3300025942 | Bacteria | 2102 |
| 503 | Ga0207689_10181700 | 3300025942 | Bacteria | 1734 |
| 504 | Ga0207689_10266925 | 3300025942 | Bacteria | 1416 |
| 505 | Ga0207689_10320271 | 3300025942 | Bacteria | 1287 |
| 506 | Ga0207661_10004909 | 3300025944 | Bacteria | 9371 |
| 507 | Ga0207661_10011748 | 3300025944 | Bacteria | 6356 |
| 508 | Ga0207661_10047173 | 3300025944 | Bacteria | 3419 |
| 509 | Ga0207679_10000112 | 3300025945 | Bacteria | 65716 |
| 510 | Ga0207667_10025956 | 3300025949 | Bacteria | 6408 |
| 511 | Ga0207667_10203956 | 3300025949 | Bacteria | 2028 |
| 512 | Ga0207667_10214557 | 3300025949 | Bacteria | 1972 |
| 513 | Ga0207667_10313675 | 3300025949 | Bacteria | 1602 |
| 514 | Ga0207651_10000099 | 3300025960 | Bacteria | 38059 |
| 515 | Ga0207651_10031165 | 3300025960 | Bacteria | 3405 |
| 516 | Ga0207712_10001957 | 3300025961 | Bacteria | 13516 |
| 517 | Ga0207668_10003391 | 3300025972 | Bacteria | 9338 |
| 518 | Ga0207668_10110071 | 3300025972 | Bacteria | 2065 |
| 519 | Ga0207668_10113802 | 3300025972 | Bacteria | 2035 |
| 520 | Ga0207668_10115342 | 3300025972 | Bacteria | 2023 |
| 521 | Ga0207668_10126611 | 3300025972 | Bacteria | 1943 |
| 522 | Ga0207668_10204806 | 3300025972 | Bacteria | 1574 |
| 523 | Ga0207668_10226629 | 3300025972 | Bacteria | 1504 |
| 524 | Ga0207640_10000382 | 3300025981 | Bacteria | 28458 |
| 525 | Ga0207658_10035295 | 3300025986 | Bacteria | 3580 |
| 526 | Ga0207658_10276669 | 3300025986 | Bacteria | 1437 |
| 527 | Ga0207677_10005315 | 3300026023 | Bacteria | 6981 |
| 528 | Ga0207677_10010700 | 3300026023 | Bacteria | 5199 |
| 529 | Ga0207677_10133847 | 3300026023 | Bacteria | 1887 |
| 530 | Ga0207677_10174836 | 3300026023 | Bacteria | 1683 |
| 531 | Ga0207677_10189017 | 3300026023 | Bacteria | 1627 |
| 532 | Ga0207703_10004258 | 3300026035 | Bacteria | 11776 |
| 533 | Ga0207703_10025231 | 3300026035 | Bacteria | 4675 |
| 534 | Ga0207639_10032542 | 3300026041 | Bacteria | 3839 |
| 535 | Ga0207639_10042404 | 3300026041 | Bacteria | 3410 |
| 536 | Ga0207639_10205900 | 3300026041 | Bacteria | 1690 |
| 537 | Ga0207639_10208433 | 3300026041 | Bacteria | 1681 |
| 538 | Ga0207639_10269595 | 3300026041 | Bacteria | 1493 |
| 539 | Ga0207639_10285271 | 3300026041 | Bacteria | 1454 |
| 540 | Ga0207678_10003272 | 3300026067 | Bacteria | 14619 |
| 541 | Ga0207678_10007002 | 3300026067 | Bacteria | 10009 |
| 542 | Ga0207678_10031527 | 3300026067 | Bacteria | 4624 |
| 543 | Ga0207678_10056323 | 3300026067 | Bacteria | 3384 |
| 544 | Ga0207678_10299181 | 3300026067 | Bacteria | 1382 |
| 545 | Ga0207708_10012755 | 3300026075 | Bacteria | 6267 |
| 546 | Ga0207708_10148868 | 3300026075 | Bacteria | 1841 |
| 547 | Ga0207708_10397502 | 3300026075 | Bacteria | 1139 |
| 548 | Ga0207702_10093858 | 3300026078 | Bacteria | 2633 |
| 549 | Ga0207702_10142451 | 3300026078 | Bacteria | 2171 |
| 550 | Ga0207641_10001777 | 3300026088 | Bacteria | 20763 |
| 551 | Ga0207648_10007480 | 3300026089 | Bacteria | 10733 |
| 552 | Ga0207648_10031836 | 3300026089 | Bacteria | 4661 |
| 553 | Ga0207648_10047840 | 3300026089 | Bacteria | 3747 |
| 554 | Ga0207676_10000494 | 3300026095 | Bacteria | 33145 |
| 555 | Ga0207676_10014703 | 3300026095 | Bacteria | 5637 |
| 556 | Ga0207676_10123689 | 3300026095 | Bacteria | 2186 |
| 557 | Ga0207674_10020449 | 3300026116 | Bacteria | 7152 |
| 558 | Ga0207674_10035721 | 3300026116 | Bacteria | 5186 |
| 559 | Ga0207674_10082755 | 3300026116 | Bacteria | 3210 |
| 560 | Ga0207674_10099104 | 3300026116 | Bacteria | 2897 |
| 561 | Ga0207674_10102256 | 3300026116 | Bacteria | 2846 |
| 562 | Ga0207675_100003533 | 3300026118 | Bacteria | 15253 |
| 563 | Ga0207675_100301176 | 3300026118 | Bacteria | 1561 |
| 564 | Ga0207683_10001272 | 3300026121 | Bacteria | 22830 |
| 565 | Ga0207683_10001853 | 3300026121 | Bacteria | 18701 |
| 566 | Ga0207683_10007911 | 3300026121 | Bacteria | 9095 |
| 567 | Ga0207683_10011627 | 3300026121 | Bacteria | 7513 |
| 568 | Ga0207683_10014162 | 3300026121 | Bacteria | 6795 |
| 569 | Ga0207683_10015318 | 3300026121 | Bacteria | 6529 |
| 570 | Ga0207683_10027632 | 3300026121 | Bacteria | 4902 |
| 571 | Ga0207683_10042796 | 3300026121 | Bacteria | 3956 |
| 572 | Ga0207683_10185536 | 3300026121 | Bacteria | 1887 |
| 573 | Ga0207683_10194398 | 3300026121 | Bacteria | 1843 |
| 574 | Ga0207698_10063441 | 3300026142 | Bacteria | 2891 |
| 575 | Ga0207698_10070195 | 3300026142 | Bacteria | 2774 |
| 576 | Ga0210002_1001992 | 3300027617 | Bacteria | 2937 |
| 577 | Ga0209998_10001588 | 3300027717 | Bacteria | 5462 |
| 578 | Ga0209813_10016915 | 3300027866 | Bacteria | 1997 |
| 579 | Ga0209974_10032320 | 3300027876 | Bacteria | 1734 |
| 580 | Ga0207428_10000064 | 3300027907 | Bacteria | 151185 |
| 581 | Ga0207428_10000140 | 3300027907 | Bacteria | 97818 |
| 582 | Ga0268266_10004422 | 3300028379 | Bacteria | 13462 |
| 583 | Ga0268266_10007719 | 3300028379 | Bacteria | 9656 |
| 584 | Ga0268266_10025484 | 3300028379 | Bacteria | 5032 |
| 585 | Ga0268266_10047939 | 3300028379 | Bacteria | 3661 |
| 586 | Ga0268266_10055302 | 3300028379 | Bacteria | 3412 |
| 587 | Ga0268266_10110471 | 3300028379 | Bacteria | 2435 |
| 588 | Ga0268266_10127814 | 3300028379 | Bacteria | 2270 |
| 589 | Ga0268266_10195528 | 3300028379 | Bacteria | 1848 |
| 590 | Ga0268266_10318353 | 3300028379 | Bacteria | 1455 |
| 591 | Ga0268266_10365962 | 3300028379 | Bacteria | 1357 |
| 592 | Ga0268266_10418333 | 3300028379 | Bacteria | 1270 |
| 593 | Ga0268265_10011223 | 3300028380 | Bacteria | 6056 |
| 594 | Ga0268265_10026351 | 3300028380 | Bacteria | 4135 |
| 595 | Ga0268265_10113231 | 3300028380 | Bacteria | 2219 |
| 596 | Ga0268265_10205865 | 3300028380 | Bacteria | 1710 |
| 597 | Ga0268264_10000107 | 3300028381 | Bacteria | 209105 |
| 598 | Ga0268264_10005082 | 3300028381 | Bacteria | 11144 |
| 599 | Ga0268264_10086725 | 3300028381 | Bacteria | 2690 |
| 600 | Ga0268264_10104967 | 3300028381 | Bacteria | 2464 |
| 601 | Ga0265334_10015125 | 3300028573 | Bacteria | 3210 |
| 602 | Ga0307515_10060988 | 3300028794 | Bacteria | 5363 |
| 603 | Ga0265332_10050236 | 3300031238 | Bacteria | 1792 |
| 604 | Ga0265328_10058289 | 3300031239 | Bacteria | 1418 |
| 605 | Ga0265325_10000006 | 3300031241 | Bacteria | 255758 |
| 606 | Ga0265325_10075637 | 3300031241 | Bacteria | 1681 |
| 607 | Ga0265329_10012070 | 3300031242 | Bacteria | 3119 |
| 608 | Ga0265340_10014381 | 3300031247 | Bacteria | 4134 |
| 609 | Ga0265339_10006887 | 3300031249 | Bacteria | 7407 |
| 610 | Ga0265331_10034717 | 3300031250 | Bacteria | 2485 |
| 611 | Ga0265316_10221091 | 3300031344 | Bacteria | 1397 |
| 612 | Ga0307513_10077502 | 3300031456 | Bacteria | 3442 |
| 613 | Ga0307513_10144650 | 3300031456 | Bacteria | 2298 |
| 614 | Ga0307509_10021381 | 3300031507 | Bacteria | 7315 |
| 615 | Ga0265313_10023271 | 3300031595 | Bacteria | 3341 |
| 616 | Ga0307508_10000154 | 3300031616 | Bacteria | 82824 |
| 617 | Ga0307508_10265459 | 3300031616 | Bacteria | 1311 |
| 618 | Ga0265314_10005615 | 3300031711 | Bacteria | 11266 |
| 619 | Ga0265342_10003968 | 3300031712 | Bacteria | 11854 |
| 620 | Ga0265342_10017314 | 3300031712 | Bacteria | 4691 |
| 621 | Ga0265342_10102272 | 3300031712 | Bacteria | 1630 |
| 622 | Ga0265342_10106101 | 3300031712 | Bacteria | 1595 |
| 623 | Ga0307516_10029059 | 3300031730 | Bacteria | 5590 |
| 624 | Ga0307410_10174005 | 3300031852 | Bacteria | 1625 |
| 625 | Ga0307416_100063443 | 3300032002 | Bacteria | 3026 |
| 626 | Ga0307510_10156282 | 3300033180 | Bacteria | 1887 |
| 627 | Ga0315911_1000008 | 3300033442 | Bacteria | 381285 |
| 628 | Ga0373930_0001231 | 3300034816 | Bacteria | 3781 |
| 629 | Ga0373958_0010245 | 3300034819 | Bacteria | 1560 |
| 630 | Ga0373959_0002918 | 3300034820 | Bacteria | 2713 |
| 631 | Ga0373938_0015719 | 3300034957 | Bacteria | 1470 |
| 632 | Ga0373928_0022088 | 3300035084 | Bacteria | 1347 |
| 633 | Ga0373929_0017606 | 3300035085 | Bacteria | 1412 |
| 634 | Ga0373934_0023900 | 3300035086 | Bacteria | 2363 |
| 635 | Ga0373940_0004788 | 3300035088 | Bacteria | 2885 |
| 636 | Ga0373952_0000859 | 3300035092 | Bacteria | 5518 |
| 637 | Ga0373952_0004422 | 3300035092 | Bacteria | 2550 |
| 638 | Ga0373923_0040479 | 3300035111 | Bacteria | 1918 |
| 639 | Ga0373923_0051674 | 3300035111 | Bacteria | 1725 |
| 640 | Ga0373923_0119338 | 3300035111 | Bacteria | 1177 |
| 641 | Ga0373936_0006063 | 3300035113 | Bacteria | 4555 |
| 642 | Ga0373941_0000494 | 3300035115 | Bacteria | 7908 |
| 643 | Ga0373941_0005534 | 3300035115 | Bacteria | 2978 |
| 644 | Ga0373941_0007844 | 3300035115 | Bacteria | 2630 |
| 645 | Ga0373953_0001092 | 3300035117 | Bacteria | 7676 |
| 646 | Ga0373953_0004155 | 3300035117 | Bacteria | 4592 |
| 647 | Ga0373953_0019195 | 3300035117 | Bacteria | 2541 |
| 648 | Ga0373954_0001821 | 3300035118 | Bacteria | 8793 |
| 649 | Ga0373954_0046149 | 3300035118 | Bacteria | 2036 |
| 650 | Ga0373956_0002051 | 3300035119 | Bacteria | 8345 |
| 651 | Ga0373956_0002956 | 3300035119 | Bacteria | 6879 |
| 652 | Ga0373957_0000374 | 3300035120 | Bacteria | 11335 |
| 653 | Ga0373960_0000398 | 3300035121 | Bacteria | 8493 |
| 654 | Ga0373960_0040243 | 3300035121 | Bacteria | 1348 |
| 655 | Ga0373943_0005372 | 3300035170 | Bacteria | 5763 |
| 656 | Ga0373943_0052716 | 3300035170 | Bacteria | 2006 |
| 657 | Ga0373943_0162967 | 3300035170 | Bacteria | 1215 |
| 658 | Ga0373946_0027757 | 3300035171 | Bacteria | 2241 |
| 659 | Ga0373946_0137298 | 3300035171 | Bacteria | 1130 |
| 660 | Ga0373955_0009267 | 3300035172 | Bacteria | 4609 |
| 661 | Ga0373955_0009372 | 3300035172 | Bacteria | 4582 |
| 662 | Ga0373955_0011740 | 3300035172 | Bacteria | 4187 |
| 663 | Ga0373955_0046015 | 3300035172 | Bacteria | 2357 |
| 664 | Ga0373962_0003525 | 3300035242 | Bacteria | 3760 |
| 665 | Ga0373962_0022368 | 3300035242 | Bacteria | 1676 |
| 666 | Ga0373924_0020683 | 3300035410 | Bacteria | 2560 |
| 667 | Ga0373931_0001718 | 3300035691 | Bacteria | 9499 |
| 668 | Ga0373931_0014040 | 3300035691 | Bacteria | 3908 |
| 669 | Ga0373931_0019150 | 3300035691 | Bacteria | 3412 |
| 670 | Ga0373931_0034618 | 3300035691 | Bacteria | 2622 |
| 671 | Ga0373935_0006022 | 3300035692 | Bacteria | 7205 |
| 672 | Ga0373935_0083521 | 3300035692 | Bacteria | 2079 |
| 673 | Ga0373935_0107474 | 3300035692 | Bacteria | 1847 |
| 674 | Ga0373935_0206185 | 3300035692 | Bacteria | 1361 |
| 675 | Ga0373927_0025352 | 3300035695 | Bacteria | 3876 |
| 676 | Ga0373927_0042636 | 3300035695 | Bacteria | 2940 |
| 677 | Ga0373927_0153904 | 3300035695 | Bacteria | 1505 |
| 678 | Ga0373933_0001100 | 3300035724 | Bacteria | 16117 |
| 679 | Ga0373933_0045156 | 3300035724 | Bacteria | 2612 |
| 680 | Ga0373947_0000340 | 3300035725 | Bacteria | 26369 |
| 681 | Ga0373947_0035595 | 3300035725 | Bacteria | 2948 |
| 682 | Ga0373947_0064359 | 3300035725 | Bacteria | 2236 |
| 683 | Ga0373947_0088961 | 3300035725 | Bacteria | 1923 |
| 684 | Ga0373947_0170331 | 3300035725 | Bacteria | 1412 |
| 685 | Ga0373937_0001302 | 3300036401 | Bacteria | 20904 |
| 686 | Ga0373937_0002947 | 3300036401 | Bacteria | 14245 |
| 687 | Ga0373937_0005103 | 3300036401 | Bacteria | 11187 |
| 688 | Ga0373937_0017774 | 3300036401 | Bacteria | 6344 |
| 689 | Ga0373937_0064217 | 3300036401 | Bacteria | 3377 |
| 690 | Ga0373937_0318829 | 3300036401 | Bacteria | 1470 |
| 691 | Ga0373925_0007663 | 3300037068 | Bacteria | 7864 |
| 692 | Ga0373925_0008452 | 3300037068 | Bacteria | 7500 |
| 693 | Ga0373925_0020271 | 3300037068 | Bacteria | 4838 |
| 694 | Ga0373925_0052361 | 3300037068 | Bacteria | 3050 |
| 695 | Ga0436364_1064018 | 3300037853 | Bacteria | 2560 |
| 696 | Ga0395901_0784501 | 3300038443 | Bacteria | 943 |
| 697 | Ga0436365_0702073 | 3300039437 | Bacteria | 1769 |
| 698 | Ga0439453_0000060 | 3300041408 | Bacteria | 7820 |
| 699 | Ga0451807_0668963 | 3300041486 | Bacteria | 1500 |
| 700 | Ga0439435_0002105 | 3300042436 | Bacteria | 3870 |
| 701 | Ga0466957_0033043 | 3300044842 | Bacteria | 3102 |
| 702 | Ga0466958_0114579 | 3300045836 | Bacteria | 1684 |
| 703 | Ga0466967_0122303 | 3300045976 | Bacteria | 2407 |
| 704 | Ga0495592_0001601 | 3300046454 | Bacteria | 15847 |
| 705 | Ga0495592_0005759 | 3300046454 | Bacteria | 9175 |
| 706 | Ga0495603_0019964 | 3300046455 | Bacteria | 4059 |
| 707 | Ga0495603_0022944 | 3300046455 | Bacteria | 3777 |
| 708 | Ga0495603_0025589 | 3300046455 | Bacteria | 3569 |
| 709 | Ga0495603_0053963 | 3300046455 | Bacteria | 2384 |
| 710 | Ga0495603_0099568 | 3300046455 | Bacteria | 1697 |
| 711 | Ga0495629_0000529 | 3300046459 | Bacteria | 31881 |
| 712 | Ga0495629_0008986 | 3300046459 | Bacteria | 7333 |
| 713 | Ga0495629_0046527 | 3300046459 | Bacteria | 3043 |
| 714 | Ga0495629_0059688 | 3300046459 | Bacteria | 2666 |
| 715 | Ga0495629_0172112 | 3300046459 | Bacteria | 1502 |
| 716 | Ga0495638_0009159 | 3300046460 | Bacteria | 6963 |
| 717 | Ga0495638_0011077 | 3300046460 | Bacteria | 6233 |
| 718 | Ga0495651_0001433 | 3300046462 | Bacteria | 18463 |
| 719 | Ga0495651_0020115 | 3300046462 | Bacteria | 5181 |
| 720 | Ga0495651_0195766 | 3300046462 | Bacteria | 1419 |
| 721 | Ga0495651_0260327 | 3300046462 | Bacteria | 1180 |
| 722 | Ga0495653_0016031 | 3300046463 | Bacteria | 6107 |
| 723 | Ga0495653_0051871 | 3300046463 | Bacteria | 3146 |
| 724 | Ga0495653_0089488 | 3300046463 | Bacteria | 2255 |
| 725 | Ga0495653_0090070 | 3300046463 | Bacteria | 2246 |
| 726 | Ga0495653_0160841 | 3300046463 | Bacteria | 1559 |
| 727 | Ga0495582_0006293 | 3300046473 | Bacteria | 6611 |
| 728 | Ga0495605_0058205 | 3300046474 | Bacteria | 1858 |
| 729 | Ga0495605_0126410 | 3300046474 | Bacteria | 1156 |
| 730 | Ga0495639_0009690 | 3300046475 | Bacteria | 4134 |
| 731 | Ga0495639_0034011 | 3300046475 | Bacteria | 2278 |
| 732 | Ga0495639_0066427 | 3300046475 | Bacteria | 1660 |
| 733 | Ga0495664_0018790 | 3300046477 | Bacteria | 3966 |
| 734 | Ga0495664_0023312 | 3300046477 | Bacteria | 3592 |
| 735 | Ga0495664_0029806 | 3300046477 | Bacteria | 3194 |
| 736 | Ga0495664_0037955 | 3300046477 | Bacteria | 2843 |
| 737 | Ga0495584_0120905 | 3300046491 | Bacteria | 1326 |
| 738 | Ga0495585_0031604 | 3300046492 | Bacteria | 3004 |
| 739 | Ga0495585_0038601 | 3300046492 | Bacteria | 2687 |
| 740 | Ga0495585_0105382 | 3300046492 | Bacteria | 1504 |
| 741 | Ga0495594_0054755 | 3300046499 | Bacteria | 2199 |
| 742 | Ga0495583_0104207 | 3300046506 | Bacteria | 1208 |
| 743 | Ga0495606_0001566 | 3300046507 | Bacteria | 29975 |
| 744 | Ga0495606_0074530 | 3300046507 | Bacteria | 2126 |
| 745 | Ga0495608_0008113 | 3300046511 | Bacteria | 7381 |
| 746 | Ga0495608_0011568 | 3300046511 | Bacteria | 6139 |
| 747 | Ga0495608_0016511 | 3300046511 | Bacteria | 5108 |
| 748 | Ga0495608_0098528 | 3300046511 | Bacteria | 1886 |
| 749 | Ga0495618_0015173 | 3300046514 | Bacteria | 4700 |
| 750 | Ga0495618_0048917 | 3300046514 | Bacteria | 2670 |
| 751 | Ga0495628_0002572 | 3300046516 | Bacteria | 16332 |
| 752 | Ga0495628_0007597 | 3300046516 | Bacteria | 9371 |
| 753 | Ga0495628_0015999 | 3300046516 | Bacteria | 6258 |
| 754 | Ga0495628_0314441 | 3300046516 | Bacteria | 1157 |
| 755 | Ga0495630_0040548 | 3300046517 | Bacteria | 3480 |
| 756 | Ga0495630_0103006 | 3300046517 | Bacteria | 2160 |
| 757 | Ga0495631_0115442 | 3300046518 | Bacteria | 1154 |
| 758 | Ga0495666_0069319 | 3300046526 | Bacteria | 1678 |
| 759 | Ga0495652_0002428 | 3300046529 | Bacteria | 19213 |
| 760 | Ga0495652_0091823 | 3300046529 | Bacteria | 2481 |
| 761 | Ga0495652_0115683 | 3300046529 | Bacteria | 2148 |
| 762 | Ga0495665_0005351 | 3300046531 | Bacteria | 6920 |
| 763 | Ga0495665_0085638 | 3300046531 | Bacteria | 1656 |
| 764 | Ga0495640_0015450 | 3300046533 | Bacteria | 5745 |
| 765 | Ga0495640_0047337 | 3300046533 | Bacteria | 2976 |
| 766 | Ga0495640_0064294 | 3300046533 | Bacteria | 2481 |
| 767 | Ga0495587_0009736 | 3300046536 | Bacteria | 6144 |
| 768 | Ga0495587_0052159 | 3300046536 | Bacteria | 2414 |
| 769 | Ga0495598_0017520 | 3300046537 | Bacteria | 1848 |
| 770 | Ga0495609_0090437 | 3300046538 | Bacteria | 1331 |
| 771 | Ga0495621_0023115 | 3300046539 | Bacteria | 2066 |
| 772 | Ga0495621_0050206 | 3300046539 | Bacteria | 1490 |
| 773 | Ga0495645_0001788 | 3300046543 | Bacteria | 14608 |
| 774 | Ga0495645_0025716 | 3300046543 | Bacteria | 4274 |
| 775 | Ga0495645_0028258 | 3300046543 | Bacteria | 4076 |
| 776 | Ga0495645_0038226 | 3300046543 | Bacteria | 3501 |
| 777 | Ga0495645_0052493 | 3300046543 | Bacteria | 2966 |
| 778 | Ga0495645_0094722 | 3300046543 | Bacteria | 2129 |
| 779 | Ga0495667_0003563 | 3300046559 | Bacteria | 10468 |
| 780 | Ga0495667_0005768 | 3300046559 | Bacteria | 8384 |
| 781 | Ga0495667_0119452 | 3300046559 | Bacteria | 1702 |
| 782 | Ga0495656_0016994 | 3300046615 | Bacteria | 2770 |
| 783 | Ga0495656_0032549 | 3300046615 | Bacteria | 2122 |
| 784 | Ga0495656_0035929 | 3300046615 | Bacteria | 2038 |
| 785 | Ga0495656_0091561 | 3300046615 | Bacteria | 1391 |
| 786 | Ga0495668_0118180 | 3300046616 | Bacteria | 1450 |
| 787 | Ga0495634_0004321 | 3300046642 | Bacteria | 11195 |
| 788 | Ga0495625_0082150 | 3300046660 | Bacteria | 2241 |
| 789 | Ga0495635_0000429 | 3300046663 | Bacteria | 26634 |
| 790 | Ga0495635_0013995 | 3300046663 | Bacteria | 5613 |
| 791 | Ga0495635_0027056 | 3300046663 | Bacteria | 3990 |
| 792 | Ga0495635_0322937 | 3300046663 | Bacteria | 1033 |
| 793 | Ga0495659_0007040 | 3300046664 | Bacteria | 3557 |
| 794 | Ga0495659_0033686 | 3300046664 | Bacteria | 1799 |
| 795 | Ga0495588_0083701 | 3300046674 | Bacteria | 1666 |
| 796 | Ga0495657_0009336 | 3300046675 | Bacteria | 7443 |
| 797 | Ga0495657_0010262 | 3300046675 | Bacteria | 7049 |
| 798 | Ga0495657_0013260 | 3300046675 | Bacteria | 6087 |
| 799 | Ga0495599_0003035 | 3300046678 | Bacteria | 9769 |
| 800 | Ga0495623_0007229 | 3300046679 | Bacteria | 7207 |
| 801 | Ga0495623_0007655 | 3300046679 | Bacteria | 7019 |
| 802 | Ga0495623_0049055 | 3300046679 | Bacteria | 2675 |
| 803 | Ga0495623_0102314 | 3300046679 | Bacteria | 1744 |
| 804 | Ga0495623_0127033 | 3300046679 | Bacteria | 1530 |
| 805 | Ga0495646_0001304 | 3300046680 | Bacteria | 14717 |
| 806 | Ga0495646_0043515 | 3300046680 | Bacteria | 2749 |
| 807 | Ga0495647_0008584 | 3300046681 | Bacteria | 3437 |
| 808 | Ga0495658_0000781 | 3300046683 | Bacteria | 17152 |
| 809 | Ga0495658_0011048 | 3300046683 | Bacteria | 4530 |
| 810 | Ga0495669_0077313 | 3300046684 | Bacteria | 1524 |
| 811 | Ga0495669_0083675 | 3300046684 | Bacteria | 1467 |
| 812 | Ga0495613_0006286 | 3300046689 | Bacteria | 8885 |
| 813 | Ga0495613_0029327 | 3300046689 | Bacteria | 4091 |
| 814 | Ga0495613_0219605 | 3300046689 | Bacteria | 1335 |
| 815 | Ga0495624_0040078 | 3300046690 | Bacteria | 3001 |
| 816 | Ga0495624_0081726 | 3300046690 | Bacteria | 2001 |
| 817 | Ga0495624_0132083 | 3300046690 | Bacteria | 1531 |
| 818 | Ga0495670_0012130 | 3300046691 | Bacteria | 4239 |
| 819 | Ga0495649_0080821 | 3300046694 | Bacteria | 1738 |
| 820 | Ga0495600_0007607 | 3300046809 | Bacteria | 6637 |
| 821 | Ga0495600_0014546 | 3300046809 | Bacteria | 4959 |
| 822 | Ga0495581_0005737 | 3300047315 | Bacteria | 7194 |
| 823 | Ga0495581_0030017 | 3300047315 | Bacteria | 3152 |
| 824 | Ga0495581_0092012 | 3300047315 | Bacteria | 1760 |
| 825 | Ga0495604_0002235 | 3300047317 | Bacteria | 15508 |
| 826 | Ga0495604_0002822 | 3300047317 | Bacteria | 13952 |
| 827 | Ga0495604_0010023 | 3300047317 | Bacteria | 7501 |
| 828 | Ga0495604_0116513 | 3300047317 | Bacteria | 1939 |
| 829 | Ga0495674_0004206 | 3300047319 | Bacteria | 13863 |
| 830 | Ga0495674_0006763 | 3300047319 | Bacteria | 10975 |
| 831 | Ga0495674_0021636 | 3300047319 | Bacteria | 5945 |
| 832 | Ga0495674_0082394 | 3300047319 | Bacteria | 2758 |
| 833 | Ga0495674_0198450 | 3300047319 | Bacteria | 1665 |
| 834 | Ga0495672_0032259 | 3300047320 | Bacteria | 3261 |
| 835 | Ga0495672_0106579 | 3300047320 | Bacteria | 1511 |
| 836 | Ga0495676_0062585 | 3300047321 | Bacteria | 2904 |
| 837 | Ga0495676_0121550 | 3300047321 | Bacteria | 1899 |
| 838 | Ga0495680_0006824 | 3300047322 | Bacteria | 10544 |
| 839 | Ga0495680_0029393 | 3300047322 | Bacteria | 4500 |
| 840 | Ga0495675_0002904 | 3300047444 | Bacteria | 10293 |
| 841 | Ga0495675_0067445 | 3300047444 | Bacteria | 2260 |
| 842 | Ga0495684_0000497 | 3300047471 | Bacteria | 32091 |
| 843 | Ga0495684_0015464 | 3300047471 | Bacteria | 5872 |
| 844 | Ga0495684_0016411 | 3300047471 | Bacteria | 5703 |
| 845 | Ga0495684_0025159 | 3300047471 | Bacteria | 4577 |
| 846 | Ga0495684_0281626 | 3300047471 | Bacteria | 1199 |
| 847 | Ga0495686_0147868 | 3300047472 | Bacteria | 1381 |
| 848 | Ga0495593_0014868 | 3300047673 | Bacteria | 4421 |
| 849 | Ga0495593_0014947 | 3300047673 | Bacteria | 4408 |
| 850 | Ga0495593_0016723 | 3300047673 | Bacteria | 4133 |
| 851 | Ga0495593_0023433 | 3300047673 | Bacteria | 3432 |
| 852 | Ga0495602_0040996 | 3300048088 | Bacteria | 4234 |
| 853 | Ga0495602_0128581 | 3300048088 | Bacteria | 2024 |
| 854 | Ga0495602_0152128 | 3300048088 | Bacteria | 1817 |
| 855 | Ga0495614_0010418 | 3300048089 | Bacteria | 4099 |
| 856 | Ga0495614_0018899 | 3300048089 | Bacteria | 2984 |
| 857 | Ga0495615_0000368 | 3300048090 | Bacteria | 7077 |
| 858 | Ga0495615_0012724 | 3300048090 | Bacteria | 1741 |
| 859 | Ga0496100_0012538 | 3300048903 | Bacteria | 4862 |
| 860 | Ga0496100_0015511 | 3300048903 | Bacteria | 4451 |
| 861 | Ga0496100_0040306 | 3300048903 | Bacteria | 2970 |
| 862 | Ga0496100_0072267 | 3300048903 | Bacteria | 2305 |
| 863 | Ga0496100_0128194 | 3300048903 | Bacteria | 1784 |
| 864 | Ga0496100_0249420 | 3300048903 | Bacteria | 1313 |
| 865 | Ga0496100_0279397 | 3300048903 | Bacteria | 1244 |
| 866 | Ga0496101_0000235 | 3300048904 | Bacteria | 41146 |
| 867 | Ga0496101_0001165 | 3300048904 | Bacteria | 15728 |
| 868 | Ga0496101_0008415 | 3300048904 | Bacteria | 6740 |
| 869 | Ga0496101_0019223 | 3300048904 | Bacteria | 4661 |
| 870 | Ga0496101_0052924 | 3300048904 | Bacteria | 2928 |
| 871 | Ga0496101_0053933 | 3300048904 | Bacteria | 2902 |
| 872 | Ga0496101_0195594 | 3300048904 | Bacteria | 1562 |
| 873 | Ga0496102_0005341 | 3300048905 | Bacteria | 10905 |
| 874 | Ga0496102_0022951 | 3300048905 | Bacteria | 5535 |
| 875 | Ga0496102_0028248 | 3300048905 | Bacteria | 5009 |
| 876 | Ga0496102_0039515 | 3300048905 | Bacteria | 4263 |
| 877 | Ga0496102_0155347 | 3300048905 | Bacteria | 2151 |
| 878 | Ga0496103_0003790 | 3300048906 | Bacteria | 9196 |
| 879 | Ga0496103_0011444 | 3300048906 | Bacteria | 5258 |
| 880 | Ga0496103_0014101 | 3300048906 | Bacteria | 4744 |
| 881 | Ga0496104_0000351 | 3300048907 | Bacteria | 41200 |
| 882 | Ga0496104_0003146 | 3300048907 | Bacteria | 14223 |
| 883 | Ga0496104_0008914 | 3300048907 | Bacteria | 8913 |
| 884 | Ga0496104_0215047 | 3300048907 | Bacteria | 1834 |
| 885 | Ga0496104_0250055 | 3300048907 | Bacteria | 1685 |
| 886 | Ga0496104_0285969 | 3300048907 | Bacteria | 1561 |
| 887 | Ga0496104_0499306 | 3300048907 | Bacteria | 1128 |
| 888 | Ga0496105_0000840 | 3300048908 | Bacteria | 20909 |
| 889 | Ga0496105_0006427 | 3300048908 | Bacteria | 9034 |
| 890 | Ga0496105_0012927 | 3300048908 | Bacteria | 6616 |
| 891 | Ga0496105_0029441 | 3300048908 | Bacteria | 4494 |
| 892 | Ga0496105_0030009 | 3300048908 | Bacteria | 4454 |
| 893 | Ga0496105_0037048 | 3300048908 | Bacteria | 4018 |
| 894 | Ga0496105_0190590 | 3300048908 | Bacteria | 1676 |
| 895 | Ga0496106_0000788 | 3300048909 | Bacteria | 22899 |
| 896 | Ga0496106_0002108 | 3300048909 | Bacteria | 14874 |
| 897 | Ga0496106_0010763 | 3300048909 | Bacteria | 6759 |
| 898 | Ga0496106_0011781 | 3300048909 | Bacteria | 6454 |
| 899 | Ga0496106_0169369 | 3300048909 | Bacteria | 1730 |
| 900 | Ga0496106_0181176 | 3300048909 | Bacteria | 1672 |
| 901 | Ga0496106_0186831 | 3300048909 | Bacteria | 1646 |
| 902 | Ga0496106_0325966 | 3300048909 | Bacteria | 1233 |
| 903 | Ga0496107_0004819 | 3300048910 | Bacteria | 9159 |
| 904 | Ga0496107_0011301 | 3300048910 | Bacteria | 6216 |
| 905 | Ga0496107_0013863 | 3300048910 | Bacteria | 5634 |
| 906 | Ga0496107_0030116 | 3300048910 | Bacteria | 3867 |
| 907 | Ga0496107_0074682 | 3300048910 | Bacteria | 2466 |
| 908 | Ga0496107_0111973 | 3300048910 | Bacteria | 2006 |
| 909 | Ga0496108_0011130 | 3300048911 | Bacteria | 7309 |
| 910 | Ga0496108_0016530 | 3300048911 | Bacteria | 6022 |
| 911 | Ga0496108_0019665 | 3300048911 | Bacteria | 5546 |
| 912 | Ga0496108_0037794 | 3300048911 | Bacteria | 4022 |
| 913 | Ga0496108_0082807 | 3300048911 | Bacteria | 2721 |
| 914 | Ga0496108_0237162 | 3300048911 | Bacteria | 1586 |
| 915 | Ga0496109_0005654 | 3300048912 | Bacteria | 10459 |
| 916 | Ga0496109_0007962 | 3300048912 | Bacteria | 8983 |
| 917 | Ga0496109_0023341 | 3300048912 | Bacteria | 5489 |
| 918 | Ga0496109_0027237 | 3300048912 | Bacteria | 5102 |
| 919 | Ga0496109_0028566 | 3300048912 | Bacteria | 4989 |
| 920 | Ga0496109_0040011 | 3300048912 | Bacteria | 4245 |
| 921 | Ga0496109_0045566 | 3300048912 | Bacteria | 3980 |
| 922 | Ga0496110_0034051 | 3300048913 | Bacteria | 4409 |
| 923 | Ga0496110_0039961 | 3300048913 | Bacteria | 4087 |
| 924 | Ga0496110_0075409 | 3300048913 | Bacteria | 2996 |
| 925 | Ga0496110_0492910 | 3300048913 | Bacteria | 1116 |
| 926 | Ga0496111_0002946 | 3300048914 | Bacteria | 10413 |
| 927 | Ga0496111_0009883 | 3300048914 | Bacteria | 6377 |
| 928 | Ga0496111_0039701 | 3300048914 | Bacteria | 3376 |
| 929 | Ga0496111_0057681 | 3300048914 | Bacteria | 2811 |
| 930 | Ga0496112_0000018 | 3300048915 | Bacteria | 188820 |
| 931 | Ga0496112_0011859 | 3300048915 | Bacteria | 7982 |
| 932 | Ga0496112_0013345 | 3300048915 | Bacteria | 7583 |
| 933 | Ga0496112_0030393 | 3300048915 | Bacteria | 5227 |
| 934 | Ga0496112_0069569 | 3300048915 | Bacteria | 3477 |
| 935 | Ga0496112_0334061 | 3300048915 | Bacteria | 1459 |
| 936 | Ga0496112_0421533 | 3300048915 | Bacteria | 1273 |
| 937 | Ga0496113_0013732 | 3300048916 | Bacteria | 5500 |
| 938 | Ga0496113_0017464 | 3300048916 | Bacteria | 4981 |
| 939 | Ga0496113_0035587 | 3300048916 | Bacteria | 3642 |
| 940 | Ga0496113_0062084 | 3300048916 | Bacteria | 2821 |
| 941 | Ga0496113_0071978 | 3300048916 | Bacteria | 2630 |
| 942 | Ga0496114_0009940 | 3300048917 | Bacteria | 7562 |
| 943 | Ga0496114_0023363 | 3300048917 | Bacteria | 5045 |
| 944 | Ga0496114_0037148 | 3300048917 | Bacteria | 4028 |
| 945 | Ga0496114_0048719 | 3300048917 | Bacteria | 3524 |
| 946 | Ga0496114_0066495 | 3300048917 | Bacteria | 3022 |
| 947 | Ga0496114_0112239 | 3300048917 | Bacteria | 2336 |
| 948 | Ga0496115_0002701 | 3300048918 | Bacteria | 12737 |
| 949 | Ga0496115_0010842 | 3300048918 | Bacteria | 6819 |
| 950 | Ga0496115_0019196 | 3300048918 | Bacteria | 5259 |
| 951 | Ga0496115_0050174 | 3300048918 | Bacteria | 3342 |
| 952 | Ga0496115_0078464 | 3300048918 | Bacteria | 2686 |
| 953 | Ga0496115_0109684 | 3300048918 | Bacteria | 2266 |
| 954 | Ga0496115_0123713 | 3300048918 | Bacteria | 2129 |
| 955 | Ga0496116_0227024 | 3300048919 | Bacteria | 951 |
| 956 | Ga0496117_0007128 | 3300048920 | Bacteria | 11048 |
| 957 | Ga0496117_0074479 | 3300048920 | Bacteria | 2260 |
| 958 | Ga0496118_0003592 | 3300048921 | Bacteria | 19299 |
| 959 | Ga0496118_0078665 | 3300048921 | Bacteria | 2332 |
| 960 | Ga0496119_0055304 | 3300048922 | Bacteria | 2411 |
| 961 | Ga0496121_0000640 | 3300048924 | Bacteria | 65295 |
| 962 | Ga0496121_0038643 | 3300048924 | Bacteria | 4220 |
| 963 | Ga0496121_0046507 | 3300048924 | Bacteria | 3713 |
| 964 | Ga0496121_0048134 | 3300048924 | Bacteria | 3630 |
| 965 | Ga0496121_0093528 | 3300048924 | Bacteria | 2340 |
| 966 | Ga0496121_0188119 | 3300048924 | Bacteria | 1483 |
| 967 | Ga0496124_0002189 | 3300048927 | Bacteria | 26104 |
| 968 | Ga0496125_0085843 | 3300048928 | Bacteria | 2383 |
| 969 | Ga0496126_0009499 | 3300048929 | Bacteria | 10319 |
| 970 | Ga0496126_0018354 | 3300048929 | Bacteria | 6933 |
| 971 | Ga0496126_0043259 | 3300048929 | Bacteria | 4155 |
| 972 | Ga0496126_0047915 | 3300048929 | Bacteria | 3910 |
| 973 | Ga0496126_0068906 | 3300048929 | Bacteria | 3157 |
| 974 | Ga0496126_0080924 | 3300048929 | Bacteria | 2873 |
| 975 | Ga0496126_0115449 | 3300048929 | Bacteria | 2334 |
| 976 | Ga0496126_0164235 | 3300048929 | Bacteria | 1896 |
| 977 | Ga0496126_0254389 | 3300048929 | Bacteria | 1462 |
| 978 | Ga0501036_0003984 | 3300049572 | Bacteria | 11869 |
| 979 | Ga0501037_0025075 | 3300049573 | Bacteria | 4406 |
| 980 | Ga0501037_0040497 | 3300049573 | Bacteria | 3428 |
| 981 | Ga0501038_0040262 | 3300049574 | Bacteria | 4083 |
| 982 | Ga0501046_0067505 | 3300049580 | Bacteria | 2785 |
| 983 | Ga0501047_0000100 | 3300049581 | Bacteria | 105717 |
| 984 | Ga0501047_0052511 | 3300049581 | Bacteria | 3940 |
| 985 | Ga0501048_0000083 | 3300049582 | Bacteria | 49621 |
| 986 | Ga0501048_0098144 | 3300049582 | Bacteria | 2067 |
| 987 | Ga0501068_0041556 | 3300049584 | Bacteria | 2763 |
| 988 | Ga0501070_0009792 | 3300049586 | Bacteria | 8108 |
| 989 | Ga0501070_0152053 | 3300049586 | Bacteria | 1909 |
| 990 | Ga0501070_0215422 | 3300049586 | Bacteria | 1575 |
| 991 | Ga0501072_0003943 | 3300049588 | Bacteria | 11230 |
| 992 | Ga0501072_0218576 | 3300049588 | Bacteria | 1519 |
| 993 | Ga0501074_0017935 | 3300049590 | Bacteria | 5143 |
| 994 | Ga0501074_0040074 | 3300049590 | Bacteria | 3392 |
| 995 | Ga0501074_0046177 | 3300049590 | Bacteria | 3149 |
| 996 | Ga0501079_0033083 | 3300049741 | Bacteria | 3976 |
| 997 | Ga0501080_0000030 | 3300049742 | Bacteria | 87736 |
| 998 | Ga0501080_0029073 | 3300049742 | Bacteria | 5145 |
| 999 | Ga0501080_0290083 | 3300049742 | Bacteria | 1486 |
| 1000 | Ga0501083_0002641 | 3300049744 | Bacteria | 12337 |
| 1001 | Ga0501083_0194828 | 3300049744 | Bacteria | 1322 |
| 1002 | Ga0501035_0023582 | 3300049822 | Bacteria | 5645 |
| 1003 | Ga0501035_0438882 | 3300049822 | Bacteria | 1081 |
| 1004 | Ga0501044_0000587 | 3300049823 | Bacteria | 44137 |
| 1005 | nmdc:mga03n38_150788_c1 | 3300050490 | Bacteria | 1169 |
| 1006 | nmdc:mga0yw44_104257_c1 | 3300050492 | Bacteria | 1810 |
| 1007 | nmdc:mga0yw44_63102_c1 | 3300050492 | Bacteria | 2277 |
| 1008 | nmdc:mga0k408_2505_c2 | 3300050493 | Bacteria | 7672 |
| 1009 | nmdc:mga0k408_36277_c1 | 3300050493 | Bacteria | 2829 |
| 1010 | nmdc:mga06z11_34154_c1 | 3300050494 | Bacteria | 2494 |
| 1011 | nmdc:mga06z11_4911_c1 | 3300050494 | Bacteria | 5306 |
| 1012 | nmdc:mga07m45_49692_c1 | 3300050496 | Bacteria | 2361 |
| 1013 | nmdc:mga05p37_10233_c1 | 3300050507 | Bacteria | 11137 |
| 1014 | nmdc:mga05p37_166916_c1 | 3300050507 | Bacteria | 2686 |
| 1015 | nmdc:mga05p37_225_c1 | 3300050507 | Bacteria | 57238 |
| 1016 | nmdc:mga09592_244_c1 | 3300050508 | Bacteria | 39424 |
| 1017 | nmdc:mga09592_58040_c1 | 3300050508 | Bacteria | 3273 |
| 1018 | nmdc:mga09592_736_c1 | 3300050508 | Bacteria | 25222 |
| 1019 | nmdc:mga0qj67_215_c1 | 3300050509 | Bacteria | 39409 |
| 1020 | nmdc:mga0qj67_2611_c1 | 3300050509 | Bacteria | 12909 |
| 1021 | nmdc:mga0qj67_4314_c1 | 3300050509 | Bacteria | 10307 |
| 1022 | nmdc:mga06r32_12515_c1 | 3300050510 | Bacteria | 7657 |
| 1023 | nmdc:mga06r32_341_c1 | 3300050510 | Bacteria | 38959 |
| 1024 | nmdc:mga06r32_731_c1 | 3300050510 | Bacteria | 28813 |
| 1025 | nmdc:mga08y16_131595_c1 | 3300050511 | Bacteria | 2601 |
| 1026 | nmdc:mga08y16_145004_c1 | 3300050511 | Bacteria | 2468 |
| 1027 | nmdc:mga08y16_252107_c1 | 3300050511 | Bacteria | 1824 |
| 1028 | nmdc:mga08y16_617_c1 | 3300050511 | Bacteria | 33261 |
| 1029 | nmdc:mga08y16_6190_c1 | 3300050511 | Bacteria | 12557 |
| 1030 | nmdc:mga0n895_308807_c1 | 3300050512 | Bacteria | 1603 |
| 1031 | nmdc:mga0n895_457_c1 | 3300050512 | Bacteria | 27383 |
| 1032 | nmdc:mga0n895_543324_c1 | 3300050512 | Bacteria | 1168 |
| 1033 | nmdc:mga0rr50_11539_c1 | 3300050513 | Bacteria | 5662 |
| 1034 | nmdc:mga0rr50_19557_c1 | 3300050513 | Bacteria | 4574 |
| 1035 | nmdc:mga08x19_81571_c1 | 3300050514 | Bacteria | 2124 |
| 1036 | nmdc:mga0a205_1019_c1 | 3300050515 | Bacteria | 23295 |
| 1037 | nmdc:mga0a205_17989_c1 | 3300050515 | Bacteria | 6068 |
| 1038 | Ga0495601_0000413 | 3300053077 | Bacteria | 22423 |
| 1039 | Ga0495601_0000668 | 3300053077 | Bacteria | 18282 |
| 1040 | Ga0495601_0005956 | 3300053077 | Bacteria | 7113 |
| 1041 | Ga0495601_0007499 | 3300053077 | Bacteria | 6400 |
| 1042 | Ga0495601_0018585 | 3300053077 | Bacteria | 4231 |
| 1043 | Ga0495601_0060131 | 3300053077 | Bacteria | 2410 |
| 1044 | Ga0495612_0001564 | 3300053078 | Bacteria | 9430 |
| 1045 | Ga0495612_0002430 | 3300053078 | Bacteria | 7675 |
| 1046 | Ga0495612_0006791 | 3300053078 | Bacteria | 4688 |
| 1047 | Ga0495612_0008871 | 3300053078 | Bacteria | 4073 |
| 1048 | Ga0495612_0019920 | 3300053078 | Bacteria | 2688 |
| 1049 | Ga0495595_0000516 | 3300053084 | Bacteria | 14727 |
| 1050 | Ga0495595_0001465 | 3300053084 | Bacteria | 9212 |
| 1051 | Ga0495595_0003553 | 3300053084 | Bacteria | 6186 |
| 1052 | Ga0495619_0001679 | 3300053085 | Bacteria | 14639 |
| 1053 | Ga0495619_0001957 | 3300053085 | Bacteria | 13737 |
| 1054 | Ga0495619_0002856 | 3300053085 | Bacteria | 11246 |
| 1055 | Ga0495619_0020676 | 3300053085 | Bacteria | 4195 |
| 1056 | Ga0495619_0054518 | 3300053085 | Bacteria | 2646 |
| 1057 | Ga0495619_0106148 | 3300053085 | Bacteria | 1915 |
| 1058 | Ga0495619_0128604 | 3300053085 | Bacteria | 1740 |
| 1059 | Ga0500651_0102011 | 3300053093 | Bacteria | 1758 |
| 1060 | Ga0500651_0185374 | 3300053093 | Bacteria | 1234 |
| 1061 | Ga0500566_0001625 | 3300053094 | Bacteria | 13231 |
| 1062 | Ga0500566_0013519 | 3300053094 | Bacteria | 4804 |
| 1063 | Ga0500566_0107849 | 3300053094 | Bacteria | 1518 |
| 1064 | Ga0500641_0098123 | 3300053096 | Bacteria | 1255 |
| 1065 | Ga0500648_043289 | 3300053097 | Bacteria | 2556 |
| 1066 | Ga0500594_0071074 | 3300053118 | Bacteria | 1023 |
| 1067 | Ga0500595_000010 | 3300053119 | Bacteria | 275806 |
| 1068 | Ga0500595_000095 | 3300053119 | Bacteria | 61248 |
| 1069 | Ga0500595_003699 | 3300053119 | Bacteria | 7057 |
| 1070 | Ga0500595_018815 | 3300053119 | Bacteria | 2518 |
| 1071 | Ga0500642_0017123 | 3300053130 | Bacteria | 2771 |
| 1072 | Ga0500658_0024140 | 3300053134 | Bacteria | 2327 |
| 1073 | Ga0500559_0047011 | 3300053136 | Bacteria | 1894 |
| 1074 | Ga0500573_0175702 | 3300053140 | Bacteria | 1155 |
| 1075 | Ga0500622_0054551 | 3300053156 | Bacteria | 2050 |
| 1076 | Ga0500627_0125752 | 3300053158 | Bacteria | 1157 |
| 1077 | Ga0500634_0069625 | 3300053161 | Bacteria | 1844 |
| 1078 | Ga0500638_006677 | 3300053162 | Bacteria | 4750 |
| 1079 | Ga0500636_0014540 | 3300053177 | Bacteria | 4629 |
| 1080 | Ga0500637_0000495 | 3300053178 | Bacteria | 15245 |
| 1081 | Ga0500596_004825 | 3300053735 | Bacteria | 2437 |
| 1082 | Ga0501082_0192337 | 3300060353 | Bacteria | 1775 |
| 1083 | Ga0530510_0058804 | 3300061734 | Bacteria | 2780 |
| 1084 | Ga0530510_0113785 | 3300061734 | Bacteria | 1983 |
| 1085 | Ga0530510_0192984 | 3300061734 | Bacteria | 1512 |
| 1086 | 2513661634 | 2513237096 | Bacteria | 8722461 |
| 1087 | 2513863107 | 2513237137 | Bacteria | 9558895 |
| 1088 | 2513923311 | 2513237145 | Bacteria | 8979722 |
| 1089 | 2517889126 | 2517572143 | Bacteria | 9484767 |
| 1090 | 2524541222 | 2524023228 | Bacteria | 10118060 |
| 1091 | 2671121588 | 2667528175 | Bacteria | 7532676 |
| 1092 | 2728753705 | 2728368998 | Bacteria | 8720350 |
| 1093 | 2793072628 | 2791355197 | Bacteria | 8420563 |
| 1094 | 2876818203 | 2876808645 | Bacteria | 8824342 |
| 1095 | 2879115151 | 2879110137 | Bacteria | 8907982 |
| 1096 | 2885382864 | 2885374607 | Bacteria | 8927485 |
| 1097 | 2903756127 | 2903748898 | Bacteria | 9972761 |
| 1098 | 2904690931 | 2904690495 | Bacteria | 9412302 |
| 1099 | 2904708248 | |||
| 1100 | 2906613483 | |||
| 1101 | 2906643032 | 2906635258 | Bacteria | 8601019 |
| 1102 | 2906668201 | 2906660503 | Bacteria | 8595048 |
| 1103 | 2908747738 | 2908739725 | Bacteria | 8628932 |
| 1104 | 2908756987 | 2908756301 | Bacteria | 8864324 |
| 1105 | 2922388792 | 2922386360 | Bacteria | 7017218 |
| 1106 | 2922433921 | |||
| 1107 | 2935634942 | 2935630451 | Bacteria | 8169952 |
| 1108 | 2941514270 | 2941507105 | Bacteria | 8166816 |
| 1109 | 2941522231 | 2941515067 | Bacteria | 8166720 |
| 1110 | 2941530102 | 2941523033 | Bacteria | 8169134 |
| 1111 | 3005475361 | 3005474847 | Bacteria | 9259049 |
| 1112 | 8006935923 | 8006933436 | Bacteria | 10410654 |
| 1113 | 8006975961 | 8006973647 | Bacteria | 10679141 |
| 1114 | 8019562749 | 8019555841 | Bacteria | 9642137 |
| 1115 | 8019572828 | 8019565922 | Bacteria | 9639779 |
| 1116 | Ga0495585_0004431 | |||
| 1117 | JGI24746J21847_1004478 | |||
| 1118 | JGI24739J22299_10004105 | |||
| 1119 | JGI24737J22298_10002708 | |||
| 1120 | JGI24750J21931_1000175 | |||
| 1121 | JGI24748J21848_1000514 | |||
| 1122 | JGI24738J21930_10001046 | |||
| 1123 | JGI24749J21850_1001064 | |||
| 1124 | JGI24744J21845_10000566 | |||
| 1125 | JGI24034J26672_10000462 | |||
| 1126 | JGI24742J22300_10000420 | |||
| 1127 | JGI24751J29686_10016485 | |||
| 1128 | JGI25406J46586_10000028 | |||
| 1129 | JGI25404J52841_10015339 | |||
| 1130 | JGI25405J52794_10009101 | |||
| 1131 | Ga0065712_10029709 | |||
| 1132 | Ga0065712_10113471 | |||
| 1133 | Ga0065712_10135995 | |||
| 1134 | Ga0065715_10037919 | |||
| 1135 | Ga0065715_10137549 | |||
| 1136 | Ga0070658_10101559 | |||
| 1137 | Ga0070676_10006058 | |||
| 1138 | Ga0070676_10024678 | |||
| 1139 | Ga0070676_10088731 | |||
| 1140 | Ga0070676_10131041 | |||
| 1141 | Ga0070683_100000836 | |||
| 1142 | Ga0070683_100011738 | |||
| 1143 | Ga0070683_100067592 | |||
| 1144 | Ga0070683_100075014 | |||
| 1145 | Ga0070690_100000700 | |||
| 1146 | Ga0070690_100063572 | |||
| 1147 | Ga0070690_100171286 | |||
| 1148 | Ga0070670_100006794 | |||
| 1149 | Ga0070670_100031028 | |||
| 1150 | Ga0070670_100046472 | |||
| 1151 | Ga0070670_100086754 | |||
| 1152 | Ga0070677_10000406 | |||
| 1153 | Ga0070677_10002338 | |||
| 1154 | Ga0070677_10028755 | |||
| 1155 | Ga0070677_10036854 | |||
| 1156 | Ga0070677_10037432 | |||
| 1157 | Ga0068869_100000653 | |||
| 1158 | Ga0068869_100106003 | |||
| 1159 | Ga0070666_10005529 | |||
| 1160 | Ga0070666_10031827 | |||
| 1161 | Ga0070680_100005042 | |||
| 1162 | Ga0070680_100043949 | |||
| 1163 | Ga0070680_100069523 | |||
| 1164 | Ga0070680_100073871 | |||
| 1165 | Ga0070682_100005253 | |||
| 1166 | Ga0070682_100020427 | |||
| 1167 | Ga0070682_100090951 | |||
| 1168 | Ga0068868_100005815 | |||
| 1169 | Ga0068868_100010958 | |||
| 1170 | Ga0068868_100097041 | |||
| 1171 | Ga0068868_100114377 | |||
| 1172 | Ga0070660_100023548 | |||
| 1173 | Ga0070660_100214228 | |||
| 1174 | Ga0070689_100010029 | |||
| 1175 | Ga0070689_100045887 | |||
| 1176 | Ga0070691_10004006 | |||
| 1177 | Ga0070687_100000387 | |||
| 1178 | Ga0070661_100001217 | |||
| 1179 | Ga0070692_10003662 | |||
| 1180 | Ga0070668_100019465 | |||
| 1181 | Ga0070668_100093673 | |||
| 1182 | Ga0070669_100009354 | |||
| 1183 | Ga0070675_100021874 | |||
| 1184 | Ga0070675_100125571 | |||
| 1185 | Ga0070671_100005891 | |||
| 1186 | Ga0070671_100020315 | |||
| 1187 | Ga0070671_100031898 | |||
| 1188 | Ga0070671_100172306 | |||
| 1189 | Ga0070671_100202708 | |||
| 1190 | Ga0070671_100288270 | |||
| 1191 | Ga0070674_100001918 | |||
| 1192 | Ga0070674_100003371 | |||
| 1193 | Ga0070674_100011258 | |||
| 1194 | Ga0070674_100074811 | |||
| 1195 | Ga0070674_100358750 | |||
| 1196 | Ga0070674_100374632 | |||
| 1197 | Ga0070673_100001086 | |||
| 1198 | Ga0070673_100122369 | |||
| 1199 | Ga0070673_100262418 | |||
| 1200 | Ga0070688_100034076 | |||
| 1201 | Ga0070688_100054495 | |||
| 1202 | Ga0070688_100097415 | |||
| 1203 | Ga0070688_100154625 | |||
| 1204 | Ga0070659_100006583 | |||
| 1205 | Ga0070667_100002687 | |||
| 1206 | Ga0070667_100122297 | |||
| 1207 | Ga0070667_100139796 | |||
| 1208 | Ga0070667_100327348 | |||
| 1209 | Ga0070709_10001257 | |||
| 1210 | Ga0070709_10006522 | |||
| 1211 | Ga0070709_10009430 | |||
| 1212 | Ga0070714_100141720 | |||
| 1213 | Ga0070714_100175934 | |||
| 1214 | Ga0070713_100000374 | |||
| 1215 | Ga0070713_100020428 | |||
| 1216 | Ga0070713_100028156 | |||
| 1217 | Ga0070710_10091766 | |||
| 1218 | Ga0070701_10002820 | |||
| 1219 | Ga0070701_10099733 | |||
| 1220 | Ga0070701_10141958 | |||
| 1221 | Ga0070711_100023758 | |||
| 1222 | Ga0070711_100033722 | |||
| 1223 | Ga0070711_100035137 | |||
| 1224 | Ga0070711_100221046 | |||
| 1225 | Ga0070705_100001711 | |||
| 1226 | Ga0070705_100158085 | |||
| 1227 | Ga0070700_100016369 | |||
| 1228 | Ga0070694_100007442 | |||
| 1229 | Ga0070708_100104737 | |||
| 1230 | Ga0070708_100209862 | |||
| 1231 | Ga0070663_100021845 | |||
| 1232 | Ga0070663_100025326 | |||
| 1233 | Ga0070663_100064000 | |||
| 1234 | Ga0070663_100093309 | |||
| 1235 | Ga0070678_100001680 | |||
| 1236 | Ga0070678_100028582 | |||
| 1237 | Ga0070678_100031777 | |||
| 1238 | Ga0070678_100056209 | |||
| 1239 | Ga0070678_100061286 | |||
| 1240 | Ga0070678_100089587 | |||
| 1241 | Ga0070678_100139062 | |||
| 1242 | Ga0070662_100009816 | |||
| 1243 | Ga0070662_100012878 | |||
| 1244 | Ga0070662_100176492 | |||
| 1245 | Ga0070662_100178517 | |||
| 1246 | Ga0070681_10015832 | |||
| 1247 | Ga0070681_10050414 | |||
| 1248 | Ga0070681_10061500 | |||
| 1249 | Ga0070681_10220683 | |||
| 1250 | Ga0070681_10325796 | |||
| 1251 | Ga0068867_100000874 | |||
| 1252 | Ga0068867_100031810 | |||
| 1253 | Ga0068867_100050648 | |||
| 1254 | Ga0070685_10003079 | |||
| 1255 | Ga0070685_10246411 | |||
| 1256 | Ga0070707_100099390 | |||
| 1257 | Ga0070679_100040768 | |||
| 1258 | Ga0070679_100151164 | |||
| 1259 | Ga0070679_100210850 | |||
| 1260 | Ga0070684_100004467 | |||
| 1261 | Ga0070684_100016286 | |||
| 1262 | Ga0070684_100171967 | |||
| 1263 | Ga0070697_100002564 | |||
| 1264 | Ga0068853_100003110 | |||
| 1265 | Ga0068853_100069092 | |||
| 1266 | Ga0068853_100093456 | |||
| 1267 | Ga0068853_100098738 | |||
| 1268 | Ga0068853_100175699 | |||
| 1269 | Ga0068853_100253732 | |||
| 1270 | Ga0068853_100330674 | |||
| 1271 | Ga0070672_100005379 | |||
| 1272 | Ga0070672_100005531 | |||
| 1273 | Ga0070672_100053092 | |||
| 1274 | Ga0070672_100131220 | |||
| 1275 | Ga0070672_100262842 | |||
| 1276 | Ga0070686_100004079 | |||
| 1277 | Ga0070695_100012339 | |||
| 1278 | Ga0070695_100026443 | |||
| 1279 | Ga0070695_100135344 | |||
| 1280 | Ga0070696_100008243 | |||
| 1281 | Ga0070696_100039848 | |||
| 1282 | Ga0070693_100072635 | |||
| 1283 | Ga0070693_100168400 | |||
| 1284 | Ga0070665_100023550 | |||
| 1285 | Ga0070665_100203213 | |||
| 1286 | Ga0070665_100234436 | |||
| 1287 | Ga0070665_100350418 | |||
| 1288 | Ga0070704_100065568 | |||
| 1289 | Ga0068855_100072645 | |||
| 1290 | Ga0068855_100082241 | |||
| 1291 | Ga0068855_100098486 | |||
| 1292 | Ga0068855_100108293 | |||
| 1293 | Ga0068855_100235299 | |||
| 1294 | Ga0070664_100027792 | |||
| 1295 | Ga0068857_100025732 | |||
| 1296 | Ga0068857_100069181 | |||
| 1297 | Ga0068854_100002509 | |||
| 1298 | Ga0068854_100106576 | |||
| 1299 | Ga0068856_100007430 | |||
| 1300 | Ga0068856_100061086 | |||
| 1301 | Ga0068856_100085445 | |||
| 1302 | Ga0068856_100119327 | |||
| 1303 | Ga0070702_100003283 | |||
| 1304 | Ga0068852_100006607 | |||
| 1305 | Ga0068852_100093916 | |||
| 1306 | Ga0068852_100366140 | |||
| 1307 | Ga0068859_100038170 | |||
| 1308 | Ga0068859_100069054 | |||
| 1309 | Ga0068859_100122021 | |||
| 1310 | Ga0068859_100276898 | |||
| 1311 | Ga0068864_100001321 | |||
| 1312 | Ga0068864_100087223 | |||
| 1313 | Ga0068864_100099414 | |||
| 1314 | Ga0068864_100195682 | |||
| 1315 | Ga0068866_10002168 | |||
| 1316 | Ga0068866_10037249 | |||
| 1317 | Ga0068866_10096173 | |||
| 1318 | Ga0068870_10000716 | |||
| 1319 | Ga0068863_100000965 | |||
| 1320 | Ga0068863_100107159 | |||
| 1321 | Ga0068863_100120246 | |||
| 1322 | Ga0068858_100003017 | |||
| 1323 | Ga0068858_100064343 | |||
| 1324 | Ga0068858_100065499 | |||
| 1325 | Ga0068858_100222549 | |||
| 1326 | Ga0068860_100000577 | |||
| 1327 | Ga0068860_100014200 | |||
| 1328 | Ga0068860_100041961 | |||
| 1329 | Ga0068860_100276217 | |||
| 1330 | Ga0068860_100304064 | |||
| 1331 | Ga0068862_100003246 | |||
| 1332 | Ga0068862_100019155 | |||
| 1333 | Ga0068862_100234364 | |||
| 1334 | Ga0081455_10000327 | |||
| 1335 | Ga0081455_10003093 | |||
| 1336 | Ga0081455_10006033 | |||
| 1337 | Ga0081455_10011459 | |||
| 1338 | Ga0081455_10053413 | |||
| 1339 | Ga0081455_10103105 | |||
| 1340 | Ga0081455_10158909 | |||
| 1341 | Ga0081455_10215824 | |||
| 1342 | Ga0081540_1000102 | |||
| 1343 | Ga0081540_1001430 | |||
| 1344 | Ga0081540_1003410 | |||
| 1345 | Ga0081540_1003755 | |||
| 1346 | Ga0081540_1009790 | |||
| 1347 | Ga0081540_1014713 | |||
| 1348 | Ga0081540_1017229 | |||
| 1349 | Ga0081540_1063111 | |||
| 1350 | Ga0081539_10000048 | |||
| 1351 | Ga0081539_10058707 | |||
| 1352 | Ga0081539_10072824 | |||
| 1353 | Ga0070717_10007141 | |||
| 1354 | Ga0070717_10010868 | |||
| 1355 | Ga0070717_10013303 | |||
| 1356 | Ga0070717_10059267 | |||
| 1357 | Ga0075365_10018199 | |||
| 1358 | Ga0075365_10099182 | |||
| 1359 | Ga0075363_100008259 | |||
| 1360 | Ga0075363_100023705 | |||
| 1361 | Ga0075432_10000765 | |||
| 1362 | Ga0070716_100006717 | |||
| 1363 | Ga0070712_100024348 | |||
| 1364 | Ga0070712_100106270 | |||
| 1365 | Ga0075362_10045225 | |||
| 1366 | Ga0075367_10039381 | |||
| 1367 | Ga0075367_10045981 | |||
| 1368 | Ga0075367_10048843 | |||
| 1369 | Ga0075369_10026031 | |||
| 1370 | Ga0075366_10002375 | |||
| 1371 | Ga0097621_100034122 | |||
| 1372 | Ga0075370_10026132 | |||
| 1373 | Ga0068871_100001025 | |||
| 1374 | Ga0068871_100005428 | |||
| 1375 | Ga0068871_100027579 | |||
| 1376 | Ga0068871_100073854 | |||
| 1377 | Ga0068871_100195067 | |||
| 1378 | Ga0068871_100292928 | |||
| 1379 | Ga0075428_100020912 | |||
| 1380 | Ga0075428_100131629 | |||
| 1381 | Ga0075428_100135424 | |||
| 1382 | Ga0075430_100000026 | |||
| 1383 | Ga0075430_100000222 | |||
| 1384 | Ga0075430_100012924 | |||
| 1385 | Ga0075431_100000451 | |||
| 1386 | Ga0075431_100032904 | |||
| 1387 | Ga0075433_10002991 | |||
| 1388 | Ga0075433_10016718 | |||
| 1389 | Ga0075434_100000110 | |||
| 1390 | Ga0075434_100001174 | |||
| 1391 | Ga0075429_100000247 | |||
| 1392 | Ga0075429_100009429 | |||
| 1393 | Ga0075429_100030873 | |||
| 1394 | Ga0068865_100005281 | |||
| 1395 | Ga0068865_100013742 | |||
| 1396 | Ga0068865_100103441 | |||
| 1397 | Ga0075436_100004698 | |||
| 1398 | Ga0075436_100089836 | |||
| 1399 | Ga0097620_100038166 | |||
| 1400 | Ga0097620_100069047 | |||
| 1401 | Ga0097620_100122027 | |||
| 1402 | Ga0097620_100276897 | |||
| 1403 | Ga0075435_100016201 | |||
| 1404 | Ga0075435_100110089 | |||
| 1405 | Ga0075435_100266357 | |||
| 1406 | Ga0099794_10015687 | |||
| 1407 | Ga0105251_10077573 | |||
| 1408 | Ga0105240_10121284 | |||
| 1409 | Ga0111539_10000337 | |||
| 1410 | Ga0111539_10014415 | |||
| 1411 | Ga0111539_10150346 | |||
| 1412 | Ga0105245_10000380 | |||
| 1413 | Ga0105245_10060762 | |||
| 1414 | Ga0105245_10070201 | |||
| 1415 | Ga0105245_10111892 | |||
| 1416 | Ga0105245_10114924 | |||
| 1417 | Ga0105247_10001411 | |||
| 1418 | Ga0105247_10006423 | |||
| 1419 | Ga0105247_10016700 | |||
| 1420 | Ga0105247_10025590 | |||
| 1421 | Ga0105247_10048427 | |||
| 1422 | Ga0105247_10062814 | |||
| 1423 | Ga0114129_10053822 | |||
| 1424 | Ga0114129_10097181 | |||
| 1425 | Ga0114129_10229244 | |||
| 1426 | Ga0114129_10652340 | |||
| 1427 | Ga0105243_10008080 | |||
| 1428 | Ga0105243_10031539 | |||
| 1429 | Ga0105243_10230951 | |||
| 1430 | Ga0105243_10283021 | |||
| 1431 | Ga0105241_10027743 | |||
| 1432 | Ga0105241_10128056 | |||
| 1433 | Ga0105241_10159805 | |||
| 1434 | Ga0105242_10000350 | |||
| 1435 | Ga0105242_10035266 | |||
| 1436 | Ga0105242_10078490 | |||
| 1437 | Ga0105242_10131844 | |||
| 1438 | Ga0105248_10013825 | |||
| 1439 | Ga0105248_10015595 | |||
| 1440 | Ga0105248_10019063 | |||
| 1441 | Ga0105248_10037197 | |||
| 1442 | Ga0105248_10080964 | |||
| 1443 | Ga0105248_10145105 | |||
| 1444 | Ga0105237_10066040 | |||
| 1445 | Ga0105237_10173347 | |||
| 1446 | Ga0105237_10182842 | |||
| 1447 | Ga0105237_10202763 | |||
| 1448 | Ga0105237_10383751 | |||
| 1449 | Ga0105249_10007137 | |||
| 1450 | Ga0105249_10122164 | |||
| 1451 | Ga0105239_10017528 | |||
| 1452 | Ga0105239_10114074 | |||
| 1453 | Ga0105239_10311499 | |||
| 1454 | Ga0105239_10348954 | |||
| 1455 | Ga0105246_10002609 | |||
| 1456 | Ga0105246_10148574 | |||
| 1457 | Ga0157373_10045507 | |||
| 1458 | Ga0157371_10135704 | |||
| 1459 | Ga0157370_10322474 | |||
| 1460 | Ga0157369_10095876 | |||
| 1461 | Ga0157369_10174759 | |||
| 1462 | Ga0157374_10032360 | |||
| 1463 | Ga0157374_10053103 | |||
| 1464 | Ga0157374_10054750 | |||
| 1465 | Ga0157374_10062182 | |||
| 1466 | Ga0157374_10065956 | |||
| 1467 | Ga0157374_10099654 | |||
| 1468 | Ga0157378_10043205 | |||
| 1469 | Ga0157378_10107630 | |||
| 1470 | Ga0157378_10254793 | |||
| 1471 | Ga0163162_10010530 | |||
| 1472 | Ga0163162_10068510 | |||
| 1473 | Ga0163162_10095629 | |||
| 1474 | Ga0163162_10420014 | |||
| 1475 | Ga0157372_10009499 | |||
| 1476 | Ga0157372_10084860 | |||
| 1477 | Ga0157375_10002791 | |||
| 1478 | Ga0157375_10022203 | |||
| 1479 | Ga0157375_10113058 | |||
| 1480 | Ga0157375_10246096 | |||
| 1481 | Ga0157375_10316399 | |||
| 1482 | Ga0157375_10346805 | |||
| 1483 | Ga0163163_10016636 | |||
| 1484 | Ga0163163_10043798 | |||
| 1485 | Ga0163163_10054275 | |||
| 1486 | Ga0163163_10100808 | |||
| 1487 | Ga0163163_10166611 | |||
| 1488 | Ga0163163_10170037 | |||
| 1489 | Ga0163163_10276705 | |||
| 1490 | Ga0157380_10009701 | |||
| 1491 | Ga0157380_10100720 | |||
| 1492 | Ga0157380_10121457 | |||
| 1493 | Ga0157380_10131344 | |||
| 1494 | Ga0157380_10145235 | |||
| 1495 | Ga0157380_10270244 | |||
| 1496 | Ga0157377_10000341 | |||
| 1497 | Ga0157377_10059329 | |||
| 1498 | Ga0157379_10106097 | |||
| 1499 | Ga0157379_10287188 | |||
| 1500 | Ga0157376_10000663 | |||
| 1501 | Ga0157376_10040464 | |||
| 1502 | Ga0157376_10141002 | |||
| 1503 | Ga0157376_10187083 | |||
| 1504 | Ga0157376_10424407 | |||
| 1505 | Ga0163161_10000379 | |||
| 1506 | Ga0163161_10264180 | |||
| 1507 | Ga0207666_1000103 | |||
| 1508 | Ga0209758_1002448 | |||
| 1509 | Ga0209758_1008580 | |||
| 1510 | Ga0207697_10001374 | |||
| 1511 | Ga0207697_10055588 | |||
| 1512 | Ga0207653_10008349 | |||
| 1513 | Ga0207682_10000043 | |||
| 1514 | Ga0207682_10001519 | |||
| 1515 | Ga0207682_10001931 | |||
| 1516 | Ga0207692_10003295 | |||
| 1517 | Ga0207692_10006313 | |||
| 1518 | Ga0207642_10007175 | |||
| 1519 | Ga0207710_10008560 | |||
| 1520 | Ga0207710_10049955 | |||
| 1521 | Ga0207688_10000083 | |||
| 1522 | Ga0207688_10004971 | |||
| 1523 | Ga0207680_10006796 | |||
| 1524 | Ga0207647_10003002 | |||
| 1525 | Ga0207685_10000528 | |||
| 1526 | Ga0207685_10000914 | |||
| 1527 | Ga0207699_10006599 | |||
| 1528 | Ga0207699_10010546 | |||
| 1529 | Ga0207699_10045368 | |||
| 1530 | Ga0207645_10000899 | |||
| 1531 | Ga0207645_10014247 | |||
| 1532 | Ga0207645_10070342 | |||
| 1533 | Ga0207643_10000128 | |||
| 1534 | Ga0207643_10038664 | |||
| 1535 | Ga0207643_10140506 | |||
| 1536 | Ga0207684_10204578 | |||
| 1537 | Ga0207654_10005950 | |||
| 1538 | Ga0207707_10001534 | |||
| 1539 | Ga0207707_10004166 | |||
| 1540 | Ga0207707_10055634 | |||
| 1541 | Ga0207707_10345496 | |||
| 1542 | Ga0207695_10089205 | |||
| 1543 | Ga0207695_10247016 | |||
| 1544 | Ga0207671_10057611 | |||
| 1545 | Ga0207671_10073915 | |||
| 1546 | Ga0207671_10113763 | |||
| 1547 | Ga0207671_10156329 | |||
| 1548 | Ga0207671_10192162 | |||
| 1549 | Ga0207693_10003105 | |||
| 1550 | Ga0207693_10117568 | |||
| 1551 | Ga0207693_10156925 | |||
| 1552 | Ga0207663_10003674 | |||
| 1553 | Ga0207663_10009887 | |||
| 1554 | Ga0207663_10027621 | |||
| 1555 | Ga0207660_10023127 | |||
| 1556 | Ga0207660_10044159 | |||
| 1557 | Ga0207660_10049075 | |||
| 1558 | Ga0207662_10000975 | |||
| 1559 | Ga0207662_10231736 | |||
| 1560 | Ga0207657_10020169 | |||
| 1561 | Ga0207649_10002321 | |||
| 1562 | Ga0207652_10005425 | |||
| 1563 | Ga0207652_10013947 | |||
| 1564 | Ga0207652_10024211 | |||
| 1565 | Ga0207652_10027543 | |||
| 1566 | Ga0207652_10056338 | |||
| 1567 | Ga0207646_10220450 | |||
| 1568 | Ga0207681_10006781 | |||
| 1569 | Ga0207681_10188193 | |||
| 1570 | Ga0207694_10032282 | |||
| 1571 | Ga0207650_10008902 | |||
| 1572 | Ga0207650_10123258 | |||
| 1573 | Ga0207659_10007188 | |||
| 1574 | Ga0207659_10050993 | |||
| 1575 | Ga0207687_10000522 | |||
| 1576 | Ga0207687_10062204 | |||
| 1577 | Ga0207687_10150080 | |||
| 1578 | Ga0207700_10004890 | |||
| 1579 | Ga0207700_10024078 | |||
| 1580 | Ga0207700_10025747 | |||
| 1581 | Ga0207700_10149321 | |||
| 1582 | Ga0207664_10010948 | |||
| 1583 | Ga0207644_10000611 | |||
| 1584 | Ga0207644_10006011 | |||
| 1585 | Ga0207644_10075011 | |||
| 1586 | Ga0207690_10003223 | |||
| 1587 | Ga0207706_10001616 | |||
| 1588 | Ga0207706_10015033 | |||
| 1589 | Ga0207686_10014769 | |||
| 1590 | Ga0207686_10056767 | |||
| 1591 | Ga0207709_10009743 | |||
| 1592 | Ga0207709_10026097 | |||
| 1593 | Ga0207709_10248435 | |||
| 1594 | Ga0207709_10262109 | |||
| 1595 | Ga0207670_10000631 | |||
| 1596 | Ga0207670_10007366 | |||
| 1597 | Ga0207669_10000797 | |||
| 1598 | Ga0207669_10002598 | |||
| 1599 | Ga0207669_10290147 | |||
| 1600 | Ga0207704_10047461 | |||
| 1601 | Ga0207704_10292194 | |||
| 1602 | Ga0207665_10001379 | |||
| 1603 | Ga0207665_10009568 | |||
| 1604 | Ga0207665_10092666 | |||
| 1605 | Ga0207691_10000599 | |||
| 1606 | Ga0207691_10002935 | |||
| 1607 | Ga0207691_10019716 | |||
| 1608 | Ga0207691_10023830 | |||
| 1609 | Ga0207691_10173454 | |||
| 1610 | Ga0207711_10008296 | |||
| 1611 | Ga0207711_10010676 | |||
| 1612 | Ga0207711_10052202 | |||
| 1613 | Ga0207711_10077904 | |||
| 1614 | Ga0207711_10235281 | |||
| 1615 | Ga0207689_10000165 | |||
| 1616 | Ga0207689_10054251 | |||
| 1617 | Ga0207689_10126494 | |||
| 1618 | Ga0207689_10181700 | |||
| 1619 | Ga0207689_10266925 | |||
| 1620 | Ga0207689_10320271 | |||
| 1621 | Ga0207661_10004909 | |||
| 1622 | Ga0207661_10011748 | |||
| 1623 | Ga0207661_10047173 | |||
| 1624 | Ga0207679_10000112 | |||
| 1625 | Ga0207667_10025956 | |||
| 1626 | Ga0207667_10203956 | |||
| 1627 | Ga0207667_10214557 | |||
| 1628 | Ga0207667_10313675 | |||
| 1629 | Ga0207651_10000099 | |||
| 1630 | Ga0207651_10031165 | |||
| 1631 | Ga0207712_10001957 | |||
| 1632 | Ga0207668_10003391 | |||
| 1633 | Ga0207668_10110071 | |||
| 1634 | Ga0207668_10113802 | |||
| 1635 | Ga0207668_10115342 | |||
| 1636 | Ga0207668_10126611 | |||
| 1637 | Ga0207668_10204806 | |||
| 1638 | Ga0207668_10226629 | |||
| 1639 | Ga0207640_10000382 | |||
| 1640 | Ga0207658_10035295 | |||
| 1641 | Ga0207658_10276669 | |||
| 1642 | Ga0207677_10005315 | |||
| 1643 | Ga0207677_10010700 | |||
| 1644 | Ga0207677_10133847 | |||
| 1645 | Ga0207677_10174836 | |||
| 1646 | Ga0207677_10189017 | |||
| 1647 | Ga0207703_10004258 | |||
| 1648 | Ga0207703_10025231 | |||
| 1649 | Ga0207639_10032542 | |||
| 1650 | Ga0207639_10042404 | |||
| 1651 | Ga0207639_10205900 | |||
| 1652 | Ga0207639_10208433 | |||
| 1653 | Ga0207639_10269595 | |||
| 1654 | Ga0207639_10285271 | |||
| 1655 | Ga0207678_10003272 | |||
| 1656 | Ga0207678_10007002 | |||
| 1657 | Ga0207678_10031527 | |||
| 1658 | Ga0207678_10056323 | |||
| 1659 | Ga0207678_10299181 | |||
| 1660 | Ga0207708_10012755 | |||
| 1661 | Ga0207708_10148868 | |||
| 1662 | Ga0207708_10397502 | |||
| 1663 | Ga0207702_10093858 | |||
| 1664 | Ga0207702_10142451 | |||
| 1665 | Ga0207641_10001777 | |||
| 1666 | Ga0207648_10007480 | |||
| 1667 | Ga0207648_10031836 | |||
| 1668 | Ga0207648_10047840 | |||
| 1669 | Ga0207676_10000494 | |||
| 1670 | Ga0207676_10014703 | |||
| 1671 | Ga0207676_10123689 | |||
| 1672 | Ga0207674_10020449 | |||
| 1673 | Ga0207674_10035721 | |||
| 1674 | Ga0207674_10082755 | |||
| 1675 | Ga0207674_10099104 | |||
| 1676 | Ga0207674_10102256 | |||
| 1677 | Ga0207675_100003533 | |||
| 1678 | Ga0207675_100301176 | |||
| 1679 | Ga0207683_10001272 | |||
| 1680 | Ga0207683_10001853 | |||
| 1681 | Ga0207683_10007911 | |||
| 1682 | Ga0207683_10011627 | |||
| 1683 | Ga0207683_10014162 | |||
| 1684 | Ga0207683_10015318 | |||
| 1685 | Ga0207683_10027632 | |||
| 1686 | Ga0207683_10042796 | |||
| 1687 | Ga0207683_10185536 | |||
| 1688 | Ga0207683_10194398 | |||
| 1689 | Ga0207698_10063441 | |||
| 1690 | Ga0207698_10070195 | |||
| 1691 | Ga0210002_1001992 | |||
| 1692 | Ga0209998_10001588 | |||
| 1693 | Ga0209813_10016915 | |||
| 1694 | Ga0209974_10032320 | |||
| 1695 | Ga0207428_10000064 | |||
| 1696 | Ga0207428_10000140 | |||
| 1697 | Ga0268266_10004422 | |||
| 1698 | Ga0268266_10007719 | |||
| 1699 | Ga0268266_10025484 | |||
| 1700 | Ga0268266_10047939 | |||
| 1701 | Ga0268266_10055302 | |||
| 1702 | Ga0268266_10110471 | |||
| 1703 | Ga0268266_10127814 | |||
| 1704 | Ga0268266_10195528 | |||
| 1705 | Ga0268266_10318353 | |||
| 1706 | Ga0268266_10365962 | |||
| 1707 | Ga0268266_10418333 | |||
| 1708 | Ga0268265_10011223 | |||
| 1709 | Ga0268265_10026351 | |||
| 1710 | Ga0268265_10113231 | |||
| 1711 | Ga0268265_10205865 | |||
| 1712 | Ga0268264_10000107 | |||
| 1713 | Ga0268264_10005082 | |||
| 1714 | Ga0268264_10086725 | |||
| 1715 | Ga0268264_10104967 | |||
| 1716 | Ga0265334_10015125 | |||
| 1717 | Ga0307515_10060988 | |||
| 1718 | Ga0265332_10050236 | |||
| 1719 | Ga0265328_10058289 | |||
| 1720 | Ga0265325_10000006 | |||
| 1721 | Ga0265325_10075637 | |||
| 1722 | Ga0265329_10012070 | |||
| 1723 | Ga0265340_10014381 | |||
| 1724 | Ga0265339_10006887 | |||
| 1725 | Ga0265331_10034717 | |||
| 1726 | Ga0265316_10221091 | |||
| 1727 | Ga0307513_10077502 | |||
| 1728 | Ga0307513_10144650 | |||
| 1729 | Ga0307509_10021381 | |||
| 1730 | Ga0265313_10023271 | |||
| 1731 | Ga0307508_10000154 | |||
| 1732 | Ga0307508_10265459 | |||
| 1733 | Ga0265314_10005615 | |||
| 1734 | Ga0265342_10003968 | |||
| 1735 | Ga0265342_10017314 | |||
| 1736 | Ga0265342_10102272 | |||
| 1737 | Ga0265342_10106101 | |||
| 1738 | Ga0307516_10029059 | |||
| 1739 | Ga0307410_10174005 | |||
| 1740 | Ga0307416_100063443 | |||
| 1741 | Ga0307510_10156282 | |||
| 1742 | Ga0315911_1000008 | |||
| 1743 | Ga0373930_0001231 | |||
| 1744 | Ga0373958_0010245 | |||
| 1745 | Ga0373959_0002918 | |||
| 1746 | Ga0373938_0015719 | |||
| 1747 | Ga0373928_0022088 | |||
| 1748 | Ga0373929_0017606 | |||
| 1749 | Ga0373934_0023900 | |||
| 1750 | Ga0373940_0004788 | |||
| 1751 | Ga0373952_0000859 | |||
| 1752 | Ga0373952_0004422 | |||
| 1753 | Ga0373923_0040479 | |||
| 1754 | Ga0373923_0051674 | |||
| 1755 | Ga0373923_0119338 | |||
| 1756 | Ga0373936_0006063 | |||
| 1757 | Ga0373941_0000494 | |||
| 1758 | Ga0373941_0005534 | |||
| 1759 | Ga0373941_0007844 | |||
| 1760 | Ga0373953_0001092 | |||
| 1761 | Ga0373953_0004155 | |||
| 1762 | Ga0373953_0019195 | |||
| 1763 | Ga0373954_0001821 | |||
| 1764 | Ga0373954_0046149 | |||
| 1765 | Ga0373956_0002051 | |||
| 1766 | Ga0373956_0002956 | |||
| 1767 | Ga0373957_0000374 | |||
| 1768 | Ga0373960_0000398 | |||
| 1769 | Ga0373960_0040243 | |||
| 1770 | Ga0373943_0005372 | |||
| 1771 | Ga0373943_0052716 | |||
| 1772 | Ga0373943_0162967 | |||
| 1773 | Ga0373946_0027757 | |||
| 1774 | Ga0373946_0137298 | |||
| 1775 | Ga0373955_0009267 | |||
| 1776 | Ga0373955_0009372 | |||
| 1777 | Ga0373955_0011740 | |||
| 1778 | Ga0373955_0046015 | |||
| 1779 | Ga0373962_0003525 | |||
| 1780 | Ga0373962_0022368 | |||
| 1781 | Ga0373924_0020683 | |||
| 1782 | Ga0373931_0001718 | |||
| 1783 | Ga0373931_0014040 | |||
| 1784 | Ga0373931_0019150 | |||
| 1785 | Ga0373931_0034618 | |||
| 1786 | Ga0373935_0006022 | |||
| 1787 | Ga0373935_0083521 | |||
| 1788 | Ga0373935_0107474 | |||
| 1789 | Ga0373935_0206185 | |||
| 1790 | Ga0373927_0025352 | |||
| 1791 | Ga0373927_0042636 | |||
| 1792 | Ga0373927_0153904 | |||
| 1793 | Ga0373933_0001100 | |||
| 1794 | Ga0373933_0045156 | |||
| 1795 | Ga0373947_0000340 | |||
| 1796 | Ga0373947_0035595 | |||
| 1797 | Ga0373947_0064359 | |||
| 1798 | Ga0373947_0088961 | |||
| 1799 | Ga0373947_0170331 | |||
| 1800 | Ga0373937_0001302 | |||
| 1801 | Ga0373937_0002947 | |||
| 1802 | Ga0373937_0005103 | |||
| 1803 | Ga0373937_0017774 | |||
| 1804 | Ga0373937_0064217 | |||
| 1805 | Ga0373937_0318829 | |||
| 1806 | Ga0373925_0007663 | |||
| 1807 | Ga0373925_0008452 | |||
| 1808 | Ga0373925_0020271 | |||
| 1809 | Ga0373925_0052361 | |||
| 1810 | Ga0436364_1064018 | |||
| 1811 | Ga0395901_0784501 | |||
| 1812 | Ga0436365_0702073 | |||
| 1813 | Ga0439453_0000060 | |||
| 1814 | Ga0451807_0668963 | |||
| 1815 | Ga0439435_0002105 | |||
| 1816 | Ga0466957_0033043 | |||
| 1817 | Ga0466958_0114579 | |||
| 1818 | Ga0466967_0122303 | |||
| 1819 | Ga0495592_0001601 | |||
| 1820 | Ga0495592_0005759 | |||
| 1821 | Ga0495603_0019964 | |||
| 1822 | Ga0495603_0022944 | |||
| 1823 | Ga0495603_0025589 | |||
| 1824 | Ga0495603_0053963 | |||
| 1825 | Ga0495603_0099568 | |||
| 1826 | Ga0495629_0000529 | |||
| 1827 | Ga0495629_0008986 | |||
| 1828 | Ga0495629_0046527 | |||
| 1829 | Ga0495629_0059688 | |||
| 1830 | Ga0495629_0172112 | |||
| 1831 | Ga0495638_0009159 | |||
| 1832 | Ga0495638_0011077 | |||
| 1833 | Ga0495651_0001433 | |||
| 1834 | Ga0495651_0020115 | |||
| 1835 | Ga0495651_0195766 | |||
| 1836 | Ga0495651_0260327 | |||
| 1837 | Ga0495653_0016031 | |||
| 1838 | Ga0495653_0051871 | |||
| 1839 | Ga0495653_0089488 | |||
| 1840 | Ga0495653_0090070 | |||
| 1841 | Ga0495653_0160841 | |||
| 1842 | Ga0495582_0006293 | |||
| 1843 | Ga0495605_0058205 | |||
| 1844 | Ga0495605_0126410 | |||
| 1845 | Ga0495639_0009690 | |||
| 1846 | Ga0495639_0034011 | |||
| 1847 | Ga0495639_0066427 | |||
| 1848 | Ga0495664_0018790 | |||
| 1849 | Ga0495664_0023312 | |||
| 1850 | Ga0495664_0029806 | |||
| 1851 | Ga0495664_0037955 | |||
| 1852 | Ga0495584_0120905 | |||
| 1853 | Ga0495585_0031604 | |||
| 1854 | Ga0495585_0038601 | |||
| 1855 | Ga0495585_0105382 | |||
| 1856 | Ga0495594_0054755 | |||
| 1857 | Ga0495583_0104207 | |||
| 1858 | Ga0495606_0001566 | |||
| 1859 | Ga0495606_0074530 | |||
| 1860 | Ga0495608_0008113 | |||
| 1861 | Ga0495608_0011568 | |||
| 1862 | Ga0495608_0016511 | |||
| 1863 | Ga0495608_0098528 | |||
| 1864 | Ga0495618_0015173 | |||
| 1865 | Ga0495618_0048917 | |||
| 1866 | Ga0495628_0002572 | |||
| 1867 | Ga0495628_0007597 | |||
| 1868 | Ga0495628_0015999 | |||
| 1869 | Ga0495628_0314441 | |||
| 1870 | Ga0495630_0040548 | |||
| 1871 | Ga0495630_0103006 | |||
| 1872 | Ga0495631_0115442 | |||
| 1873 | Ga0495666_0069319 | |||
| 1874 | Ga0495652_0002428 | |||
| 1875 | Ga0495652_0091823 | |||
| 1876 | Ga0495652_0115683 | |||
| 1877 | Ga0495665_0005351 | |||
| 1878 | Ga0495665_0085638 | |||
| 1879 | Ga0495640_0015450 | |||
| 1880 | Ga0495640_0047337 | |||
| 1881 | Ga0495640_0064294 | |||
| 1882 | Ga0495587_0009736 | |||
| 1883 | Ga0495587_0052159 | |||
| 1884 | Ga0495598_0017520 | |||
| 1885 | Ga0495609_0090437 | |||
| 1886 | Ga0495621_0023115 | |||
| 1887 | Ga0495621_0050206 | |||
| 1888 | Ga0495645_0001788 | |||
| 1889 | Ga0495645_0025716 | |||
| 1890 | Ga0495645_0028258 | |||
| 1891 | Ga0495645_0038226 | |||
| 1892 | Ga0495645_0052493 | |||
| 1893 | Ga0495645_0094722 | |||
| 1894 | Ga0495667_0003563 | |||
| 1895 | Ga0495667_0005768 | |||
| 1896 | Ga0495667_0119452 | |||
| 1897 | Ga0495656_0016994 | |||
| 1898 | Ga0495656_0032549 | |||
| 1899 | Ga0495656_0035929 | |||
| 1900 | Ga0495656_0091561 | |||
| 1901 | Ga0495668_0118180 | |||
| 1902 | Ga0495634_0004321 | |||
| 1903 | Ga0495625_0082150 | |||
| 1904 | Ga0495635_0000429 | |||
| 1905 | Ga0495635_0013995 | |||
| 1906 | Ga0495635_0027056 | |||
| 1907 | Ga0495635_0322937 | |||
| 1908 | Ga0495659_0007040 | |||
| 1909 | Ga0495659_0033686 | |||
| 1910 | Ga0495588_0083701 | |||
| 1911 | Ga0495657_0009336 | |||
| 1912 | Ga0495657_0010262 | |||
| 1913 | Ga0495657_0013260 | |||
| 1914 | Ga0495599_0003035 | |||
| 1915 | Ga0495623_0007229 | |||
| 1916 | Ga0495623_0007655 | |||
| 1917 | Ga0495623_0049055 | |||
| 1918 | Ga0495623_0102314 | |||
| 1919 | Ga0495623_0127033 | |||
| 1920 | Ga0495646_0001304 | |||
| 1921 | Ga0495646_0043515 | |||
| 1922 | Ga0495647_0008584 | |||
| 1923 | Ga0495658_0000781 | |||
| 1924 | Ga0495658_0011048 | |||
| 1925 | Ga0495669_0077313 | |||
| 1926 | Ga0495669_0083675 | |||
| 1927 | Ga0495613_0006286 | |||
| 1928 | Ga0495613_0029327 | |||
| 1929 | Ga0495613_0219605 | |||
| 1930 | Ga0495624_0040078 | |||
| 1931 | Ga0495624_0081726 | |||
| 1932 | Ga0495624_0132083 | |||
| 1933 | Ga0495670_0012130 | |||
| 1934 | Ga0495649_0080821 | |||
| 1935 | Ga0495600_0007607 | |||
| 1936 | Ga0495600_0014546 | |||
| 1937 | Ga0495581_0005737 | |||
| 1938 | Ga0495581_0030017 | |||
| 1939 | Ga0495581_0092012 | |||
| 1940 | Ga0495604_0002235 | |||
| 1941 | Ga0495604_0002822 | |||
| 1942 | Ga0495604_0010023 | |||
| 1943 | Ga0495604_0116513 | |||
| 1944 | Ga0495674_0004206 | |||
| 1945 | Ga0495674_0006763 | |||
| 1946 | Ga0495674_0021636 | |||
| 1947 | Ga0495674_0082394 | |||
| 1948 | Ga0495674_0198450 | |||
| 1949 | Ga0495672_0032259 | |||
| 1950 | Ga0495672_0106579 | |||
| 1951 | Ga0495676_0062585 | |||
| 1952 | Ga0495676_0121550 | |||
| 1953 | Ga0495680_0006824 | |||
| 1954 | Ga0495680_0029393 | |||
| 1955 | Ga0495675_0002904 | |||
| 1956 | Ga0495675_0067445 | |||
| 1957 | Ga0495684_0000497 | |||
| 1958 | Ga0495684_0015464 | |||
| 1959 | Ga0495684_0016411 | |||
| 1960 | Ga0495684_0025159 | |||
| 1961 | Ga0495684_0281626 | |||
| 1962 | Ga0495686_0147868 | |||
| 1963 | Ga0495593_0014868 | |||
| 1964 | Ga0495593_0014947 | |||
| 1965 | Ga0495593_0016723 | |||
| 1966 | Ga0495593_0023433 | |||
| 1967 | Ga0495602_0040996 | |||
| 1968 | Ga0495602_0128581 | |||
| 1969 | Ga0495602_0152128 | |||
| 1970 | Ga0495614_0010418 | |||
| 1971 | Ga0495614_0018899 | |||
| 1972 | Ga0495615_0000368 | |||
| 1973 | Ga0495615_0012724 | |||
| 1974 | Ga0496100_0012538 | |||
| 1975 | Ga0496100_0015511 | |||
| 1976 | Ga0496100_0040306 | |||
| 1977 | Ga0496100_0072267 | |||
| 1978 | Ga0496100_0128194 | |||
| 1979 | Ga0496100_0249420 | |||
| 1980 | Ga0496100_0279397 | |||
| 1981 | Ga0496101_0000235 | |||
| 1982 | Ga0496101_0001165 | |||
| 1983 | Ga0496101_0008415 | |||
| 1984 | Ga0496101_0019223 | |||
| 1985 | Ga0496101_0052924 | |||
| 1986 | Ga0496101_0053933 | |||
| 1987 | Ga0496101_0195594 | |||
| 1988 | Ga0496102_0005341 | |||
| 1989 | Ga0496102_0022951 | |||
| 1990 | Ga0496102_0028248 | |||
| 1991 | Ga0496102_0039515 | |||
| 1992 | Ga0496102_0155347 | |||
| 1993 | Ga0496103_0003790 | |||
| 1994 | Ga0496103_0011444 | |||
| 1995 | Ga0496103_0014101 | |||
| 1996 | Ga0496104_0000351 | |||
| 1997 | Ga0496104_0003146 | |||
| 1998 | Ga0496104_0008914 | |||
| 1999 | Ga0496104_0215047 | |||
| 2000 | Ga0496104_0250055 | |||
| 2001 | Ga0496104_0285969 | |||
| 2002 | Ga0496104_0499306 | |||
| 2003 | Ga0496105_0000840 | |||
| 2004 | Ga0496105_0006427 | |||
| 2005 | Ga0496105_0012927 | |||
| 2006 | Ga0496105_0029441 | |||
| 2007 | Ga0496105_0030009 | |||
| 2008 | Ga0496105_0037048 | |||
| 2009 | Ga0496105_0190590 | |||
| 2010 | Ga0496106_0000788 | |||
| 2011 | Ga0496106_0002108 | |||
| 2012 | Ga0496106_0010763 | |||
| 2013 | Ga0496106_0011781 | |||
| 2014 | Ga0496106_0169369 | |||
| 2015 | Ga0496106_0181176 | |||
| 2016 | Ga0496106_0186831 | |||
| 2017 | Ga0496106_0325966 | |||
| 2018 | Ga0496107_0004819 | |||
| 2019 | Ga0496107_0011301 | |||
| 2020 | Ga0496107_0013863 | |||
| 2021 | Ga0496107_0030116 | |||
| 2022 | Ga0496107_0074682 | |||
| 2023 | Ga0496107_0111973 | |||
| 2024 | Ga0496108_0011130 | |||
| 2025 | Ga0496108_0016530 | |||
| 2026 | Ga0496108_0019665 | |||
| 2027 | Ga0496108_0037794 | |||
| 2028 | Ga0496108_0082807 | |||
| 2029 | Ga0496108_0237162 | |||
| 2030 | Ga0496109_0005654 | |||
| 2031 | Ga0496109_0007962 | |||
| 2032 | Ga0496109_0023341 | |||
| 2033 | Ga0496109_0027237 | |||
| 2034 | Ga0496109_0028566 | |||
| 2035 | Ga0496109_0040011 | |||
| 2036 | Ga0496109_0045566 | |||
| 2037 | Ga0496110_0034051 | |||
| 2038 | Ga0496110_0039961 | |||
| 2039 | Ga0496110_0075409 | |||
| 2040 | Ga0496110_0492910 | |||
| 2041 | Ga0496111_0002946 | |||
| 2042 | Ga0496111_0009883 | |||
| 2043 | Ga0496111_0039701 | |||
| 2044 | Ga0496111_0057681 | |||
| 2045 | Ga0496112_0000018 | |||
| 2046 | Ga0496112_0011859 | |||
| 2047 | Ga0496112_0013345 | |||
| 2048 | Ga0496112_0030393 | |||
| 2049 | Ga0496112_0069569 | |||
| 2050 | Ga0496112_0334061 | |||
| 2051 | Ga0496112_0421533 | |||
| 2052 | Ga0496113_0013732 | |||
| 2053 | Ga0496113_0017464 | |||
| 2054 | Ga0496113_0035587 | |||
| 2055 | Ga0496113_0062084 | |||
| 2056 | Ga0496113_0071978 | |||
| 2057 | Ga0496114_0009940 | |||
| 2058 | Ga0496114_0023363 | |||
| 2059 | Ga0496114_0037148 | |||
| 2060 | Ga0496114_0048719 | |||
| 2061 | Ga0496114_0066495 | |||
| 2062 | Ga0496114_0112239 | |||
| 2063 | Ga0496115_0002701 | |||
| 2064 | Ga0496115_0010842 | |||
| 2065 | Ga0496115_0019196 | |||
| 2066 | Ga0496115_0050174 | |||
| 2067 | Ga0496115_0078464 | |||
| 2068 | Ga0496115_0109684 | |||
| 2069 | Ga0496115_0123713 | |||
| 2070 | Ga0496116_0227024 | |||
| 2071 | Ga0496117_0007128 | |||
| 2072 | Ga0496117_0074479 | |||
| 2073 | Ga0496118_0003592 | |||
| 2074 | Ga0496118_0078665 | |||
| 2075 | Ga0496119_0055304 | |||
| 2076 | Ga0496121_0000640 | |||
| 2077 | Ga0496121_0038643 | |||
| 2078 | Ga0496121_0046507 | |||
| 2079 | Ga0496121_0048134 | |||
| 2080 | Ga0496121_0093528 | |||
| 2081 | Ga0496121_0188119 | |||
| 2082 | Ga0496124_0002189 | |||
| 2083 | Ga0496125_0085843 | |||
| 2084 | Ga0496126_0009499 | |||
| 2085 | Ga0496126_0018354 | |||
| 2086 | Ga0496126_0043259 | |||
| 2087 | Ga0496126_0047915 | |||
| 2088 | Ga0496126_0068906 | |||
| 2089 | Ga0496126_0080924 | |||
| 2090 | Ga0496126_0115449 | |||
| 2091 | Ga0496126_0164235 | |||
| 2092 | Ga0496126_0254389 | |||
| 2093 | Ga0501036_0003984 | |||
| 2094 | Ga0501037_0025075 | |||
| 2095 | Ga0501037_0040497 | |||
| 2096 | Ga0501038_0040262 | |||
| 2097 | Ga0501046_0067505 | |||
| 2098 | Ga0501047_0000100 | |||
| 2099 | Ga0501047_0052511 | |||
| 2100 | Ga0501048_0000083 | |||
| 2101 | Ga0501048_0098144 | |||
| 2102 | Ga0501068_0041556 | |||
| 2103 | Ga0501070_0009792 | |||
| 2104 | Ga0501070_0152053 | |||
| 2105 | Ga0501070_0215422 | |||
| 2106 | Ga0501072_0003943 | |||
| 2107 | Ga0501072_0218576 | |||
| 2108 | Ga0501074_0017935 | |||
| 2109 | Ga0501074_0040074 | |||
| 2110 | Ga0501074_0046177 | |||
| 2111 | Ga0501079_0033083 | |||
| 2112 | Ga0501080_0000030 | |||
| 2113 | Ga0501080_0029073 | |||
| 2114 | Ga0501080_0290083 | |||
| 2115 | Ga0501083_0002641 | |||
| 2116 | Ga0501083_0194828 | |||
| 2117 | Ga0501035_0023582 | |||
| 2118 | Ga0501035_0438882 | |||
| 2119 | Ga0501044_0000587 | |||
| 2120 | nmdc:mga03n38_150788_c1 | |||
| 2121 | nmdc:mga0yw44_104257_c1 | |||
| 2122 | nmdc:mga0yw44_63102_c1 | |||
| 2123 | nmdc:mga0k408_2505_c2 | |||
| 2124 | nmdc:mga0k408_36277_c1 | |||
| 2125 | nmdc:mga06z11_34154_c1 | |||
| 2126 | nmdc:mga06z11_4911_c1 | |||
| 2127 | nmdc:mga07m45_49692_c1 | |||
| 2128 | nmdc:mga05p37_10233_c1 | |||
| 2129 | nmdc:mga05p37_166916_c1 | |||
| 2130 | nmdc:mga05p37_225_c1 | |||
| 2131 | nmdc:mga09592_244_c1 | |||
| 2132 | nmdc:mga09592_58040_c1 | |||
| 2133 | nmdc:mga09592_736_c1 | |||
| 2134 | nmdc:mga0qj67_215_c1 | |||
| 2135 | nmdc:mga0qj67_2611_c1 | |||
| 2136 | nmdc:mga0qj67_4314_c1 | |||
| 2137 | nmdc:mga06r32_12515_c1 | |||
| 2138 | nmdc:mga06r32_341_c1 | |||
| 2139 | nmdc:mga06r32_731_c1 | |||
| 2140 | nmdc:mga08y16_131595_c1 | |||
| 2141 | nmdc:mga08y16_145004_c1 | |||
| 2142 | nmdc:mga08y16_252107_c1 | |||
| 2143 | nmdc:mga08y16_617_c1 | |||
| 2144 | nmdc:mga08y16_6190_c1 | |||
| 2145 | nmdc:mga0n895_308807_c1 | |||
| 2146 | nmdc:mga0n895_457_c1 | |||
| 2147 | nmdc:mga0n895_543324_c1 | |||
| 2148 | nmdc:mga0rr50_11539_c1 | |||
| 2149 | nmdc:mga0rr50_19557_c1 | |||
| 2150 | nmdc:mga08x19_81571_c1 | |||
| 2151 | nmdc:mga0a205_1019_c1 | |||
| 2152 | nmdc:mga0a205_17989_c1 | |||
| 2153 | Ga0495601_0000413 | |||
| 2154 | Ga0495601_0000668 | |||
| 2155 | Ga0495601_0005956 | |||
| 2156 | Ga0495601_0007499 | |||
| 2157 | Ga0495601_0018585 | |||
| 2158 | Ga0495601_0060131 | |||
| 2159 | Ga0495612_0001564 | |||
| 2160 | Ga0495612_0002430 | |||
| 2161 | Ga0495612_0006791 | |||
| 2162 | Ga0495612_0008871 | |||
| 2163 | Ga0495612_0019920 | |||
| 2164 | Ga0495595_0000516 | |||
| 2165 | Ga0495595_0001465 | |||
| 2166 | Ga0495595_0003553 | |||
| 2167 | Ga0495619_0001679 | |||
| 2168 | Ga0495619_0001957 | |||
| 2169 | Ga0495619_0002856 | |||
| 2170 | Ga0495619_0020676 | |||
| 2171 | Ga0495619_0054518 | |||
| 2172 | Ga0495619_0106148 | |||
| 2173 | Ga0495619_0128604 | |||
| 2174 | Ga0500651_0102011 | |||
| 2175 | Ga0500651_0185374 | |||
| 2176 | Ga0500566_0001625 | |||
| 2177 | Ga0500566_0013519 | |||
| 2178 | Ga0500566_0107849 | |||
| 2179 | Ga0500641_0098123 | |||
| 2180 | Ga0500648_043289 | |||
| 2181 | Ga0500594_0071074 | |||
| 2182 | Ga0500595_000010 | |||
| 2183 | Ga0500595_000095 | |||
| 2184 | Ga0500595_003699 | |||
| 2185 | Ga0500595_018815 | |||
| 2186 | Ga0500642_0017123 | |||
| 2187 | Ga0500658_0024140 | |||
| 2188 | Ga0500559_0047011 | |||
| 2189 | Ga0500573_0175702 | |||
| 2190 | Ga0500622_0054551 | |||
| 2191 | Ga0500627_0125752 | |||
| 2192 | Ga0500634_0069625 | |||
| 2193 | Ga0500638_006677 | |||
| 2194 | Ga0500636_0014540 | |||
| 2195 | Ga0500637_0000495 | |||
| 2196 | Ga0500596_004825 | |||
| 2197 | Ga0501082_0192337 | |||
| 2198 | Ga0530510_0058804 | |||
| 2199 | Ga0530510_0113785 | |||
| 2200 | Ga0530510_0192984 | |||
| 2201 | 2513661634 | |||
| 2202 | 2513863107 | |||
| 2203 | 2513923311 | |||
| 2204 | 2517889126 | |||
| 2205 | 2524541222 | |||
| 2206 | 2671121588 | |||
| 2207 | 2728753705 | |||
| 2208 | 2793072628 | |||
| 2209 | 2876818203 | |||
| 2210 | 2879115151 | |||
| 2211 | 2885382864 | |||
| 2212 | 2903756127 | |||
| 2213 | 2904690931 | |||
| 2214 | 2904708248 | |||
| 2215 | 2906613483 | |||
| 2216 | 2906643032 | |||
| 2217 | 2906668201 | |||
| 2218 | 2908747738 | |||
| 2219 | 2908756987 | |||
| 2220 | 2922388792 | |||
| 2221 | 2922433921 | |||
| 2222 | 2935634942 | |||
| 2223 | 2941514270 | |||
| 2224 | 2941522231 | |||
| 2225 | 2941530102 | |||
| 2226 | 3005475361 | |||
| 2227 | 8006935923 | |||
| 2228 | 8006975961 | |||
| 2229 | 8019562749 | |||
| 2230 | 8019572828 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4r74-assembly4.cif.gz_D | structure of the periplasmic binding protein afua from actinobacillus pleuropneumoniae (exogenous fructose-6-phosphate bound) | 0.9097 | 48 | 353 |
| 7f6o-assembly2.cif.gz_B | crystal structure of metal-citrate-binding mutant (s26a) protein (mcta) of abc transporter endogenously bound to mn2+-citrate complex | 0.8948 | 37 | 352 |
| 7f6p-assembly3.cif.gz_C | crystal structure of metal-citrate-binding mutant (d28a) protein (mcta) of abc transporter endogenously bound to citrate | 0.8946 | 37 | 352 |
| 6wce-assembly1.cif.gz_A | structure of the periplasmic binding protein p5pa | 0.8923 | 48 | 351 |
| 7f6e-assembly1.cif.gz_A | crystal structure of metal-citrate-binding protein (mcta) of abc transporter endogenously bound to mg2+-citrate complex (form i) | 0.8885 | 30 | 352 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4r74A01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8827 | 48 | 318 | 3.40.190.10 |
| 1y4tD01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8827 | 50 | 315 | 3.40.190.10 |
| af_Q2G1D9_30_309_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.869 | 50 | 330 | 3.40.190.10 |
| 1y4tD01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8661 | 50 | 315 | 3.40.190.10 |
| 4elqB01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8651 | 49 | 321 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537SX32-F1-model_v4 | Extracellular solute-binding protein | 0.9936 | 57 | 353 |
GO:0042597
GO:0046872 |
| AF-A0A537SX32-F1-model_v4 | Extracellular solute-binding protein | 0.987 | 57 | 353 |
GO:0042597
GO:0046872 |
| AF-A0A7S7TCI2-F1-model_v4 | Iron ABC transporter substrate-binding protein | 0.9867 | 19 | 353 |
GO:0046872
|
| AF-A0A1F9A1T1-F1-model_v4 | Iron ABC transporter substrate-binding protein | 0.9802 | 71 | 353 |
|
| AF-A0A1F7TGV6-F1-model_v4 | Iron ABC transporter substrate-binding protein | 0.9739 | 39 | 353 |
GO:0046872
|