F490393

General Info

Members Datasets Scaffolds Average Seq Length
1120 444 2230 352

Family's Representative Sequence

Representative Sequence 3300046492|Ga0495585_0004431|Ga0495585_0004431_3923_5149
Length 408
Sequence MAGAGRLLSRRKLLKAVAALPLAYAAPLCAEPPPAQAITPALIAAATKEGQLTWYTSADSQLAEKVGKAFEQKFRGVRVRVERAGGERIFARVAQEYASGLHVADAVSTGDAAQFLAWKRQELLAPYVPEDVARYIPPEHRDPDGFYASVRSSLCVIAYNTAMVKREDAPKSFANLLDLKWKGKIVKAHPSYSGTIMTSTYQMVRELSWSYLEQLARQQVLQVQSATDTPKKVVLGERPVMADGNESNVLLLKEAGGPIEVVYAAEGTPSIVQPSAIFVAAPHPNAARLFQNYLFGVEGQELFVNLGGLRSLHALVKDKPGRTPLSAIKVWKDDPAAVETQGEDIKRRYSLWCLITRSRGSTPRLHMKQLKQVLLSVSWVHDCRYKPSAGQPLPRFDLSRSQLVSGLR

Samples

Sample ID Description Type Environment
1 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
6 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
11 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
12 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
13 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
15 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
45 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
46 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
47 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
48 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
49 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
50 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
51 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
52 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
53 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
56 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
57 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
58 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
59 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
60 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
61 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
62 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
63 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
67 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
68 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
69 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
70 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
71 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
72 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
73 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
74 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
75 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
76 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
77 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
80 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
81 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
82 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
83 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
84 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
85 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
86 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
87 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
88 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
89 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
90 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
91 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
92 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
93 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
94 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
95 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
96 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
97 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
98 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
99 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
100 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
102 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
103 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
104 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
105 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
106 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
107 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
108 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
109 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
110 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
111 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
112 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
113 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
114 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
115 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
116 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
118 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
119 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
120 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
121 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
122 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
123 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
124 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
125 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
126 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
127 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
128 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
129 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
130 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
131 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
132 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
133 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
134 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
135 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
136 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
137 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
138 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
139 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
140 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
141 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
142 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
143 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
145 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
214 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
216 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
220 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
221 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
222 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
223 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
224 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
225 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
226 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
227 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
228 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
229 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
230 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
231 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
232 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
233 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
234 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
235 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
236 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
237 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
238 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
239 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
240 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
241 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
242 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
243 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
244 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
245 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
246 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
247 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
248 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
249 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
250 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
251 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
252 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
253 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
254 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
255 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
256 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
257 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
258 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
259 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
260 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
261 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
262 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
263 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
264 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
265 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
266 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
267 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
268 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
269 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
270 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
271 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
272 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
273 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
274 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
275 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
276 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
277 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
278 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
279 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
280 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
281 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
282 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
283 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
284 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
285 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
286 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
287 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
288 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
289 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
290 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
291 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
292 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
293 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
294 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
295 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
296 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
297 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
298 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
299 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
300 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
301 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
302 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
303 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
304 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
305 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
306 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
307 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
308 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
309 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
310 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
311 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
312 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
313 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
314 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
315 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
316 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
317 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
318 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
319 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
320 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
321 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
322 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
323 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
324 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
325 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
326 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
327 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
328 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
329 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
330 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
331 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
332 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
333 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
334 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
335 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
336 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
337 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
338 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
339 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
340 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
341 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
342 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
343 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
344 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
345 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
346 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
347 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
348 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
349 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
350 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
351 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
352 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
353 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
354 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
355 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
356 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
357 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
358 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
359 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
360 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
361 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
362 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
363 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
370 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
371 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
372 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
373 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
374 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
375 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
376 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
377 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
378 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
379 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
380 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
381 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
382 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
383 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
384 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
385 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
386 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
387 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
388 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
389 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
390 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
391 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
392 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
393 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
394 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
395 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
396 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
397 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
398 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
399 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
400 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
401 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
402 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
403 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
404 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
405 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
406 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
407 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
408 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
409 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
410 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
411 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
412 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
413 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
414 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
415 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
416 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
417 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
418 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
419 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
420 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
421 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
422 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
423 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
424 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
425 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
426 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
427 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
428 2904699407
429 2906610324
430 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
431 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
432 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
433 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
434 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
435 2922425934
436 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
437 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
438 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
439 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
440 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
441 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
442 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
443 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
444 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.58
Metatranscriptomes 0
Isolates 2.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.02
Nodule 1.96
Rhizoplane 8.75
Rhizosphere 81.61
Stem 0
Stem Tuber 0
Unclassified 0.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495585_0004431 3300046492 Bacteria 9107
2 JGI24746J21847_1004478 3300001977 Bacteria 2202
3 JGI24739J22299_10004105 3300001989 Bacteria 5568
4 JGI24737J22298_10002708 3300001990 Bacteria 6265
5 JGI24750J21931_1000175 3300002070 Bacteria 10684
6 JGI24748J21848_1000514 3300002074 Bacteria 4251
7 JGI24738J21930_10001046 3300002075 Bacteria 7887
8 JGI24749J21850_1001064 3300002076 Bacteria 3908
9 JGI24744J21845_10000566 3300002077 Bacteria 6684
10 JGI24034J26672_10000462 3300002239 Bacteria 5246
11 JGI24742J22300_10000420 3300002244 Bacteria 6269
12 JGI24751J29686_10016485 3300002459 Bacteria 1523
13 JGI25406J46586_10000028 3300003203 Bacteria 70247
14 JGI25404J52841_10015339 3300003659 Bacteria 1662
15 JGI25405J52794_10009101 3300003911 Bacteria 1869
16 Ga0065712_10029709 3300005290 Bacteria 1233
17 Ga0065712_10113471 3300005290 Bacteria 1782
18 Ga0065712_10135995 3300005290 Bacteria 1489
19 Ga0065715_10037919 3300005293 Bacteria 1156
20 Ga0065715_10137549 3300005293 Bacteria 1903
21 Ga0070658_10101559 3300005327 Bacteria 2378
22 Ga0070676_10006058 3300005328 Bacteria 6455
23 Ga0070676_10024678 3300005328 Bacteria 3390
24 Ga0070676_10088731 3300005328 Bacteria 1890
25 Ga0070676_10131041 3300005328 Bacteria 1585
26 Ga0070683_100000836 3300005329 Bacteria 22825
27 Ga0070683_100011738 3300005329 Bacteria 7585
28 Ga0070683_100067592 3300005329 Bacteria 3329
29 Ga0070683_100075014 3300005329 Bacteria 3159
30 Ga0070690_100000700 3300005330 Bacteria 17192
31 Ga0070690_100063572 3300005330 Bacteria 2382
32 Ga0070690_100171286 3300005330 Bacteria 1494
33 Ga0070670_100006794 3300005331 Bacteria 9685
34 Ga0070670_100031028 3300005331 Bacteria 4602
35 Ga0070670_100046472 3300005331 Bacteria 3733
36 Ga0070670_100086754 3300005331 Bacteria 2689
37 Ga0070677_10000406 3300005333 Bacteria 14999
38 Ga0070677_10002338 3300005333 Bacteria 6059
39 Ga0070677_10028755 3300005333 Bacteria 2102
40 Ga0070677_10036854 3300005333 Bacteria 1905
41 Ga0070677_10037432 3300005333 Bacteria 1892
42 Ga0068869_100000653 3300005334 Bacteria 19619
43 Ga0068869_100106003 3300005334 Bacteria 2132
44 Ga0070666_10005529 3300005335 Bacteria 7752
45 Ga0070666_10031827 3300005335 Bacteria 3483
46 Ga0070680_100005042 3300005336 Bacteria 9963
47 Ga0070680_100043949 3300005336 Bacteria 3630
48 Ga0070680_100069523 3300005336 Bacteria 2891
49 Ga0070680_100073871 3300005336 Bacteria 2805
50 Ga0070682_100005253 3300005337 Bacteria 7206
51 Ga0070682_100020427 3300005337 Bacteria 3895
52 Ga0070682_100090951 3300005337 Bacteria 1997
53 Ga0068868_100005815 3300005338 Bacteria 8692
54 Ga0068868_100010958 3300005338 Bacteria 6584
55 Ga0068868_100097041 3300005338 Bacteria 2381
56 Ga0068868_100114377 3300005338 Bacteria 2195
57 Ga0070660_100023548 3300005339 Bacteria 4562
58 Ga0070660_100214228 3300005339 Bacteria 1564
59 Ga0070689_100010029 3300005340 Bacteria 6743
60 Ga0070689_100045887 3300005340 Bacteria 3366
61 Ga0070691_10004006 3300005341 Bacteria 6669
62 Ga0070687_100000387 3300005343 Bacteria 14981
63 Ga0070661_100001217 3300005344 Bacteria 18141
64 Ga0070692_10003662 3300005345 Bacteria 6283
65 Ga0070668_100019465 3300005347 Bacteria 5109
66 Ga0070668_100093673 3300005347 Bacteria 2371
67 Ga0070669_100009354 3300005353 Bacteria 6980
68 Ga0070675_100021874 3300005354 Bacteria 5109
69 Ga0070675_100125571 3300005354 Bacteria 2182
70 Ga0070671_100005891 3300005355 Bacteria 9767
71 Ga0070671_100020315 3300005355 Bacteria 5415
72 Ga0070671_100031898 3300005355 Bacteria 4355
73 Ga0070671_100172306 3300005355 Bacteria 1831
74 Ga0070671_100202708 3300005355 Bacteria 1683
75 Ga0070671_100288270 3300005355 Bacteria 1397
76 Ga0070674_100001918 3300005356 Bacteria 11324
77 Ga0070674_100003371 3300005356 Bacteria 8951
78 Ga0070674_100011258 3300005356 Bacteria 5439
79 Ga0070674_100074811 3300005356 Bacteria 2404
80 Ga0070674_100358750 3300005356 Bacteria 1179
81 Ga0070674_100374632 3300005356 Bacteria 1156
82 Ga0070673_100001086 3300005364 Bacteria 15555
83 Ga0070673_100122369 3300005364 Bacteria 2173
84 Ga0070673_100262418 3300005364 Bacteria 1509
85 Ga0070688_100034076 3300005365 Bacteria 3081
86 Ga0070688_100054495 3300005365 Bacteria 2505
87 Ga0070688_100097415 3300005365 Bacteria 1933
88 Ga0070688_100154625 3300005365 Bacteria 1570
89 Ga0070659_100006583 3300005366 Bacteria 8390
90 Ga0070667_100002687 3300005367 Bacteria 15394
91 Ga0070667_100122297 3300005367 Bacteria 2265
92 Ga0070667_100139796 3300005367 Bacteria 2119
93 Ga0070667_100327348 3300005367 Bacteria 1384
94 Ga0070709_10001257 3300005434 Bacteria 13866
95 Ga0070709_10006522 3300005434 Bacteria 6362
96 Ga0070709_10009430 3300005434 Bacteria 5386
97 Ga0070714_100141720 3300005435 Bacteria 2159
98 Ga0070714_100175934 3300005435 Bacteria 1945
99 Ga0070713_100000374 3300005436 Bacteria 28680
100 Ga0070713_100020428 3300005436 Bacteria 5078
101 Ga0070713_100028156 3300005436 Bacteria 4434
102 Ga0070710_10091766 3300005437 Bacteria 1793
103 Ga0070701_10002820 3300005438 Bacteria 6767
104 Ga0070701_10099733 3300005438 Bacteria 1607
105 Ga0070701_10141958 3300005438 Unclassified 1374
106 Ga0070711_100023758 3300005439 Bacteria 3991
107 Ga0070711_100033722 3300005439 Bacteria 3410
108 Ga0070711_100035137 3300005439 Bacteria 3348
109 Ga0070711_100221046 3300005439 Bacteria 1472
110 Ga0070705_100001711 3300005440 Bacteria 11431
111 Ga0070705_100158085 3300005440 Bacteria 1512
112 Ga0070700_100016369 3300005441 Bacteria 4223
113 Ga0070694_100007442 3300005444 Bacteria 6676
114 Ga0070708_100104737 3300005445 Bacteria 2594
115 Ga0070708_100209862 3300005445 Bacteria 1825
116 Ga0070663_100021845 3300005455 Bacteria 4264
117 Ga0070663_100025326 3300005455 Bacteria 4004
118 Ga0070663_100064000 3300005455 Bacteria 2657
119 Ga0070663_100093309 3300005455 Bacteria 2233
120 Ga0070678_100001680 3300005456 Bacteria 11863
121 Ga0070678_100028582 3300005456 Bacteria 3805
122 Ga0070678_100031777 3300005456 Bacteria 3647
123 Ga0070678_100056209 3300005456 Bacteria 2877
124 Ga0070678_100061286 3300005456 Bacteria 2772
125 Ga0070678_100089587 3300005456 Bacteria 2355
126 Ga0070678_100139062 3300005456 Bacteria 1940
127 Ga0070662_100009816 3300005457 Bacteria 6271
128 Ga0070662_100012878 3300005457 Bacteria 5557
129 Ga0070662_100176492 3300005457 Bacteria 1682
130 Ga0070662_100178517 3300005457 Bacteria 1672
131 Ga0070681_10015832 3300005458 Bacteria 7517
132 Ga0070681_10050414 3300005458 Bacteria 4153
133 Ga0070681_10061500 3300005458 Bacteria 3729
134 Ga0070681_10220683 3300005458 Bacteria 1811
135 Ga0070681_10325796 3300005458 Bacteria 1446
136 Ga0068867_100000874 3300005459 Bacteria 20341
137 Ga0068867_100031810 3300005459 Bacteria 3812
138 Ga0068867_100050648 3300005459 Bacteria 3062
139 Ga0070685_10003079 3300005466 Bacteria 8488
140 Ga0070685_10246411 3300005466 Bacteria 1182
141 Ga0070707_100099390 3300005468 Bacteria 2819
142 Ga0070679_100040768 3300005530 Bacteria 4619
143 Ga0070679_100151164 3300005530 Bacteria 2298
144 Ga0070679_100210850 3300005530 Bacteria 1906
145 Ga0070684_100004467 3300005535 Bacteria 10651
146 Ga0070684_100016286 3300005535 Bacteria 6074
147 Ga0070684_100171967 3300005535 Bacteria 1968
148 Ga0070697_100002564 3300005536 Bacteria 13978
149 Ga0068853_100003110 3300005539 Bacteria 12691
150 Ga0068853_100069092 3300005539 Bacteria 3072
151 Ga0068853_100093456 3300005539 Bacteria 2648
152 Ga0068853_100098738 3300005539 Bacteria 2579
153 Ga0068853_100175699 3300005539 Bacteria 1940
154 Ga0068853_100253732 3300005539 Bacteria 1615
155 Ga0068853_100330674 3300005539 Bacteria 1414
156 Ga0070672_100005379 3300005543 Bacteria 8483
157 Ga0070672_100005531 3300005543 Bacteria 8389
158 Ga0070672_100053092 3300005543 Bacteria 3167
159 Ga0070672_100131220 3300005543 Bacteria 2059
160 Ga0070672_100262842 3300005543 Bacteria 1456
161 Ga0070686_100004079 3300005544 Bacteria 8032
162 Ga0070695_100012339 3300005545 Bacteria 5123
163 Ga0070695_100026443 3300005545 Bacteria 3590
164 Ga0070695_100135344 3300005545 Bacteria 1703
165 Ga0070696_100008243 3300005546 Bacteria 6975
166 Ga0070696_100039848 3300005546 Bacteria 3244
167 Ga0070693_100072635 3300005547 Bacteria 2030
168 Ga0070693_100168400 3300005547 Bacteria 1401
169 Ga0070665_100023550 3300005548 Bacteria 6200
170 Ga0070665_100203213 3300005548 Bacteria 1982
171 Ga0070665_100234436 3300005548 Bacteria 1836
172 Ga0070665_100350418 3300005548 Bacteria 1482
173 Ga0070704_100065568 3300005549 Bacteria 2615
174 Ga0068855_100072645 3300005563 Bacteria 3998
175 Ga0068855_100082241 3300005563 Bacteria 3732
176 Ga0068855_100098486 3300005563 Bacteria 3368
177 Ga0068855_100108293 3300005563 Bacteria 3192
178 Ga0068855_100235299 3300005563 Bacteria 2049
179 Ga0070664_100027792 3300005564 Bacteria 4703
180 Ga0068857_100025732 3300005577 Bacteria 5181
181 Ga0068857_100069181 3300005577 Bacteria 3143
182 Ga0068854_100002509 3300005578 Bacteria 11386
183 Ga0068854_100106576 3300005578 Bacteria 2109
184 Ga0068856_100007430 3300005614 Bacteria 10692
185 Ga0068856_100061086 3300005614 Bacteria 3722
186 Ga0068856_100085445 3300005614 Bacteria 3134
187 Ga0068856_100119327 3300005614 Bacteria 2638
188 Ga0070702_100003283 3300005615 Bacteria 7206
189 Ga0068852_100006607 3300005616 Bacteria 8398
190 Ga0068852_100093916 3300005616 Bacteria 2689
191 Ga0068852_100366140 3300005616 Bacteria 1411
192 Ga0068859_100038170 3300005617 Bacteria 4819
193 Ga0068859_100069054 3300005617 Bacteria 3568
194 Ga0068859_100122021 3300005617 Bacteria 2672
195 Ga0068859_100276898 3300005617 Bacteria 1770
196 Ga0068864_100001321 3300005618 Bacteria 20620
197 Ga0068864_100087223 3300005618 Bacteria 2747
198 Ga0068864_100099414 3300005618 Bacteria 2577
199 Ga0068864_100195682 3300005618 Bacteria 1855
200 Ga0068866_10002168 3300005718 Bacteria 8173
201 Ga0068866_10037249 3300005718 Bacteria 2388
202 Ga0068866_10096173 3300005718 Bacteria 1624
203 Ga0068870_10000716 3300005840 Bacteria 12739
204 Ga0068863_100000965 3300005841 Bacteria 28914
205 Ga0068863_100107159 3300005841 Bacteria 2659
206 Ga0068863_100120246 3300005841 Bacteria 2504
207 Ga0068858_100003017 3300005842 Bacteria 16885
208 Ga0068858_100064343 3300005842 Bacteria 3394
209 Ga0068858_100065499 3300005842 Bacteria 3362
210 Ga0068858_100222549 3300005842 Bacteria 1788
211 Ga0068860_100000577 3300005843 Bacteria 44036
212 Ga0068860_100014200 3300005843 Bacteria 7808
213 Ga0068860_100041961 3300005843 Bacteria 4371
214 Ga0068860_100276217 3300005843 Bacteria 1641
215 Ga0068860_100304064 3300005843 Bacteria 1563
216 Ga0068862_100003246 3300005844 Bacteria 14077
217 Ga0068862_100019155 3300005844 Bacteria 5706
218 Ga0068862_100234364 3300005844 Bacteria 1666
219 Ga0081455_10000327 3300005937 Bacteria 62253
220 Ga0081455_10003093 3300005937 Bacteria 19378
221 Ga0081455_10006033 3300005937 Bacteria 13120
222 Ga0081455_10011459 3300005937 Bacteria 8907
223 Ga0081455_10053413 3300005937 Bacteria 3451
224 Ga0081455_10103105 3300005937 Bacteria 2286
225 Ga0081455_10158909 3300005937 Bacteria 1735
226 Ga0081455_10215824 3300005937 Bacteria 1426
227 Ga0081540_1000102 3300005983 Bacteria 91311
228 Ga0081540_1001430 3300005983 Bacteria 20638
229 Ga0081540_1003410 3300005983 Bacteria 12579
230 Ga0081540_1003755 3300005983 Bacteria 11903
231 Ga0081540_1009790 3300005983 Bacteria 6562
232 Ga0081540_1014713 3300005983 Bacteria 4996
233 Ga0081540_1017229 3300005983 Bacteria 4479
234 Ga0081540_1063111 3300005983 Bacteria 1755
235 Ga0081539_10000048 3300005985 Bacteria 272906
236 Ga0081539_10058707 3300005985 Bacteria 2122
237 Ga0081539_10072824 3300005985 Bacteria 1835
238 Ga0070717_10007141 3300006028 Bacteria 8277
239 Ga0070717_10010868 3300006028 Bacteria 6891
240 Ga0070717_10013303 3300006028 Bacteria 6301
241 Ga0070717_10059267 3300006028 Bacteria 3167
242 Ga0075365_10018199 3300006038 Bacteria 4315
243 Ga0075365_10099182 3300006038 Bacteria 1993
244 Ga0075363_100008259 3300006048 Bacteria 4839
245 Ga0075363_100023705 3300006048 Bacteria 3114
246 Ga0075432_10000765 3300006058 Bacteria 9994
247 Ga0070716_100006717 3300006173 Bacteria 5634
248 Ga0070712_100024348 3300006175 Bacteria 4011
249 Ga0070712_100106270 3300006175 Bacteria 2086
250 Ga0075362_10045225 3300006177 Bacteria 1954
251 Ga0075367_10039381 3300006178 Bacteria 2756
252 Ga0075367_10045981 3300006178 Bacteria 2563
253 Ga0075367_10048843 3300006178 Bacteria 2494
254 Ga0075369_10026031 3300006186 Bacteria 2436
255 Ga0075366_10002375 3300006195 Bacteria 9645
256 Ga0097621_100034122 3300006237 Bacteria 4057
257 Ga0075370_10026132 3300006353 Bacteria 3232
258 Ga0068871_100001025 3300006358 Bacteria 18716
259 Ga0068871_100005428 3300006358 Bacteria 8937
260 Ga0068871_100027579 3300006358 Bacteria 4443
261 Ga0068871_100073854 3300006358 Bacteria 2812
262 Ga0068871_100195067 3300006358 Bacteria 1746
263 Ga0068871_100292928 3300006358 Bacteria 1427
264 Ga0075428_100020912 3300006844 Bacteria 7246
265 Ga0075428_100131629 3300006844 Bacteria 2720
266 Ga0075428_100135424 3300006844 Bacteria 2679
267 Ga0075430_100000026 3300006846 Bacteria 78833
268 Ga0075430_100000222 3300006846 Bacteria 39248
269 Ga0075430_100012924 3300006846 Bacteria 7115
270 Ga0075431_100000451 3300006847 Bacteria 33773
271 Ga0075431_100032904 3300006847 Bacteria 5343
272 Ga0075433_10002991 3300006852 Bacteria 12983
273 Ga0075433_10016718 3300006852 Bacteria 6056
274 Ga0075434_100000110 3300006871 Bacteria 46873
275 Ga0075434_100001174 3300006871 Bacteria 21706
276 Ga0075429_100000247 3300006880 Bacteria 37266
277 Ga0075429_100009429 3300006880 Bacteria 8475
278 Ga0075429_100030873 3300006880 Bacteria 4657
279 Ga0068865_100005281 3300006881 Bacteria 7815
280 Ga0068865_100013742 3300006881 Bacteria 5127
281 Ga0068865_100103441 3300006881 Bacteria 2089
282 Ga0075436_100004698 3300006914 Bacteria 9369
283 Ga0075436_100089836 3300006914 Bacteria 2135
284 Ga0097620_100038166 3300006931 Bacteria 4819
285 Ga0097620_100069047 3300006931 Bacteria 3568
286 Ga0097620_100122027 3300006931 Bacteria 2672
287 Ga0097620_100276897 3300006931 Bacteria 1770
288 Ga0075435_100016201 3300007076 Bacteria 5618
289 Ga0075435_100110089 3300007076 Bacteria 2290
290 Ga0075435_100266357 3300007076 Bacteria 1461
291 Ga0099794_10015687 3300007265 Bacteria 3349
292 Ga0105251_10077573 3300009011 Bacteria 1540
293 Ga0105240_10121284 3300009093 Bacteria 3147
294 Ga0111539_10000337 3300009094 Bacteria 57733
295 Ga0111539_10014415 3300009094 Bacteria 9866
296 Ga0111539_10150346 3300009094 Bacteria 2726
297 Ga0105245_10000380 3300009098 Bacteria 41293
298 Ga0105245_10060762 3300009098 Bacteria 3404
299 Ga0105245_10070201 3300009098 Bacteria 3178
300 Ga0105245_10111892 3300009098 Bacteria 2540
301 Ga0105245_10114924 3300009098 Bacteria 2507
302 Ga0105247_10001411 3300009101 Bacteria 17428
303 Ga0105247_10006423 3300009101 Bacteria 7280
304 Ga0105247_10016700 3300009101 Bacteria 4401
305 Ga0105247_10025590 3300009101 Bacteria 3561
306 Ga0105247_10048427 3300009101 Bacteria 2610
307 Ga0105247_10062814 3300009101 Bacteria 2304
308 Ga0114129_10053822 3300009147 Bacteria 5645
309 Ga0114129_10097181 3300009147 Bacteria 4077
310 Ga0114129_10229244 3300009147 Bacteria 2502
311 Ga0114129_10652340 3300009147 Bacteria 1358
312 Ga0105243_10008080 3300009148 Bacteria 8076
313 Ga0105243_10031539 3300009148 Bacteria 4087
314 Ga0105243_10230951 3300009148 Bacteria 1641
315 Ga0105243_10283021 3300009148 Bacteria 1494
316 Ga0105241_10027743 3300009174 Bacteria 4215
317 Ga0105241_10128056 3300009174 Bacteria 2052
318 Ga0105241_10159805 3300009174 Bacteria 1851
319 Ga0105242_10000350 3300009176 Bacteria 37047
320 Ga0105242_10035266 3300009176 Bacteria 4012
321 Ga0105242_10078490 3300009176 Bacteria 2756
322 Ga0105242_10131844 3300009176 Bacteria 2158
323 Ga0105248_10013825 3300009177 Bacteria 8882
324 Ga0105248_10015595 3300009177 Bacteria 8376
325 Ga0105248_10019063 3300009177 Bacteria 7586
326 Ga0105248_10037197 3300009177 Bacteria 5445
327 Ga0105248_10080964 3300009177 Bacteria 3651
328 Ga0105248_10145105 3300009177 Bacteria 2678
329 Ga0105237_10066040 3300009545 Bacteria 3612
330 Ga0105237_10173347 3300009545 Bacteria 2157
331 Ga0105237_10182842 3300009545 Bacteria 2096
332 Ga0105237_10202763 3300009545 Bacteria 1984
333 Ga0105237_10383751 3300009545 Bacteria 1410
334 Ga0105249_10007137 3300009553 Bacteria 9750
335 Ga0105249_10122164 3300009553 Bacteria 2476
336 Ga0105239_10017528 3300010375 Bacteria 7921
337 Ga0105239_10114074 3300010375 Bacteria 2997
338 Ga0105239_10311499 3300010375 Bacteria 1774
339 Ga0105239_10348954 3300010375 Bacteria 1671
340 Ga0105246_10002609 3300011119 Bacteria 10906
341 Ga0105246_10148574 3300011119 Bacteria 1771
342 Ga0157373_10045507 3300013100 Bacteria 3132
343 Ga0157371_10135704 3300013102 Bacteria 1752
344 Ga0157370_10322474 3300013104 Bacteria 1425
345 Ga0157369_10095876 3300013105 Bacteria 3165
346 Ga0157369_10174759 3300013105 Bacteria 2261
347 Ga0157374_10032360 3300013296 Bacteria 4761
348 Ga0157374_10053103 3300013296 Bacteria 3777
349 Ga0157374_10054750 3300013296 Bacteria 3722
350 Ga0157374_10062182 3300013296 Bacteria 3498
351 Ga0157374_10065956 3300013296 Bacteria 3401
352 Ga0157374_10099654 3300013296 Bacteria 2784
353 Ga0157378_10043205 3300013297 Bacteria 4002
354 Ga0157378_10107630 3300013297 Bacteria 2551
355 Ga0157378_10254793 3300013297 Bacteria 1681
356 Ga0163162_10010530 3300013306 Bacteria 8994
357 Ga0163162_10068510 3300013306 Bacteria 3600
358 Ga0163162_10095629 3300013306 Bacteria 3058
359 Ga0163162_10420014 3300013306 Bacteria 1470
360 Ga0157372_10009499 3300013307 Bacteria 10344
361 Ga0157372_10084860 3300013307 Bacteria 3591
362 Ga0157375_10002791 3300013308 Bacteria 15110
363 Ga0157375_10022203 3300013308 Bacteria 5839
364 Ga0157375_10113058 3300013308 Bacteria 2816
365 Ga0157375_10246096 3300013308 Bacteria 1948
366 Ga0157375_10316399 3300013308 Bacteria 1725
367 Ga0157375_10346805 3300013308 Bacteria 1650
368 Ga0163163_10016636 3300014325 Bacteria 6838
369 Ga0163163_10043798 3300014325 Bacteria 4390
370 Ga0163163_10054275 3300014325 Bacteria 3959
371 Ga0163163_10100808 3300014325 Bacteria 2910
372 Ga0163163_10166611 3300014325 Bacteria 2250
373 Ga0163163_10170037 3300014325 Bacteria 2226
374 Ga0163163_10276705 3300014325 Bacteria 1730
375 Ga0157380_10009701 3300014326 Bacteria 6906
376 Ga0157380_10100720 3300014326 Bacteria 2406
377 Ga0157380_10121457 3300014326 Bacteria 2213
378 Ga0157380_10131344 3300014326 Bacteria 2137
379 Ga0157380_10145235 3300014326 Bacteria 2044
380 Ga0157380_10270244 3300014326 Bacteria 1549
381 Ga0157377_10000341 3300014745 Bacteria 20841
382 Ga0157377_10059329 3300014745 Bacteria 2181
383 Ga0157379_10106097 3300014968 Bacteria 2522
384 Ga0157379_10287188 3300014968 Bacteria 1498
385 Ga0157376_10000663 3300014969 Bacteria 22264
386 Ga0157376_10040464 3300014969 Bacteria 3809
387 Ga0157376_10141002 3300014969 Bacteria 2162
388 Ga0157376_10187083 3300014969 Bacteria 1896
389 Ga0157376_10424407 3300014969 Bacteria 1291
390 Ga0163161_10000379 3300017792 Bacteria 37281
391 Ga0163161_10264180 3300017792 Bacteria 1345
392 Ga0207666_1000103 3300025271 Bacteria 13338
393 Ga0209758_1002448 3300025297 Bacteria 18947
394 Ga0209758_1008580 3300025297 Bacteria 6576
395 Ga0207697_10001374 3300025315 Bacteria 13320
396 Ga0207697_10055588 3300025315 Bacteria 1641
397 Ga0207653_10008349 3300025885 Bacteria 3226
398 Ga0207682_10000043 3300025893 Bacteria 52108
399 Ga0207682_10001519 3300025893 Bacteria 10697
400 Ga0207682_10001931 3300025893 Bacteria 9419
401 Ga0207692_10003295 3300025898 Bacteria 6293
402 Ga0207692_10006313 3300025898 Bacteria 4803
403 Ga0207642_10007175 3300025899 Bacteria 3750
404 Ga0207710_10008560 3300025900 Bacteria 4313
405 Ga0207710_10049955 3300025900 Bacteria 1875
406 Ga0207688_10000083 3300025901 Bacteria 36050
407 Ga0207688_10004971 3300025901 Bacteria 7237
408 Ga0207680_10006796 3300025903 Bacteria 5551
409 Ga0207647_10003002 3300025904 Bacteria 12691
410 Ga0207685_10000528 3300025905 Bacteria 6575
411 Ga0207685_10000914 3300025905 Bacteria 5631
412 Ga0207699_10006599 3300025906 Bacteria 5632
413 Ga0207699_10010546 3300025906 Bacteria 4642
414 Ga0207699_10045368 3300025906 Bacteria 2565
415 Ga0207645_10000899 3300025907 Bacteria 24667
416 Ga0207645_10014247 3300025907 Bacteria 5326
417 Ga0207645_10070342 3300025907 Bacteria 2238
418 Ga0207643_10000128 3300025908 Bacteria 51191
419 Ga0207643_10038664 3300025908 Bacteria 2681
420 Ga0207643_10140506 3300025908 Bacteria 1442
421 Ga0207684_10204578 3300025910 Bacteria 1703
422 Ga0207654_10005950 3300025911 Bacteria 6140
423 Ga0207707_10001534 3300025912 Bacteria 21320
424 Ga0207707_10004166 3300025912 Bacteria 12809
425 Ga0207707_10055634 3300025912 Bacteria 3441
426 Ga0207707_10345496 3300025912 Bacteria 1282
427 Ga0207695_10089205 3300025913 Bacteria 3101
428 Ga0207695_10247016 3300025913 Bacteria 1684
429 Ga0207671_10057611 3300025914 Bacteria 2880
430 Ga0207671_10073915 3300025914 Bacteria 2547
431 Ga0207671_10113763 3300025914 Bacteria 2062
432 Ga0207671_10156329 3300025914 Bacteria 1764
433 Ga0207671_10192162 3300025914 Bacteria 1592
434 Ga0207693_10003105 3300025915 Bacteria 14304
435 Ga0207693_10117568 3300025915 Bacteria 2087
436 Ga0207693_10156925 3300025915 Bacteria 1790
437 Ga0207663_10003674 3300025916 Bacteria 7543
438 Ga0207663_10009887 3300025916 Bacteria 5051
439 Ga0207663_10027621 3300025916 Bacteria 3311
440 Ga0207660_10023127 3300025917 Bacteria 4194
441 Ga0207660_10044159 3300025917 Bacteria 3135
442 Ga0207660_10049075 3300025917 Bacteria 2990
443 Ga0207662_10000975 3300025918 Bacteria 13319
444 Ga0207662_10231736 3300025918 Bacteria 1206
445 Ga0207657_10020169 3300025919 Bacteria 6307
446 Ga0207649_10002321 3300025920 Bacteria 10689
447 Ga0207652_10005425 3300025921 Bacteria 10348
448 Ga0207652_10013947 3300025921 Bacteria 6506
449 Ga0207652_10024211 3300025921 Bacteria 5035
450 Ga0207652_10027543 3300025921 Bacteria 4736
451 Ga0207652_10056338 3300025921 Bacteria 3384
452 Ga0207646_10220450 3300025922 Bacteria 1714
453 Ga0207681_10006781 3300025923 Bacteria 7022
454 Ga0207681_10188193 3300025923 Bacteria 1577
455 Ga0207694_10032282 3300025924 Bacteria 4006
456 Ga0207650_10008902 3300025925 Bacteria 6860
457 Ga0207650_10123258 3300025925 Bacteria 2020
458 Ga0207659_10007188 3300025926 Bacteria 6838
459 Ga0207659_10050993 3300025926 Bacteria 2941
460 Ga0207687_10000522 3300025927 Bacteria 25753
461 Ga0207687_10062204 3300025927 Bacteria 2639
462 Ga0207687_10150080 3300025927 Bacteria 1777
463 Ga0207700_10004890 3300025928 Bacteria 7962
464 Ga0207700_10024078 3300025928 Bacteria 4208
465 Ga0207700_10025747 3300025928 Bacteria 4091
466 Ga0207700_10149321 3300025928 Bacteria 1930
467 Ga0207664_10010948 3300025929 Bacteria 6424
468 Ga0207644_10000611 3300025931 Bacteria 22735
469 Ga0207644_10006011 3300025931 Bacteria 7913
470 Ga0207644_10075011 3300025931 Bacteria 2484
471 Ga0207690_10003223 3300025932 Bacteria 9794
472 Ga0207706_10001616 3300025933 Bacteria 22352
473 Ga0207706_10015033 3300025933 Bacteria 7006
474 Ga0207686_10014769 3300025934 Bacteria 4357
475 Ga0207686_10056767 3300025934 Bacteria 2462
476 Ga0207709_10009743 3300025935 Bacteria 5295
477 Ga0207709_10026097 3300025935 Bacteria 3353
478 Ga0207709_10248435 3300025935 Bacteria 1298
479 Ga0207709_10262109 3300025935 Bacteria 1268
480 Ga0207670_10000631 3300025936 Bacteria 18876
481 Ga0207670_10007366 3300025936 Bacteria 6135
482 Ga0207669_10000797 3300025937 Bacteria 13482
483 Ga0207669_10002598 3300025937 Bacteria 7722
484 Ga0207669_10290147 3300025937 Bacteria 1238
485 Ga0207704_10047461 3300025938 Bacteria 2567
486 Ga0207704_10292194 3300025938 Bacteria 1244
487 Ga0207665_10001379 3300025939 Bacteria 16369
488 Ga0207665_10009568 3300025939 Bacteria 6365
489 Ga0207665_10092666 3300025939 Bacteria 2097
490 Ga0207691_10000599 3300025940 Bacteria 35997
491 Ga0207691_10002935 3300025940 Bacteria 16639
492 Ga0207691_10019716 3300025940 Bacteria 6378
493 Ga0207691_10023830 3300025940 Bacteria 5760
494 Ga0207691_10173454 3300025940 Bacteria 1887
495 Ga0207711_10008296 3300025941 Bacteria 8696
496 Ga0207711_10010676 3300025941 Bacteria 7637
497 Ga0207711_10052202 3300025941 Bacteria 3503
498 Ga0207711_10077904 3300025941 Bacteria 2890
499 Ga0207711_10235281 3300025941 Bacteria 1679
500 Ga0207689_10000165 3300025942 Bacteria 57494
501 Ga0207689_10054251 3300025942 Bacteria 3302
502 Ga0207689_10126494 3300025942 Bacteria 2102
503 Ga0207689_10181700 3300025942 Bacteria 1734
504 Ga0207689_10266925 3300025942 Bacteria 1416
505 Ga0207689_10320271 3300025942 Bacteria 1287
506 Ga0207661_10004909 3300025944 Bacteria 9371
507 Ga0207661_10011748 3300025944 Bacteria 6356
508 Ga0207661_10047173 3300025944 Bacteria 3419
509 Ga0207679_10000112 3300025945 Bacteria 65716
510 Ga0207667_10025956 3300025949 Bacteria 6408
511 Ga0207667_10203956 3300025949 Bacteria 2028
512 Ga0207667_10214557 3300025949 Bacteria 1972
513 Ga0207667_10313675 3300025949 Bacteria 1602
514 Ga0207651_10000099 3300025960 Bacteria 38059
515 Ga0207651_10031165 3300025960 Bacteria 3405
516 Ga0207712_10001957 3300025961 Bacteria 13516
517 Ga0207668_10003391 3300025972 Bacteria 9338
518 Ga0207668_10110071 3300025972 Bacteria 2065
519 Ga0207668_10113802 3300025972 Bacteria 2035
520 Ga0207668_10115342 3300025972 Bacteria 2023
521 Ga0207668_10126611 3300025972 Bacteria 1943
522 Ga0207668_10204806 3300025972 Bacteria 1574
523 Ga0207668_10226629 3300025972 Bacteria 1504
524 Ga0207640_10000382 3300025981 Bacteria 28458
525 Ga0207658_10035295 3300025986 Bacteria 3580
526 Ga0207658_10276669 3300025986 Bacteria 1437
527 Ga0207677_10005315 3300026023 Bacteria 6981
528 Ga0207677_10010700 3300026023 Bacteria 5199
529 Ga0207677_10133847 3300026023 Bacteria 1887
530 Ga0207677_10174836 3300026023 Bacteria 1683
531 Ga0207677_10189017 3300026023 Bacteria 1627
532 Ga0207703_10004258 3300026035 Bacteria 11776
533 Ga0207703_10025231 3300026035 Bacteria 4675
534 Ga0207639_10032542 3300026041 Bacteria 3839
535 Ga0207639_10042404 3300026041 Bacteria 3410
536 Ga0207639_10205900 3300026041 Bacteria 1690
537 Ga0207639_10208433 3300026041 Bacteria 1681
538 Ga0207639_10269595 3300026041 Bacteria 1493
539 Ga0207639_10285271 3300026041 Bacteria 1454
540 Ga0207678_10003272 3300026067 Bacteria 14619
541 Ga0207678_10007002 3300026067 Bacteria 10009
542 Ga0207678_10031527 3300026067 Bacteria 4624
543 Ga0207678_10056323 3300026067 Bacteria 3384
544 Ga0207678_10299181 3300026067 Bacteria 1382
545 Ga0207708_10012755 3300026075 Bacteria 6267
546 Ga0207708_10148868 3300026075 Bacteria 1841
547 Ga0207708_10397502 3300026075 Bacteria 1139
548 Ga0207702_10093858 3300026078 Bacteria 2633
549 Ga0207702_10142451 3300026078 Bacteria 2171
550 Ga0207641_10001777 3300026088 Bacteria 20763
551 Ga0207648_10007480 3300026089 Bacteria 10733
552 Ga0207648_10031836 3300026089 Bacteria 4661
553 Ga0207648_10047840 3300026089 Bacteria 3747
554 Ga0207676_10000494 3300026095 Bacteria 33145
555 Ga0207676_10014703 3300026095 Bacteria 5637
556 Ga0207676_10123689 3300026095 Bacteria 2186
557 Ga0207674_10020449 3300026116 Bacteria 7152
558 Ga0207674_10035721 3300026116 Bacteria 5186
559 Ga0207674_10082755 3300026116 Bacteria 3210
560 Ga0207674_10099104 3300026116 Bacteria 2897
561 Ga0207674_10102256 3300026116 Bacteria 2846
562 Ga0207675_100003533 3300026118 Bacteria 15253
563 Ga0207675_100301176 3300026118 Bacteria 1561
564 Ga0207683_10001272 3300026121 Bacteria 22830
565 Ga0207683_10001853 3300026121 Bacteria 18701
566 Ga0207683_10007911 3300026121 Bacteria 9095
567 Ga0207683_10011627 3300026121 Bacteria 7513
568 Ga0207683_10014162 3300026121 Bacteria 6795
569 Ga0207683_10015318 3300026121 Bacteria 6529
570 Ga0207683_10027632 3300026121 Bacteria 4902
571 Ga0207683_10042796 3300026121 Bacteria 3956
572 Ga0207683_10185536 3300026121 Bacteria 1887
573 Ga0207683_10194398 3300026121 Bacteria 1843
574 Ga0207698_10063441 3300026142 Bacteria 2891
575 Ga0207698_10070195 3300026142 Bacteria 2774
576 Ga0210002_1001992 3300027617 Bacteria 2937
577 Ga0209998_10001588 3300027717 Bacteria 5462
578 Ga0209813_10016915 3300027866 Bacteria 1997
579 Ga0209974_10032320 3300027876 Bacteria 1734
580 Ga0207428_10000064 3300027907 Bacteria 151185
581 Ga0207428_10000140 3300027907 Bacteria 97818
582 Ga0268266_10004422 3300028379 Bacteria 13462
583 Ga0268266_10007719 3300028379 Bacteria 9656
584 Ga0268266_10025484 3300028379 Bacteria 5032
585 Ga0268266_10047939 3300028379 Bacteria 3661
586 Ga0268266_10055302 3300028379 Bacteria 3412
587 Ga0268266_10110471 3300028379 Bacteria 2435
588 Ga0268266_10127814 3300028379 Bacteria 2270
589 Ga0268266_10195528 3300028379 Bacteria 1848
590 Ga0268266_10318353 3300028379 Bacteria 1455
591 Ga0268266_10365962 3300028379 Bacteria 1357
592 Ga0268266_10418333 3300028379 Bacteria 1270
593 Ga0268265_10011223 3300028380 Bacteria 6056
594 Ga0268265_10026351 3300028380 Bacteria 4135
595 Ga0268265_10113231 3300028380 Bacteria 2219
596 Ga0268265_10205865 3300028380 Bacteria 1710
597 Ga0268264_10000107 3300028381 Bacteria 209105
598 Ga0268264_10005082 3300028381 Bacteria 11144
599 Ga0268264_10086725 3300028381 Bacteria 2690
600 Ga0268264_10104967 3300028381 Bacteria 2464
601 Ga0265334_10015125 3300028573 Bacteria 3210
602 Ga0307515_10060988 3300028794 Bacteria 5363
603 Ga0265332_10050236 3300031238 Bacteria 1792
604 Ga0265328_10058289 3300031239 Bacteria 1418
605 Ga0265325_10000006 3300031241 Bacteria 255758
606 Ga0265325_10075637 3300031241 Bacteria 1681
607 Ga0265329_10012070 3300031242 Bacteria 3119
608 Ga0265340_10014381 3300031247 Bacteria 4134
609 Ga0265339_10006887 3300031249 Bacteria 7407
610 Ga0265331_10034717 3300031250 Bacteria 2485
611 Ga0265316_10221091 3300031344 Bacteria 1397
612 Ga0307513_10077502 3300031456 Bacteria 3442
613 Ga0307513_10144650 3300031456 Bacteria 2298
614 Ga0307509_10021381 3300031507 Bacteria 7315
615 Ga0265313_10023271 3300031595 Bacteria 3341
616 Ga0307508_10000154 3300031616 Bacteria 82824
617 Ga0307508_10265459 3300031616 Bacteria 1311
618 Ga0265314_10005615 3300031711 Bacteria 11266
619 Ga0265342_10003968 3300031712 Bacteria 11854
620 Ga0265342_10017314 3300031712 Bacteria 4691
621 Ga0265342_10102272 3300031712 Bacteria 1630
622 Ga0265342_10106101 3300031712 Bacteria 1595
623 Ga0307516_10029059 3300031730 Bacteria 5590
624 Ga0307410_10174005 3300031852 Bacteria 1625
625 Ga0307416_100063443 3300032002 Bacteria 3026
626 Ga0307510_10156282 3300033180 Bacteria 1887
627 Ga0315911_1000008 3300033442 Bacteria 381285
628 Ga0373930_0001231 3300034816 Bacteria 3781
629 Ga0373958_0010245 3300034819 Bacteria 1560
630 Ga0373959_0002918 3300034820 Bacteria 2713
631 Ga0373938_0015719 3300034957 Bacteria 1470
632 Ga0373928_0022088 3300035084 Bacteria 1347
633 Ga0373929_0017606 3300035085 Bacteria 1412
634 Ga0373934_0023900 3300035086 Bacteria 2363
635 Ga0373940_0004788 3300035088 Bacteria 2885
636 Ga0373952_0000859 3300035092 Bacteria 5518
637 Ga0373952_0004422 3300035092 Bacteria 2550
638 Ga0373923_0040479 3300035111 Bacteria 1918
639 Ga0373923_0051674 3300035111 Bacteria 1725
640 Ga0373923_0119338 3300035111 Bacteria 1177
641 Ga0373936_0006063 3300035113 Bacteria 4555
642 Ga0373941_0000494 3300035115 Bacteria 7908
643 Ga0373941_0005534 3300035115 Bacteria 2978
644 Ga0373941_0007844 3300035115 Bacteria 2630
645 Ga0373953_0001092 3300035117 Bacteria 7676
646 Ga0373953_0004155 3300035117 Bacteria 4592
647 Ga0373953_0019195 3300035117 Bacteria 2541
648 Ga0373954_0001821 3300035118 Bacteria 8793
649 Ga0373954_0046149 3300035118 Bacteria 2036
650 Ga0373956_0002051 3300035119 Bacteria 8345
651 Ga0373956_0002956 3300035119 Bacteria 6879
652 Ga0373957_0000374 3300035120 Bacteria 11335
653 Ga0373960_0000398 3300035121 Bacteria 8493
654 Ga0373960_0040243 3300035121 Bacteria 1348
655 Ga0373943_0005372 3300035170 Bacteria 5763
656 Ga0373943_0052716 3300035170 Bacteria 2006
657 Ga0373943_0162967 3300035170 Bacteria 1215
658 Ga0373946_0027757 3300035171 Bacteria 2241
659 Ga0373946_0137298 3300035171 Bacteria 1130
660 Ga0373955_0009267 3300035172 Bacteria 4609
661 Ga0373955_0009372 3300035172 Bacteria 4582
662 Ga0373955_0011740 3300035172 Bacteria 4187
663 Ga0373955_0046015 3300035172 Bacteria 2357
664 Ga0373962_0003525 3300035242 Bacteria 3760
665 Ga0373962_0022368 3300035242 Bacteria 1676
666 Ga0373924_0020683 3300035410 Bacteria 2560
667 Ga0373931_0001718 3300035691 Bacteria 9499
668 Ga0373931_0014040 3300035691 Bacteria 3908
669 Ga0373931_0019150 3300035691 Bacteria 3412
670 Ga0373931_0034618 3300035691 Bacteria 2622
671 Ga0373935_0006022 3300035692 Bacteria 7205
672 Ga0373935_0083521 3300035692 Bacteria 2079
673 Ga0373935_0107474 3300035692 Bacteria 1847
674 Ga0373935_0206185 3300035692 Bacteria 1361
675 Ga0373927_0025352 3300035695 Bacteria 3876
676 Ga0373927_0042636 3300035695 Bacteria 2940
677 Ga0373927_0153904 3300035695 Bacteria 1505
678 Ga0373933_0001100 3300035724 Bacteria 16117
679 Ga0373933_0045156 3300035724 Bacteria 2612
680 Ga0373947_0000340 3300035725 Bacteria 26369
681 Ga0373947_0035595 3300035725 Bacteria 2948
682 Ga0373947_0064359 3300035725 Bacteria 2236
683 Ga0373947_0088961 3300035725 Bacteria 1923
684 Ga0373947_0170331 3300035725 Bacteria 1412
685 Ga0373937_0001302 3300036401 Bacteria 20904
686 Ga0373937_0002947 3300036401 Bacteria 14245
687 Ga0373937_0005103 3300036401 Bacteria 11187
688 Ga0373937_0017774 3300036401 Bacteria 6344
689 Ga0373937_0064217 3300036401 Bacteria 3377
690 Ga0373937_0318829 3300036401 Bacteria 1470
691 Ga0373925_0007663 3300037068 Bacteria 7864
692 Ga0373925_0008452 3300037068 Bacteria 7500
693 Ga0373925_0020271 3300037068 Bacteria 4838
694 Ga0373925_0052361 3300037068 Bacteria 3050
695 Ga0436364_1064018 3300037853 Bacteria 2560
696 Ga0395901_0784501 3300038443 Bacteria 943
697 Ga0436365_0702073 3300039437 Bacteria 1769
698 Ga0439453_0000060 3300041408 Bacteria 7820
699 Ga0451807_0668963 3300041486 Bacteria 1500
700 Ga0439435_0002105 3300042436 Bacteria 3870
701 Ga0466957_0033043 3300044842 Bacteria 3102
702 Ga0466958_0114579 3300045836 Bacteria 1684
703 Ga0466967_0122303 3300045976 Bacteria 2407
704 Ga0495592_0001601 3300046454 Bacteria 15847
705 Ga0495592_0005759 3300046454 Bacteria 9175
706 Ga0495603_0019964 3300046455 Bacteria 4059
707 Ga0495603_0022944 3300046455 Bacteria 3777
708 Ga0495603_0025589 3300046455 Bacteria 3569
709 Ga0495603_0053963 3300046455 Bacteria 2384
710 Ga0495603_0099568 3300046455 Bacteria 1697
711 Ga0495629_0000529 3300046459 Bacteria 31881
712 Ga0495629_0008986 3300046459 Bacteria 7333
713 Ga0495629_0046527 3300046459 Bacteria 3043
714 Ga0495629_0059688 3300046459 Bacteria 2666
715 Ga0495629_0172112 3300046459 Bacteria 1502
716 Ga0495638_0009159 3300046460 Bacteria 6963
717 Ga0495638_0011077 3300046460 Bacteria 6233
718 Ga0495651_0001433 3300046462 Bacteria 18463
719 Ga0495651_0020115 3300046462 Bacteria 5181
720 Ga0495651_0195766 3300046462 Bacteria 1419
721 Ga0495651_0260327 3300046462 Bacteria 1180
722 Ga0495653_0016031 3300046463 Bacteria 6107
723 Ga0495653_0051871 3300046463 Bacteria 3146
724 Ga0495653_0089488 3300046463 Bacteria 2255
725 Ga0495653_0090070 3300046463 Bacteria 2246
726 Ga0495653_0160841 3300046463 Bacteria 1559
727 Ga0495582_0006293 3300046473 Bacteria 6611
728 Ga0495605_0058205 3300046474 Bacteria 1858
729 Ga0495605_0126410 3300046474 Bacteria 1156
730 Ga0495639_0009690 3300046475 Bacteria 4134
731 Ga0495639_0034011 3300046475 Bacteria 2278
732 Ga0495639_0066427 3300046475 Bacteria 1660
733 Ga0495664_0018790 3300046477 Bacteria 3966
734 Ga0495664_0023312 3300046477 Bacteria 3592
735 Ga0495664_0029806 3300046477 Bacteria 3194
736 Ga0495664_0037955 3300046477 Bacteria 2843
737 Ga0495584_0120905 3300046491 Bacteria 1326
738 Ga0495585_0031604 3300046492 Bacteria 3004
739 Ga0495585_0038601 3300046492 Bacteria 2687
740 Ga0495585_0105382 3300046492 Bacteria 1504
741 Ga0495594_0054755 3300046499 Bacteria 2199
742 Ga0495583_0104207 3300046506 Bacteria 1208
743 Ga0495606_0001566 3300046507 Bacteria 29975
744 Ga0495606_0074530 3300046507 Bacteria 2126
745 Ga0495608_0008113 3300046511 Bacteria 7381
746 Ga0495608_0011568 3300046511 Bacteria 6139
747 Ga0495608_0016511 3300046511 Bacteria 5108
748 Ga0495608_0098528 3300046511 Bacteria 1886
749 Ga0495618_0015173 3300046514 Bacteria 4700
750 Ga0495618_0048917 3300046514 Bacteria 2670
751 Ga0495628_0002572 3300046516 Bacteria 16332
752 Ga0495628_0007597 3300046516 Bacteria 9371
753 Ga0495628_0015999 3300046516 Bacteria 6258
754 Ga0495628_0314441 3300046516 Bacteria 1157
755 Ga0495630_0040548 3300046517 Bacteria 3480
756 Ga0495630_0103006 3300046517 Bacteria 2160
757 Ga0495631_0115442 3300046518 Bacteria 1154
758 Ga0495666_0069319 3300046526 Bacteria 1678
759 Ga0495652_0002428 3300046529 Bacteria 19213
760 Ga0495652_0091823 3300046529 Bacteria 2481
761 Ga0495652_0115683 3300046529 Bacteria 2148
762 Ga0495665_0005351 3300046531 Bacteria 6920
763 Ga0495665_0085638 3300046531 Bacteria 1656
764 Ga0495640_0015450 3300046533 Bacteria 5745
765 Ga0495640_0047337 3300046533 Bacteria 2976
766 Ga0495640_0064294 3300046533 Bacteria 2481
767 Ga0495587_0009736 3300046536 Bacteria 6144
768 Ga0495587_0052159 3300046536 Bacteria 2414
769 Ga0495598_0017520 3300046537 Bacteria 1848
770 Ga0495609_0090437 3300046538 Bacteria 1331
771 Ga0495621_0023115 3300046539 Bacteria 2066
772 Ga0495621_0050206 3300046539 Bacteria 1490
773 Ga0495645_0001788 3300046543 Bacteria 14608
774 Ga0495645_0025716 3300046543 Bacteria 4274
775 Ga0495645_0028258 3300046543 Bacteria 4076
776 Ga0495645_0038226 3300046543 Bacteria 3501
777 Ga0495645_0052493 3300046543 Bacteria 2966
778 Ga0495645_0094722 3300046543 Bacteria 2129
779 Ga0495667_0003563 3300046559 Bacteria 10468
780 Ga0495667_0005768 3300046559 Bacteria 8384
781 Ga0495667_0119452 3300046559 Bacteria 1702
782 Ga0495656_0016994 3300046615 Bacteria 2770
783 Ga0495656_0032549 3300046615 Bacteria 2122
784 Ga0495656_0035929 3300046615 Bacteria 2038
785 Ga0495656_0091561 3300046615 Bacteria 1391
786 Ga0495668_0118180 3300046616 Bacteria 1450
787 Ga0495634_0004321 3300046642 Bacteria 11195
788 Ga0495625_0082150 3300046660 Bacteria 2241
789 Ga0495635_0000429 3300046663 Bacteria 26634
790 Ga0495635_0013995 3300046663 Bacteria 5613
791 Ga0495635_0027056 3300046663 Bacteria 3990
792 Ga0495635_0322937 3300046663 Bacteria 1033
793 Ga0495659_0007040 3300046664 Bacteria 3557
794 Ga0495659_0033686 3300046664 Bacteria 1799
795 Ga0495588_0083701 3300046674 Bacteria 1666
796 Ga0495657_0009336 3300046675 Bacteria 7443
797 Ga0495657_0010262 3300046675 Bacteria 7049
798 Ga0495657_0013260 3300046675 Bacteria 6087
799 Ga0495599_0003035 3300046678 Bacteria 9769
800 Ga0495623_0007229 3300046679 Bacteria 7207
801 Ga0495623_0007655 3300046679 Bacteria 7019
802 Ga0495623_0049055 3300046679 Bacteria 2675
803 Ga0495623_0102314 3300046679 Bacteria 1744
804 Ga0495623_0127033 3300046679 Bacteria 1530
805 Ga0495646_0001304 3300046680 Bacteria 14717
806 Ga0495646_0043515 3300046680 Bacteria 2749
807 Ga0495647_0008584 3300046681 Bacteria 3437
808 Ga0495658_0000781 3300046683 Bacteria 17152
809 Ga0495658_0011048 3300046683 Bacteria 4530
810 Ga0495669_0077313 3300046684 Bacteria 1524
811 Ga0495669_0083675 3300046684 Bacteria 1467
812 Ga0495613_0006286 3300046689 Bacteria 8885
813 Ga0495613_0029327 3300046689 Bacteria 4091
814 Ga0495613_0219605 3300046689 Bacteria 1335
815 Ga0495624_0040078 3300046690 Bacteria 3001
816 Ga0495624_0081726 3300046690 Bacteria 2001
817 Ga0495624_0132083 3300046690 Bacteria 1531
818 Ga0495670_0012130 3300046691 Bacteria 4239
819 Ga0495649_0080821 3300046694 Bacteria 1738
820 Ga0495600_0007607 3300046809 Bacteria 6637
821 Ga0495600_0014546 3300046809 Bacteria 4959
822 Ga0495581_0005737 3300047315 Bacteria 7194
823 Ga0495581_0030017 3300047315 Bacteria 3152
824 Ga0495581_0092012 3300047315 Bacteria 1760
825 Ga0495604_0002235 3300047317 Bacteria 15508
826 Ga0495604_0002822 3300047317 Bacteria 13952
827 Ga0495604_0010023 3300047317 Bacteria 7501
828 Ga0495604_0116513 3300047317 Bacteria 1939
829 Ga0495674_0004206 3300047319 Bacteria 13863
830 Ga0495674_0006763 3300047319 Bacteria 10975
831 Ga0495674_0021636 3300047319 Bacteria 5945
832 Ga0495674_0082394 3300047319 Bacteria 2758
833 Ga0495674_0198450 3300047319 Bacteria 1665
834 Ga0495672_0032259 3300047320 Bacteria 3261
835 Ga0495672_0106579 3300047320 Bacteria 1511
836 Ga0495676_0062585 3300047321 Bacteria 2904
837 Ga0495676_0121550 3300047321 Bacteria 1899
838 Ga0495680_0006824 3300047322 Bacteria 10544
839 Ga0495680_0029393 3300047322 Bacteria 4500
840 Ga0495675_0002904 3300047444 Bacteria 10293
841 Ga0495675_0067445 3300047444 Bacteria 2260
842 Ga0495684_0000497 3300047471 Bacteria 32091
843 Ga0495684_0015464 3300047471 Bacteria 5872
844 Ga0495684_0016411 3300047471 Bacteria 5703
845 Ga0495684_0025159 3300047471 Bacteria 4577
846 Ga0495684_0281626 3300047471 Bacteria 1199
847 Ga0495686_0147868 3300047472 Bacteria 1381
848 Ga0495593_0014868 3300047673 Bacteria 4421
849 Ga0495593_0014947 3300047673 Bacteria 4408
850 Ga0495593_0016723 3300047673 Bacteria 4133
851 Ga0495593_0023433 3300047673 Bacteria 3432
852 Ga0495602_0040996 3300048088 Bacteria 4234
853 Ga0495602_0128581 3300048088 Bacteria 2024
854 Ga0495602_0152128 3300048088 Bacteria 1817
855 Ga0495614_0010418 3300048089 Bacteria 4099
856 Ga0495614_0018899 3300048089 Bacteria 2984
857 Ga0495615_0000368 3300048090 Bacteria 7077
858 Ga0495615_0012724 3300048090 Bacteria 1741
859 Ga0496100_0012538 3300048903 Bacteria 4862
860 Ga0496100_0015511 3300048903 Bacteria 4451
861 Ga0496100_0040306 3300048903 Bacteria 2970
862 Ga0496100_0072267 3300048903 Bacteria 2305
863 Ga0496100_0128194 3300048903 Bacteria 1784
864 Ga0496100_0249420 3300048903 Bacteria 1313
865 Ga0496100_0279397 3300048903 Bacteria 1244
866 Ga0496101_0000235 3300048904 Bacteria 41146
867 Ga0496101_0001165 3300048904 Bacteria 15728
868 Ga0496101_0008415 3300048904 Bacteria 6740
869 Ga0496101_0019223 3300048904 Bacteria 4661
870 Ga0496101_0052924 3300048904 Bacteria 2928
871 Ga0496101_0053933 3300048904 Bacteria 2902
872 Ga0496101_0195594 3300048904 Bacteria 1562
873 Ga0496102_0005341 3300048905 Bacteria 10905
874 Ga0496102_0022951 3300048905 Bacteria 5535
875 Ga0496102_0028248 3300048905 Bacteria 5009
876 Ga0496102_0039515 3300048905 Bacteria 4263
877 Ga0496102_0155347 3300048905 Bacteria 2151
878 Ga0496103_0003790 3300048906 Bacteria 9196
879 Ga0496103_0011444 3300048906 Bacteria 5258
880 Ga0496103_0014101 3300048906 Bacteria 4744
881 Ga0496104_0000351 3300048907 Bacteria 41200
882 Ga0496104_0003146 3300048907 Bacteria 14223
883 Ga0496104_0008914 3300048907 Bacteria 8913
884 Ga0496104_0215047 3300048907 Bacteria 1834
885 Ga0496104_0250055 3300048907 Bacteria 1685
886 Ga0496104_0285969 3300048907 Bacteria 1561
887 Ga0496104_0499306 3300048907 Bacteria 1128
888 Ga0496105_0000840 3300048908 Bacteria 20909
889 Ga0496105_0006427 3300048908 Bacteria 9034
890 Ga0496105_0012927 3300048908 Bacteria 6616
891 Ga0496105_0029441 3300048908 Bacteria 4494
892 Ga0496105_0030009 3300048908 Bacteria 4454
893 Ga0496105_0037048 3300048908 Bacteria 4018
894 Ga0496105_0190590 3300048908 Bacteria 1676
895 Ga0496106_0000788 3300048909 Bacteria 22899
896 Ga0496106_0002108 3300048909 Bacteria 14874
897 Ga0496106_0010763 3300048909 Bacteria 6759
898 Ga0496106_0011781 3300048909 Bacteria 6454
899 Ga0496106_0169369 3300048909 Bacteria 1730
900 Ga0496106_0181176 3300048909 Bacteria 1672
901 Ga0496106_0186831 3300048909 Bacteria 1646
902 Ga0496106_0325966 3300048909 Bacteria 1233
903 Ga0496107_0004819 3300048910 Bacteria 9159
904 Ga0496107_0011301 3300048910 Bacteria 6216
905 Ga0496107_0013863 3300048910 Bacteria 5634
906 Ga0496107_0030116 3300048910 Bacteria 3867
907 Ga0496107_0074682 3300048910 Bacteria 2466
908 Ga0496107_0111973 3300048910 Bacteria 2006
909 Ga0496108_0011130 3300048911 Bacteria 7309
910 Ga0496108_0016530 3300048911 Bacteria 6022
911 Ga0496108_0019665 3300048911 Bacteria 5546
912 Ga0496108_0037794 3300048911 Bacteria 4022
913 Ga0496108_0082807 3300048911 Bacteria 2721
914 Ga0496108_0237162 3300048911 Bacteria 1586
915 Ga0496109_0005654 3300048912 Bacteria 10459
916 Ga0496109_0007962 3300048912 Bacteria 8983
917 Ga0496109_0023341 3300048912 Bacteria 5489
918 Ga0496109_0027237 3300048912 Bacteria 5102
919 Ga0496109_0028566 3300048912 Bacteria 4989
920 Ga0496109_0040011 3300048912 Bacteria 4245
921 Ga0496109_0045566 3300048912 Bacteria 3980
922 Ga0496110_0034051 3300048913 Bacteria 4409
923 Ga0496110_0039961 3300048913 Bacteria 4087
924 Ga0496110_0075409 3300048913 Bacteria 2996
925 Ga0496110_0492910 3300048913 Bacteria 1116
926 Ga0496111_0002946 3300048914 Bacteria 10413
927 Ga0496111_0009883 3300048914 Bacteria 6377
928 Ga0496111_0039701 3300048914 Bacteria 3376
929 Ga0496111_0057681 3300048914 Bacteria 2811
930 Ga0496112_0000018 3300048915 Bacteria 188820
931 Ga0496112_0011859 3300048915 Bacteria 7982
932 Ga0496112_0013345 3300048915 Bacteria 7583
933 Ga0496112_0030393 3300048915 Bacteria 5227
934 Ga0496112_0069569 3300048915 Bacteria 3477
935 Ga0496112_0334061 3300048915 Bacteria 1459
936 Ga0496112_0421533 3300048915 Bacteria 1273
937 Ga0496113_0013732 3300048916 Bacteria 5500
938 Ga0496113_0017464 3300048916 Bacteria 4981
939 Ga0496113_0035587 3300048916 Bacteria 3642
940 Ga0496113_0062084 3300048916 Bacteria 2821
941 Ga0496113_0071978 3300048916 Bacteria 2630
942 Ga0496114_0009940 3300048917 Bacteria 7562
943 Ga0496114_0023363 3300048917 Bacteria 5045
944 Ga0496114_0037148 3300048917 Bacteria 4028
945 Ga0496114_0048719 3300048917 Bacteria 3524
946 Ga0496114_0066495 3300048917 Bacteria 3022
947 Ga0496114_0112239 3300048917 Bacteria 2336
948 Ga0496115_0002701 3300048918 Bacteria 12737
949 Ga0496115_0010842 3300048918 Bacteria 6819
950 Ga0496115_0019196 3300048918 Bacteria 5259
951 Ga0496115_0050174 3300048918 Bacteria 3342
952 Ga0496115_0078464 3300048918 Bacteria 2686
953 Ga0496115_0109684 3300048918 Bacteria 2266
954 Ga0496115_0123713 3300048918 Bacteria 2129
955 Ga0496116_0227024 3300048919 Bacteria 951
956 Ga0496117_0007128 3300048920 Bacteria 11048
957 Ga0496117_0074479 3300048920 Bacteria 2260
958 Ga0496118_0003592 3300048921 Bacteria 19299
959 Ga0496118_0078665 3300048921 Bacteria 2332
960 Ga0496119_0055304 3300048922 Bacteria 2411
961 Ga0496121_0000640 3300048924 Bacteria 65295
962 Ga0496121_0038643 3300048924 Bacteria 4220
963 Ga0496121_0046507 3300048924 Bacteria 3713
964 Ga0496121_0048134 3300048924 Bacteria 3630
965 Ga0496121_0093528 3300048924 Bacteria 2340
966 Ga0496121_0188119 3300048924 Bacteria 1483
967 Ga0496124_0002189 3300048927 Bacteria 26104
968 Ga0496125_0085843 3300048928 Bacteria 2383
969 Ga0496126_0009499 3300048929 Bacteria 10319
970 Ga0496126_0018354 3300048929 Bacteria 6933
971 Ga0496126_0043259 3300048929 Bacteria 4155
972 Ga0496126_0047915 3300048929 Bacteria 3910
973 Ga0496126_0068906 3300048929 Bacteria 3157
974 Ga0496126_0080924 3300048929 Bacteria 2873
975 Ga0496126_0115449 3300048929 Bacteria 2334
976 Ga0496126_0164235 3300048929 Bacteria 1896
977 Ga0496126_0254389 3300048929 Bacteria 1462
978 Ga0501036_0003984 3300049572 Bacteria 11869
979 Ga0501037_0025075 3300049573 Bacteria 4406
980 Ga0501037_0040497 3300049573 Bacteria 3428
981 Ga0501038_0040262 3300049574 Bacteria 4083
982 Ga0501046_0067505 3300049580 Bacteria 2785
983 Ga0501047_0000100 3300049581 Bacteria 105717
984 Ga0501047_0052511 3300049581 Bacteria 3940
985 Ga0501048_0000083 3300049582 Bacteria 49621
986 Ga0501048_0098144 3300049582 Bacteria 2067
987 Ga0501068_0041556 3300049584 Bacteria 2763
988 Ga0501070_0009792 3300049586 Bacteria 8108
989 Ga0501070_0152053 3300049586 Bacteria 1909
990 Ga0501070_0215422 3300049586 Bacteria 1575
991 Ga0501072_0003943 3300049588 Bacteria 11230
992 Ga0501072_0218576 3300049588 Bacteria 1519
993 Ga0501074_0017935 3300049590 Bacteria 5143
994 Ga0501074_0040074 3300049590 Bacteria 3392
995 Ga0501074_0046177 3300049590 Bacteria 3149
996 Ga0501079_0033083 3300049741 Bacteria 3976
997 Ga0501080_0000030 3300049742 Bacteria 87736
998 Ga0501080_0029073 3300049742 Bacteria 5145
999 Ga0501080_0290083 3300049742 Bacteria 1486
1000 Ga0501083_0002641 3300049744 Bacteria 12337
1001 Ga0501083_0194828 3300049744 Bacteria 1322
1002 Ga0501035_0023582 3300049822 Bacteria 5645
1003 Ga0501035_0438882 3300049822 Bacteria 1081
1004 Ga0501044_0000587 3300049823 Bacteria 44137
1005 nmdc:mga03n38_150788_c1 3300050490 Bacteria 1169
1006 nmdc:mga0yw44_104257_c1 3300050492 Bacteria 1810
1007 nmdc:mga0yw44_63102_c1 3300050492 Bacteria 2277
1008 nmdc:mga0k408_2505_c2 3300050493 Bacteria 7672
1009 nmdc:mga0k408_36277_c1 3300050493 Bacteria 2829
1010 nmdc:mga06z11_34154_c1 3300050494 Bacteria 2494
1011 nmdc:mga06z11_4911_c1 3300050494 Bacteria 5306
1012 nmdc:mga07m45_49692_c1 3300050496 Bacteria 2361
1013 nmdc:mga05p37_10233_c1 3300050507 Bacteria 11137
1014 nmdc:mga05p37_166916_c1 3300050507 Bacteria 2686
1015 nmdc:mga05p37_225_c1 3300050507 Bacteria 57238
1016 nmdc:mga09592_244_c1 3300050508 Bacteria 39424
1017 nmdc:mga09592_58040_c1 3300050508 Bacteria 3273
1018 nmdc:mga09592_736_c1 3300050508 Bacteria 25222
1019 nmdc:mga0qj67_215_c1 3300050509 Bacteria 39409
1020 nmdc:mga0qj67_2611_c1 3300050509 Bacteria 12909
1021 nmdc:mga0qj67_4314_c1 3300050509 Bacteria 10307
1022 nmdc:mga06r32_12515_c1 3300050510 Bacteria 7657
1023 nmdc:mga06r32_341_c1 3300050510 Bacteria 38959
1024 nmdc:mga06r32_731_c1 3300050510 Bacteria 28813
1025 nmdc:mga08y16_131595_c1 3300050511 Bacteria 2601
1026 nmdc:mga08y16_145004_c1 3300050511 Bacteria 2468
1027 nmdc:mga08y16_252107_c1 3300050511 Bacteria 1824
1028 nmdc:mga08y16_617_c1 3300050511 Bacteria 33261
1029 nmdc:mga08y16_6190_c1 3300050511 Bacteria 12557
1030 nmdc:mga0n895_308807_c1 3300050512 Bacteria 1603
1031 nmdc:mga0n895_457_c1 3300050512 Bacteria 27383
1032 nmdc:mga0n895_543324_c1 3300050512 Bacteria 1168
1033 nmdc:mga0rr50_11539_c1 3300050513 Bacteria 5662
1034 nmdc:mga0rr50_19557_c1 3300050513 Bacteria 4574
1035 nmdc:mga08x19_81571_c1 3300050514 Bacteria 2124
1036 nmdc:mga0a205_1019_c1 3300050515 Bacteria 23295
1037 nmdc:mga0a205_17989_c1 3300050515 Bacteria 6068
1038 Ga0495601_0000413 3300053077 Bacteria 22423
1039 Ga0495601_0000668 3300053077 Bacteria 18282
1040 Ga0495601_0005956 3300053077 Bacteria 7113
1041 Ga0495601_0007499 3300053077 Bacteria 6400
1042 Ga0495601_0018585 3300053077 Bacteria 4231
1043 Ga0495601_0060131 3300053077 Bacteria 2410
1044 Ga0495612_0001564 3300053078 Bacteria 9430
1045 Ga0495612_0002430 3300053078 Bacteria 7675
1046 Ga0495612_0006791 3300053078 Bacteria 4688
1047 Ga0495612_0008871 3300053078 Bacteria 4073
1048 Ga0495612_0019920 3300053078 Bacteria 2688
1049 Ga0495595_0000516 3300053084 Bacteria 14727
1050 Ga0495595_0001465 3300053084 Bacteria 9212
1051 Ga0495595_0003553 3300053084 Bacteria 6186
1052 Ga0495619_0001679 3300053085 Bacteria 14639
1053 Ga0495619_0001957 3300053085 Bacteria 13737
1054 Ga0495619_0002856 3300053085 Bacteria 11246
1055 Ga0495619_0020676 3300053085 Bacteria 4195
1056 Ga0495619_0054518 3300053085 Bacteria 2646
1057 Ga0495619_0106148 3300053085 Bacteria 1915
1058 Ga0495619_0128604 3300053085 Bacteria 1740
1059 Ga0500651_0102011 3300053093 Bacteria 1758
1060 Ga0500651_0185374 3300053093 Bacteria 1234
1061 Ga0500566_0001625 3300053094 Bacteria 13231
1062 Ga0500566_0013519 3300053094 Bacteria 4804
1063 Ga0500566_0107849 3300053094 Bacteria 1518
1064 Ga0500641_0098123 3300053096 Bacteria 1255
1065 Ga0500648_043289 3300053097 Bacteria 2556
1066 Ga0500594_0071074 3300053118 Bacteria 1023
1067 Ga0500595_000010 3300053119 Bacteria 275806
1068 Ga0500595_000095 3300053119 Bacteria 61248
1069 Ga0500595_003699 3300053119 Bacteria 7057
1070 Ga0500595_018815 3300053119 Bacteria 2518
1071 Ga0500642_0017123 3300053130 Bacteria 2771
1072 Ga0500658_0024140 3300053134 Bacteria 2327
1073 Ga0500559_0047011 3300053136 Bacteria 1894
1074 Ga0500573_0175702 3300053140 Bacteria 1155
1075 Ga0500622_0054551 3300053156 Bacteria 2050
1076 Ga0500627_0125752 3300053158 Bacteria 1157
1077 Ga0500634_0069625 3300053161 Bacteria 1844
1078 Ga0500638_006677 3300053162 Bacteria 4750
1079 Ga0500636_0014540 3300053177 Bacteria 4629
1080 Ga0500637_0000495 3300053178 Bacteria 15245
1081 Ga0500596_004825 3300053735 Bacteria 2437
1082 Ga0501082_0192337 3300060353 Bacteria 1775
1083 Ga0530510_0058804 3300061734 Bacteria 2780
1084 Ga0530510_0113785 3300061734 Bacteria 1983
1085 Ga0530510_0192984 3300061734 Bacteria 1512
1086 2513661634 2513237096 Bacteria 8722461
1087 2513863107 2513237137 Bacteria 9558895
1088 2513923311 2513237145 Bacteria 8979722
1089 2517889126 2517572143 Bacteria 9484767
1090 2524541222 2524023228 Bacteria 10118060
1091 2671121588 2667528175 Bacteria 7532676
1092 2728753705 2728368998 Bacteria 8720350
1093 2793072628 2791355197 Bacteria 8420563
1094 2876818203 2876808645 Bacteria 8824342
1095 2879115151 2879110137 Bacteria 8907982
1096 2885382864 2885374607 Bacteria 8927485
1097 2903756127 2903748898 Bacteria 9972761
1098 2904690931 2904690495 Bacteria 9412302
1099 2904708248
1100 2906613483
1101 2906643032 2906635258 Bacteria 8601019
1102 2906668201 2906660503 Bacteria 8595048
1103 2908747738 2908739725 Bacteria 8628932
1104 2908756987 2908756301 Bacteria 8864324
1105 2922388792 2922386360 Bacteria 7017218
1106 2922433921
1107 2935634942 2935630451 Bacteria 8169952
1108 2941514270 2941507105 Bacteria 8166816
1109 2941522231 2941515067 Bacteria 8166720
1110 2941530102 2941523033 Bacteria 8169134
1111 3005475361 3005474847 Bacteria 9259049
1112 8006935923 8006933436 Bacteria 10410654
1113 8006975961 8006973647 Bacteria 10679141
1114 8019562749 8019555841 Bacteria 9642137
1115 8019572828 8019565922 Bacteria 9639779
1116 Ga0495585_0004431
1117 JGI24746J21847_1004478
1118 JGI24739J22299_10004105
1119 JGI24737J22298_10002708
1120 JGI24750J21931_1000175
1121 JGI24748J21848_1000514
1122 JGI24738J21930_10001046
1123 JGI24749J21850_1001064
1124 JGI24744J21845_10000566
1125 JGI24034J26672_10000462
1126 JGI24742J22300_10000420
1127 JGI24751J29686_10016485
1128 JGI25406J46586_10000028
1129 JGI25404J52841_10015339
1130 JGI25405J52794_10009101
1131 Ga0065712_10029709
1132 Ga0065712_10113471
1133 Ga0065712_10135995
1134 Ga0065715_10037919
1135 Ga0065715_10137549
1136 Ga0070658_10101559
1137 Ga0070676_10006058
1138 Ga0070676_10024678
1139 Ga0070676_10088731
1140 Ga0070676_10131041
1141 Ga0070683_100000836
1142 Ga0070683_100011738
1143 Ga0070683_100067592
1144 Ga0070683_100075014
1145 Ga0070690_100000700
1146 Ga0070690_100063572
1147 Ga0070690_100171286
1148 Ga0070670_100006794
1149 Ga0070670_100031028
1150 Ga0070670_100046472
1151 Ga0070670_100086754
1152 Ga0070677_10000406
1153 Ga0070677_10002338
1154 Ga0070677_10028755
1155 Ga0070677_10036854
1156 Ga0070677_10037432
1157 Ga0068869_100000653
1158 Ga0068869_100106003
1159 Ga0070666_10005529
1160 Ga0070666_10031827
1161 Ga0070680_100005042
1162 Ga0070680_100043949
1163 Ga0070680_100069523
1164 Ga0070680_100073871
1165 Ga0070682_100005253
1166 Ga0070682_100020427
1167 Ga0070682_100090951
1168 Ga0068868_100005815
1169 Ga0068868_100010958
1170 Ga0068868_100097041
1171 Ga0068868_100114377
1172 Ga0070660_100023548
1173 Ga0070660_100214228
1174 Ga0070689_100010029
1175 Ga0070689_100045887
1176 Ga0070691_10004006
1177 Ga0070687_100000387
1178 Ga0070661_100001217
1179 Ga0070692_10003662
1180 Ga0070668_100019465
1181 Ga0070668_100093673
1182 Ga0070669_100009354
1183 Ga0070675_100021874
1184 Ga0070675_100125571
1185 Ga0070671_100005891
1186 Ga0070671_100020315
1187 Ga0070671_100031898
1188 Ga0070671_100172306
1189 Ga0070671_100202708
1190 Ga0070671_100288270
1191 Ga0070674_100001918
1192 Ga0070674_100003371
1193 Ga0070674_100011258
1194 Ga0070674_100074811
1195 Ga0070674_100358750
1196 Ga0070674_100374632
1197 Ga0070673_100001086
1198 Ga0070673_100122369
1199 Ga0070673_100262418
1200 Ga0070688_100034076
1201 Ga0070688_100054495
1202 Ga0070688_100097415
1203 Ga0070688_100154625
1204 Ga0070659_100006583
1205 Ga0070667_100002687
1206 Ga0070667_100122297
1207 Ga0070667_100139796
1208 Ga0070667_100327348
1209 Ga0070709_10001257
1210 Ga0070709_10006522
1211 Ga0070709_10009430
1212 Ga0070714_100141720
1213 Ga0070714_100175934
1214 Ga0070713_100000374
1215 Ga0070713_100020428
1216 Ga0070713_100028156
1217 Ga0070710_10091766
1218 Ga0070701_10002820
1219 Ga0070701_10099733
1220 Ga0070701_10141958
1221 Ga0070711_100023758
1222 Ga0070711_100033722
1223 Ga0070711_100035137
1224 Ga0070711_100221046
1225 Ga0070705_100001711
1226 Ga0070705_100158085
1227 Ga0070700_100016369
1228 Ga0070694_100007442
1229 Ga0070708_100104737
1230 Ga0070708_100209862
1231 Ga0070663_100021845
1232 Ga0070663_100025326
1233 Ga0070663_100064000
1234 Ga0070663_100093309
1235 Ga0070678_100001680
1236 Ga0070678_100028582
1237 Ga0070678_100031777
1238 Ga0070678_100056209
1239 Ga0070678_100061286
1240 Ga0070678_100089587
1241 Ga0070678_100139062
1242 Ga0070662_100009816
1243 Ga0070662_100012878
1244 Ga0070662_100176492
1245 Ga0070662_100178517
1246 Ga0070681_10015832
1247 Ga0070681_10050414
1248 Ga0070681_10061500
1249 Ga0070681_10220683
1250 Ga0070681_10325796
1251 Ga0068867_100000874
1252 Ga0068867_100031810
1253 Ga0068867_100050648
1254 Ga0070685_10003079
1255 Ga0070685_10246411
1256 Ga0070707_100099390
1257 Ga0070679_100040768
1258 Ga0070679_100151164
1259 Ga0070679_100210850
1260 Ga0070684_100004467
1261 Ga0070684_100016286
1262 Ga0070684_100171967
1263 Ga0070697_100002564
1264 Ga0068853_100003110
1265 Ga0068853_100069092
1266 Ga0068853_100093456
1267 Ga0068853_100098738
1268 Ga0068853_100175699
1269 Ga0068853_100253732
1270 Ga0068853_100330674
1271 Ga0070672_100005379
1272 Ga0070672_100005531
1273 Ga0070672_100053092
1274 Ga0070672_100131220
1275 Ga0070672_100262842
1276 Ga0070686_100004079
1277 Ga0070695_100012339
1278 Ga0070695_100026443
1279 Ga0070695_100135344
1280 Ga0070696_100008243
1281 Ga0070696_100039848
1282 Ga0070693_100072635
1283 Ga0070693_100168400
1284 Ga0070665_100023550
1285 Ga0070665_100203213
1286 Ga0070665_100234436
1287 Ga0070665_100350418
1288 Ga0070704_100065568
1289 Ga0068855_100072645
1290 Ga0068855_100082241
1291 Ga0068855_100098486
1292 Ga0068855_100108293
1293 Ga0068855_100235299
1294 Ga0070664_100027792
1295 Ga0068857_100025732
1296 Ga0068857_100069181
1297 Ga0068854_100002509
1298 Ga0068854_100106576
1299 Ga0068856_100007430
1300 Ga0068856_100061086
1301 Ga0068856_100085445
1302 Ga0068856_100119327
1303 Ga0070702_100003283
1304 Ga0068852_100006607
1305 Ga0068852_100093916
1306 Ga0068852_100366140
1307 Ga0068859_100038170
1308 Ga0068859_100069054
1309 Ga0068859_100122021
1310 Ga0068859_100276898
1311 Ga0068864_100001321
1312 Ga0068864_100087223
1313 Ga0068864_100099414
1314 Ga0068864_100195682
1315 Ga0068866_10002168
1316 Ga0068866_10037249
1317 Ga0068866_10096173
1318 Ga0068870_10000716
1319 Ga0068863_100000965
1320 Ga0068863_100107159
1321 Ga0068863_100120246
1322 Ga0068858_100003017
1323 Ga0068858_100064343
1324 Ga0068858_100065499
1325 Ga0068858_100222549
1326 Ga0068860_100000577
1327 Ga0068860_100014200
1328 Ga0068860_100041961
1329 Ga0068860_100276217
1330 Ga0068860_100304064
1331 Ga0068862_100003246
1332 Ga0068862_100019155
1333 Ga0068862_100234364
1334 Ga0081455_10000327
1335 Ga0081455_10003093
1336 Ga0081455_10006033
1337 Ga0081455_10011459
1338 Ga0081455_10053413
1339 Ga0081455_10103105
1340 Ga0081455_10158909
1341 Ga0081455_10215824
1342 Ga0081540_1000102
1343 Ga0081540_1001430
1344 Ga0081540_1003410
1345 Ga0081540_1003755
1346 Ga0081540_1009790
1347 Ga0081540_1014713
1348 Ga0081540_1017229
1349 Ga0081540_1063111
1350 Ga0081539_10000048
1351 Ga0081539_10058707
1352 Ga0081539_10072824
1353 Ga0070717_10007141
1354 Ga0070717_10010868
1355 Ga0070717_10013303
1356 Ga0070717_10059267
1357 Ga0075365_10018199
1358 Ga0075365_10099182
1359 Ga0075363_100008259
1360 Ga0075363_100023705
1361 Ga0075432_10000765
1362 Ga0070716_100006717
1363 Ga0070712_100024348
1364 Ga0070712_100106270
1365 Ga0075362_10045225
1366 Ga0075367_10039381
1367 Ga0075367_10045981
1368 Ga0075367_10048843
1369 Ga0075369_10026031
1370 Ga0075366_10002375
1371 Ga0097621_100034122
1372 Ga0075370_10026132
1373 Ga0068871_100001025
1374 Ga0068871_100005428
1375 Ga0068871_100027579
1376 Ga0068871_100073854
1377 Ga0068871_100195067
1378 Ga0068871_100292928
1379 Ga0075428_100020912
1380 Ga0075428_100131629
1381 Ga0075428_100135424
1382 Ga0075430_100000026
1383 Ga0075430_100000222
1384 Ga0075430_100012924
1385 Ga0075431_100000451
1386 Ga0075431_100032904
1387 Ga0075433_10002991
1388 Ga0075433_10016718
1389 Ga0075434_100000110
1390 Ga0075434_100001174
1391 Ga0075429_100000247
1392 Ga0075429_100009429
1393 Ga0075429_100030873
1394 Ga0068865_100005281
1395 Ga0068865_100013742
1396 Ga0068865_100103441
1397 Ga0075436_100004698
1398 Ga0075436_100089836
1399 Ga0097620_100038166
1400 Ga0097620_100069047
1401 Ga0097620_100122027
1402 Ga0097620_100276897
1403 Ga0075435_100016201
1404 Ga0075435_100110089
1405 Ga0075435_100266357
1406 Ga0099794_10015687
1407 Ga0105251_10077573
1408 Ga0105240_10121284
1409 Ga0111539_10000337
1410 Ga0111539_10014415
1411 Ga0111539_10150346
1412 Ga0105245_10000380
1413 Ga0105245_10060762
1414 Ga0105245_10070201
1415 Ga0105245_10111892
1416 Ga0105245_10114924
1417 Ga0105247_10001411
1418 Ga0105247_10006423
1419 Ga0105247_10016700
1420 Ga0105247_10025590
1421 Ga0105247_10048427
1422 Ga0105247_10062814
1423 Ga0114129_10053822
1424 Ga0114129_10097181
1425 Ga0114129_10229244
1426 Ga0114129_10652340
1427 Ga0105243_10008080
1428 Ga0105243_10031539
1429 Ga0105243_10230951
1430 Ga0105243_10283021
1431 Ga0105241_10027743
1432 Ga0105241_10128056
1433 Ga0105241_10159805
1434 Ga0105242_10000350
1435 Ga0105242_10035266
1436 Ga0105242_10078490
1437 Ga0105242_10131844
1438 Ga0105248_10013825
1439 Ga0105248_10015595
1440 Ga0105248_10019063
1441 Ga0105248_10037197
1442 Ga0105248_10080964
1443 Ga0105248_10145105
1444 Ga0105237_10066040
1445 Ga0105237_10173347
1446 Ga0105237_10182842
1447 Ga0105237_10202763
1448 Ga0105237_10383751
1449 Ga0105249_10007137
1450 Ga0105249_10122164
1451 Ga0105239_10017528
1452 Ga0105239_10114074
1453 Ga0105239_10311499
1454 Ga0105239_10348954
1455 Ga0105246_10002609
1456 Ga0105246_10148574
1457 Ga0157373_10045507
1458 Ga0157371_10135704
1459 Ga0157370_10322474
1460 Ga0157369_10095876
1461 Ga0157369_10174759
1462 Ga0157374_10032360
1463 Ga0157374_10053103
1464 Ga0157374_10054750
1465 Ga0157374_10062182
1466 Ga0157374_10065956
1467 Ga0157374_10099654
1468 Ga0157378_10043205
1469 Ga0157378_10107630
1470 Ga0157378_10254793
1471 Ga0163162_10010530
1472 Ga0163162_10068510
1473 Ga0163162_10095629
1474 Ga0163162_10420014
1475 Ga0157372_10009499
1476 Ga0157372_10084860
1477 Ga0157375_10002791
1478 Ga0157375_10022203
1479 Ga0157375_10113058
1480 Ga0157375_10246096
1481 Ga0157375_10316399
1482 Ga0157375_10346805
1483 Ga0163163_10016636
1484 Ga0163163_10043798
1485 Ga0163163_10054275
1486 Ga0163163_10100808
1487 Ga0163163_10166611
1488 Ga0163163_10170037
1489 Ga0163163_10276705
1490 Ga0157380_10009701
1491 Ga0157380_10100720
1492 Ga0157380_10121457
1493 Ga0157380_10131344
1494 Ga0157380_10145235
1495 Ga0157380_10270244
1496 Ga0157377_10000341
1497 Ga0157377_10059329
1498 Ga0157379_10106097
1499 Ga0157379_10287188
1500 Ga0157376_10000663
1501 Ga0157376_10040464
1502 Ga0157376_10141002
1503 Ga0157376_10187083
1504 Ga0157376_10424407
1505 Ga0163161_10000379
1506 Ga0163161_10264180
1507 Ga0207666_1000103
1508 Ga0209758_1002448
1509 Ga0209758_1008580
1510 Ga0207697_10001374
1511 Ga0207697_10055588
1512 Ga0207653_10008349
1513 Ga0207682_10000043
1514 Ga0207682_10001519
1515 Ga0207682_10001931
1516 Ga0207692_10003295
1517 Ga0207692_10006313
1518 Ga0207642_10007175
1519 Ga0207710_10008560
1520 Ga0207710_10049955
1521 Ga0207688_10000083
1522 Ga0207688_10004971
1523 Ga0207680_10006796
1524 Ga0207647_10003002
1525 Ga0207685_10000528
1526 Ga0207685_10000914
1527 Ga0207699_10006599
1528 Ga0207699_10010546
1529 Ga0207699_10045368
1530 Ga0207645_10000899
1531 Ga0207645_10014247
1532 Ga0207645_10070342
1533 Ga0207643_10000128
1534 Ga0207643_10038664
1535 Ga0207643_10140506
1536 Ga0207684_10204578
1537 Ga0207654_10005950
1538 Ga0207707_10001534
1539 Ga0207707_10004166
1540 Ga0207707_10055634
1541 Ga0207707_10345496
1542 Ga0207695_10089205
1543 Ga0207695_10247016
1544 Ga0207671_10057611
1545 Ga0207671_10073915
1546 Ga0207671_10113763
1547 Ga0207671_10156329
1548 Ga0207671_10192162
1549 Ga0207693_10003105
1550 Ga0207693_10117568
1551 Ga0207693_10156925
1552 Ga0207663_10003674
1553 Ga0207663_10009887
1554 Ga0207663_10027621
1555 Ga0207660_10023127
1556 Ga0207660_10044159
1557 Ga0207660_10049075
1558 Ga0207662_10000975
1559 Ga0207662_10231736
1560 Ga0207657_10020169
1561 Ga0207649_10002321
1562 Ga0207652_10005425
1563 Ga0207652_10013947
1564 Ga0207652_10024211
1565 Ga0207652_10027543
1566 Ga0207652_10056338
1567 Ga0207646_10220450
1568 Ga0207681_10006781
1569 Ga0207681_10188193
1570 Ga0207694_10032282
1571 Ga0207650_10008902
1572 Ga0207650_10123258
1573 Ga0207659_10007188
1574 Ga0207659_10050993
1575 Ga0207687_10000522
1576 Ga0207687_10062204
1577 Ga0207687_10150080
1578 Ga0207700_10004890
1579 Ga0207700_10024078
1580 Ga0207700_10025747
1581 Ga0207700_10149321
1582 Ga0207664_10010948
1583 Ga0207644_10000611
1584 Ga0207644_10006011
1585 Ga0207644_10075011
1586 Ga0207690_10003223
1587 Ga0207706_10001616
1588 Ga0207706_10015033
1589 Ga0207686_10014769
1590 Ga0207686_10056767
1591 Ga0207709_10009743
1592 Ga0207709_10026097
1593 Ga0207709_10248435
1594 Ga0207709_10262109
1595 Ga0207670_10000631
1596 Ga0207670_10007366
1597 Ga0207669_10000797
1598 Ga0207669_10002598
1599 Ga0207669_10290147
1600 Ga0207704_10047461
1601 Ga0207704_10292194
1602 Ga0207665_10001379
1603 Ga0207665_10009568
1604 Ga0207665_10092666
1605 Ga0207691_10000599
1606 Ga0207691_10002935
1607 Ga0207691_10019716
1608 Ga0207691_10023830
1609 Ga0207691_10173454
1610 Ga0207711_10008296
1611 Ga0207711_10010676
1612 Ga0207711_10052202
1613 Ga0207711_10077904
1614 Ga0207711_10235281
1615 Ga0207689_10000165
1616 Ga0207689_10054251
1617 Ga0207689_10126494
1618 Ga0207689_10181700
1619 Ga0207689_10266925
1620 Ga0207689_10320271
1621 Ga0207661_10004909
1622 Ga0207661_10011748
1623 Ga0207661_10047173
1624 Ga0207679_10000112
1625 Ga0207667_10025956
1626 Ga0207667_10203956
1627 Ga0207667_10214557
1628 Ga0207667_10313675
1629 Ga0207651_10000099
1630 Ga0207651_10031165
1631 Ga0207712_10001957
1632 Ga0207668_10003391
1633 Ga0207668_10110071
1634 Ga0207668_10113802
1635 Ga0207668_10115342
1636 Ga0207668_10126611
1637 Ga0207668_10204806
1638 Ga0207668_10226629
1639 Ga0207640_10000382
1640 Ga0207658_10035295
1641 Ga0207658_10276669
1642 Ga0207677_10005315
1643 Ga0207677_10010700
1644 Ga0207677_10133847
1645 Ga0207677_10174836
1646 Ga0207677_10189017
1647 Ga0207703_10004258
1648 Ga0207703_10025231
1649 Ga0207639_10032542
1650 Ga0207639_10042404
1651 Ga0207639_10205900
1652 Ga0207639_10208433
1653 Ga0207639_10269595
1654 Ga0207639_10285271
1655 Ga0207678_10003272
1656 Ga0207678_10007002
1657 Ga0207678_10031527
1658 Ga0207678_10056323
1659 Ga0207678_10299181
1660 Ga0207708_10012755
1661 Ga0207708_10148868
1662 Ga0207708_10397502
1663 Ga0207702_10093858
1664 Ga0207702_10142451
1665 Ga0207641_10001777
1666 Ga0207648_10007480
1667 Ga0207648_10031836
1668 Ga0207648_10047840
1669 Ga0207676_10000494
1670 Ga0207676_10014703
1671 Ga0207676_10123689
1672 Ga0207674_10020449
1673 Ga0207674_10035721
1674 Ga0207674_10082755
1675 Ga0207674_10099104
1676 Ga0207674_10102256
1677 Ga0207675_100003533
1678 Ga0207675_100301176
1679 Ga0207683_10001272
1680 Ga0207683_10001853
1681 Ga0207683_10007911
1682 Ga0207683_10011627
1683 Ga0207683_10014162
1684 Ga0207683_10015318
1685 Ga0207683_10027632
1686 Ga0207683_10042796
1687 Ga0207683_10185536
1688 Ga0207683_10194398
1689 Ga0207698_10063441
1690 Ga0207698_10070195
1691 Ga0210002_1001992
1692 Ga0209998_10001588
1693 Ga0209813_10016915
1694 Ga0209974_10032320
1695 Ga0207428_10000064
1696 Ga0207428_10000140
1697 Ga0268266_10004422
1698 Ga0268266_10007719
1699 Ga0268266_10025484
1700 Ga0268266_10047939
1701 Ga0268266_10055302
1702 Ga0268266_10110471
1703 Ga0268266_10127814
1704 Ga0268266_10195528
1705 Ga0268266_10318353
1706 Ga0268266_10365962
1707 Ga0268266_10418333
1708 Ga0268265_10011223
1709 Ga0268265_10026351
1710 Ga0268265_10113231
1711 Ga0268265_10205865
1712 Ga0268264_10000107
1713 Ga0268264_10005082
1714 Ga0268264_10086725
1715 Ga0268264_10104967
1716 Ga0265334_10015125
1717 Ga0307515_10060988
1718 Ga0265332_10050236
1719 Ga0265328_10058289
1720 Ga0265325_10000006
1721 Ga0265325_10075637
1722 Ga0265329_10012070
1723 Ga0265340_10014381
1724 Ga0265339_10006887
1725 Ga0265331_10034717
1726 Ga0265316_10221091
1727 Ga0307513_10077502
1728 Ga0307513_10144650
1729 Ga0307509_10021381
1730 Ga0265313_10023271
1731 Ga0307508_10000154
1732 Ga0307508_10265459
1733 Ga0265314_10005615
1734 Ga0265342_10003968
1735 Ga0265342_10017314
1736 Ga0265342_10102272
1737 Ga0265342_10106101
1738 Ga0307516_10029059
1739 Ga0307410_10174005
1740 Ga0307416_100063443
1741 Ga0307510_10156282
1742 Ga0315911_1000008
1743 Ga0373930_0001231
1744 Ga0373958_0010245
1745 Ga0373959_0002918
1746 Ga0373938_0015719
1747 Ga0373928_0022088
1748 Ga0373929_0017606
1749 Ga0373934_0023900
1750 Ga0373940_0004788
1751 Ga0373952_0000859
1752 Ga0373952_0004422
1753 Ga0373923_0040479
1754 Ga0373923_0051674
1755 Ga0373923_0119338
1756 Ga0373936_0006063
1757 Ga0373941_0000494
1758 Ga0373941_0005534
1759 Ga0373941_0007844
1760 Ga0373953_0001092
1761 Ga0373953_0004155
1762 Ga0373953_0019195
1763 Ga0373954_0001821
1764 Ga0373954_0046149
1765 Ga0373956_0002051
1766 Ga0373956_0002956
1767 Ga0373957_0000374
1768 Ga0373960_0000398
1769 Ga0373960_0040243
1770 Ga0373943_0005372
1771 Ga0373943_0052716
1772 Ga0373943_0162967
1773 Ga0373946_0027757
1774 Ga0373946_0137298
1775 Ga0373955_0009267
1776 Ga0373955_0009372
1777 Ga0373955_0011740
1778 Ga0373955_0046015
1779 Ga0373962_0003525
1780 Ga0373962_0022368
1781 Ga0373924_0020683
1782 Ga0373931_0001718
1783 Ga0373931_0014040
1784 Ga0373931_0019150
1785 Ga0373931_0034618
1786 Ga0373935_0006022
1787 Ga0373935_0083521
1788 Ga0373935_0107474
1789 Ga0373935_0206185
1790 Ga0373927_0025352
1791 Ga0373927_0042636
1792 Ga0373927_0153904
1793 Ga0373933_0001100
1794 Ga0373933_0045156
1795 Ga0373947_0000340
1796 Ga0373947_0035595
1797 Ga0373947_0064359
1798 Ga0373947_0088961
1799 Ga0373947_0170331
1800 Ga0373937_0001302
1801 Ga0373937_0002947
1802 Ga0373937_0005103
1803 Ga0373937_0017774
1804 Ga0373937_0064217
1805 Ga0373937_0318829
1806 Ga0373925_0007663
1807 Ga0373925_0008452
1808 Ga0373925_0020271
1809 Ga0373925_0052361
1810 Ga0436364_1064018
1811 Ga0395901_0784501
1812 Ga0436365_0702073
1813 Ga0439453_0000060
1814 Ga0451807_0668963
1815 Ga0439435_0002105
1816 Ga0466957_0033043
1817 Ga0466958_0114579
1818 Ga0466967_0122303
1819 Ga0495592_0001601
1820 Ga0495592_0005759
1821 Ga0495603_0019964
1822 Ga0495603_0022944
1823 Ga0495603_0025589
1824 Ga0495603_0053963
1825 Ga0495603_0099568
1826 Ga0495629_0000529
1827 Ga0495629_0008986
1828 Ga0495629_0046527
1829 Ga0495629_0059688
1830 Ga0495629_0172112
1831 Ga0495638_0009159
1832 Ga0495638_0011077
1833 Ga0495651_0001433
1834 Ga0495651_0020115
1835 Ga0495651_0195766
1836 Ga0495651_0260327
1837 Ga0495653_0016031
1838 Ga0495653_0051871
1839 Ga0495653_0089488
1840 Ga0495653_0090070
1841 Ga0495653_0160841
1842 Ga0495582_0006293
1843 Ga0495605_0058205
1844 Ga0495605_0126410
1845 Ga0495639_0009690
1846 Ga0495639_0034011
1847 Ga0495639_0066427
1848 Ga0495664_0018790
1849 Ga0495664_0023312
1850 Ga0495664_0029806
1851 Ga0495664_0037955
1852 Ga0495584_0120905
1853 Ga0495585_0031604
1854 Ga0495585_0038601
1855 Ga0495585_0105382
1856 Ga0495594_0054755
1857 Ga0495583_0104207
1858 Ga0495606_0001566
1859 Ga0495606_0074530
1860 Ga0495608_0008113
1861 Ga0495608_0011568
1862 Ga0495608_0016511
1863 Ga0495608_0098528
1864 Ga0495618_0015173
1865 Ga0495618_0048917
1866 Ga0495628_0002572
1867 Ga0495628_0007597
1868 Ga0495628_0015999
1869 Ga0495628_0314441
1870 Ga0495630_0040548
1871 Ga0495630_0103006
1872 Ga0495631_0115442
1873 Ga0495666_0069319
1874 Ga0495652_0002428
1875 Ga0495652_0091823
1876 Ga0495652_0115683
1877 Ga0495665_0005351
1878 Ga0495665_0085638
1879 Ga0495640_0015450
1880 Ga0495640_0047337
1881 Ga0495640_0064294
1882 Ga0495587_0009736
1883 Ga0495587_0052159
1884 Ga0495598_0017520
1885 Ga0495609_0090437
1886 Ga0495621_0023115
1887 Ga0495621_0050206
1888 Ga0495645_0001788
1889 Ga0495645_0025716
1890 Ga0495645_0028258
1891 Ga0495645_0038226
1892 Ga0495645_0052493
1893 Ga0495645_0094722
1894 Ga0495667_0003563
1895 Ga0495667_0005768
1896 Ga0495667_0119452
1897 Ga0495656_0016994
1898 Ga0495656_0032549
1899 Ga0495656_0035929
1900 Ga0495656_0091561
1901 Ga0495668_0118180
1902 Ga0495634_0004321
1903 Ga0495625_0082150
1904 Ga0495635_0000429
1905 Ga0495635_0013995
1906 Ga0495635_0027056
1907 Ga0495635_0322937
1908 Ga0495659_0007040
1909 Ga0495659_0033686
1910 Ga0495588_0083701
1911 Ga0495657_0009336
1912 Ga0495657_0010262
1913 Ga0495657_0013260
1914 Ga0495599_0003035
1915 Ga0495623_0007229
1916 Ga0495623_0007655
1917 Ga0495623_0049055
1918 Ga0495623_0102314
1919 Ga0495623_0127033
1920 Ga0495646_0001304
1921 Ga0495646_0043515
1922 Ga0495647_0008584
1923 Ga0495658_0000781
1924 Ga0495658_0011048
1925 Ga0495669_0077313
1926 Ga0495669_0083675
1927 Ga0495613_0006286
1928 Ga0495613_0029327
1929 Ga0495613_0219605
1930 Ga0495624_0040078
1931 Ga0495624_0081726
1932 Ga0495624_0132083
1933 Ga0495670_0012130
1934 Ga0495649_0080821
1935 Ga0495600_0007607
1936 Ga0495600_0014546
1937 Ga0495581_0005737
1938 Ga0495581_0030017
1939 Ga0495581_0092012
1940 Ga0495604_0002235
1941 Ga0495604_0002822
1942 Ga0495604_0010023
1943 Ga0495604_0116513
1944 Ga0495674_0004206
1945 Ga0495674_0006763
1946 Ga0495674_0021636
1947 Ga0495674_0082394
1948 Ga0495674_0198450
1949 Ga0495672_0032259
1950 Ga0495672_0106579
1951 Ga0495676_0062585
1952 Ga0495676_0121550
1953 Ga0495680_0006824
1954 Ga0495680_0029393
1955 Ga0495675_0002904
1956 Ga0495675_0067445
1957 Ga0495684_0000497
1958 Ga0495684_0015464
1959 Ga0495684_0016411
1960 Ga0495684_0025159
1961 Ga0495684_0281626
1962 Ga0495686_0147868
1963 Ga0495593_0014868
1964 Ga0495593_0014947
1965 Ga0495593_0016723
1966 Ga0495593_0023433
1967 Ga0495602_0040996
1968 Ga0495602_0128581
1969 Ga0495602_0152128
1970 Ga0495614_0010418
1971 Ga0495614_0018899
1972 Ga0495615_0000368
1973 Ga0495615_0012724
1974 Ga0496100_0012538
1975 Ga0496100_0015511
1976 Ga0496100_0040306
1977 Ga0496100_0072267
1978 Ga0496100_0128194
1979 Ga0496100_0249420
1980 Ga0496100_0279397
1981 Ga0496101_0000235
1982 Ga0496101_0001165
1983 Ga0496101_0008415
1984 Ga0496101_0019223
1985 Ga0496101_0052924
1986 Ga0496101_0053933
1987 Ga0496101_0195594
1988 Ga0496102_0005341
1989 Ga0496102_0022951
1990 Ga0496102_0028248
1991 Ga0496102_0039515
1992 Ga0496102_0155347
1993 Ga0496103_0003790
1994 Ga0496103_0011444
1995 Ga0496103_0014101
1996 Ga0496104_0000351
1997 Ga0496104_0003146
1998 Ga0496104_0008914
1999 Ga0496104_0215047
2000 Ga0496104_0250055
2001 Ga0496104_0285969
2002 Ga0496104_0499306
2003 Ga0496105_0000840
2004 Ga0496105_0006427
2005 Ga0496105_0012927
2006 Ga0496105_0029441
2007 Ga0496105_0030009
2008 Ga0496105_0037048
2009 Ga0496105_0190590
2010 Ga0496106_0000788
2011 Ga0496106_0002108
2012 Ga0496106_0010763
2013 Ga0496106_0011781
2014 Ga0496106_0169369
2015 Ga0496106_0181176
2016 Ga0496106_0186831
2017 Ga0496106_0325966
2018 Ga0496107_0004819
2019 Ga0496107_0011301
2020 Ga0496107_0013863
2021 Ga0496107_0030116
2022 Ga0496107_0074682
2023 Ga0496107_0111973
2024 Ga0496108_0011130
2025 Ga0496108_0016530
2026 Ga0496108_0019665
2027 Ga0496108_0037794
2028 Ga0496108_0082807
2029 Ga0496108_0237162
2030 Ga0496109_0005654
2031 Ga0496109_0007962
2032 Ga0496109_0023341
2033 Ga0496109_0027237
2034 Ga0496109_0028566
2035 Ga0496109_0040011
2036 Ga0496109_0045566
2037 Ga0496110_0034051
2038 Ga0496110_0039961
2039 Ga0496110_0075409
2040 Ga0496110_0492910
2041 Ga0496111_0002946
2042 Ga0496111_0009883
2043 Ga0496111_0039701
2044 Ga0496111_0057681
2045 Ga0496112_0000018
2046 Ga0496112_0011859
2047 Ga0496112_0013345
2048 Ga0496112_0030393
2049 Ga0496112_0069569
2050 Ga0496112_0334061
2051 Ga0496112_0421533
2052 Ga0496113_0013732
2053 Ga0496113_0017464
2054 Ga0496113_0035587
2055 Ga0496113_0062084
2056 Ga0496113_0071978
2057 Ga0496114_0009940
2058 Ga0496114_0023363
2059 Ga0496114_0037148
2060 Ga0496114_0048719
2061 Ga0496114_0066495
2062 Ga0496114_0112239
2063 Ga0496115_0002701
2064 Ga0496115_0010842
2065 Ga0496115_0019196
2066 Ga0496115_0050174
2067 Ga0496115_0078464
2068 Ga0496115_0109684
2069 Ga0496115_0123713
2070 Ga0496116_0227024
2071 Ga0496117_0007128
2072 Ga0496117_0074479
2073 Ga0496118_0003592
2074 Ga0496118_0078665
2075 Ga0496119_0055304
2076 Ga0496121_0000640
2077 Ga0496121_0038643
2078 Ga0496121_0046507
2079 Ga0496121_0048134
2080 Ga0496121_0093528
2081 Ga0496121_0188119
2082 Ga0496124_0002189
2083 Ga0496125_0085843
2084 Ga0496126_0009499
2085 Ga0496126_0018354
2086 Ga0496126_0043259
2087 Ga0496126_0047915
2088 Ga0496126_0068906
2089 Ga0496126_0080924
2090 Ga0496126_0115449
2091 Ga0496126_0164235
2092 Ga0496126_0254389
2093 Ga0501036_0003984
2094 Ga0501037_0025075
2095 Ga0501037_0040497
2096 Ga0501038_0040262
2097 Ga0501046_0067505
2098 Ga0501047_0000100
2099 Ga0501047_0052511
2100 Ga0501048_0000083
2101 Ga0501048_0098144
2102 Ga0501068_0041556
2103 Ga0501070_0009792
2104 Ga0501070_0152053
2105 Ga0501070_0215422
2106 Ga0501072_0003943
2107 Ga0501072_0218576
2108 Ga0501074_0017935
2109 Ga0501074_0040074
2110 Ga0501074_0046177
2111 Ga0501079_0033083
2112 Ga0501080_0000030
2113 Ga0501080_0029073
2114 Ga0501080_0290083
2115 Ga0501083_0002641
2116 Ga0501083_0194828
2117 Ga0501035_0023582
2118 Ga0501035_0438882
2119 Ga0501044_0000587
2120 nmdc:mga03n38_150788_c1
2121 nmdc:mga0yw44_104257_c1
2122 nmdc:mga0yw44_63102_c1
2123 nmdc:mga0k408_2505_c2
2124 nmdc:mga0k408_36277_c1
2125 nmdc:mga06z11_34154_c1
2126 nmdc:mga06z11_4911_c1
2127 nmdc:mga07m45_49692_c1
2128 nmdc:mga05p37_10233_c1
2129 nmdc:mga05p37_166916_c1
2130 nmdc:mga05p37_225_c1
2131 nmdc:mga09592_244_c1
2132 nmdc:mga09592_58040_c1
2133 nmdc:mga09592_736_c1
2134 nmdc:mga0qj67_215_c1
2135 nmdc:mga0qj67_2611_c1
2136 nmdc:mga0qj67_4314_c1
2137 nmdc:mga06r32_12515_c1
2138 nmdc:mga06r32_341_c1
2139 nmdc:mga06r32_731_c1
2140 nmdc:mga08y16_131595_c1
2141 nmdc:mga08y16_145004_c1
2142 nmdc:mga08y16_252107_c1
2143 nmdc:mga08y16_617_c1
2144 nmdc:mga08y16_6190_c1
2145 nmdc:mga0n895_308807_c1
2146 nmdc:mga0n895_457_c1
2147 nmdc:mga0n895_543324_c1
2148 nmdc:mga0rr50_11539_c1
2149 nmdc:mga0rr50_19557_c1
2150 nmdc:mga08x19_81571_c1
2151 nmdc:mga0a205_1019_c1
2152 nmdc:mga0a205_17989_c1
2153 Ga0495601_0000413
2154 Ga0495601_0000668
2155 Ga0495601_0005956
2156 Ga0495601_0007499
2157 Ga0495601_0018585
2158 Ga0495601_0060131
2159 Ga0495612_0001564
2160 Ga0495612_0002430
2161 Ga0495612_0006791
2162 Ga0495612_0008871
2163 Ga0495612_0019920
2164 Ga0495595_0000516
2165 Ga0495595_0001465
2166 Ga0495595_0003553
2167 Ga0495619_0001679
2168 Ga0495619_0001957
2169 Ga0495619_0002856
2170 Ga0495619_0020676
2171 Ga0495619_0054518
2172 Ga0495619_0106148
2173 Ga0495619_0128604
2174 Ga0500651_0102011
2175 Ga0500651_0185374
2176 Ga0500566_0001625
2177 Ga0500566_0013519
2178 Ga0500566_0107849
2179 Ga0500641_0098123
2180 Ga0500648_043289
2181 Ga0500594_0071074
2182 Ga0500595_000010
2183 Ga0500595_000095
2184 Ga0500595_003699
2185 Ga0500595_018815
2186 Ga0500642_0017123
2187 Ga0500658_0024140
2188 Ga0500559_0047011
2189 Ga0500573_0175702
2190 Ga0500622_0054551
2191 Ga0500627_0125752
2192 Ga0500634_0069625
2193 Ga0500638_006677
2194 Ga0500636_0014540
2195 Ga0500637_0000495
2196 Ga0500596_004825
2197 Ga0501082_0192337
2198 Ga0530510_0058804
2199 Ga0530510_0113785
2200 Ga0530510_0192984
2201 2513661634
2202 2513863107
2203 2513923311
2204 2517889126
2205 2524541222
2206 2671121588
2207 2728753705
2208 2793072628
2209 2876818203
2210 2879115151
2211 2885382864
2212 2903756127
2213 2904690931
2214 2904708248
2215 2906613483
2216 2906643032
2217 2906668201
2218 2908747738
2219 2908756987
2220 2922388792
2221 2922433921
2222 2935634942
2223 2941514270
2224 2941522231
2225 2941530102
2226 3005475361
2227 8006935923
2228 8006975961
2229 8019562749
2230 8019572828

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13531

SBP_bac_11

Bacterial extracellular solute-binding protein

52

307

0.87

PF13343

SBP_bac_6

Bacterial extracellular solute-binding protein

104

325

0.83

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

53

301

0.82

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

65

338

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4r74-assembly4.cif.gz_D structure of the periplasmic binding protein afua from actinobacillus pleuropneumoniae (exogenous fructose-6-phosphate bound) 0.9097 48 353
7f6o-assembly2.cif.gz_B crystal structure of metal-citrate-binding mutant (s26a) protein (mcta) of abc transporter endogenously bound to mn2+-citrate complex 0.8948 37 352
7f6p-assembly3.cif.gz_C crystal structure of metal-citrate-binding mutant (d28a) protein (mcta) of abc transporter endogenously bound to citrate 0.8946 37 352
6wce-assembly1.cif.gz_A structure of the periplasmic binding protein p5pa 0.8923 48 351
7f6e-assembly1.cif.gz_A crystal structure of metal-citrate-binding protein (mcta) of abc transporter endogenously bound to mg2+-citrate complex (form i) 0.8885 30 352
ID Description Score Start End Superfamily
4r74A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8827 48 318 3.40.190.10
1y4tD01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8827 50 315 3.40.190.10
af_Q2G1D9_30_309_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.869 50 330 3.40.190.10
1y4tD01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8661 50 315 3.40.190.10
4elqB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8651 49 321 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A537SX32-F1-model_v4 Extracellular solute-binding protein 0.9936 57 353 GO:0042597
GO:0046872
AF-A0A537SX32-F1-model_v4 Extracellular solute-binding protein 0.987 57 353 GO:0042597
GO:0046872
AF-A0A7S7TCI2-F1-model_v4 Iron ABC transporter substrate-binding protein 0.9867 19 353 GO:0046872
AF-A0A1F9A1T1-F1-model_v4 Iron ABC transporter substrate-binding protein 0.9802 71 353
AF-A0A1F7TGV6-F1-model_v4 Iron ABC transporter substrate-binding protein 0.9739 39 353 GO:0046872

Map