F490405

General Info

Members Datasets Scaffolds Average Seq Length
1121 384 2242 189

Family's Representative Sequence

Representative Sequence 3300031691|Ga0316579_10119696|Ga0316579_101196962
Length 220
Sequence VGPFTFVTRPYSIRPIEKEGPSATGKLEDLLALNVATASAAPGTYPALVLNADYRPLSYYPLSLWGWQDAVKAVFLDRVNIVSEYDHAVHSPSFEMRLPSVVSLKNYVRPALYPAFTRFNVFLRDRFTCQYCGDNQDLTFDHLIPRSRGGLTRWDNVVTACAPCNLLKGGQMPERAKMWPAQKPYRPTVFELHRNGRLFPPNYLHESWLDYLYWDTELEP

Samples

Sample ID Description Type Environment
1 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
9 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
83 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
84 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
85 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
86 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
87 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
88 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
89 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
90 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
91 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
92 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
93 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
94 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
95 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
96 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
97 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
98 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
99 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
100 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
101 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
102 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
104 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
105 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
106 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
108 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
109 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
111 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
112 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
113 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
114 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
115 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
118 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
119 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
120 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
128 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
132 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
133 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
195 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
196 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
200 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
201 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
203 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
204 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
205 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
206 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
207 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
208 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
209 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
210 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
211 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
212 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
213 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
214 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
215 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
216 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
217 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
218 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
219 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
220 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
221 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
222 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
223 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
224 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
225 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
226 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
227 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
228 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
229 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
230 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
231 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
232 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
233 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
234 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
235 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
236 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
237 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
238 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
239 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
240 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
241 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
242 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
243 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
244 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
245 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
246 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
247 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
248 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
249 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
250 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
251 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
252 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
253 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
254 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
255 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
256 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
257 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
258 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
259 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
260 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
261 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
262 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
263 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
264 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
265 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
266 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
267 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
268 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
269 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
270 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
271 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
272 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
273 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
274 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
275 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
276 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
277 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
278 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
279 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
280 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
281 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
282 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
283 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
284 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
285 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
286 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
287 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
288 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
289 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
290 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
291 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
292 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
293 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
294 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
295 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
296 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
297 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
298 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
299 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
300 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
301 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
302 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
303 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
304 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
305 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
306 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
307 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
323 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
324 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
325 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
326 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
327 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
328 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
329 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
330 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
331 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
332 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
333 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
334 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
335 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
336 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
337 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
340 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
341 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
342 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
343 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
344 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
345 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
346 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
347 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
348 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
349 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
350 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
351 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
352 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
353 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
354 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
355 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
356 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
357 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
358 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
359 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
360 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
361 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
362 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
363 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
364 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
365 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
366 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
367 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
368 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
369 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
370 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
371 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
372 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
373 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
374 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
375 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
376 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
377 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
378 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
379 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
381 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
382 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
383 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
384 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.46
Metatranscriptomes 0.36
Isolates 0.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.85
Nodule 0
Rhizoplane 7.85
Rhizosphere 83.23
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316579_10119696 3300031691 Bacteria 1265
2 JGI24737J22298_10081339 3300001990 Bacteria 964
3 JGI24743J22301_10034028 3300001991 Bacteria 1010
4 JGI24738J21930_10015365 3300002075 Bacteria 1630
5 JGI24744J21845_10033172 3300002077 Bacteria 983
6 JGI24751J29686_10007195 3300002459 Bacteria 2274
7 JGI25153J46596_10000795 3300003215 Bacteria 19333
8 JGI25404J52841_10075442 3300003659 Bacteria 705
9 Ga0058861_11856512 3300004800 Bacteria 662
10 Ga0070658_10022621 3300005327 Bacteria 5044
11 Ga0070658_10113711 3300005327 Bacteria 2244
12 Ga0070676_10011090 3300005328 Bacteria 4898
13 Ga0070676_10343045 3300005328 Bacteria 1025
14 Ga0070683_100820424 3300005329 Bacteria 892
15 Ga0070690_100000561 3300005330 Bacteria 18625
16 Ga0070670_100183978 3300005331 Bacteria 1814
17 Ga0068869_100009514 3300005334 Bacteria 6306
18 Ga0068869_100241917 3300005334 Bacteria 1438
19 Ga0068869_100514748 3300005334 Bacteria 1001
20 Ga0070666_10035262 3300005335 Bacteria 3318
21 Ga0070680_100002131 3300005336 Bacteria 14630
22 Ga0070680_100005579 3300005336 Bacteria 9529
23 Ga0070680_100015559 3300005336 Bacteria 5968
24 Ga0070682_100005412 3300005337 Bacteria 7109
25 Ga0070682_100026953 3300005337 Bacteria 3444
26 Ga0068868_100173535 3300005338 Bacteria 1786
27 Ga0068868_100452505 3300005338 Bacteria 1117
28 Ga0070660_100000992 3300005339 Bacteria 19050
29 Ga0070660_100023114 3300005339 Bacteria 4604
30 Ga0070660_100097889 3300005339 Bacteria 2321
31 Ga0070660_100424041 3300005339 Bacteria 1102
32 Ga0070660_100438389 3300005339 Bacteria 1083
33 Ga0070689_100001726 3300005340 Bacteria 13976
34 Ga0070689_100248503 3300005340 Bacteria 1467
35 Ga0070691_10000562 3300005341 Bacteria 14127
36 Ga0070691_10006469 3300005341 Bacteria 5356
37 Ga0070691_10233096 3300005341 Bacteria 980
38 Ga0070661_100012630 3300005344 Bacteria 5909
39 Ga0070692_10009644 3300005345 Bacteria 4363
40 Ga0070692_10314946 3300005345 Bacteria 960
41 Ga0070668_100002757 3300005347 Bacteria 12917
42 Ga0070668_100032459 3300005347 Bacteria 3974
43 Ga0070669_100006492 3300005353 Bacteria 8422
44 Ga0070675_100015761 3300005354 Bacteria 5982
45 Ga0070675_100066500 3300005354 Bacteria 2982
46 Ga0070671_100244508 3300005355 Bacteria 1523
47 Ga0070674_100003270 3300005356 Bacteria 9057
48 Ga0070674_100171348 3300005356 Bacteria 1655
49 Ga0070674_100446376 3300005356 Bacteria 1067
50 Ga0070673_100001503 3300005364 Bacteria 13694
51 Ga0070688_100000325 3300005365 Bacteria 24378
52 Ga0070688_100037055 3300005365 Bacteria 2970
53 Ga0070659_100049377 3300005366 Bacteria 3308
54 Ga0070659_100573276 3300005366 Bacteria 968
55 Ga0070667_100001935 3300005367 Bacteria 18374
56 Ga0070703_10001104 3300005406 Bacteria 8368
57 Ga0070703_10024599 3300005406 Bacteria 1781
58 Ga0070709_10003028 3300005434 Bacteria 9023
59 Ga0070709_10433117 3300005434 Bacteria 988
60 Ga0070714_100004288 3300005435 Bacteria 10745
61 Ga0070714_100060495 3300005435 Bacteria 3250
62 Ga0070714_100601723 3300005435 Bacteria 1056
63 Ga0070713_100057888 3300005436 Bacteria 3229
64 Ga0070713_100225167 3300005436 Bacteria 1703
65 Ga0070713_100575706 3300005436 Bacteria 1068
66 Ga0070710_10001947 3300005437 Bacteria 9772
67 Ga0070710_10214335 3300005437 Bacteria 1222
68 Ga0070701_10058914 3300005438 Bacteria 2017
69 Ga0070701_10174014 3300005438 Bacteria 1256
70 Ga0070705_100002473 3300005440 Bacteria 9285
71 Ga0070705_100006034 3300005440 Bacteria 5927
72 Ga0070705_100103977 3300005440 Bacteria 1800
73 Ga0070700_100002150 3300005441 Bacteria 9990
74 Ga0070700_100280656 3300005441 Bacteria 1208
75 Ga0070694_100002195 3300005444 Bacteria 11576
76 Ga0070694_100012212 3300005444 Bacteria 5336
77 Ga0070694_100110347 3300005444 Bacteria 1959
78 Ga0070708_100017015 3300005445 Bacteria 6053
79 Ga0070663_100019318 3300005455 Bacteria 4487
80 Ga0070663_100030914 3300005455 Bacteria 3674
81 Ga0070663_100064599 3300005455 Bacteria 2646
82 Ga0070663_100134703 3300005455 Bacteria 1880
83 Ga0070663_100196569 3300005455 Bacteria 1572
84 Ga0070663_100559377 3300005455 Bacteria 957
85 Ga0070678_100011080 3300005456 Bacteria 5543
86 Ga0070678_100083255 3300005456 Bacteria 2432
87 Ga0070678_100281826 3300005456 Bacteria 1406
88 Ga0070662_100026312 3300005457 Bacteria 4028
89 Ga0070662_100426578 3300005457 Bacteria 1098
90 Ga0070681_10058131 3300005458 Bacteria 3847
91 Ga0070681_10181373 3300005458 Bacteria 2027
92 Ga0070681_10194801 3300005458 Bacteria 1946
93 Ga0070681_10238539 3300005458 Bacteria 1732
94 Ga0070681_10745931 3300005458 Bacteria 896
95 Ga0068867_100345218 3300005459 Bacteria 1241
96 Ga0068867_100595764 3300005459 Bacteria 963
97 Ga0068867_100936278 3300005459 Bacteria 782
98 Ga0070685_10012899 3300005466 Bacteria 4399
99 Ga0070706_100222435 3300005467 Bacteria 1762
100 Ga0070707_100099790 3300005468 Bacteria 2813
101 Ga0070699_100365272 3300005518 Bacteria 1302
102 Ga0070699_100465247 3300005518 Bacteria 1147
103 Ga0070679_100020360 3300005530 Bacteria 6467
104 Ga0070679_100062398 3300005530 Bacteria 3715
105 Ga0070679_100278139 3300005530 Bacteria 1627
106 Ga0070697_100010611 3300005536 Bacteria 7189
107 Ga0070697_100396520 3300005536 Bacteria 1197
108 Ga0068853_100019714 3300005539 Bacteria 5599
109 Ga0068853_100081680 3300005539 Bacteria 2830
110 Ga0070672_100004041 3300005543 Bacteria 9572
111 Ga0070686_100003435 3300005544 Bacteria 8693
112 Ga0070686_100263238 3300005544 Bacteria 1265
113 Ga0070695_100000469 3300005545 Bacteria 20922
114 Ga0070695_100004632 3300005545 Bacteria 8082
115 Ga0070695_100030077 3300005545 Bacteria 3379
116 Ga0070696_100002758 3300005546 Bacteria 11651
117 Ga0070696_100013920 3300005546 Bacteria 5398
118 Ga0070696_100025462 3300005546 Bacteria 4023
119 Ga0070696_100130543 3300005546 Bacteria 1828
120 Ga0070696_100436704 3300005546 Bacteria 1031
121 Ga0070693_100098217 3300005547 Bacteria 1779
122 Ga0070665_100002525 3300005548 Bacteria 20104
123 Ga0070665_100127253 3300005548 Bacteria 2550
124 Ga0070665_100807996 3300005548 Bacteria 951
125 Ga0070704_100001153 3300005549 Bacteria 13818
126 Ga0070704_100012084 3300005549 Bacteria 5323
127 Ga0068855_100057146 3300005563 Bacteria 4574
128 Ga0068855_100090642 3300005563 Bacteria 3528
129 Ga0068855_100133243 3300005563 Bacteria 2836
130 Ga0070664_100005363 3300005564 Bacteria 10293
131 Ga0068857_100010679 3300005577 Bacteria 7987
132 Ga0068857_100494202 3300005577 Bacteria 1148
133 Ga0068854_100911776 3300005578 Bacteria 773
134 Ga0068856_100022052 3300005614 Bacteria 6193
135 Ga0068856_100240978 3300005614 Bacteria 1824
136 Ga0070702_100027617 3300005615 Bacteria 3065
137 Ga0070702_100153964 3300005615 Bacteria 1479
138 Ga0068852_100791962 3300005616 Bacteria 962
139 Ga0068852_101042495 3300005616 Bacteria 837
140 Ga0068859_100053762 3300005617 Bacteria 4050
141 Ga0068859_100100373 3300005617 Bacteria 2950
142 Ga0068859_100250447 3300005617 Bacteria 1862
143 Ga0068859_100856337 3300005617 Bacteria 995
144 Ga0068864_100008037 3300005618 Bacteria 8703
145 Ga0068866_10006874 3300005718 Bacteria 4752
146 Ga0068866_10084586 3300005718 Bacteria 1712
147 Ga0068861_100001916 3300005719 Bacteria 13393
148 Ga0068861_100110932 3300005719 Bacteria 2197
149 Ga0068861_100252383 3300005719 Bacteria 1506
150 Ga0068861_100393988 3300005719 Bacteria 1227
151 Ga0068861_101028450 3300005719 Bacteria 788
152 Ga0068851_10037550 3300005834 Bacteria 2429
153 Ga0068863_100005761 3300005841 Bacteria 12158
154 Ga0068863_100291455 3300005841 Bacteria 1582
155 Ga0068863_100307741 3300005841 Bacteria 1538
156 Ga0068858_100005292 3300005842 Bacteria 12650
157 Ga0068858_100131671 3300005842 Bacteria 2346
158 Ga0068858_100445738 3300005842 Bacteria 1247
159 Ga0068858_100638864 3300005842 Bacteria 1034
160 Ga0068860_100002761 3300005843 Bacteria 18272
161 Ga0068860_100129149 3300005843 Bacteria 2424
162 Ga0068860_100323957 3300005843 Bacteria 1513
163 Ga0068862_100000882 3300005844 Bacteria 29221
164 Ga0068862_100050365 3300005844 Bacteria 3559
165 Ga0068862_100094138 3300005844 Bacteria 2613
166 Ga0068862_100443994 3300005844 Bacteria 1222
167 Ga0068862_100630580 3300005844 Bacteria 1032
168 Ga0081455_10000017 3300005937 Bacteria 174550
169 Ga0081455_10087625 3300005937 Bacteria 2532
170 Ga0081455_10281850 3300005937 Bacteria 1200
171 Ga0081540_1000059 3300005983 Bacteria 120226
172 Ga0081540_1002895 3300005983 Bacteria 13848
173 Ga0081540_1104620 3300005983 Bacteria 1211
174 Ga0081539_10047256 3300005985 Bacteria 2460
175 Ga0081539_10055948 3300005985 Bacteria 2192
176 Ga0075365_10008422 3300006038 Bacteria 5853
177 Ga0075365_10303298 3300006038 Bacteria 1124
178 Ga0075365_10338372 3300006038 Bacteria 1060
179 Ga0075368_10002627 3300006042 Bacteria 5900
180 Ga0075368_10010081 3300006042 Bacteria 3411
181 Ga0075368_10069205 3300006042 Bacteria 1424
182 Ga0075363_100002556 3300006048 Bacteria 7474
183 Ga0075363_100051202 3300006048 Bacteria 2201
184 Ga0075363_100207540 3300006048 Bacteria 1121
185 Ga0075363_100215199 3300006048 Bacteria 1100
186 Ga0075363_100238686 3300006048 Bacteria 1045
187 Ga0075364_10007444 3300006051 Bacteria 6502
188 Ga0075364_10050791 3300006051 Bacteria 2707
189 Ga0075432_10046498 3300006058 Bacteria 1523
190 Ga0070715_10000677 3300006163 Bacteria 9132
191 Ga0070715_10146388 3300006163 Bacteria 1153
192 Ga0070716_100427168 3300006173 Bacteria 960
193 Ga0070712_100152274 3300006175 Bacteria 1777
194 Ga0070712_100414793 3300006175 Bacteria 1115
195 Ga0070712_100436899 3300006175 Bacteria 1087
196 Ga0070712_100998755 3300006175 Bacteria 724
197 Ga0075362_10009019 3300006177 Bacteria 3839
198 Ga0075362_10105180 3300006177 Bacteria 1323
199 Ga0075367_10002466 3300006178 Bacteria 8466
200 Ga0075367_10059803 3300006178 Bacteria 2270
201 Ga0075367_10117459 3300006178 Bacteria 1637
202 Ga0075367_10708397 3300006178 Bacteria 640
203 Ga0075367_10708398 3300006178 Bacteria 640
204 Ga0075366_10009689 3300006195 Bacteria 5384
205 Ga0075366_10035651 3300006195 Bacteria 2933
206 Ga0075366_10108172 3300006195 Bacteria 1672
207 Ga0075370_10122743 3300006353 Bacteria 1513
208 Ga0075370_10123722 3300006353 Bacteria 1507
209 Ga0075370_10193803 3300006353 Bacteria 1198
210 Ga0075428_100004072 3300006844 Bacteria 16071
211 Ga0075428_100066837 3300006844 Bacteria 3936
212 Ga0075428_100075933 3300006844 Bacteria 3669
213 Ga0075428_100089721 3300006844 Bacteria 3353
214 Ga0075428_100220249 3300006844 Bacteria 2049
215 Ga0075428_100630909 3300006844 Bacteria 1143
216 Ga0075430_100020936 3300006846 Bacteria 5560
217 Ga0075430_100157719 3300006846 Bacteria 1889
218 Ga0075430_100175781 3300006846 Bacteria 1781
219 Ga0075430_100185834 3300006846 Bacteria 1728
220 Ga0075431_100000351 3300006847 Bacteria 36455
221 Ga0075431_100000970 3300006847 Bacteria 25471
222 Ga0075431_100216367 3300006847 Bacteria 1955
223 Ga0075431_100367977 3300006847 Bacteria 1443
224 Ga0075431_100571027 3300006847 Bacteria 1117
225 Ga0075433_10896263 3300006852 Bacteria 774
226 Ga0075434_100003410 3300006871 Bacteria 14224
227 Ga0075434_100096194 3300006871 Bacteria 2966
228 Ga0075434_100096348 3300006871 Bacteria 2964
229 Ga0075434_100131948 3300006871 Bacteria 2518
230 Ga0075434_100231210 3300006871 Bacteria 1868
231 Ga0075429_100022672 3300006880 Bacteria 5443
232 Ga0075429_100067251 3300006880 Bacteria 3118
233 Ga0075429_100392073 3300006880 Bacteria 1216
234 Ga0075429_100475372 3300006880 Bacteria 1095
235 Ga0068865_100046207 3300006881 Bacteria 2987
236 Ga0075436_100008583 3300006914 Bacteria 6982
237 Ga0075436_100036883 3300006914 Bacteria 3375
238 Ga0075436_100060322 3300006914 Bacteria 2620
239 Ga0075436_100121871 3300006914 Bacteria 1825
240 Ga0097620_100053754 3300006931 Bacteria 4050
241 Ga0097620_100100376 3300006931 Bacteria 2950
242 Ga0097620_100250447 3300006931 Bacteria 1862
243 Ga0097620_100856192 3300006931 Bacteria 995
244 Ga0075435_100140032 3300007076 Bacteria 2029
245 Ga0075435_100221024 3300007076 Bacteria 1608
246 Ga0105250_10016435 3300009092 Bacteria 3015
247 Ga0105240_10100026 3300009093 Bacteria 3528
248 Ga0105240_10603380 3300009093 Bacteria 1208
249 Ga0105240_11042347 3300009093 Bacteria 873
250 Ga0111539_10020032 3300009094 Bacteria 8241
251 Ga0111539_10035569 3300009094 Bacteria 6029
252 Ga0111539_10110683 3300009094 Bacteria 3223
253 Ga0111539_10119809 3300009094 Bacteria 3083
254 Ga0111539_10166810 3300009094 Bacteria 2574
255 Ga0111539_10225597 3300009094 Bacteria 2182
256 Ga0111539_10486546 3300009094 Bacteria 1437
257 Ga0111539_10732256 3300009094 Bacteria 1151
258 Ga0105245_10048564 3300009098 Bacteria 3797
259 Ga0105245_10393016 3300009098 Bacteria 1384
260 Ga0105245_10438318 3300009098 Bacteria 1313
261 Ga0105245_10769293 3300009098 Bacteria 1000
262 Ga0105245_10784461 3300009098 Bacteria 990
263 Ga0105247_10000609 3300009101 Bacteria 28779
264 Ga0105247_10010671 3300009101 Bacteria 5546
265 Ga0114129_10018904 3300009147 Bacteria 9816
266 Ga0114129_10024012 3300009147 Bacteria 8641
267 Ga0114129_10062125 3300009147 Bacteria 5219
268 Ga0114129_10172552 3300009147 Bacteria 2947
269 Ga0114129_10190191 3300009147 Bacteria 2788
270 Ga0114129_10218183 3300009147 Bacteria 2575
271 Ga0114129_10232411 3300009147 Bacteria 2483
272 Ga0114129_10403542 3300009147 Bacteria 1801
273 Ga0114129_10993504 3300009147 Bacteria 1057
274 Ga0105243_10180118 3300009148 Bacteria 1837
275 Ga0105243_10194671 3300009148 Bacteria 1773
276 Ga0105243_10614103 3300009148 Bacteria 1048
277 Ga0105241_10034871 3300009174 Bacteria 3784
278 Ga0105241_10917135 3300009174 Bacteria 814
279 Ga0105241_11170261 3300009174 Bacteria 727
280 Ga0105242_10021952 3300009176 Bacteria 5017
281 Ga0105242_10088403 3300009176 Bacteria 2603
282 Ga0105242_10101644 3300009176 Bacteria 2437
283 Ga0105242_11584218 3300009176 Bacteria 688
284 Ga0105248_10002468 3300009177 Bacteria 20553
285 Ga0105248_10169236 3300009177 Bacteria 2463
286 Ga0105248_10648258 3300009177 Bacteria 1191
287 Ga0105248_10952958 3300009177 Bacteria 969
288 Ga0105248_10989801 3300009177 Bacteria 950
289 Ga0105238_10060410 3300009551 Bacteria 3794
290 Ga0105238_10161499 3300009551 Bacteria 2216
291 Ga0105238_10314470 3300009551 Bacteria 1551
292 Ga0105249_10005382 3300009553 Bacteria 11046
293 Ga0105249_10007873 3300009553 Bacteria 9283
294 Ga0105249_10032082 3300009553 Bacteria 4752
295 Ga0105249_10261902 3300009553 Bacteria 1719
296 Ga0105249_10682861 3300009553 Bacteria 1086
297 Ga0105249_10763255 3300009553 Bacteria 1030
298 Ga0105249_11162531 3300009553 Bacteria 842
299 Ga0105239_10489753 3300010375 Bacteria 1397
300 Ga0105239_10677970 3300010375 Bacteria 1178
301 Ga0105246_10000561 3300011119 Bacteria 20535
302 Ga0105246_10008712 3300011119 Bacteria 6242
303 Ga0105246_10014812 3300011119 Bacteria 4912
304 Ga0157373_10170815 3300013100 Bacteria 1530
305 Ga0157371_10005663 3300013102 Bacteria 10487
306 Ga0157371_10033849 3300013102 Bacteria 3669
307 Ga0157371_10605715 3300013102 Bacteria 815
308 Ga0157370_10083225 3300013104 Bacteria 3009
309 Ga0157370_10399825 3300013104 Bacteria 1264
310 Ga0157370_10440383 3300013104 Bacteria 1198
311 Ga0157370_10448868 3300013104 Bacteria 1186
312 Ga0157369_10007173 3300013105 Bacteria 12842
313 Ga0157369_10071315 3300013105 Bacteria 3730
314 Ga0157369_10320669 3300013105 Bacteria 1611
315 Ga0157374_10025204 3300013296 Bacteria 5336
316 Ga0157378_10008073 3300013297 Bacteria 9187
317 Ga0157378_10030176 3300013297 Bacteria 4790
318 Ga0157378_10905258 3300013297 Bacteria 913
319 Ga0163162_10041257 3300013306 Bacteria 4617
320 Ga0163162_11038436 3300013306 Bacteria 927
321 Ga0157372_10019854 3300013307 Bacteria 7242
322 Ga0157372_10021642 3300013307 Bacteria 6951
323 Ga0157372_10063261 3300013307 Bacteria 4148
324 Ga0157375_10040766 3300013308 Bacteria 4479
325 Ga0157375_10044221 3300013308 Bacteria 4325
326 Ga0157375_10135173 3300013308 Bacteria 2588
327 Ga0157375_10404414 3300013308 Bacteria 1532
328 Ga0157375_10633418 3300013308 Bacteria 1226
329 Ga0163163_10026589 3300014325 Bacteria 5534
330 Ga0163163_10108959 3300014325 Bacteria 2797
331 Ga0163163_11021653 3300014325 Bacteria 890
332 Ga0157380_10025361 3300014326 Bacteria 4496
333 Ga0157380_10226148 3300014326 Bacteria 1677
334 Ga0157379_10028501 3300014968 Bacteria 4966
335 Ga0157379_10203703 3300014968 Bacteria 1790
336 Ga0157379_10236023 3300014968 Bacteria 1658
337 Ga0157379_10390940 3300014968 Bacteria 1277
338 Ga0157376_10011540 3300014969 Bacteria 6518
339 Ga0157376_10065450 3300014969 Bacteria 3069
340 Ga0157376_10296288 3300014969 Bacteria 1529
341 Ga0163161_10001569 3300017792 Bacteria 16869
342 Ga0163161_10015108 3300017792 Bacteria 5383
343 Ga0163161_10210300 3300017792 Bacteria 1502
344 Ga0163161_10714111 3300017792 Bacteria 836
345 Ga0213876_10010267 3300021384 Bacteria 5028
346 Ga0224712_10396512 3300022467 Bacteria 657
347 Ga0207656_10161814 3300025321 Bacteria 1066
348 Ga0207696_1087311 3300025711 Bacteria 857
349 Ga0207653_10000374 3300025885 Bacteria 20974
350 Ga0207692_10002749 3300025898 Bacteria 6778
351 Ga0207642_10142868 3300025899 Bacteria 1264
352 Ga0207642_10500055 3300025899 Bacteria 744
353 Ga0207710_10099730 3300025900 Bacteria 1368
354 Ga0207688_10007398 3300025901 Bacteria 5979
355 Ga0207688_10148136 3300025901 Bacteria 1385
356 Ga0207680_10039662 3300025903 Bacteria 2734
357 Ga0207647_10026669 3300025904 Bacteria 3777
358 Ga0207647_10070216 3300025904 Bacteria 2116
359 Ga0207647_10303463 3300025904 Bacteria 909
360 Ga0207699_10003347 3300025906 Bacteria 7642
361 Ga0207699_10400590 3300025906 Bacteria 977
362 Ga0207699_10453189 3300025906 Bacteria 920
363 Ga0207645_10046945 3300025907 Bacteria 2758
364 Ga0207645_10185538 3300025907 Bacteria 1365
365 Ga0207645_10537433 3300025907 Bacteria 792
366 Ga0207705_10046415 3300025909 Bacteria 3122
367 Ga0207705_10048379 3300025909 Bacteria 3059
368 Ga0207705_10143395 3300025909 Bacteria 1785
369 Ga0207684_10185312 3300025910 Bacteria 1795
370 Ga0207654_10365607 3300025911 Bacteria 996
371 Ga0207707_10030851 3300025912 Bacteria 4689
372 Ga0207707_10092245 3300025912 Bacteria 2647
373 Ga0207707_10227485 3300025912 Bacteria 1623
374 Ga0207707_10601960 3300025912 Bacteria 930
375 Ga0207695_10069781 3300025913 Bacteria 3595
376 Ga0207671_10239554 3300025914 Bacteria 1425
377 Ga0207693_10000475 3300025915 Bacteria 36541
378 Ga0207693_10050554 3300025915 Bacteria 3264
379 Ga0207693_10086156 3300025915 Bacteria 2461
380 Ga0207693_10362926 3300025915 Bacteria 1133
381 Ga0207693_10567273 3300025915 Bacteria 885
382 Ga0207663_10060300 3300025916 Bacteria 2404
383 Ga0207663_10120917 3300025916 Bacteria 1793
384 Ga0207663_10548344 3300025916 Bacteria 904
385 Ga0207660_10009114 3300025917 Bacteria 6427
386 Ga0207660_10015263 3300025917 Bacteria 5068
387 Ga0207660_10053407 3300025917 Bacteria 2880
388 Ga0207660_10121755 3300025917 Bacteria 1977
389 Ga0207660_10141075 3300025917 Bacteria 1842
390 Ga0207657_10000257 3300025919 Bacteria 56368
391 Ga0207657_10022287 3300025919 Bacteria 5933
392 Ga0207657_10029991 3300025919 Bacteria 4943
393 Ga0207657_10399010 3300025919 Bacteria 1082
394 Ga0207657_10479160 3300025919 Bacteria 975
395 Ga0207649_10009293 3300025920 Bacteria 5377
396 Ga0207649_10178994 3300025920 Bacteria 1483
397 Ga0207652_10012873 3300025921 Bacteria 6766
398 Ga0207652_10057653 3300025921 Bacteria 3345
399 Ga0207652_10328685 3300025921 Bacteria 1380
400 Ga0207681_10006543 3300025923 Bacteria 7148
401 Ga0207694_10103905 3300025924 Bacteria 2253
402 Ga0207694_10361902 3300025924 Bacteria 1202
403 Ga0207650_10023952 3300025925 Bacteria 4334
404 Ga0207650_10534740 3300025925 Bacteria 982
405 Ga0207659_10014473 3300025926 Bacteria 5090
406 Ga0207659_10317666 3300025926 Bacteria 1284
407 Ga0207659_10705467 3300025926 Bacteria 864
408 Ga0207687_10017270 3300025927 Bacteria 4749
409 Ga0207687_10389356 3300025927 Bacteria 1144
410 Ga0207687_10441907 3300025927 Bacteria 1077
411 Ga0207700_10045009 3300025928 Bacteria 3253
412 Ga0207700_10061619 3300025928 Bacteria 2846
413 Ga0207664_10024047 3300025929 Bacteria 4574
414 Ga0207664_10056483 3300025929 Bacteria 3118
415 Ga0207664_10310494 3300025929 Bacteria 1389
416 Ga0207664_10412881 3300025929 Bacteria 1202
417 Ga0207690_10004089 3300025932 Bacteria 8612
418 Ga0207690_10313667 3300025932 Bacteria 1231
419 Ga0207690_10352866 3300025932 Bacteria 1163
420 Ga0207706_10000295 3300025933 Bacteria 54132
421 Ga0207706_10080248 3300025933 Bacteria 2869
422 Ga0207706_10150904 3300025933 Bacteria 2044
423 Ga0207706_10247401 3300025933 Bacteria 1558
424 Ga0207706_10326860 3300025933 Bacteria 1334
425 Ga0207686_10009588 3300025934 Bacteria 5255
426 Ga0207686_10114915 3300025934 Bacteria 1822
427 Ga0207670_10156465 3300025936 Bacteria 1697
428 Ga0207670_10306635 3300025936 Bacteria 1245
429 Ga0207669_10115495 3300025937 Bacteria 1809
430 Ga0207669_10396114 3300025937 Bacteria 1080
431 Ga0207669_10435114 3300025937 Bacteria 1036
432 Ga0207704_10047528 3300025938 Bacteria 2566
433 Ga0207704_10127908 3300025938 Bacteria 1753
434 Ga0207691_10012478 3300025940 Bacteria 8147
435 Ga0207711_10079330 3300025941 Bacteria 2865
436 Ga0207711_10141699 3300025941 Bacteria 2163
437 Ga0207711_10327177 3300025941 Bacteria 1417
438 Ga0207689_10015855 3300025942 Bacteria 6383
439 Ga0207689_10100773 3300025942 Bacteria 2372
440 Ga0207689_10168623 3300025942 Bacteria 1804
441 Ga0207689_10178752 3300025942 Bacteria 1750
442 Ga0207689_10445903 3300025942 Bacteria 1081
443 Ga0207679_10010018 3300025945 Bacteria 6091
444 Ga0207667_10028414 3300025949 Bacteria 6075
445 Ga0207667_10079696 3300025949 Bacteria 3394
446 Ga0207667_10251036 3300025949 Bacteria 1809
447 Ga0207651_10018644 3300025960 Bacteria 4136
448 Ga0207651_10149142 3300025960 Bacteria 1818
449 Ga0207651_10975422 3300025960 Bacteria 757
450 Ga0207712_10003183 3300025961 Bacteria 10441
451 Ga0207712_10016761 3300025961 Bacteria 4750
452 Ga0207712_10254506 3300025961 Bacteria 1421
453 Ga0207668_10023265 3300025972 Bacteria 3979
454 Ga0207668_10049779 3300025972 Bacteria 2882
455 Ga0207668_10053648 3300025972 Bacteria 2795
456 Ga0207658_10251877 3300025986 Bacteria 1501
457 Ga0207658_10786988 3300025986 Bacteria 863
458 Ga0207677_10409501 3300026023 Bacteria 1152
459 Ga0207677_10557427 3300026023 Bacteria 1000
460 Ga0207677_10579333 3300026023 Bacteria 982
461 Ga0207703_10030739 3300026035 Bacteria 4243
462 Ga0207703_10108693 3300026035 Bacteria 2362
463 Ga0207703_10114535 3300026035 Bacteria 2306
464 Ga0207703_10149752 3300026035 Bacteria 2033
465 Ga0207703_10218379 3300026035 Bacteria 1703
466 Ga0207703_10818633 3300026035 Bacteria 890
467 Ga0207639_10094686 3300026041 Bacteria 2398
468 Ga0207639_10186335 3300026041 Bacteria 1769
469 Ga0207639_10858622 3300026041 Bacteria 847
470 Ga0207678_10000493 3300026067 Bacteria 35870
471 Ga0207678_10000618 3300026067 Bacteria 32543
472 Ga0207678_10027215 3300026067 Bacteria 4987
473 Ga0207678_10057637 3300026067 Bacteria 3343
474 Ga0207678_10150556 3300026067 Bacteria 1986
475 Ga0207678_10158100 3300026067 Bacteria 1936
476 Ga0207708_10000419 3300026075 Bacteria 33290
477 Ga0207708_10024430 3300026075 Bacteria 4571
478 Ga0207708_10198711 3300026075 Bacteria 1599
479 Ga0207702_10012922 3300026078 Bacteria 6945
480 Ga0207702_10312288 3300026078 Bacteria 1495
481 Ga0207702_10371949 3300026078 Bacteria 1372
482 Ga0207702_10377254 3300026078 Bacteria 1363
483 Ga0207702_10382816 3300026078 Bacteria 1353
484 Ga0207641_10486972 3300026088 Bacteria 1196
485 Ga0207648_10076207 3300026089 Bacteria 2924
486 Ga0207648_10664505 3300026089 Bacteria 964
487 Ga0207676_10006577 3300026095 Bacteria 8218
488 Ga0207676_10008297 3300026095 Bacteria 7383
489 Ga0207676_10220352 3300026095 Bacteria 1689
490 Ga0207674_10000524 3300026116 Bacteria 50350
491 Ga0207674_10017662 3300026116 Bacteria 7778
492 Ga0207674_10168637 3300026116 Bacteria 2143
493 Ga0207674_10351586 3300026116 Bacteria 1425
494 Ga0207675_100016946 3300026118 Bacteria 6808
495 Ga0207675_100043636 3300026118 Bacteria 4188
496 Ga0207675_100048394 3300026118 Bacteria 3969
497 Ga0207675_100420025 3300026118 Bacteria 1320
498 Ga0207675_100467134 3300026118 Bacteria 1252
499 Ga0207675_101262960 3300026118 Bacteria 759
500 Ga0207683_10001226 3300026121 Bacteria 23295
501 Ga0207683_10092983 3300026121 Bacteria 2687
502 Ga0207683_10294056 3300026121 Bacteria 1485
503 Ga0207698_10113687 3300026142 Bacteria 2275
504 Ga0207698_10571095 3300026142 Bacteria 1111
505 Ga0209970_1049781 3300027614 Bacteria 757
506 Ga0209998_10004407 3300027717 Bacteria 2993
507 Ga0209813_10000171 3300027866 Bacteria 21130
508 Ga0209813_10041975 3300027866 Bacteria 1397
509 Ga0209813_10257525 3300027866 Bacteria 665
510 Ga0207428_10148201 3300027907 Bacteria 1788
511 Ga0207428_10264594 3300027907 Bacteria 1280
512 Ga0207428_10338469 3300027907 Bacteria 1109
513 Ga0207428_10435651 3300027907 Bacteria 957
514 Ga0268266_10059310 3300028379 Bacteria 3297
515 Ga0268266_10261578 3300028379 Bacteria 1604
516 Ga0268266_10781516 3300028379 Bacteria 922
517 Ga0268266_10783792 3300028379 Bacteria 920
518 Ga0268265_10004721 3300028380 Bacteria 9406
519 Ga0268265_10014868 3300028380 Bacteria 5313
520 Ga0268265_10209649 3300028380 Bacteria 1697
521 Ga0268265_10285075 3300028380 Bacteria 1480
522 Ga0268265_11293137 3300028380 Bacteria 729
523 Ga0268265_11615179 3300028380 Bacteria 653
524 Ga0268264_10001467 3300028381 Bacteria 22033
525 Ga0268264_10024408 3300028381 Bacteria 4936
526 Ga0268264_10062635 3300028381 Bacteria 3124
527 Ga0268264_10125576 3300028381 Bacteria 2267
528 Ga0268264_10396203 3300028381 Bacteria 1326
529 Ga0268264_10810422 3300028381 Bacteria 936
530 Ga0268264_11024039 3300028381 Bacteria 833
531 Ga0268264_11031488 3300028381 Bacteria 830
532 Ga0265334_10174620 3300028573 Bacteria 752
533 Ga0265338_10013880 3300028800 Bacteria 9046
534 Ga0265770_1022529 3300030878 Bacteria 1008
535 Ga0265325_10005633 3300031241 Bacteria 7706
536 Ga0265340_10074621 3300031247 Bacteria 1603
537 Ga0307513_10150196 3300031456 Bacteria 2240
538 Ga0265313_10012127 3300031595 Bacteria 5300
539 Ga0316575_10000635 3300031665 Bacteria 10352
540 Ga0316575_10168999 3300031665 Bacteria 906
541 Ga0316579_10026695 3300031691 Bacteria 2616
542 Ga0265314_10090687 3300031711 Bacteria 1990
543 Ga0265314_10146168 3300031711 Bacteria 1456
544 Ga0265342_10000196 3300031712 Bacteria 67364
545 Ga0316576_10066779 3300031727 Bacteria 2646
546 Ga0316576_10080740 3300031727 Bacteria 2412
547 Ga0316578_10035125 3300031728 Bacteria 2880
548 Ga0316578_10281211 3300031728 Bacteria 996
549 Ga0307516_10298265 3300031730 Bacteria 1288
550 Ga0316577_10055163 3300031733 Bacteria 2217
551 Ga0307406_11161064 3300031901 Bacteria 669
552 Ga0307415_100741711 3300032126 Bacteria 891
553 Ga0307415_101185341 3300032126 Bacteria 719
554 Ga0316583_10001515 3300032133 Bacteria 7799
555 Ga0316583_10002725 3300032133 Bacteria 6177
556 Ga0316580_10002044 3300032139 Bacteria 5467
557 Ga0373930_0042757 3300034816 Bacteria 970
558 Ga0373948_0032560 3300034817 Bacteria 1058
559 Ga0373958_0065902 3300034819 Bacteria 794
560 Ga0373958_0118703 3300034819 Bacteria 637
561 Ga0373938_0003280 3300034957 Bacteria 2640
562 Ga0373928_0003676 3300035084 Bacteria 2923
563 Ga0373929_0050399 3300035085 Bacteria 950
564 Ga0373940_0001495 3300035088 Bacteria 4245
565 Ga0373949_0043095 3300035090 Bacteria 1116
566 Ga0373952_0000911 3300035092 Bacteria 5364
567 Ga0373952_0065004 3300035092 Bacteria 900
568 Ga0373939_0003523 3300035114 Bacteria 3677
569 Ga0373939_0023404 3300035114 Bacteria 1711
570 Ga0373941_0004025 3300035115 Bacteria 3368
571 Ga0373954_0009258 3300035118 Bacteria 4332
572 Ga0373956_0061245 3300035119 Bacteria 1705
573 Ga0373960_0001814 3300035121 Bacteria 4784
574 Ga0373960_0281002 3300035121 Bacteria 613
575 Ga0373943_0049623 3300035170 Bacteria 2060
576 Ga0373943_0377514 3300035170 Bacteria 816
577 Ga0373942_0016832 3300035207 Bacteria 1797
578 Ga0373942_0063572 3300035207 Bacteria 1063
579 Ga0373961_0014187 3300035241 Bacteria 2021
580 Ga0373962_0008826 3300035242 Bacteria 2489
581 Ga0373962_0021830 3300035242 Bacteria 1692
582 Ga0316574_0612254 3300035398 Bacteria 672
583 Ga0373924_0065163 3300035410 Bacteria 1530
584 Ga0373924_0096445 3300035410 Bacteria 1269
585 Ga0373931_0001961 3300035691 Bacteria 9040
586 Ga0373931_0005752 3300035691 Bacteria 5759
587 Ga0373931_0032804 3300035691 Bacteria 2689
588 Ga0373931_0127668 3300035691 Bacteria 1460
589 Ga0373931_0209892 3300035691 Bacteria 1167
590 Ga0373935_0507701 3300035692 Bacteria 876
591 Ga0373933_0163570 3300035724 Bacteria 1414
592 Ga0373933_0245737 3300035724 Bacteria 1152
593 Ga0373947_0005469 3300035725 Bacteria 7415
594 Ga0373947_0548484 3300035725 Bacteria 787
595 Ga0373937_0030900 3300036401 Bacteria 4850
596 Ga0373937_0120542 3300036401 Bacteria 2444
597 Ga0373937_0199494 3300036401 Bacteria 1881
598 Ga0373937_0314718 3300036401 Bacteria 1481
599 Ga0316584_0024328 3300036712 Bacteria 4431
600 Ga0373925_0003584 3300037068 Bacteria 11964
601 Ga0373925_0099534 3300037068 Bacteria 2233
602 Ga0395900_0051648 3300037418 Bacteria 4234
603 Ga0395898_0042204 3300037466 Bacteria 4502
604 Ga0395898_0169011 3300037466 Bacteria 2090
605 Ga0395905_0012711 3300037471 Bacteria 8097
606 Ga0395901_0120613 3300038443 Bacteria 2756
607 Ga0400490_56103 3300038726 Bacteria 1303
608 Ga0400488_05883 3300038741 Bacteria 1080
609 Ga0400486_13917 3300038742 Bacteria 2439
610 Ga0400486_14766 3300038742 Bacteria 5129
611 Ga0400486_18818 3300038742 Bacteria 2413
612 Ga0400486_32381 3300038742 Bacteria 1118
613 Ga0436365_0298223 3300039437 Bacteria 74249
614 Ga0439440_0016497 3300042993 Bacteria 1618
615 Ga0466963_0000784 3300044694 Bacteria 15788
616 Ga0466964_0526692 3300044706 Bacteria 638
617 Ga0466957_0075011 3300044842 Bacteria 2098
618 Ga0466959_0206602 3300045049 Bacteria 1366
619 Ga0466967_0037630 3300045976 Bacteria 4142
620 Ga0466967_1868616 3300045976 Bacteria 597
621 Ga0495617_065145 3300046452 Bacteria 1202
622 Ga0495603_0001301 3300046455 Bacteria 14523
623 Ga0495603_0255851 3300046455 Bacteria 1008
624 Ga0495603_0482836 3300046455 Bacteria 710
625 Ga0495629_0001832 3300046459 Bacteria 16639
626 Ga0495629_0366716 3300046459 Bacteria 981
627 Ga0495638_0144499 3300046460 Bacteria 1385
628 Ga0495651_0212292 3300046462 Bacteria 1346
629 Ga0495580_0000261 3300046472 Bacteria 42129
630 Ga0495582_0008699 3300046473 Bacteria 5597
631 Ga0495582_0226714 3300046473 Bacteria 1070
632 Ga0495594_0000284 3300046499 Bacteria 24943
633 Ga0495644_0065785 3300046523 Bacteria 1362
634 Ga0495663_0129482 3300046525 Bacteria 850
635 Ga0495652_0464731 3300046529 Bacteria 883
636 Ga0495665_0008036 3300046531 Bacteria 5722
637 Ga0495640_0101743 3300046533 Bacteria 1886
638 Ga0495586_0325342 3300046535 Bacteria 882
639 Ga0495587_0037396 3300046536 Bacteria 2915
640 Ga0495622_0000747 3300046557 Bacteria 18182
641 Ga0495667_0086574 3300046559 Bacteria 2032
642 Ga0495667_0251329 3300046559 Bacteria 1125
643 Ga0495634_0018127 3300046642 Bacteria 5015
644 Ga0495634_0221766 3300046642 Bacteria 1167
645 Ga0495634_0448856 3300046642 Bacteria 761
646 Ga0495635_0019959 3300046663 Bacteria 4670
647 Ga0495659_0112414 3300046664 Bacteria 1065
648 Ga0495588_0019650 3300046674 Bacteria 3311
649 Ga0495657_0094760 3300046675 Bacteria 1909
650 Ga0495647_0128287 3300046681 Bacteria 1072
651 Ga0495658_0025615 3300046683 Bacteria 3154
652 Ga0495613_0009976 3300046689 Bacteria 7056
653 Ga0495581_0000368 3300047315 Bacteria 22619
654 Ga0495581_0123193 3300047315 Bacteria 1509
655 Ga0495604_0425360 3300047317 Bacteria 871
656 Ga0495676_0033223 3300047321 Bacteria 4348
657 Ga0495680_0317732 3300047322 Bacteria 1090
658 Ga0495673_0205521 3300047469 Bacteria 735
659 Ga0495593_0008410 3300047673 Bacteria 6001
660 Ga0495602_0078277 3300048088 Bacteria 2793
661 Ga0495602_0316949 3300048088 Bacteria 1136
662 Ga0495602_0348122 3300048088 Bacteria 1070
663 Ga0495614_0004726 3300048089 Bacteria 6141
664 Ga0496100_0015553 3300048903 Bacteria 4445
665 Ga0496100_0016219 3300048903 Bacteria 4369
666 Ga0496100_0115884 3300048903 Bacteria 1869
667 Ga0496100_0174406 3300048903 Bacteria 1551
668 Ga0496100_0348813 3300048903 Bacteria 1117
669 Ga0496101_0013242 3300048904 Bacteria 5523
670 Ga0496101_0019010 3300048904 Bacteria 4681
671 Ga0496101_0057475 3300048904 Bacteria 2814
672 Ga0496101_0079579 3300048904 Bacteria 2419
673 Ga0496101_0125665 3300048904 Bacteria 1943
674 Ga0496101_0134824 3300048904 Bacteria 1878
675 Ga0496102_0007410 3300048905 Bacteria 9368
676 Ga0496102_0010081 3300048905 Bacteria 8129
677 Ga0496102_0030115 3300048905 Bacteria 4857
678 Ga0496102_0071147 3300048905 Bacteria 3193
679 Ga0496102_0533455 3300048905 Bacteria 1096
680 Ga0496102_0881998 3300048905 Bacteria 816
681 Ga0496103_0001233 3300048906 Bacteria 17480
682 Ga0496103_0033464 3300048906 Bacteria 3140
683 Ga0496103_0049223 3300048906 Bacteria 2606
684 Ga0496104_0007954 3300048907 Bacteria 9399
685 Ga0496104_0026091 3300048907 Bacteria 5390
686 Ga0496104_0042550 3300048907 Bacteria 4263
687 Ga0496104_0067077 3300048907 Bacteria 3408
688 Ga0496104_0075986 3300048907 Bacteria 3199
689 Ga0496104_0114183 3300048907 Bacteria 2590
690 Ga0496104_0142721 3300048907 Bacteria 2300
691 Ga0496104_1179851 3300048907 Bacteria 669
692 Ga0496105_0001211 3300048908 Bacteria 17985
693 Ga0496105_0015741 3300048908 Bacteria 6035
694 Ga0496105_0052820 3300048908 Bacteria 3357
695 Ga0496105_0156265 3300048908 Bacteria 1873
696 Ga0496105_0177218 3300048908 Bacteria 1746
697 Ga0496105_0702685 3300048908 Bacteria 776
698 Ga0496106_0004430 3300048909 Bacteria 10405
699 Ga0496106_0007527 3300048909 Bacteria 8054
700 Ga0496106_0018990 3300048909 Bacteria 5094
701 Ga0496106_0034118 3300048909 Bacteria 3799
702 Ga0496106_0124425 3300048909 Bacteria 2018
703 Ga0496106_0319808 3300048909 Bacteria 1245
704 Ga0496107_0003657 3300048910 Bacteria 10335
705 Ga0496107_0018449 3300048910 Bacteria 4913
706 Ga0496107_0028919 3300048910 Bacteria 3941
707 Ga0496107_0036331 3300048910 Bacteria 3533
708 Ga0496107_0108752 3300048910 Bacteria 2036
709 Ga0496108_0007938 3300048911 Bacteria 8603
710 Ga0496108_0010282 3300048911 Bacteria 7595
711 Ga0496108_0042096 3300048911 Bacteria 3813
712 Ga0496108_0055992 3300048911 Bacteria 3312
713 Ga0496108_0056924 3300048911 Bacteria 3285
714 Ga0496108_0161622 3300048911 Bacteria 1936
715 Ga0496108_0672526 3300048911 Bacteria 899
716 Ga0496109_0015528 3300048912 Bacteria 6638
717 Ga0496109_0092237 3300048912 Bacteria 2801
718 Ga0496109_0098134 3300048912 Bacteria 2716
719 Ga0496109_0175237 3300048912 Bacteria 2013
720 Ga0496109_0374081 3300048912 Bacteria 1346
721 Ga0496109_0508388 3300048912 Bacteria 1137
722 Ga0496109_1202736 3300048912 Bacteria 694
723 Ga0496110_0010989 3300048913 Bacteria 7386
724 Ga0496110_0109060 3300048913 Bacteria 2486
725 Ga0496110_0133253 3300048913 Bacteria 2244
726 Ga0496110_0194232 3300048913 Bacteria 1843
727 Ga0496110_0516824 3300048913 Bacteria 1086
728 Ga0496110_1279628 3300048913 Bacteria 643
729 Ga0496111_0013225 3300048914 Bacteria 5609
730 Ga0496111_0058082 3300048914 Bacteria 2801
731 Ga0496111_0069748 3300048914 Bacteria 2556
732 Ga0496112_0008228 3300048915 Bacteria 9330
733 Ga0496112_0057633 3300048915 Bacteria 3825
734 Ga0496112_0289342 3300048915 Bacteria 1584
735 Ga0496112_0581067 3300048915 Bacteria 1053
736 Ga0496112_1271015 3300048915 Bacteria 652
737 Ga0496113_0008909 3300048916 Bacteria 6564
738 Ga0496113_0014231 3300048916 Bacteria 5422
739 Ga0496113_0024976 3300048916 Bacteria 4255
740 Ga0496113_0112115 3300048916 Bacteria 2124
741 Ga0496113_0603020 3300048916 Bacteria 879
742 Ga0496114_0002797 3300048917 Bacteria 13362
743 Ga0496114_0004634 3300048917 Bacteria 10683
744 Ga0496114_0055852 3300048917 Bacteria 3294
745 Ga0496114_0118542 3300048917 Bacteria 2274
746 Ga0496114_0222925 3300048917 Bacteria 1655
747 Ga0496114_0263542 3300048917 Bacteria 1518
748 Ga0496115_0008294 3300048918 Bacteria 7680
749 Ga0496115_0049448 3300048918 Bacteria 3366
750 Ga0496115_0061576 3300048918 Bacteria 3025
751 Ga0496115_0145473 3300048918 Bacteria 1956
752 Ga0501031_0021043 3300049568 Bacteria 4254
753 Ga0501031_0027842 3300049568 Bacteria 3684
754 Ga0501031_0115700 3300049568 Bacteria 1752
755 Ga0501031_0140186 3300049568 Bacteria 1580
756 Ga0501031_0576964 3300049568 Bacteria 724
757 Ga0501032_0009094 3300049569 Bacteria 7210
758 Ga0501032_0027641 3300049569 Bacteria 3899
759 Ga0501032_0143093 3300049569 Bacteria 1575
760 Ga0501032_0320616 3300049569 Bacteria 1000
761 Ga0501032_0409986 3300049569 Bacteria 870
762 Ga0501033_0016498 3300049570 Bacteria 5592
763 Ga0501033_0191888 3300049570 Bacteria 1462
764 Ga0501033_0574319 3300049570 Bacteria 775
765 Ga0501034_0000166 3300049571 Bacteria 122782
766 Ga0501034_0017833 3300049571 Bacteria 7281
767 Ga0501034_0024277 3300049571 Bacteria 6166
768 Ga0501034_0101235 3300049571 Bacteria 2875
769 Ga0501034_0143543 3300049571 Bacteria 2366
770 Ga0501034_0152519 3300049571 Bacteria 2286
771 Ga0501034_0350221 3300049571 Bacteria 1405
772 Ga0501034_0370804 3300049571 Bacteria 1358
773 Ga0501034_1067742 3300049571 Bacteria 689
774 Ga0501036_0013023 3300049572 Bacteria 6905
775 Ga0501036_0013428 3300049572 Bacteria 6805
776 Ga0501036_0014707 3300049572 Bacteria 6525
777 Ga0501036_0077041 3300049572 Bacteria 2821
778 Ga0501036_0153822 3300049572 Bacteria 1940
779 Ga0501036_0411245 3300049572 Bacteria 1128
780 Ga0501036_0490745 3300049572 Bacteria 1022
781 Ga0501036_0852525 3300049572 Bacteria 749
782 Ga0501036_0921637 3300049572 Bacteria 717
783 Ga0501037_0004386 3300049573 Bacteria 10246
784 Ga0501037_0032105 3300049573 Bacteria 3876
785 Ga0501037_0308677 3300049573 Bacteria 1097
786 Ga0501037_0396691 3300049573 Bacteria 947
787 Ga0501038_0029591 3300049574 Bacteria 4851
788 Ga0501038_0117883 3300049574 Bacteria 2192
789 Ga0501038_0246295 3300049574 Bacteria 1417
790 Ga0501038_0291223 3300049574 Bacteria 1283
791 Ga0501038_0599139 3300049574 Bacteria 834
792 Ga0501038_0766418 3300049574 Bacteria 719
793 Ga0501038_1021602 3300049574 Bacteria 606
794 Ga0501039_0000230 3300049575 Bacteria 40697
795 Ga0501039_0078893 3300049575 Bacteria 2561
796 Ga0501039_0370938 3300049575 Bacteria 1124
797 Ga0501039_0449605 3300049575 Bacteria 1012
798 Ga0501039_0577998 3300049575 Bacteria 881
799 Ga0501039_0635265 3300049575 Bacteria 836
800 Ga0501040_0009227 3300049576 Bacteria 6423
801 Ga0501040_0036706 3300049576 Bacteria 3327
802 Ga0501040_0076617 3300049576 Bacteria 2312
803 Ga0501040_0095091 3300049576 Bacteria 2074
804 Ga0501040_0133244 3300049576 Bacteria 1748
805 Ga0501040_0244952 3300049576 Bacteria 1278
806 Ga0501040_0247965 3300049576 Bacteria 1270
807 Ga0501040_0360240 3300049576 Bacteria 1042
808 Ga0501040_0360324 3300049576 Bacteria 1042
809 Ga0501041_0014949 3300049577 Bacteria 4610
810 Ga0501041_0053548 3300049577 Bacteria 2461
811 Ga0501041_0088441 3300049577 Bacteria 1912
812 Ga0501041_0190342 3300049577 Bacteria 1285
813 Ga0501041_0326668 3300049577 Bacteria 968
814 Ga0501042_0100511 3300049578 Bacteria 2080
815 Ga0501042_0150466 3300049578 Bacteria 1678
816 Ga0501042_0258377 3300049578 Bacteria 1257
817 Ga0501042_0275483 3300049578 Bacteria 1215
818 Ga0501042_0284615 3300049578 Bacteria 1194
819 Ga0501043_0052188 3300049579 Bacteria 3213
820 Ga0501043_0496374 3300049579 Bacteria 912
821 Ga0501043_0651197 3300049579 Bacteria 774
822 Ga0501046_0001428 3300049580 Bacteria 22967
823 Ga0501046_0002133 3300049580 Bacteria 18692
824 Ga0501046_0064352 3300049580 Bacteria 2863
825 Ga0501046_0102257 3300049580 Bacteria 2197
826 Ga0501046_0277392 3300049580 Bacteria 1228
827 Ga0501046_0329268 3300049580 Bacteria 1112
828 Ga0501046_0462332 3300049580 Bacteria 912
829 Ga0501047_0000283 3300049581 Bacteria 58613
830 Ga0501047_0001075 3300049581 Bacteria 27218
831 Ga0501047_0052390 3300049581 Bacteria 3944
832 Ga0501047_0070447 3300049581 Bacteria 3367
833 Ga0501047_0111720 3300049581 Bacteria 2615
834 Ga0501047_0520665 3300049581 Bacteria 1015
835 Ga0501047_0773440 3300049581 Bacteria 775
836 Ga0501048_0003856 3300049582 Bacteria 11424
837 Ga0501048_0057479 3300049582 Bacteria 2759
838 Ga0501048_0094292 3300049582 Bacteria 2111
839 Ga0501048_0164689 3300049582 Bacteria 1570
840 Ga0501048_0221780 3300049582 Bacteria 1341
841 Ga0501048_0336823 3300049582 Bacteria 1075
842 Ga0501048_0599487 3300049582 Bacteria 791
843 Ga0501067_0000733 3300049583 Bacteria 17658
844 Ga0501067_0076023 3300049583 Bacteria 1861
845 Ga0501067_0179996 3300049583 Bacteria 1177
846 Ga0501068_0002424 3300049584 Bacteria 9897
847 Ga0501068_0210449 3300049584 Bacteria 1235
848 Ga0501068_0226803 3300049584 Bacteria 1188
849 Ga0501068_0227384 3300049584 Bacteria 1186
850 Ga0501069_0005060 3300049585 Bacteria 6837
851 Ga0501069_0039624 3300049585 Bacteria 2603
852 Ga0501069_0138468 3300049585 Bacteria 1396
853 Ga0501069_0408058 3300049585 Bacteria 804
854 Ga0501070_0030079 3300049586 Bacteria 4550
855 Ga0501070_0138351 3300049586 Bacteria 2011
856 Ga0501070_0319554 3300049586 Bacteria 1263
857 Ga0501070_0360206 3300049586 Bacteria 1180
858 Ga0501070_0363637 3300049586 Bacteria 1173
859 Ga0501070_0383284 3300049586 Bacteria 1139
860 Ga0501070_0517554 3300049586 Bacteria 957
861 Ga0501070_0587698 3300049586 Bacteria 889
862 Ga0501071_0016735 3300049587 Bacteria 5043
863 Ga0501071_0077619 3300049587 Bacteria 2426
864 Ga0501071_0439338 3300049587 Bacteria 998
865 Ga0501071_0465222 3300049587 Bacteria 968
866 Ga0501071_0525508 3300049587 Bacteria 908
867 Ga0501071_0570523 3300049587 Bacteria 869
868 Ga0501071_0574498 3300049587 Bacteria 866
869 Ga0501072_0024117 3300049588 Bacteria 4729
870 Ga0501072_0031137 3300049588 Bacteria 4174
871 Ga0501072_0098136 3300049588 Bacteria 2329
872 Ga0501072_0185101 3300049588 Bacteria 1661
873 Ga0501072_0237869 3300049588 Bacteria 1450
874 Ga0501073_0004768 3300049589 Bacteria 10177
875 Ga0501073_0024561 3300049589 Bacteria 4327
876 Ga0501073_0052214 3300049589 Bacteria 2863
877 Ga0501073_0160862 3300049589 Bacteria 1556
878 Ga0501073_0321809 3300049589 Bacteria 1067
879 Ga0501073_0343024 3300049589 Bacteria 1031
880 Ga0501073_0425149 3300049589 Bacteria 918
881 Ga0501073_0685731 3300049589 Bacteria 707
882 Ga0501073_0806451 3300049589 Bacteria 647
883 Ga0501074_0009941 3300049590 Bacteria 6913
884 Ga0501074_0102561 3300049590 Bacteria 2048
885 Ga0501074_0107888 3300049590 Bacteria 1993
886 Ga0501074_0128641 3300049590 Bacteria 1812
887 Ga0501074_0143945 3300049590 Bacteria 1704
888 Ga0501074_0251675 3300049590 Bacteria 1256
889 Ga0501074_0273011 3300049590 Bacteria 1202
890 Ga0501074_0325410 3300049590 Bacteria 1091
891 Ga0501074_0601263 3300049590 Bacteria 778
892 Ga0501075_0057440 3300049591 Bacteria 2930
893 Ga0501075_0068804 3300049591 Bacteria 2675
894 Ga0501075_0116300 3300049591 Bacteria 2033
895 Ga0501075_0123113 3300049591 Bacteria 1974
896 Ga0501075_0126484 3300049591 Bacteria 1946
897 Ga0501075_0133606 3300049591 Bacteria 1890
898 Ga0501075_0665571 3300049591 Bacteria 793
899 Ga0501076_0095747 3300049592 Bacteria 2391
900 Ga0501076_0104525 3300049592 Bacteria 2285
901 Ga0501076_0156958 3300049592 Bacteria 1852
902 Ga0501076_0654864 3300049592 Bacteria 867
903 Ga0501076_1028952 3300049592 Bacteria 678
904 Ga0501076_1097233 3300049592 Bacteria 655
905 Ga0501077_0017146 3300049593 Bacteria 4567
906 Ga0501077_0027073 3300049593 Bacteria 3641
907 Ga0501077_0081417 3300049593 Bacteria 2051
908 Ga0501077_0097459 3300049593 Bacteria 1863
909 Ga0501077_0298443 3300049593 Bacteria 1026
910 Ga0501077_0397904 3300049593 Bacteria 880
911 Ga0501077_0618310 3300049593 Bacteria 696
912 Ga0501079_0002883 3300049741 Bacteria 12554
913 Ga0501079_0128171 3300049741 Bacteria 1974
914 Ga0501079_0128436 3300049741 Bacteria 1972
915 Ga0501079_0142607 3300049741 Bacteria 1866
916 Ga0501079_0175913 3300049741 Bacteria 1669
917 Ga0501079_0407657 3300049741 Bacteria 1066
918 Ga0501079_0455351 3300049741 Bacteria 1005
919 Ga0501079_0531669 3300049741 Bacteria 924
920 Ga0501080_0000075 3300049742 Bacteria 66767
921 Ga0501080_0004878 3300049742 Bacteria 11953
922 Ga0501080_0017056 3300049742 Bacteria 6706
923 Ga0501080_0118352 3300049742 Bacteria 2456
924 Ga0501080_0146514 3300049742 Bacteria 2183
925 Ga0501080_0202025 3300049742 Bacteria 1824
926 Ga0501080_0262658 3300049742 Bacteria 1572
927 Ga0501080_0525637 3300049742 Bacteria 1055
928 Ga0501081_0022447 3300049743 Bacteria 4223
929 Ga0501081_0048680 3300049743 Bacteria 2917
930 Ga0501081_0079053 3300049743 Bacteria 2300
931 Ga0501081_0100916 3300049743 Bacteria 2040
932 Ga0501081_0116411 3300049743 Bacteria 1900
933 Ga0501081_0151720 3300049743 Bacteria 1665
934 Ga0501081_0267792 3300049743 Bacteria 1249
935 Ga0501081_0293731 3300049743 Bacteria 1191
936 Ga0501081_0389669 3300049743 Bacteria 1030
937 Ga0501081_0972896 3300049743 Bacteria 641
938 Ga0501083_0017264 3300049744 Bacteria 5032
939 Ga0501083_0282396 3300049744 Bacteria 1080
940 Ga0501083_0384027 3300049744 Bacteria 913
941 Ga0501083_0460315 3300049744 Bacteria 828
942 Ga0501083_0516560 3300049744 Bacteria 777
943 Ga0501035_0000084 3300049822 Bacteria 116222
944 Ga0501035_0048411 3300049822 Bacteria 3812
945 Ga0501035_0071623 3300049822 Bacteria 3068
946 Ga0501035_0258692 3300049822 Bacteria 1476
947 Ga0501035_0261982 3300049822 Bacteria 1465
948 Ga0501035_0466977 3300049822 Bacteria 1042
949 Ga0501035_0609736 3300049822 Bacteria 889
950 Ga0501044_0000073 3300049823 Bacteria 122507
951 Ga0501044_0000332 3300049823 Bacteria 59619
952 Ga0501044_0018590 3300049823 Bacteria 7447
953 Ga0501044_0054416 3300049823 Bacteria 4113
954 Ga0501044_0191550 3300049823 Bacteria 2007
955 Ga0501044_0226439 3300049823 Bacteria 1819
956 Ga0501044_0258482 3300049823 Bacteria 1680
957 Ga0501044_0302201 3300049823 Bacteria 1529
958 Ga0501044_0510814 3300049823 Bacteria 1102
959 Ga0501045_0002048 3300049824 Bacteria 13613
960 Ga0501045_0010546 3300049824 Bacteria 6472
961 Ga0501045_0040982 3300049824 Bacteria 3369
962 Ga0501045_0146236 3300049824 Bacteria 1758
963 Ga0501045_0192389 3300049824 Bacteria 1520
964 Ga0501045_0210987 3300049824 Bacteria 1447
965 Ga0501045_0412718 3300049824 Bacteria 1004
966 Ga0501045_0426006 3300049824 Bacteria 987
967 Ga0501045_0720753 3300049824 Bacteria 736
968 nmdc:mga03683_20898_c1 3300050489 Bacteria 2517
969 nmdc:mga03683_2398_c1 3300050489 Bacteria 5815
970 nmdc:mga03n38_118146_c1 3300050490 Bacteria 1300
971 nmdc:mga03n38_5186_c1 3300050490 Bacteria 4407
972 nmdc:mga03n38_537816_c1 3300050490 Bacteria 660
973 nmdc:mga03n38_7405_c1 3300050490 Bacteria 3882
974 nmdc:mga00v17_20342_c1 3300050491 Bacteria 3801
975 nmdc:mga00v17_211397_c1 3300050491 Bacteria 1255
976 nmdc:mga0yw44_370379_c1 3300050492 Bacteria 966
977 nmdc:mga0yw44_546994_c1 3300050492 Bacteria 786
978 nmdc:mga0yw44_5697_c1 3300050492 Bacteria 5930
979 nmdc:mga0yw44_577644_c1 3300050492 Bacteria 763
980 nmdc:mga0yw44_78928_c1 3300050492 Bacteria 2059
981 nmdc:mga0k408_15774_c1 3300050493 Bacteria 4183
982 nmdc:mga0k408_195337_c1 3300050493 Bacteria 1208
983 nmdc:mga0k408_326659_c1 3300050493 Bacteria 915
984 nmdc:mga0k408_36837_c1 3300050493 Bacteria 2808
985 nmdc:mga06z11_30657_c1 3300050494 Bacteria 2604
986 nmdc:mga06z11_47067_c1 3300050494 Bacteria 2189
987 nmdc:mga06z11_484_c1 3300050494 Bacteria 14688
988 nmdc:mga06z11_59440_c1 3300050494 Bacteria 1987
989 nmdc:mga06z11_6061_c1 3300050494 Bacteria 4891
990 nmdc:mga06z11_77586_c1 3300050494 Bacteria 1774
991 nmdc:mga04h51_112795_c1 3300050495 Bacteria 1004
992 nmdc:mga04h51_2276_c1 3300050495 Bacteria 4531
993 nmdc:mga04h51_2773_c1 3300050495 Bacteria 4179
994 nmdc:mga07m45_311856_c1 3300050496 Bacteria 915
995 nmdc:mga07m45_85580_c1 3300050496 Bacteria 1803
996 nmdc:mga05p37_106040_c1 3300050507 Bacteria 3457
997 nmdc:mga05p37_1251751_c1 3300050507 Bacteria 761
998 nmdc:mga05p37_194140_c1 3300050507 Bacteria 2463
999 nmdc:mga05p37_194232_c1 3300050507 Bacteria 2462
1000 nmdc:mga05p37_226156_c1 3300050507 Bacteria 2256
1001 nmdc:mga05p37_85046_c1 3300050507 Bacteria 3897
1002 nmdc:mga05p37_887311_c1 3300050507 Bacteria 963
1003 nmdc:mga05p37_954657_c1 3300050507 Bacteria 917
1004 nmdc:mga09592_113418_c1 3300050508 Bacteria 2326
1005 nmdc:mga09592_207822_c1 3300050508 Bacteria 1696
1006 nmdc:mga09592_344404_c1 3300050508 Bacteria 1290
1007 nmdc:mga09592_652170_c1 3300050508 Bacteria 899
1008 nmdc:mga0qj67_14007_c1 3300050509 Bacteria 6058
1009 nmdc:mga0qj67_155166_c1 3300050509 Bacteria 1858
1010 nmdc:mga0qj67_222606_c1 3300050509 Bacteria 1532
1011 nmdc:mga0qj67_234476_c1 3300050509 Bacteria 1489
1012 nmdc:mga0qj67_27217_c1 3300050509 Bacteria 4429
1013 nmdc:mga0qj67_440692_c1 3300050509 Bacteria 1049
1014 nmdc:mga0qj67_56706_c1 3300050509 Bacteria 3106
1015 nmdc:mga0qj67_61157_c1 3300050509 Bacteria 2990
1016 nmdc:mga0qj67_68298_c1 3300050509 Bacteria 2832
1017 nmdc:mga06r32_121315_c1 3300050510 Bacteria 2579
1018 nmdc:mga06r32_19843_c1 3300050510 Bacteria 6177
1019 nmdc:mga06r32_235617_c1 3300050510 Bacteria 1818
1020 nmdc:mga06r32_41983_c1 3300050510 Bacteria 4347
1021 nmdc:mga06r32_435882_c1 3300050510 Bacteria 1291
1022 nmdc:mga06r32_45086_c1 3300050510 Bacteria 4202
1023 nmdc:mga06r32_51807_c2 3300050510 Bacteria 2067
1024 nmdc:mga06r32_527526_c1 3300050510 Bacteria 1156
1025 nmdc:mga06r32_571088_c1 3300050510 Bacteria 1104
1026 nmdc:mga06r32_9050_c1 3300050510 Bacteria 8973
1027 nmdc:mga08y16_117027_c1 3300050511 Bacteria 2775
1028 nmdc:mga08y16_196729_c1 3300050511 Bacteria 2089
1029 nmdc:mga08y16_382006_c1 3300050511 Bacteria 1444
1030 nmdc:mga08y16_463181_c1 3300050511 Bacteria 1292
1031 nmdc:mga08y16_573679_c1 3300050511 Bacteria 1140
1032 nmdc:mga08y16_649961_c1 3300050511 Bacteria 1059
1033 nmdc:mga08y16_80555_c1 3300050511 Bacteria 3395
1034 nmdc:mga0n895_102827_c1 3300050512 Bacteria 2868
1035 nmdc:mga0n895_179077_c1 3300050512 Bacteria 2151
1036 nmdc:mga0n895_233313_c1 3300050512 Bacteria 1868
1037 nmdc:mga0n895_286696_c1 3300050512 Bacteria 1669
1038 nmdc:mga0n895_37202_c1 3300050512 Bacteria 4706
1039 nmdc:mga0n895_636344_c1 3300050512 Bacteria 1066
1040 nmdc:mga0rr50_55040_c1 3300050513 Bacteria 2967
1041 nmdc:mga0rr50_96345_c1 3300050513 Bacteria 2315
1042 nmdc:mga0rr50_984496_c1 3300050513 Bacteria 719
1043 nmdc:mga08x19_105342_c1 3300050514 Bacteria 1875
1044 nmdc:mga08x19_272850_c1 3300050514 Bacteria 1171
1045 nmdc:mga08x19_48360_c1 3300050514 Bacteria 2725
1046 nmdc:mga0a205_108166_c1 3300050515 Bacteria 2679
1047 nmdc:mga0a205_366352_c1 3300050515 Bacteria 1307
1048 nmdc:mga0a205_3751_c1 3300050515 Bacteria 13606
1049 nmdc:mga0a205_437066_c1 3300050515 Bacteria 1169
1050 nmdc:mga0a205_72324_c1 3300050515 Bacteria 3331
1051 nmdc:mga0sz30_106310_c1 3300050516 Bacteria 1228
1052 nmdc:mga0sz30_195229_c1 3300050516 Bacteria 898
1053 Ga0495601_0007199 3300053077 Bacteria 6527
1054 Ga0495612_0024620 3300053078 Bacteria 2416
1055 Ga0495595_0545415 3300053084 Bacteria 592
1056 Ga0495619_0101664 3300053085 Bacteria 1957
1057 Ga0495619_0105795 3300053085 Bacteria 1918
1058 Ga0495619_0144278 3300053085 Bacteria 1641
1059 Ga0500644_0000601 3300053088 Bacteria 13705
1060 Ga0500646_0067236 3300053090 Bacteria 1068
1061 Ga0500651_0128906 3300053093 Bacteria 1531
1062 Ga0500566_0048812 3300053094 Bacteria 2426
1063 Ga0500641_0141011 3300053096 Bacteria 1041
1064 Ga0500555_048876 3300053103 Bacteria 1161
1065 Ga0500556_0000082 3300053104 Bacteria 89905
1066 Ga0500562_001963 3300053108 Bacteria 5157
1067 Ga0500562_036338 3300053108 Bacteria 1306
1068 Ga0500562_078428 3300053108 Bacteria 893
1069 Ga0500595_000001 3300053119 Bacteria 1088438
1070 Ga0500595_031086 3300053119 Bacteria 1794
1071 Ga0500595_035073 3300053119 Bacteria 1655
1072 Ga0500642_0047166 3300053130 Bacteria 1887
1073 Ga0500642_0258925 3300053130 Bacteria 797
1074 Ga0500642_0336922 3300053130 Bacteria 673
1075 Ga0500652_010848 3300053131 Bacteria 3139
1076 Ga0500655_076339 3300053133 Bacteria 686
1077 Ga0500658_0433866 3300053134 Bacteria 599
1078 Ga0500577_0366769 3300053142 Bacteria 630
1079 Ga0500616_0000001 3300053153 Bacteria 1986011
1080 Ga0500616_0002686 3300053153 Bacteria 14468
1081 Ga0500616_0085690 3300053153 Bacteria 1573
1082 Ga0500616_0085874 3300053153 Bacteria 1571
1083 Ga0500616_0090864 3300053153 Bacteria 1512
1084 Ga0500616_0113935 3300053153 Bacteria 1301
1085 Ga0500616_0203445 3300053153 Bacteria 875
1086 Ga0500627_0092687 3300053158 Bacteria 1353
1087 Ga0501084_0068873 3300054114 Bacteria 2962
1088 Ga0501084_0102611 3300054114 Bacteria 2402
1089 Ga0501084_0116861 3300054114 Bacteria 2242
1090 Ga0501084_0131176 3300054114 Bacteria 2109
1091 Ga0501084_0224686 3300054114 Bacteria 1584
1092 Ga0501084_0229190 3300054114 Bacteria 1568
1093 Ga0501084_0455570 3300054114 Bacteria 1081
1094 Ga0501084_0463539 3300054114 Bacteria 1071
1095 Ga0501084_0500011 3300054114 Bacteria 1027
1096 Ga0587069_071429 3300059642 Bacteria 660
1097 Ga0501082_0007320 3300060353 Bacteria 9526
1098 Ga0501082_0010460 3300060353 Bacteria 7984
1099 Ga0501082_0017392 3300060353 Bacteria 6195
1100 Ga0501082_0023793 3300060353 Bacteria 5282
1101 Ga0501082_0039705 3300060353 Bacteria 4060
1102 Ga0501082_0048495 3300060353 Bacteria 3660
1103 Ga0501082_0081616 3300060353 Bacteria 2790
1104 Ga0501082_0102242 3300060353 Bacteria 2479
1105 Ga0501082_0137116 3300060353 Bacteria 2123
1106 Ga0501082_0173159 3300060353 Bacteria 1877
1107 Ga0501082_0236248 3300060353 Bacteria 1591
1108 Ga0501082_0300509 3300060353 Bacteria 1398
1109 Ga0501082_0492563 3300060353 Bacteria 1071
1110 Ga0501082_1248601 3300060353 Bacteria 649
1111 Ga0466962_0114334 3300061719 Bacteria 1300
1112 Ga0530510_0010942 3300061734 Bacteria 6365
1113 Ga0530510_0019721 3300061734 Bacteria 4789
1114 Ga0530510_0024993 3300061734 Bacteria 4270
1115 Ga0530510_0029606 3300061734 Bacteria 3931
1116 Ga0530510_0035280 3300061734 Bacteria 3604
1117 Ga0530510_0081752 3300061734 Bacteria 2352
1118 Ga0530510_0137748 3300061734 Bacteria 1797
1119 Ga0530510_0375529 3300061734 Bacteria 1070
1120 2844538864 2844533157 Bacteria 7517899
1121 8054564213 8054563764 Bacteria 5592885
1122 Ga0316579_10119696
1123 JGI24737J22298_10081339
1124 JGI24743J22301_10034028
1125 JGI24738J21930_10015365
1126 JGI24744J21845_10033172
1127 JGI24751J29686_10007195
1128 JGI25153J46596_10000795
1129 JGI25404J52841_10075442
1130 Ga0058861_11856512
1131 Ga0070658_10022621
1132 Ga0070658_10113711
1133 Ga0070676_10011090
1134 Ga0070676_10343045
1135 Ga0070683_100820424
1136 Ga0070690_100000561
1137 Ga0070670_100183978
1138 Ga0068869_100009514
1139 Ga0068869_100241917
1140 Ga0068869_100514748
1141 Ga0070666_10035262
1142 Ga0070680_100002131
1143 Ga0070680_100005579
1144 Ga0070680_100015559
1145 Ga0070682_100005412
1146 Ga0070682_100026953
1147 Ga0068868_100173535
1148 Ga0068868_100452505
1149 Ga0070660_100000992
1150 Ga0070660_100023114
1151 Ga0070660_100097889
1152 Ga0070660_100424041
1153 Ga0070660_100438389
1154 Ga0070689_100001726
1155 Ga0070689_100248503
1156 Ga0070691_10000562
1157 Ga0070691_10006469
1158 Ga0070691_10233096
1159 Ga0070661_100012630
1160 Ga0070692_10009644
1161 Ga0070692_10314946
1162 Ga0070668_100002757
1163 Ga0070668_100032459
1164 Ga0070669_100006492
1165 Ga0070675_100015761
1166 Ga0070675_100066500
1167 Ga0070671_100244508
1168 Ga0070674_100003270
1169 Ga0070674_100171348
1170 Ga0070674_100446376
1171 Ga0070673_100001503
1172 Ga0070688_100000325
1173 Ga0070688_100037055
1174 Ga0070659_100049377
1175 Ga0070659_100573276
1176 Ga0070667_100001935
1177 Ga0070703_10001104
1178 Ga0070703_10024599
1179 Ga0070709_10003028
1180 Ga0070709_10433117
1181 Ga0070714_100004288
1182 Ga0070714_100060495
1183 Ga0070714_100601723
1184 Ga0070713_100057888
1185 Ga0070713_100225167
1186 Ga0070713_100575706
1187 Ga0070710_10001947
1188 Ga0070710_10214335
1189 Ga0070701_10058914
1190 Ga0070701_10174014
1191 Ga0070705_100002473
1192 Ga0070705_100006034
1193 Ga0070705_100103977
1194 Ga0070700_100002150
1195 Ga0070700_100280656
1196 Ga0070694_100002195
1197 Ga0070694_100012212
1198 Ga0070694_100110347
1199 Ga0070708_100017015
1200 Ga0070663_100019318
1201 Ga0070663_100030914
1202 Ga0070663_100064599
1203 Ga0070663_100134703
1204 Ga0070663_100196569
1205 Ga0070663_100559377
1206 Ga0070678_100011080
1207 Ga0070678_100083255
1208 Ga0070678_100281826
1209 Ga0070662_100026312
1210 Ga0070662_100426578
1211 Ga0070681_10058131
1212 Ga0070681_10181373
1213 Ga0070681_10194801
1214 Ga0070681_10238539
1215 Ga0070681_10745931
1216 Ga0068867_100345218
1217 Ga0068867_100595764
1218 Ga0068867_100936278
1219 Ga0070685_10012899
1220 Ga0070706_100222435
1221 Ga0070707_100099790
1222 Ga0070699_100365272
1223 Ga0070699_100465247
1224 Ga0070679_100020360
1225 Ga0070679_100062398
1226 Ga0070679_100278139
1227 Ga0070697_100010611
1228 Ga0070697_100396520
1229 Ga0068853_100019714
1230 Ga0068853_100081680
1231 Ga0070672_100004041
1232 Ga0070686_100003435
1233 Ga0070686_100263238
1234 Ga0070695_100000469
1235 Ga0070695_100004632
1236 Ga0070695_100030077
1237 Ga0070696_100002758
1238 Ga0070696_100013920
1239 Ga0070696_100025462
1240 Ga0070696_100130543
1241 Ga0070696_100436704
1242 Ga0070693_100098217
1243 Ga0070665_100002525
1244 Ga0070665_100127253
1245 Ga0070665_100807996
1246 Ga0070704_100001153
1247 Ga0070704_100012084
1248 Ga0068855_100057146
1249 Ga0068855_100090642
1250 Ga0068855_100133243
1251 Ga0070664_100005363
1252 Ga0068857_100010679
1253 Ga0068857_100494202
1254 Ga0068854_100911776
1255 Ga0068856_100022052
1256 Ga0068856_100240978
1257 Ga0070702_100027617
1258 Ga0070702_100153964
1259 Ga0068852_100791962
1260 Ga0068852_101042495
1261 Ga0068859_100053762
1262 Ga0068859_100100373
1263 Ga0068859_100250447
1264 Ga0068859_100856337
1265 Ga0068864_100008037
1266 Ga0068866_10006874
1267 Ga0068866_10084586
1268 Ga0068861_100001916
1269 Ga0068861_100110932
1270 Ga0068861_100252383
1271 Ga0068861_100393988
1272 Ga0068861_101028450
1273 Ga0068851_10037550
1274 Ga0068863_100005761
1275 Ga0068863_100291455
1276 Ga0068863_100307741
1277 Ga0068858_100005292
1278 Ga0068858_100131671
1279 Ga0068858_100445738
1280 Ga0068858_100638864
1281 Ga0068860_100002761
1282 Ga0068860_100129149
1283 Ga0068860_100323957
1284 Ga0068862_100000882
1285 Ga0068862_100050365
1286 Ga0068862_100094138
1287 Ga0068862_100443994
1288 Ga0068862_100630580
1289 Ga0081455_10000017
1290 Ga0081455_10087625
1291 Ga0081455_10281850
1292 Ga0081540_1000059
1293 Ga0081540_1002895
1294 Ga0081540_1104620
1295 Ga0081539_10047256
1296 Ga0081539_10055948
1297 Ga0075365_10008422
1298 Ga0075365_10303298
1299 Ga0075365_10338372
1300 Ga0075368_10002627
1301 Ga0075368_10010081
1302 Ga0075368_10069205
1303 Ga0075363_100002556
1304 Ga0075363_100051202
1305 Ga0075363_100207540
1306 Ga0075363_100215199
1307 Ga0075363_100238686
1308 Ga0075364_10007444
1309 Ga0075364_10050791
1310 Ga0075432_10046498
1311 Ga0070715_10000677
1312 Ga0070715_10146388
1313 Ga0070716_100427168
1314 Ga0070712_100152274
1315 Ga0070712_100414793
1316 Ga0070712_100436899
1317 Ga0070712_100998755
1318 Ga0075362_10009019
1319 Ga0075362_10105180
1320 Ga0075367_10002466
1321 Ga0075367_10059803
1322 Ga0075367_10117459
1323 Ga0075367_10708397
1324 Ga0075367_10708398
1325 Ga0075366_10009689
1326 Ga0075366_10035651
1327 Ga0075366_10108172
1328 Ga0075370_10122743
1329 Ga0075370_10123722
1330 Ga0075370_10193803
1331 Ga0075428_100004072
1332 Ga0075428_100066837
1333 Ga0075428_100075933
1334 Ga0075428_100089721
1335 Ga0075428_100220249
1336 Ga0075428_100630909
1337 Ga0075430_100020936
1338 Ga0075430_100157719
1339 Ga0075430_100175781
1340 Ga0075430_100185834
1341 Ga0075431_100000351
1342 Ga0075431_100000970
1343 Ga0075431_100216367
1344 Ga0075431_100367977
1345 Ga0075431_100571027
1346 Ga0075433_10896263
1347 Ga0075434_100003410
1348 Ga0075434_100096194
1349 Ga0075434_100096348
1350 Ga0075434_100131948
1351 Ga0075434_100231210
1352 Ga0075429_100022672
1353 Ga0075429_100067251
1354 Ga0075429_100392073
1355 Ga0075429_100475372
1356 Ga0068865_100046207
1357 Ga0075436_100008583
1358 Ga0075436_100036883
1359 Ga0075436_100060322
1360 Ga0075436_100121871
1361 Ga0097620_100053754
1362 Ga0097620_100100376
1363 Ga0097620_100250447
1364 Ga0097620_100856192
1365 Ga0075435_100140032
1366 Ga0075435_100221024
1367 Ga0105250_10016435
1368 Ga0105240_10100026
1369 Ga0105240_10603380
1370 Ga0105240_11042347
1371 Ga0111539_10020032
1372 Ga0111539_10035569
1373 Ga0111539_10110683
1374 Ga0111539_10119809
1375 Ga0111539_10166810
1376 Ga0111539_10225597
1377 Ga0111539_10486546
1378 Ga0111539_10732256
1379 Ga0105245_10048564
1380 Ga0105245_10393016
1381 Ga0105245_10438318
1382 Ga0105245_10769293
1383 Ga0105245_10784461
1384 Ga0105247_10000609
1385 Ga0105247_10010671
1386 Ga0114129_10018904
1387 Ga0114129_10024012
1388 Ga0114129_10062125
1389 Ga0114129_10172552
1390 Ga0114129_10190191
1391 Ga0114129_10218183
1392 Ga0114129_10232411
1393 Ga0114129_10403542
1394 Ga0114129_10993504
1395 Ga0105243_10180118
1396 Ga0105243_10194671
1397 Ga0105243_10614103
1398 Ga0105241_10034871
1399 Ga0105241_10917135
1400 Ga0105241_11170261
1401 Ga0105242_10021952
1402 Ga0105242_10088403
1403 Ga0105242_10101644
1404 Ga0105242_11584218
1405 Ga0105248_10002468
1406 Ga0105248_10169236
1407 Ga0105248_10648258
1408 Ga0105248_10952958
1409 Ga0105248_10989801
1410 Ga0105238_10060410
1411 Ga0105238_10161499
1412 Ga0105238_10314470
1413 Ga0105249_10005382
1414 Ga0105249_10007873
1415 Ga0105249_10032082
1416 Ga0105249_10261902
1417 Ga0105249_10682861
1418 Ga0105249_10763255
1419 Ga0105249_11162531
1420 Ga0105239_10489753
1421 Ga0105239_10677970
1422 Ga0105246_10000561
1423 Ga0105246_10008712
1424 Ga0105246_10014812
1425 Ga0157373_10170815
1426 Ga0157371_10005663
1427 Ga0157371_10033849
1428 Ga0157371_10605715
1429 Ga0157370_10083225
1430 Ga0157370_10399825
1431 Ga0157370_10440383
1432 Ga0157370_10448868
1433 Ga0157369_10007173
1434 Ga0157369_10071315
1435 Ga0157369_10320669
1436 Ga0157374_10025204
1437 Ga0157378_10008073
1438 Ga0157378_10030176
1439 Ga0157378_10905258
1440 Ga0163162_10041257
1441 Ga0163162_11038436
1442 Ga0157372_10019854
1443 Ga0157372_10021642
1444 Ga0157372_10063261
1445 Ga0157375_10040766
1446 Ga0157375_10044221
1447 Ga0157375_10135173
1448 Ga0157375_10404414
1449 Ga0157375_10633418
1450 Ga0163163_10026589
1451 Ga0163163_10108959
1452 Ga0163163_11021653
1453 Ga0157380_10025361
1454 Ga0157380_10226148
1455 Ga0157379_10028501
1456 Ga0157379_10203703
1457 Ga0157379_10236023
1458 Ga0157379_10390940
1459 Ga0157376_10011540
1460 Ga0157376_10065450
1461 Ga0157376_10296288
1462 Ga0163161_10001569
1463 Ga0163161_10015108
1464 Ga0163161_10210300
1465 Ga0163161_10714111
1466 Ga0213876_10010267
1467 Ga0224712_10396512
1468 Ga0207656_10161814
1469 Ga0207696_1087311
1470 Ga0207653_10000374
1471 Ga0207692_10002749
1472 Ga0207642_10142868
1473 Ga0207642_10500055
1474 Ga0207710_10099730
1475 Ga0207688_10007398
1476 Ga0207688_10148136
1477 Ga0207680_10039662
1478 Ga0207647_10026669
1479 Ga0207647_10070216
1480 Ga0207647_10303463
1481 Ga0207699_10003347
1482 Ga0207699_10400590
1483 Ga0207699_10453189
1484 Ga0207645_10046945
1485 Ga0207645_10185538
1486 Ga0207645_10537433
1487 Ga0207705_10046415
1488 Ga0207705_10048379
1489 Ga0207705_10143395
1490 Ga0207684_10185312
1491 Ga0207654_10365607
1492 Ga0207707_10030851
1493 Ga0207707_10092245
1494 Ga0207707_10227485
1495 Ga0207707_10601960
1496 Ga0207695_10069781
1497 Ga0207671_10239554
1498 Ga0207693_10000475
1499 Ga0207693_10050554
1500 Ga0207693_10086156
1501 Ga0207693_10362926
1502 Ga0207693_10567273
1503 Ga0207663_10060300
1504 Ga0207663_10120917
1505 Ga0207663_10548344
1506 Ga0207660_10009114
1507 Ga0207660_10015263
1508 Ga0207660_10053407
1509 Ga0207660_10121755
1510 Ga0207660_10141075
1511 Ga0207657_10000257
1512 Ga0207657_10022287
1513 Ga0207657_10029991
1514 Ga0207657_10399010
1515 Ga0207657_10479160
1516 Ga0207649_10009293
1517 Ga0207649_10178994
1518 Ga0207652_10012873
1519 Ga0207652_10057653
1520 Ga0207652_10328685
1521 Ga0207681_10006543
1522 Ga0207694_10103905
1523 Ga0207694_10361902
1524 Ga0207650_10023952
1525 Ga0207650_10534740
1526 Ga0207659_10014473
1527 Ga0207659_10317666
1528 Ga0207659_10705467
1529 Ga0207687_10017270
1530 Ga0207687_10389356
1531 Ga0207687_10441907
1532 Ga0207700_10045009
1533 Ga0207700_10061619
1534 Ga0207664_10024047
1535 Ga0207664_10056483
1536 Ga0207664_10310494
1537 Ga0207664_10412881
1538 Ga0207690_10004089
1539 Ga0207690_10313667
1540 Ga0207690_10352866
1541 Ga0207706_10000295
1542 Ga0207706_10080248
1543 Ga0207706_10150904
1544 Ga0207706_10247401
1545 Ga0207706_10326860
1546 Ga0207686_10009588
1547 Ga0207686_10114915
1548 Ga0207670_10156465
1549 Ga0207670_10306635
1550 Ga0207669_10115495
1551 Ga0207669_10396114
1552 Ga0207669_10435114
1553 Ga0207704_10047528
1554 Ga0207704_10127908
1555 Ga0207691_10012478
1556 Ga0207711_10079330
1557 Ga0207711_10141699
1558 Ga0207711_10327177
1559 Ga0207689_10015855
1560 Ga0207689_10100773
1561 Ga0207689_10168623
1562 Ga0207689_10178752
1563 Ga0207689_10445903
1564 Ga0207679_10010018
1565 Ga0207667_10028414
1566 Ga0207667_10079696
1567 Ga0207667_10251036
1568 Ga0207651_10018644
1569 Ga0207651_10149142
1570 Ga0207651_10975422
1571 Ga0207712_10003183
1572 Ga0207712_10016761
1573 Ga0207712_10254506
1574 Ga0207668_10023265
1575 Ga0207668_10049779
1576 Ga0207668_10053648
1577 Ga0207658_10251877
1578 Ga0207658_10786988
1579 Ga0207677_10409501
1580 Ga0207677_10557427
1581 Ga0207677_10579333
1582 Ga0207703_10030739
1583 Ga0207703_10108693
1584 Ga0207703_10114535
1585 Ga0207703_10149752
1586 Ga0207703_10218379
1587 Ga0207703_10818633
1588 Ga0207639_10094686
1589 Ga0207639_10186335
1590 Ga0207639_10858622
1591 Ga0207678_10000493
1592 Ga0207678_10000618
1593 Ga0207678_10027215
1594 Ga0207678_10057637
1595 Ga0207678_10150556
1596 Ga0207678_10158100
1597 Ga0207708_10000419
1598 Ga0207708_10024430
1599 Ga0207708_10198711
1600 Ga0207702_10012922
1601 Ga0207702_10312288
1602 Ga0207702_10371949
1603 Ga0207702_10377254
1604 Ga0207702_10382816
1605 Ga0207641_10486972
1606 Ga0207648_10076207
1607 Ga0207648_10664505
1608 Ga0207676_10006577
1609 Ga0207676_10008297
1610 Ga0207676_10220352
1611 Ga0207674_10000524
1612 Ga0207674_10017662
1613 Ga0207674_10168637
1614 Ga0207674_10351586
1615 Ga0207675_100016946
1616 Ga0207675_100043636
1617 Ga0207675_100048394
1618 Ga0207675_100420025
1619 Ga0207675_100467134
1620 Ga0207675_101262960
1621 Ga0207683_10001226
1622 Ga0207683_10092983
1623 Ga0207683_10294056
1624 Ga0207698_10113687
1625 Ga0207698_10571095
1626 Ga0209970_1049781
1627 Ga0209998_10004407
1628 Ga0209813_10000171
1629 Ga0209813_10041975
1630 Ga0209813_10257525
1631 Ga0207428_10148201
1632 Ga0207428_10264594
1633 Ga0207428_10338469
1634 Ga0207428_10435651
1635 Ga0268266_10059310
1636 Ga0268266_10261578
1637 Ga0268266_10781516
1638 Ga0268266_10783792
1639 Ga0268265_10004721
1640 Ga0268265_10014868
1641 Ga0268265_10209649
1642 Ga0268265_10285075
1643 Ga0268265_11293137
1644 Ga0268265_11615179
1645 Ga0268264_10001467
1646 Ga0268264_10024408
1647 Ga0268264_10062635
1648 Ga0268264_10125576
1649 Ga0268264_10396203
1650 Ga0268264_10810422
1651 Ga0268264_11024039
1652 Ga0268264_11031488
1653 Ga0265334_10174620
1654 Ga0265338_10013880
1655 Ga0265770_1022529
1656 Ga0265325_10005633
1657 Ga0265340_10074621
1658 Ga0307513_10150196
1659 Ga0265313_10012127
1660 Ga0316575_10000635
1661 Ga0316575_10168999
1662 Ga0316579_10026695
1663 Ga0265314_10090687
1664 Ga0265314_10146168
1665 Ga0265342_10000196
1666 Ga0316576_10066779
1667 Ga0316576_10080740
1668 Ga0316578_10035125
1669 Ga0316578_10281211
1670 Ga0307516_10298265
1671 Ga0316577_10055163
1672 Ga0307406_11161064
1673 Ga0307415_100741711
1674 Ga0307415_101185341
1675 Ga0316583_10001515
1676 Ga0316583_10002725
1677 Ga0316580_10002044
1678 Ga0373930_0042757
1679 Ga0373948_0032560
1680 Ga0373958_0065902
1681 Ga0373958_0118703
1682 Ga0373938_0003280
1683 Ga0373928_0003676
1684 Ga0373929_0050399
1685 Ga0373940_0001495
1686 Ga0373949_0043095
1687 Ga0373952_0000911
1688 Ga0373952_0065004
1689 Ga0373939_0003523
1690 Ga0373939_0023404
1691 Ga0373941_0004025
1692 Ga0373954_0009258
1693 Ga0373956_0061245
1694 Ga0373960_0001814
1695 Ga0373960_0281002
1696 Ga0373943_0049623
1697 Ga0373943_0377514
1698 Ga0373942_0016832
1699 Ga0373942_0063572
1700 Ga0373961_0014187
1701 Ga0373962_0008826
1702 Ga0373962_0021830
1703 Ga0316574_0612254
1704 Ga0373924_0065163
1705 Ga0373924_0096445
1706 Ga0373931_0001961
1707 Ga0373931_0005752
1708 Ga0373931_0032804
1709 Ga0373931_0127668
1710 Ga0373931_0209892
1711 Ga0373935_0507701
1712 Ga0373933_0163570
1713 Ga0373933_0245737
1714 Ga0373947_0005469
1715 Ga0373947_0548484
1716 Ga0373937_0030900
1717 Ga0373937_0120542
1718 Ga0373937_0199494
1719 Ga0373937_0314718
1720 Ga0316584_0024328
1721 Ga0373925_0003584
1722 Ga0373925_0099534
1723 Ga0395900_0051648
1724 Ga0395898_0042204
1725 Ga0395898_0169011
1726 Ga0395905_0012711
1727 Ga0395901_0120613
1728 Ga0400490_56103
1729 Ga0400488_05883
1730 Ga0400486_13917
1731 Ga0400486_14766
1732 Ga0400486_18818
1733 Ga0400486_32381
1734 Ga0436365_0298223
1735 Ga0439440_0016497
1736 Ga0466963_0000784
1737 Ga0466964_0526692
1738 Ga0466957_0075011
1739 Ga0466959_0206602
1740 Ga0466967_0037630
1741 Ga0466967_1868616
1742 Ga0495617_065145
1743 Ga0495603_0001301
1744 Ga0495603_0255851
1745 Ga0495603_0482836
1746 Ga0495629_0001832
1747 Ga0495629_0366716
1748 Ga0495638_0144499
1749 Ga0495651_0212292
1750 Ga0495580_0000261
1751 Ga0495582_0008699
1752 Ga0495582_0226714
1753 Ga0495594_0000284
1754 Ga0495644_0065785
1755 Ga0495663_0129482
1756 Ga0495652_0464731
1757 Ga0495665_0008036
1758 Ga0495640_0101743
1759 Ga0495586_0325342
1760 Ga0495587_0037396
1761 Ga0495622_0000747
1762 Ga0495667_0086574
1763 Ga0495667_0251329
1764 Ga0495634_0018127
1765 Ga0495634_0221766
1766 Ga0495634_0448856
1767 Ga0495635_0019959
1768 Ga0495659_0112414
1769 Ga0495588_0019650
1770 Ga0495657_0094760
1771 Ga0495647_0128287
1772 Ga0495658_0025615
1773 Ga0495613_0009976
1774 Ga0495581_0000368
1775 Ga0495581_0123193
1776 Ga0495604_0425360
1777 Ga0495676_0033223
1778 Ga0495680_0317732
1779 Ga0495673_0205521
1780 Ga0495593_0008410
1781 Ga0495602_0078277
1782 Ga0495602_0316949
1783 Ga0495602_0348122
1784 Ga0495614_0004726
1785 Ga0496100_0015553
1786 Ga0496100_0016219
1787 Ga0496100_0115884
1788 Ga0496100_0174406
1789 Ga0496100_0348813
1790 Ga0496101_0013242
1791 Ga0496101_0019010
1792 Ga0496101_0057475
1793 Ga0496101_0079579
1794 Ga0496101_0125665
1795 Ga0496101_0134824
1796 Ga0496102_0007410
1797 Ga0496102_0010081
1798 Ga0496102_0030115
1799 Ga0496102_0071147
1800 Ga0496102_0533455
1801 Ga0496102_0881998
1802 Ga0496103_0001233
1803 Ga0496103_0033464
1804 Ga0496103_0049223
1805 Ga0496104_0007954
1806 Ga0496104_0026091
1807 Ga0496104_0042550
1808 Ga0496104_0067077
1809 Ga0496104_0075986
1810 Ga0496104_0114183
1811 Ga0496104_0142721
1812 Ga0496104_1179851
1813 Ga0496105_0001211
1814 Ga0496105_0015741
1815 Ga0496105_0052820
1816 Ga0496105_0156265
1817 Ga0496105_0177218
1818 Ga0496105_0702685
1819 Ga0496106_0004430
1820 Ga0496106_0007527
1821 Ga0496106_0018990
1822 Ga0496106_0034118
1823 Ga0496106_0124425
1824 Ga0496106_0319808
1825 Ga0496107_0003657
1826 Ga0496107_0018449
1827 Ga0496107_0028919
1828 Ga0496107_0036331
1829 Ga0496107_0108752
1830 Ga0496108_0007938
1831 Ga0496108_0010282
1832 Ga0496108_0042096
1833 Ga0496108_0055992
1834 Ga0496108_0056924
1835 Ga0496108_0161622
1836 Ga0496108_0672526
1837 Ga0496109_0015528
1838 Ga0496109_0092237
1839 Ga0496109_0098134
1840 Ga0496109_0175237
1841 Ga0496109_0374081
1842 Ga0496109_0508388
1843 Ga0496109_1202736
1844 Ga0496110_0010989
1845 Ga0496110_0109060
1846 Ga0496110_0133253
1847 Ga0496110_0194232
1848 Ga0496110_0516824
1849 Ga0496110_1279628
1850 Ga0496111_0013225
1851 Ga0496111_0058082
1852 Ga0496111_0069748
1853 Ga0496112_0008228
1854 Ga0496112_0057633
1855 Ga0496112_0289342
1856 Ga0496112_0581067
1857 Ga0496112_1271015
1858 Ga0496113_0008909
1859 Ga0496113_0014231
1860 Ga0496113_0024976
1861 Ga0496113_0112115
1862 Ga0496113_0603020
1863 Ga0496114_0002797
1864 Ga0496114_0004634
1865 Ga0496114_0055852
1866 Ga0496114_0118542
1867 Ga0496114_0222925
1868 Ga0496114_0263542
1869 Ga0496115_0008294
1870 Ga0496115_0049448
1871 Ga0496115_0061576
1872 Ga0496115_0145473
1873 Ga0501031_0021043
1874 Ga0501031_0027842
1875 Ga0501031_0115700
1876 Ga0501031_0140186
1877 Ga0501031_0576964
1878 Ga0501032_0009094
1879 Ga0501032_0027641
1880 Ga0501032_0143093
1881 Ga0501032_0320616
1882 Ga0501032_0409986
1883 Ga0501033_0016498
1884 Ga0501033_0191888
1885 Ga0501033_0574319
1886 Ga0501034_0000166
1887 Ga0501034_0017833
1888 Ga0501034_0024277
1889 Ga0501034_0101235
1890 Ga0501034_0143543
1891 Ga0501034_0152519
1892 Ga0501034_0350221
1893 Ga0501034_0370804
1894 Ga0501034_1067742
1895 Ga0501036_0013023
1896 Ga0501036_0013428
1897 Ga0501036_0014707
1898 Ga0501036_0077041
1899 Ga0501036_0153822
1900 Ga0501036_0411245
1901 Ga0501036_0490745
1902 Ga0501036_0852525
1903 Ga0501036_0921637
1904 Ga0501037_0004386
1905 Ga0501037_0032105
1906 Ga0501037_0308677
1907 Ga0501037_0396691
1908 Ga0501038_0029591
1909 Ga0501038_0117883
1910 Ga0501038_0246295
1911 Ga0501038_0291223
1912 Ga0501038_0599139
1913 Ga0501038_0766418
1914 Ga0501038_1021602
1915 Ga0501039_0000230
1916 Ga0501039_0078893
1917 Ga0501039_0370938
1918 Ga0501039_0449605
1919 Ga0501039_0577998
1920 Ga0501039_0635265
1921 Ga0501040_0009227
1922 Ga0501040_0036706
1923 Ga0501040_0076617
1924 Ga0501040_0095091
1925 Ga0501040_0133244
1926 Ga0501040_0244952
1927 Ga0501040_0247965
1928 Ga0501040_0360240
1929 Ga0501040_0360324
1930 Ga0501041_0014949
1931 Ga0501041_0053548
1932 Ga0501041_0088441
1933 Ga0501041_0190342
1934 Ga0501041_0326668
1935 Ga0501042_0100511
1936 Ga0501042_0150466
1937 Ga0501042_0258377
1938 Ga0501042_0275483
1939 Ga0501042_0284615
1940 Ga0501043_0052188
1941 Ga0501043_0496374
1942 Ga0501043_0651197
1943 Ga0501046_0001428
1944 Ga0501046_0002133
1945 Ga0501046_0064352
1946 Ga0501046_0102257
1947 Ga0501046_0277392
1948 Ga0501046_0329268
1949 Ga0501046_0462332
1950 Ga0501047_0000283
1951 Ga0501047_0001075
1952 Ga0501047_0052390
1953 Ga0501047_0070447
1954 Ga0501047_0111720
1955 Ga0501047_0520665
1956 Ga0501047_0773440
1957 Ga0501048_0003856
1958 Ga0501048_0057479
1959 Ga0501048_0094292
1960 Ga0501048_0164689
1961 Ga0501048_0221780
1962 Ga0501048_0336823
1963 Ga0501048_0599487
1964 Ga0501067_0000733
1965 Ga0501067_0076023
1966 Ga0501067_0179996
1967 Ga0501068_0002424
1968 Ga0501068_0210449
1969 Ga0501068_0226803
1970 Ga0501068_0227384
1971 Ga0501069_0005060
1972 Ga0501069_0039624
1973 Ga0501069_0138468
1974 Ga0501069_0408058
1975 Ga0501070_0030079
1976 Ga0501070_0138351
1977 Ga0501070_0319554
1978 Ga0501070_0360206
1979 Ga0501070_0363637
1980 Ga0501070_0383284
1981 Ga0501070_0517554
1982 Ga0501070_0587698
1983 Ga0501071_0016735
1984 Ga0501071_0077619
1985 Ga0501071_0439338
1986 Ga0501071_0465222
1987 Ga0501071_0525508
1988 Ga0501071_0570523
1989 Ga0501071_0574498
1990 Ga0501072_0024117
1991 Ga0501072_0031137
1992 Ga0501072_0098136
1993 Ga0501072_0185101
1994 Ga0501072_0237869
1995 Ga0501073_0004768
1996 Ga0501073_0024561
1997 Ga0501073_0052214
1998 Ga0501073_0160862
1999 Ga0501073_0321809
2000 Ga0501073_0343024
2001 Ga0501073_0425149
2002 Ga0501073_0685731
2003 Ga0501073_0806451
2004 Ga0501074_0009941
2005 Ga0501074_0102561
2006 Ga0501074_0107888
2007 Ga0501074_0128641
2008 Ga0501074_0143945
2009 Ga0501074_0251675
2010 Ga0501074_0273011
2011 Ga0501074_0325410
2012 Ga0501074_0601263
2013 Ga0501075_0057440
2014 Ga0501075_0068804
2015 Ga0501075_0116300
2016 Ga0501075_0123113
2017 Ga0501075_0126484
2018 Ga0501075_0133606
2019 Ga0501075_0665571
2020 Ga0501076_0095747
2021 Ga0501076_0104525
2022 Ga0501076_0156958
2023 Ga0501076_0654864
2024 Ga0501076_1028952
2025 Ga0501076_1097233
2026 Ga0501077_0017146
2027 Ga0501077_0027073
2028 Ga0501077_0081417
2029 Ga0501077_0097459
2030 Ga0501077_0298443
2031 Ga0501077_0397904
2032 Ga0501077_0618310
2033 Ga0501079_0002883
2034 Ga0501079_0128171
2035 Ga0501079_0128436
2036 Ga0501079_0142607
2037 Ga0501079_0175913
2038 Ga0501079_0407657
2039 Ga0501079_0455351
2040 Ga0501079_0531669
2041 Ga0501080_0000075
2042 Ga0501080_0004878
2043 Ga0501080_0017056
2044 Ga0501080_0118352
2045 Ga0501080_0146514
2046 Ga0501080_0202025
2047 Ga0501080_0262658
2048 Ga0501080_0525637
2049 Ga0501081_0022447
2050 Ga0501081_0048680
2051 Ga0501081_0079053
2052 Ga0501081_0100916
2053 Ga0501081_0116411
2054 Ga0501081_0151720
2055 Ga0501081_0267792
2056 Ga0501081_0293731
2057 Ga0501081_0389669
2058 Ga0501081_0972896
2059 Ga0501083_0017264
2060 Ga0501083_0282396
2061 Ga0501083_0384027
2062 Ga0501083_0460315
2063 Ga0501083_0516560
2064 Ga0501035_0000084
2065 Ga0501035_0048411
2066 Ga0501035_0071623
2067 Ga0501035_0258692
2068 Ga0501035_0261982
2069 Ga0501035_0466977
2070 Ga0501035_0609736
2071 Ga0501044_0000073
2072 Ga0501044_0000332
2073 Ga0501044_0018590
2074 Ga0501044_0054416
2075 Ga0501044_0191550
2076 Ga0501044_0226439
2077 Ga0501044_0258482
2078 Ga0501044_0302201
2079 Ga0501044_0510814
2080 Ga0501045_0002048
2081 Ga0501045_0010546
2082 Ga0501045_0040982
2083 Ga0501045_0146236
2084 Ga0501045_0192389
2085 Ga0501045_0210987
2086 Ga0501045_0412718
2087 Ga0501045_0426006
2088 Ga0501045_0720753
2089 nmdc:mga03683_20898_c1
2090 nmdc:mga03683_2398_c1
2091 nmdc:mga03n38_118146_c1
2092 nmdc:mga03n38_5186_c1
2093 nmdc:mga03n38_537816_c1
2094 nmdc:mga03n38_7405_c1
2095 nmdc:mga00v17_20342_c1
2096 nmdc:mga00v17_211397_c1
2097 nmdc:mga0yw44_370379_c1
2098 nmdc:mga0yw44_546994_c1
2099 nmdc:mga0yw44_5697_c1
2100 nmdc:mga0yw44_577644_c1
2101 nmdc:mga0yw44_78928_c1
2102 nmdc:mga0k408_15774_c1
2103 nmdc:mga0k408_195337_c1
2104 nmdc:mga0k408_326659_c1
2105 nmdc:mga0k408_36837_c1
2106 nmdc:mga06z11_30657_c1
2107 nmdc:mga06z11_47067_c1
2108 nmdc:mga06z11_484_c1
2109 nmdc:mga06z11_59440_c1
2110 nmdc:mga06z11_6061_c1
2111 nmdc:mga06z11_77586_c1
2112 nmdc:mga04h51_112795_c1
2113 nmdc:mga04h51_2276_c1
2114 nmdc:mga04h51_2773_c1
2115 nmdc:mga07m45_311856_c1
2116 nmdc:mga07m45_85580_c1
2117 nmdc:mga05p37_106040_c1
2118 nmdc:mga05p37_1251751_c1
2119 nmdc:mga05p37_194140_c1
2120 nmdc:mga05p37_194232_c1
2121 nmdc:mga05p37_226156_c1
2122 nmdc:mga05p37_85046_c1
2123 nmdc:mga05p37_887311_c1
2124 nmdc:mga05p37_954657_c1
2125 nmdc:mga09592_113418_c1
2126 nmdc:mga09592_207822_c1
2127 nmdc:mga09592_344404_c1
2128 nmdc:mga09592_652170_c1
2129 nmdc:mga0qj67_14007_c1
2130 nmdc:mga0qj67_155166_c1
2131 nmdc:mga0qj67_222606_c1
2132 nmdc:mga0qj67_234476_c1
2133 nmdc:mga0qj67_27217_c1
2134 nmdc:mga0qj67_440692_c1
2135 nmdc:mga0qj67_56706_c1
2136 nmdc:mga0qj67_61157_c1
2137 nmdc:mga0qj67_68298_c1
2138 nmdc:mga06r32_121315_c1
2139 nmdc:mga06r32_19843_c1
2140 nmdc:mga06r32_235617_c1
2141 nmdc:mga06r32_41983_c1
2142 nmdc:mga06r32_435882_c1
2143 nmdc:mga06r32_45086_c1
2144 nmdc:mga06r32_51807_c2
2145 nmdc:mga06r32_527526_c1
2146 nmdc:mga06r32_571088_c1
2147 nmdc:mga06r32_9050_c1
2148 nmdc:mga08y16_117027_c1
2149 nmdc:mga08y16_196729_c1
2150 nmdc:mga08y16_382006_c1
2151 nmdc:mga08y16_463181_c1
2152 nmdc:mga08y16_573679_c1
2153 nmdc:mga08y16_649961_c1
2154 nmdc:mga08y16_80555_c1
2155 nmdc:mga0n895_102827_c1
2156 nmdc:mga0n895_179077_c1
2157 nmdc:mga0n895_233313_c1
2158 nmdc:mga0n895_286696_c1
2159 nmdc:mga0n895_37202_c1
2160 nmdc:mga0n895_636344_c1
2161 nmdc:mga0rr50_55040_c1
2162 nmdc:mga0rr50_96345_c1
2163 nmdc:mga0rr50_984496_c1
2164 nmdc:mga08x19_105342_c1
2165 nmdc:mga08x19_272850_c1
2166 nmdc:mga08x19_48360_c1
2167 nmdc:mga0a205_108166_c1
2168 nmdc:mga0a205_366352_c1
2169 nmdc:mga0a205_3751_c1
2170 nmdc:mga0a205_437066_c1
2171 nmdc:mga0a205_72324_c1
2172 nmdc:mga0sz30_106310_c1
2173 nmdc:mga0sz30_195229_c1
2174 Ga0495601_0007199
2175 Ga0495612_0024620
2176 Ga0495595_0545415
2177 Ga0495619_0101664
2178 Ga0495619_0105795
2179 Ga0495619_0144278
2180 Ga0500644_0000601
2181 Ga0500646_0067236
2182 Ga0500651_0128906
2183 Ga0500566_0048812
2184 Ga0500641_0141011
2185 Ga0500555_048876
2186 Ga0500556_0000082
2187 Ga0500562_001963
2188 Ga0500562_036338
2189 Ga0500562_078428
2190 Ga0500595_000001
2191 Ga0500595_031086
2192 Ga0500595_035073
2193 Ga0500642_0047166
2194 Ga0500642_0258925
2195 Ga0500642_0336922
2196 Ga0500652_010848
2197 Ga0500655_076339
2198 Ga0500658_0433866
2199 Ga0500577_0366769
2200 Ga0500616_0000001
2201 Ga0500616_0002686
2202 Ga0500616_0085690
2203 Ga0500616_0085874
2204 Ga0500616_0090864
2205 Ga0500616_0113935
2206 Ga0500616_0203445
2207 Ga0500627_0092687
2208 Ga0501084_0068873
2209 Ga0501084_0102611
2210 Ga0501084_0116861
2211 Ga0501084_0131176
2212 Ga0501084_0224686
2213 Ga0501084_0229190
2214 Ga0501084_0455570
2215 Ga0501084_0463539
2216 Ga0501084_0500011
2217 Ga0587069_071429
2218 Ga0501082_0007320
2219 Ga0501082_0010460
2220 Ga0501082_0017392
2221 Ga0501082_0023793
2222 Ga0501082_0039705
2223 Ga0501082_0048495
2224 Ga0501082_0081616
2225 Ga0501082_0102242
2226 Ga0501082_0137116
2227 Ga0501082_0173159
2228 Ga0501082_0236248
2229 Ga0501082_0300509
2230 Ga0501082_0492563
2231 Ga0501082_1248601
2232 Ga0466962_0114334
2233 Ga0530510_0010942
2234 Ga0530510_0019721
2235 Ga0530510_0024993
2236 Ga0530510_0029606
2237 Ga0530510_0035280
2238 Ga0530510_0081752
2239 Ga0530510_0137748
2240 Ga0530510_0375529
2241 2844538864
2242 8054564213

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01844

HNH

HNH endonuclease

129

171

0.96

PF14279

HNH_5

HNH endonuclease

129

181

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jdv-assembly1.cif.gz_A crystal structure of nme1cas9 in complex with sgrna and target dna (atatgatt pam) in catalytic state 0.8193 86 144
5x42-assembly1.cif.gz_A structure of dotl(590-659)-dotn derived from legionella pneumophila 0.8143 87 129
6jdq-assembly1.cif.gz_A crystal structure of nme1cas9 in complex with sgrna 0.794 86 143
8f43-assembly1.cif.gz_A hnh nuclease domain from g. stearothermophilus cas9, k597a mutant 0.7922 86 144
7ovb-assembly1.cif.gz_C l. pneumophila type iv coupling complex (t4cc) with density for doty n-terminal and middle domains 0.7897 87 132
ID Description Score Start End Superfamily
af_I1MTW9_33_119_1.10.30.50 Mainly Alpha;Orthogonal Bundle;DNA Binding (I), subunit A; 0.9218 106 140 1.10.30.50
af_P71806_355_434_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8674 86 136 2.30.29.30
2qgpB00 Mainly Alpha;Orthogonal Bundle;DNA Binding (I), subunit A; 0.7111 86 145 1.10.30.50
4h9dC00 Mainly Alpha;Orthogonal Bundle;DNA Binding (I), subunit A; 0.6959 87 145 1.10.30.50
af_P24200_175_274_1.10.30.50 Mainly Alpha;Orthogonal Bundle;DNA Binding (I), subunit A; 0.6563 73 144 1.10.30.50
ID Description Score Start End GO Terms
AF-A0A3D2L8Y0-F1-model_v4 HNH endonuclease 0.9687 82 155 GO:0004519
AF-A0A382GFX2-F1-model_v4 HNH endonuclease 0.96 14 78
AF-A0A1Q7HUA2-F1-model_v4 HNH nuclease domain-containing protein 0.9431 83 157
AF-A0A0F8VTA8-F1-model_v4 HNH endonuclease 0.9376 13 79
AF-A0A510V843-F1-model_v4 HNH nuclease domain-containing protein 0.9369 82 161 GO:0003676
GO:0004519
GO:0008270

Map