F490407
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1121 | 494 | 2242 | 203 |
Family's Representative Sequence
| Representative Sequence | 3300041411|Ga0439466_0004233|Ga0439466_0004233_506_1210 |
| Length | 234 |
| Sequence | MQIAGICFFRSRFFGFRVIWYAVLPYPIQTRATMTEPAPLSRPQLRRMLRKARRALTASEQRQASRGLYRQLAQHPLFRRARHISLYLPMDGEIDPRPLLLAAQRRGKATYLPVLSAWPRTKMVFQRVRPGEKLRPNRFRIPEPRVSLARQRKVWALDLVLLPLVGFDEAGGRLGMGGGFYDRSLAYLARRKSWRKPTLLGLAHECQKVAKLDQASWDVPLQGTVTDKKWYFAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 6 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 7 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 9 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 10 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 12 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 13 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 23 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 31 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 32 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 33 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 34 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 35 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 36 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 37 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 38 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 39 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 40 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 49 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 57 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 58 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 59 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 60 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 62 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 72 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 74 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 76 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 96 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 97 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 104 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 107 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 109 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 110 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 111 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 112 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 113 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 114 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 115 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 116 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 117 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 118 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 119 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 120 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 121 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 122 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 123 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 124 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 125 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 126 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 127 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 128 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 129 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 130 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 131 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 132 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 133 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 134 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 135 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 136 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 137 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 138 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 139 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 140 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 141 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 142 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 143 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 144 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 145 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 146 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 147 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 148 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 149 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 150 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 151 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 152 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 153 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 154 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 155 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 156 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 157 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 158 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 159 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 160 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 161 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 162 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 163 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 164 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 165 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 166 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 167 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 242 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 243 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 244 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 245 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 246 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 247 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 248 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 249 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 250 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 251 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 252 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 253 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 254 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 255 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 256 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 260 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 261 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 262 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 263 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 264 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 265 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 266 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 267 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 268 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 269 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 270 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 271 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 272 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 273 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 274 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 275 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 276 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 277 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 278 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 279 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 280 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 281 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 282 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 283 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 284 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 285 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 286 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 287 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 288 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 289 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 290 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 291 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 292 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 293 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 294 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 295 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 296 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 297 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 298 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 299 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 300 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 301 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 302 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 303 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 304 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 305 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 306 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 307 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 308 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 309 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 310 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 311 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 312 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 313 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 314 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 315 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 316 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 317 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 318 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 319 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 320 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 321 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 322 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 323 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 324 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 325 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 326 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 327 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 328 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 329 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 330 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 331 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 332 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 333 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 334 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 335 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 336 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 337 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 338 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 339 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 340 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 341 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 342 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 343 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 344 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 345 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 346 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 347 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 348 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 349 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 350 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 351 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 352 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 353 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 354 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 355 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 356 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 357 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 358 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 359 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 360 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 361 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 362 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 363 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 364 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 365 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 366 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 367 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 368 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 369 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 370 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 371 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 372 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 373 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 374 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 375 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 376 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 377 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 378 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 379 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 380 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 381 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 382 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 383 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 384 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 385 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 386 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 387 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 388 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 389 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 390 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 391 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 392 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 393 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 394 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 395 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 396 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 397 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 398 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 399 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 400 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 401 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 402 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 403 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 404 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 405 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 406 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 407 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 408 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 409 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 410 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 411 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 412 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 413 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 414 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 415 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 416 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 417 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 418 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 419 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 420 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 421 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 422 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 423 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 424 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 425 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 426 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 427 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 428 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 429 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 430 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 431 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 432 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 433 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 434 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 435 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 436 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 437 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 438 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 439 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 440 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 441 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 442 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 443 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 444 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 445 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 446 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 447 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 448 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 449 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 450 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 451 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 452 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 453 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 454 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 455 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 456 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 457 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 458 | 2990196909 | Pseudomonas mangrovi TC-11 | Isolate | Unclassified |
| 459 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 460 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 461 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 462 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 463 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 464 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 465 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 466 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 467 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 468 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 469 | 640427133 | Stutzerimonas stutzeri A1501 | Isolate | Rhizosphere |
| 470 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 471 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 472 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 473 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 474 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 475 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 476 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 477 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 478 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 479 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 480 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 481 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 482 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 483 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 484 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 485 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 486 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 487 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 488 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 489 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 490 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 491 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 492 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 493 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 494 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 79.84 |
| Metatranscriptomes | 0 |
| Isolates | 20.16 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.71 |
| Nodule | 2.23 |
| Rhizoplane | 6.33 |
| Rhizosphere | 73.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0439466_0004233 | 3300041411 | Bacteria | 5539 |
| 2 | MRS2a_Contig_718 | 2124908027 | Bacteria | 55855 |
| 3 | SwRhRL2b_contig_161795 | 2162886007 | Bacteria | 2844 |
| 4 | JGI25162J39368_1001123 | 3300002737 | Bacteria | 16116 |
| 5 | JGI25154J39366_1008844 | 3300002738 | Bacteria | 1273 |
| 6 | JGI25163J39215_1000851 | 3300002771 | Bacteria | 7273 |
| 7 | JGI25164J39214_1000593 | 3300002772 | Bacteria | 16116 |
| 8 | JGI25164J39214_1000683 | 3300002772 | Bacteria | 13434 |
| 9 | JGI25165J46597_1001173 | 3300003214 | Bacteria | 16116 |
| 10 | JGI25165J46597_1001371 | 3300003214 | Bacteria | 13434 |
| 11 | Ga0055538_1000032 | 3300003751 | Bacteria | 199718 |
| 12 | Ga0055539_1000043 | 3300003752 | Bacteria | 199718 |
| 13 | Ga0055533_1000052 | 3300003756 | Bacteria | 199718 |
| 14 | Ga0055532_1000047 | 3300003758 | Bacteria | 179201 |
| 15 | Ga0055525_1000062 | 3300003759 | Bacteria | 199718 |
| 16 | Ga0055525_1007718 | 3300003759 | Bacteria | 908 |
| 17 | Ga0055535_1005441 | 3300003761 | Bacteria | 2790 |
| 18 | Ga0055536_1001844 | 3300003781 | Bacteria | 12389 |
| 19 | Ga0055536_1004928 | 3300003781 | Bacteria | 6653 |
| 20 | Ga0055536_1005802 | 3300003781 | Bacteria | 5943 |
| 21 | Ga0055536_1014573 | 3300003781 | Bacteria | 2747 |
| 22 | Ga0055536_1066533 | 3300003781 | Bacteria | 726 |
| 23 | Ga0055530_10001310 | 3300003791 | Bacteria | 18721 |
| 24 | Ga0055530_10001782 | 3300003791 | Bacteria | 14972 |
| 25 | Ga0055530_10002801 | 3300003791 | Bacteria | 10727 |
| 26 | Ga0055540_1000960 | 3300003792 | Bacteria | 18721 |
| 27 | Ga0055540_1001320 | 3300003792 | Bacteria | 14972 |
| 28 | Ga0055540_1002155 | 3300003792 | Bacteria | 10727 |
| 29 | Ga0055531_10000404 | 3300003794 | Bacteria | 41520 |
| 30 | Ga0055531_10000483 | 3300003794 | Bacteria | 36666 |
| 31 | Ga0055541_1000030 | 3300003841 | Bacteria | 199616 |
| 32 | Ga0065714_10000055 | 3300005288 | Bacteria | 14101 |
| 33 | Ga0065714_10002460 | 3300005288 | Bacteria | 16953 |
| 34 | Ga0065714_10014268 | 3300005288 | Bacteria | 1924 |
| 35 | Ga0065714_10091252 | 3300005288 | Bacteria | 1916 |
| 36 | Ga0065714_10138216 | 3300005288 | Bacteria | 1176 |
| 37 | Ga0065714_10182728 | 3300005288 | Bacteria | 954 |
| 38 | Ga0065714_10192388 | 3300005288 | Bacteria | 923 |
| 39 | Ga0065704_10070757 | 3300005289 | Bacteria | 16643 |
| 40 | Ga0065704_10162785 | 3300005289 | Bacteria | 1343 |
| 41 | Ga0065712_10005777 | 3300005290 | Bacteria | 3577 |
| 42 | Ga0065712_10134151 | 3300005290 | Bacteria | 1514 |
| 43 | Ga0070676_10101728 | 3300005328 | Bacteria | 1776 |
| 44 | Ga0070670_100634682 | 3300005331 | Bacteria | 957 |
| 45 | Ga0070670_100641333 | 3300005331 | Bacteria | 952 |
| 46 | Ga0070660_100203528 | 3300005339 | Bacteria | 1606 |
| 47 | Ga0070669_100012886 | 3300005353 | Bacteria | 5940 |
| 48 | Ga0070662_100000101 | 3300005457 | Bacteria | 47097 |
| 49 | Ga0070662_100004142 | 3300005457 | Bacteria | 9123 |
| 50 | Ga0070665_100079093 | 3300005548 | Bacteria | 3294 |
| 51 | Ga0070665_100447967 | 3300005548 | Bacteria | 1300 |
| 52 | Ga0070665_100943068 | 3300005548 | Bacteria | 875 |
| 53 | Ga0070664_100001357 | 3300005564 | Bacteria | 19532 |
| 54 | Ga0070664_100901955 | 3300005564 | Bacteria | 829 |
| 55 | Ga0068854_100000622 | 3300005578 | Bacteria | 20954 |
| 56 | Ga0068851_10000007 | 3300005834 | Bacteria | 244101 |
| 57 | Ga0075364_10204207 | 3300006051 | Bacteria | 1340 |
| 58 | Ga0075432_10018293 | 3300006058 | Bacteria | 2390 |
| 59 | Ga0075432_10043859 | 3300006058 | Bacteria | 1567 |
| 60 | Ga0075432_10081572 | 3300006058 | Bacteria | 1173 |
| 61 | Ga0075362_10197469 | 3300006177 | Bacteria | 978 |
| 62 | Ga0075369_10047689 | 3300006186 | Bacteria | 1847 |
| 63 | Ga0075436_100068775 | 3300006914 | Bacteria | 2446 |
| 64 | Ga0099823_1001854 | 3300006944 | Bacteria | 18312 |
| 65 | Ga0079104_1000424 | 3300006946 | Bacteria | 48276 |
| 66 | Ga0099826_10121352 | 3300006948 | Bacteria | 1539 |
| 67 | Ga0105251_10000009 | 3300009011 | Bacteria | 192384 |
| 68 | Ga0105251_10001765 | 3300009011 | Bacteria | 18003 |
| 69 | Ga0105251_10004948 | 3300009011 | Bacteria | 8870 |
| 70 | Ga0105251_10022693 | 3300009011 | Bacteria | 3252 |
| 71 | Ga0105251_10024812 | 3300009011 | Bacteria | 3074 |
| 72 | Ga0105251_10138009 | 3300009011 | Bacteria | 1104 |
| 73 | Ga0105251_10189540 | 3300009011 | Bacteria | 926 |
| 74 | Ga0105251_10298735 | 3300009011 | Bacteria | 730 |
| 75 | Ga0105244_10001453 | 3300009036 | Bacteria | 19179 |
| 76 | Ga0105244_10009780 | 3300009036 | Bacteria | 5861 |
| 77 | Ga0105244_10034436 | 3300009036 | Bacteria | 2666 |
| 78 | Ga0105244_10082557 | 3300009036 | Bacteria | 1589 |
| 79 | Ga0105244_10084012 | 3300009036 | Bacteria | 1573 |
| 80 | Ga0105244_10147001 | 3300009036 | Bacteria | 1131 |
| 81 | Ga0105244_10163344 | 3300009036 | Bacteria | 1063 |
| 82 | Ga0105244_10167813 | 3300009036 | Bacteria | 1046 |
| 83 | Ga0105244_10173634 | 3300009036 | Bacteria | 1025 |
| 84 | Ga0105244_10224399 | 3300009036 | Bacteria | 880 |
| 85 | Ga0105244_10225852 | 3300009036 | Bacteria | 877 |
| 86 | Ga0105244_10233955 | 3300009036 | Bacteria | 859 |
| 87 | Ga0105250_10000981 | 3300009092 | Bacteria | 16625 |
| 88 | Ga0105250_10001636 | 3300009092 | Bacteria | 11944 |
| 89 | Ga0105250_10003448 | 3300009092 | Bacteria | 7489 |
| 90 | Ga0105250_10023864 | 3300009092 | Bacteria | 2466 |
| 91 | Ga0105250_10026458 | 3300009092 | Bacteria | 2337 |
| 92 | Ga0105250_10050855 | 3300009092 | Bacteria | 1663 |
| 93 | Ga0105250_10059707 | 3300009092 | Bacteria | 1532 |
| 94 | Ga0105250_10086868 | 3300009092 | Bacteria | 1270 |
| 95 | Ga0105250_10124664 | 3300009092 | Bacteria | 1061 |
| 96 | Ga0105250_10141591 | 3300009092 | Bacteria | 997 |
| 97 | Ga0105250_10181982 | 3300009092 | Bacteria | 882 |
| 98 | Ga0105243_10005105 | 3300009148 | Bacteria | 10305 |
| 99 | Ga0105243_10007458 | 3300009148 | Bacteria | 8405 |
| 100 | Ga0105243_10071746 | 3300009148 | Bacteria | 2801 |
| 101 | Ga0105243_10095656 | 3300009148 | Bacteria | 2455 |
| 102 | Ga0105237_10003007 | 3300009545 | Bacteria | 20351 |
| 103 | Ga0105237_10322881 | 3300009545 | Bacteria | 1547 |
| 104 | Ga0105238_10851491 | 3300009551 | Bacteria | 929 |
| 105 | Ga0105249_10030735 | 3300009553 | Bacteria | 4855 |
| 106 | Ga0105246_10003490 | 3300011119 | Bacteria | 9532 |
| 107 | Ga0105246_10021361 | 3300011119 | Bacteria | 4165 |
| 108 | Ga0105246_10344282 | 3300011119 | Bacteria | 1219 |
| 109 | Ga0105246_10603161 | 3300011119 | Bacteria | 949 |
| 110 | Ga0157345_1000031 | 3300012498 | Bacteria | 35083 |
| 111 | Ga0157373_10004112 | 3300013100 | Bacteria | 10971 |
| 112 | Ga0157373_10010865 | 3300013100 | Bacteria | 6701 |
| 113 | Ga0157373_10057696 | 3300013100 | Bacteria | 2753 |
| 114 | Ga0157373_10084616 | 3300013100 | Bacteria | 2236 |
| 115 | Ga0157373_10130294 | 3300013100 | Bacteria | 1769 |
| 116 | Ga0157373_10203738 | 3300013100 | Bacteria | 1395 |
| 117 | Ga0157373_10432176 | 3300013100 | Bacteria | 946 |
| 118 | Ga0157371_10000039 | 3300013102 | Bacteria | 207724 |
| 119 | Ga0157371_10003709 | 3300013102 | Bacteria | 13694 |
| 120 | Ga0157371_10187850 | 3300013102 | Bacteria | 1479 |
| 121 | Ga0157371_10479631 | 3300013102 | Bacteria | 917 |
| 122 | Ga0157370_10000698 | 3300013104 | Bacteria | 41998 |
| 123 | Ga0157370_10027157 | 3300013104 | Bacteria | 5645 |
| 124 | Ga0157370_10201559 | 3300013104 | Bacteria | 1846 |
| 125 | Ga0157370_10229481 | 3300013104 | Bacteria | 1718 |
| 126 | Ga0157370_10437336 | 3300013104 | Bacteria | 1203 |
| 127 | Ga0157370_10521352 | 3300013104 | Bacteria | 1091 |
| 128 | Ga0157369_10522253 | 3300013105 | Bacteria | 1228 |
| 129 | Ga0157369_10880321 | 3300013105 | Bacteria | 919 |
| 130 | Ga0163162_10000591 | 3300013306 | Bacteria | 33702 |
| 131 | Ga0163162_10623210 | 3300013306 | Bacteria | 1204 |
| 132 | Ga0163162_10686186 | 3300013306 | Bacteria | 1146 |
| 133 | Ga0163162_10858521 | 3300013306 | Bacteria | 1023 |
| 134 | Ga0157372_10003012 | 3300013307 | Bacteria | 18164 |
| 135 | Ga0157372_10082770 | 3300013307 | Bacteria | 3634 |
| 136 | Ga0157372_10232559 | 3300013307 | Bacteria | 2137 |
| 137 | Ga0157375_10013258 | 3300013308 | Bacteria | 7330 |
| 138 | Ga0157375_11471119 | 3300013308 | Bacteria | 803 |
| 139 | Ga0182008_10002828 | 3300014497 | Bacteria | 10729 |
| 140 | Ga0182008_10005751 | 3300014497 | Bacteria | 7017 |
| 141 | Ga0182008_10042782 | 3300014497 | Bacteria | 2256 |
| 142 | Ga0182008_10199641 | 3300014497 | Bacteria | 1017 |
| 143 | Ga0182008_10205642 | 3300014497 | Bacteria | 1003 |
| 144 | Ga0182008_10259326 | 3300014497 | Bacteria | 899 |
| 145 | Ga0182006_1004316 | 3300015261 | Bacteria | 7037 |
| 146 | Ga0182006_1004328 | 3300015261 | Bacteria | 7026 |
| 147 | Ga0182006_1022719 | 3300015261 | Bacteria | 2604 |
| 148 | Ga0182006_1096404 | 3300015261 | Bacteria | 1056 |
| 149 | Ga0182006_1099482 | 3300015261 | Bacteria | 1034 |
| 150 | Ga0182006_1129371 | 3300015261 | Bacteria | 870 |
| 151 | Ga0182007_10003731 | 3300015262 | Bacteria | 7115 |
| 152 | Ga0182005_1012359 | 3300015265 | Bacteria | 2413 |
| 153 | Ga0182005_1049830 | 3300015265 | Bacteria | 1138 |
| 154 | Ga0182005_1066671 | 3300015265 | Bacteria | 986 |
| 155 | Ga0182005_1077440 | 3300015265 | Bacteria | 916 |
| 156 | Ga0182005_1106917 | 3300015265 | Bacteria | 788 |
| 157 | Ga0182005_1111437 | 3300015265 | Bacteria | 773 |
| 158 | Ga0163161_10063034 | 3300017792 | Bacteria | 2701 |
| 159 | Ga0163161_10081806 | 3300017792 | Bacteria | 2379 |
| 160 | Ga0163161_10193053 | 3300017792 | Bacteria | 1566 |
| 161 | Ga0163161_10407145 | 3300017792 | Bacteria | 1092 |
| 162 | Ga0163161_10526570 | 3300017792 | Bacteria | 966 |
| 163 | Ga0163161_10528683 | 3300017792 | Bacteria | 964 |
| 164 | Ga0163161_10623789 | 3300017792 | Bacteria | 891 |
| 165 | Ga0163161_10682889 | 3300017792 | Bacteria | 853 |
| 166 | Ga0209435_100567 | 3300025206 | Bacteria | 6953 |
| 167 | Ga0209760_100027 | 3300025207 | Bacteria | 153290 |
| 168 | Ga0209784_100007 | 3300025224 | Bacteria | 747715 |
| 169 | Ga0209566_100009 | 3300025225 | Bacteria | 554018 |
| 170 | Ga0209674_100021 | 3300025226 | Bacteria | 629811 |
| 171 | Ga0209147_100009 | 3300025229 | Bacteria | 747409 |
| 172 | Ga0209563_100018 | 3300025230 | Bacteria | 747850 |
| 173 | Ga0209563_100496 | 3300025230 | Bacteria | 13344 |
| 174 | Ga0207427_100006 | 3300025231 | Bacteria | 785415 |
| 175 | Ga0209437_100013 | 3300025233 | Bacteria | 785457 |
| 176 | Ga0209258_100169 | 3300025242 | Bacteria | 145227 |
| 177 | Ga0209646_1000184 | 3300025246 | Bacteria | 78423 |
| 178 | Ga0209677_100012 | 3300025253 | Bacteria | 554018 |
| 179 | Ga0209759_1002680 | 3300025256 | Bacteria | 7609 |
| 180 | Ga0209759_1006804 | 3300025256 | Bacteria | 3784 |
| 181 | Ga0209233_1000022 | 3300025261 | Bacteria | 785415 |
| 182 | Ga0209675_1000989 | 3300025291 | Bacteria | 17959 |
| 183 | Ga0209676_1000015 | 3300025292 | Bacteria | 784458 |
| 184 | Ga0209676_1000030 | 3300025292 | Bacteria | 506421 |
| 185 | Ga0209676_1000041 | 3300025292 | Bacteria | 424583 |
| 186 | Ga0209676_1001202 | 3300025292 | Bacteria | 27702 |
| 187 | Ga0209676_1001662 | 3300025292 | Bacteria | 19372 |
| 188 | Ga0209050_1000024 | 3300025298 | Bacteria | 533389 |
| 189 | Ga0209050_1000030 | 3300025298 | Bacteria | 463381 |
| 190 | Ga0209050_1002563 | 3300025298 | Bacteria | 15157 |
| 191 | Ga0209050_1070810 | 3300025298 | Bacteria | 779 |
| 192 | Ga0209051_1000012 | 3300025303 | Bacteria | 595474 |
| 193 | Ga0209051_1000023 | 3300025303 | Bacteria | 437371 |
| 194 | Ga0209051_1001294 | 3300025303 | Bacteria | 22056 |
| 195 | Ga0209051_1045388 | 3300025303 | Bacteria | 1521 |
| 196 | Ga0209257_1004425 | 3300025304 | Bacteria | 10900 |
| 197 | Ga0207656_10000006 | 3300025321 | Bacteria | 395044 |
| 198 | Ga0207696_1000020 | 3300025711 | Bacteria | 434998 |
| 199 | Ga0207696_1000031 | 3300025711 | Bacteria | 384169 |
| 200 | Ga0207696_1000357 | 3300025711 | Bacteria | 46078 |
| 201 | Ga0207696_1002203 | 3300025711 | Bacteria | 9759 |
| 202 | Ga0207696_1004533 | 3300025711 | Bacteria | 5966 |
| 203 | Ga0207696_1010677 | 3300025711 | Bacteria | 3352 |
| 204 | Ga0207696_1015406 | 3300025711 | Bacteria | 2594 |
| 205 | Ga0207696_1068712 | 3300025711 | Bacteria | 988 |
| 206 | Ga0207655_1000033 | 3300025728 | Bacteria | 377066 |
| 207 | Ga0207655_1000202 | 3300025728 | Bacteria | 103907 |
| 208 | Ga0207655_1000388 | 3300025728 | Bacteria | 61513 |
| 209 | Ga0207655_1000740 | 3300025728 | Bacteria | 36777 |
| 210 | Ga0207655_1001122 | 3300025728 | Bacteria | 26144 |
| 211 | Ga0207655_1003253 | 3300025728 | Bacteria | 12195 |
| 212 | Ga0207655_1008819 | 3300025728 | Bacteria | 6344 |
| 213 | Ga0207655_1010284 | 3300025728 | Bacteria | 5684 |
| 214 | Ga0207655_1011686 | 3300025728 | Bacteria | 5200 |
| 215 | Ga0207655_1012207 | 3300025728 | Bacteria | 5043 |
| 216 | Ga0207655_1012984 | 3300025728 | Bacteria | 4817 |
| 217 | Ga0207655_1054888 | 3300025728 | Bacteria | 1581 |
| 218 | Ga0207655_1063083 | 3300025728 | Bacteria | 1422 |
| 219 | Ga0207655_1095770 | 3300025728 | Bacteria | 1034 |
| 220 | Ga0207655_1104868 | 3300025728 | Bacteria | 966 |
| 221 | Ga0207713_1000032 | 3300025735 | Bacteria | 276465 |
| 222 | Ga0207713_1000079 | 3300025735 | Bacteria | 172274 |
| 223 | Ga0207713_1000659 | 3300025735 | Bacteria | 32880 |
| 224 | Ga0207713_1000817 | 3300025735 | Bacteria | 28806 |
| 225 | Ga0207713_1001352 | 3300025735 | Bacteria | 19999 |
| 226 | Ga0207713_1001441 | 3300025735 | Bacteria | 18998 |
| 227 | Ga0207713_1001720 | 3300025735 | Bacteria | 16886 |
| 228 | Ga0207713_1002171 | 3300025735 | Bacteria | 14559 |
| 229 | Ga0207713_1006631 | 3300025735 | Bacteria | 7016 |
| 230 | Ga0207713_1015407 | 3300025735 | Bacteria | 3926 |
| 231 | Ga0207713_1021631 | 3300025735 | Bacteria | 3078 |
| 232 | Ga0207713_1025828 | 3300025735 | Bacteria | 2703 |
| 233 | Ga0207713_1033932 | 3300025735 | Bacteria | 2222 |
| 234 | Ga0207671_10000131 | 3300025914 | Bacteria | 116866 |
| 235 | Ga0207649_10000012 | 3300025920 | Bacteria | 265674 |
| 236 | Ga0207681_10000099 | 3300025923 | Bacteria | 73220 |
| 237 | Ga0207650_10000564 | 3300025925 | Bacteria | 30060 |
| 238 | Ga0207650_10551593 | 3300025925 | Bacteria | 966 |
| 239 | Ga0207706_10000580 | 3300025933 | Bacteria | 38973 |
| 240 | Ga0207706_10001804 | 3300025933 | Bacteria | 21019 |
| 241 | Ga0207686_10001491 | 3300025934 | Bacteria | 13199 |
| 242 | Ga0207709_10000248 | 3300025935 | Bacteria | 66465 |
| 243 | Ga0207709_10002118 | 3300025935 | Bacteria | 12768 |
| 244 | Ga0207709_10357584 | 3300025935 | Bacteria | 1104 |
| 245 | Ga0207709_10597052 | 3300025935 | Bacteria | 874 |
| 246 | Ga0207679_10000015 | 3300025945 | Bacteria | 265674 |
| 247 | Ga0207640_10005871 | 3300025981 | Bacteria | 6700 |
| 248 | Ga0207639_10000286 | 3300026041 | Bacteria | 36062 |
| 249 | Ga0207674_10156707 | 3300026116 | Bacteria | 2232 |
| 250 | Ga0209281_1000016 | 3300027111 | Bacteria | 588107 |
| 251 | Ga0209281_1000019 | 3300027111 | Bacteria | 576164 |
| 252 | Ga0209281_1003717 | 3300027111 | Bacteria | 4879 |
| 253 | Ga0209389_1000017 | 3300027296 | Bacteria | 180543 |
| 254 | Ga0209969_1007700 | 3300027360 | Bacteria | 1521 |
| 255 | Ga0209981_1014325 | 3300027378 | Bacteria | 1105 |
| 256 | Ga0209981_1042174 | 3300027378 | Bacteria | 683 |
| 257 | Ga0209995_1028086 | 3300027471 | Bacteria | 939 |
| 258 | Ga0209968_1015559 | 3300027526 | Bacteria | 1204 |
| 259 | Ga0209982_1003756 | 3300027552 | Bacteria | 2166 |
| 260 | Ga0209983_1001665 | 3300027665 | Bacteria | 4924 |
| 261 | Ga0209282_1101649 | 3300027666 | Bacteria | 1479 |
| 262 | Ga0209971_1001664 | 3300027682 | Bacteria | 5498 |
| 263 | Ga0209974_10062237 | 3300027876 | Bacteria | 1264 |
| 264 | Ga0207428_10016610 | 3300027907 | Bacteria | 6328 |
| 265 | Ga0207428_10048306 | 3300027907 | Bacteria | 3414 |
| 266 | Ga0207428_10137020 | 3300027907 | Bacteria | 1871 |
| 267 | Ga0207428_10165605 | 3300027907 | Bacteria | 1677 |
| 268 | Ga0207428_10287698 | 3300027907 | Bacteria | 1219 |
| 269 | Ga0207428_10298391 | 3300027907 | Bacteria | 1193 |
| 270 | Ga0207428_10299708 | 3300027907 | Bacteria | 1190 |
| 271 | Ga0268266_10017876 | 3300028379 | Bacteria | 6041 |
| 272 | Ga0268266_10478876 | 3300028379 | Bacteria | 1186 |
| 273 | Ga0268266_11153684 | 3300028379 | Bacteria | 749 |
| 274 | Ga0307517_10153724 | 3300028786 | Bacteria | 1569 |
| 275 | Ga0307511_10070889 | 3300030521 | Bacteria | 2547 |
| 276 | Ga0307511_10151688 | 3300030521 | Bacteria | 1328 |
| 277 | Ga0307511_10183664 | 3300030521 | Bacteria | 1121 |
| 278 | Ga0314311_1104385 | 3300030733 | Bacteria | 3751 |
| 279 | Ga0316179_1036317 | 3300030734 | Bacteria | 1385 |
| 280 | Ga0316178_1008333 | 3300030735 | Bacteria | 44288 |
| 281 | Ga0316183_1004754 | 3300030742 | Bacteria | 7110 |
| 282 | Ga0316181_1288553 | 3300030744 | Bacteria | 970 |
| 283 | Ga0265316_10269923 | 3300031344 | Bacteria | 1245 |
| 284 | Ga0307408_100005271 | 3300031548 | Bacteria | 8663 |
| 285 | Ga0307408_100008555 | 3300031548 | Bacteria | 6759 |
| 286 | Ga0307408_100103715 | 3300031548 | Bacteria | 2171 |
| 287 | Ga0307408_100693438 | 3300031548 | Bacteria | 914 |
| 288 | Ga0307408_100842006 | 3300031548 | Bacteria | 836 |
| 289 | Ga0307405_10003779 | 3300031731 | Bacteria | 7033 |
| 290 | Ga0307405_10004147 | 3300031731 | Bacteria | 6814 |
| 291 | Ga0307405_10064288 | 3300031731 | Bacteria | 2331 |
| 292 | Ga0307405_10607513 | 3300031731 | Bacteria | 893 |
| 293 | Ga0307405_10794221 | 3300031731 | Bacteria | 792 |
| 294 | Ga0307413_10094356 | 3300031824 | Bacteria | 1958 |
| 295 | Ga0307413_10154103 | 3300031824 | Bacteria | 1605 |
| 296 | Ga0307413_10726668 | 3300031824 | Bacteria | 827 |
| 297 | Ga0307410_10438158 | 3300031852 | Bacteria | 1063 |
| 298 | Ga0307410_10540971 | 3300031852 | Bacteria | 964 |
| 299 | Ga0307406_10689935 | 3300031901 | Bacteria | 851 |
| 300 | Ga0307407_10447050 | 3300031903 | Bacteria | 937 |
| 301 | Ga0307412_10006197 | 3300031911 | Bacteria | 6744 |
| 302 | Ga0307412_10465829 | 3300031911 | Bacteria | 1044 |
| 303 | Ga0307412_10519535 | 3300031911 | Bacteria | 994 |
| 304 | Ga0307412_10909961 | 3300031911 | Bacteria | 771 |
| 305 | Ga0307409_100344684 | 3300031995 | Bacteria | 1403 |
| 306 | Ga0307409_100602868 | 3300031995 | Bacteria | 1085 |
| 307 | Ga0307414_10002861 | 3300032004 | Bacteria | 9114 |
| 308 | Ga0307414_10122898 | 3300032004 | Bacteria | 1999 |
| 309 | Ga0307414_10156416 | 3300032004 | Bacteria | 1805 |
| 310 | Ga0307414_10432860 | 3300032004 | Bacteria | 1150 |
| 311 | Ga0307414_10597130 | 3300032004 | Bacteria | 989 |
| 312 | Ga0307414_10798460 | 3300032004 | Bacteria | 861 |
| 313 | Ga0307411_10007691 | 3300032005 | Bacteria | 5516 |
| 314 | Ga0307411_10628882 | 3300032005 | Bacteria | 926 |
| 315 | Ga0307510_10349447 | 3300033180 | Bacteria | 929 |
| 316 | Ga0237819_01191 | 3300038705 | Bacteria | 7310 |
| 317 | Ga0439438_000209 | 3300041405 | Bacteria | 26976 |
| 318 | Ga0439438_012727 | 3300041405 | Bacteria | 2566 |
| 319 | Ga0439438_015936 | 3300041405 | Bacteria | 2196 |
| 320 | Ga0439438_016124 | 3300041405 | Bacteria | 2178 |
| 321 | Ga0439438_016870 | 3300041405 | Bacteria | 2115 |
| 322 | Ga0439438_016916 | 3300041405 | Bacteria | 2111 |
| 323 | Ga0439438_017934 | 3300041405 | Bacteria | 2026 |
| 324 | Ga0439438_030726 | 3300041405 | Bacteria | 1430 |
| 325 | Ga0439438_063821 | 3300041405 | Bacteria | 919 |
| 326 | Ga0439447_001101 | 3300041407 | Bacteria | 9789 |
| 327 | Ga0439447_012357 | 3300041407 | Bacteria | 2455 |
| 328 | Ga0439447_021405 | 3300041407 | Bacteria | 1703 |
| 329 | Ga0439447_023721 | 3300041407 | Bacteria | 1596 |
| 330 | Ga0439447_036701 | 3300041407 | Bacteria | 1209 |
| 331 | Ga0439461_0081573 | 3300041410 | Bacteria | 764 |
| 332 | Ga0439466_0002901 | 3300041411 | Bacteria | 6699 |
| 333 | Ga0439466_0008382 | 3300041411 | Bacteria | 3895 |
| 334 | Ga0439466_0023219 | 3300041411 | Bacteria | 2183 |
| 335 | Ga0439466_0052913 | 3300041411 | Bacteria | 1326 |
| 336 | Ga0439466_0054140 | 3300041411 | Bacteria | 1307 |
| 337 | Ga0439466_0078341 | 3300041411 | Bacteria | 1044 |
| 338 | Ga0439466_0108165 | 3300041411 | Bacteria | 863 |
| 339 | Ga0439465_0061146 | 3300041413 | Bacteria | 1248 |
| 340 | Ga0451807_1222440 | 3300041486 | Bacteria | 996 |
| 341 | Ga0439431_0061360 | 3300041997 | Bacteria | 990 |
| 342 | Ga0439445_0032612 | 3300042004 | Bacteria | 1358 |
| 343 | Ga0439432_000624 | 3300042006 | Bacteria | 13327 |
| 344 | Ga0439432_000891 | 3300042006 | Bacteria | 11207 |
| 345 | Ga0439432_001206 | 3300042006 | Bacteria | 9795 |
| 346 | Ga0439432_017152 | 3300042006 | Bacteria | 2432 |
| 347 | Ga0439432_020886 | 3300042006 | Bacteria | 2173 |
| 348 | Ga0439432_022277 | 3300042006 | Bacteria | 2093 |
| 349 | Ga0439432_034740 | 3300042006 | Bacteria | 1617 |
| 350 | Ga0439432_091089 | 3300042006 | Bacteria | 917 |
| 351 | Ga0439451_008479 | 3300042009 | Bacteria | 2084 |
| 352 | Ga0439451_030542 | 3300042009 | Bacteria | 1083 |
| 353 | Ga0439452_007339 | 3300042010 | Bacteria | 3382 |
| 354 | Ga0439452_010715 | 3300042010 | Bacteria | 2654 |
| 355 | Ga0439452_011277 | 3300042010 | Bacteria | 2573 |
| 356 | Ga0439452_013405 | 3300042010 | Bacteria | 2302 |
| 357 | Ga0439452_015833 | 3300042010 | Bacteria | 2059 |
| 358 | Ga0439452_017966 | 3300042010 | Bacteria | 1890 |
| 359 | Ga0439452_028064 | 3300042010 | Bacteria | 1407 |
| 360 | Ga0439452_041491 | 3300042010 | Bacteria | 1082 |
| 361 | Ga0439452_059049 | 3300042010 | Bacteria | 862 |
| 362 | Ga0439456_000869 | 3300042013 | Bacteria | 6075 |
| 363 | Ga0439456_001655 | 3300042013 | Bacteria | 4502 |
| 364 | Ga0439456_016370 | 3300042013 | Bacteria | 1550 |
| 365 | Ga0439456_023406 | 3300042013 | Bacteria | 1309 |
| 366 | Ga0439463_000040 | 3300042016 | Bacteria | 27327 |
| 367 | Ga0439463_001722 | 3300042016 | Bacteria | 5709 |
| 368 | Ga0439463_019203 | 3300042016 | Bacteria | 1702 |
| 369 | Ga0439463_025124 | 3300042016 | Bacteria | 1493 |
| 370 | Ga0439463_042538 | 3300042016 | Bacteria | 1155 |
| 371 | Ga0439463_063179 | 3300042016 | Bacteria | 946 |
| 372 | Ga0439463_065752 | 3300042016 | Bacteria | 927 |
| 373 | Ga0439463_088081 | 3300042016 | Bacteria | 799 |
| 374 | Ga0450911_004396 | 3300042115 | Bacteria | 2316 |
| 375 | Ga0450911_006640 | 3300042115 | Bacteria | 1712 |
| 376 | Ga0450917_003063 | 3300042120 | Bacteria | 1204 |
| 377 | Ga0450919_002904 | 3300042121 | Bacteria | 2188 |
| 378 | Ga0450920_006650 | 3300042122 | Bacteria | 2082 |
| 379 | Ga0450922_001332 | 3300042124 | Bacteria | 2436 |
| 380 | Ga0450923_009887 | 3300042125 | Bacteria | 1679 |
| 381 | Ga0450890_000276 | 3300042127 | Bacteria | 7545 |
| 382 | Ga0450891_010271 | 3300042129 | Bacteria | 862 |
| 383 | Ga0450892_002627 | 3300042130 | Bacteria | 1518 |
| 384 | Ga0450902_000025 | 3300042137 | Bacteria | 13254 |
| 385 | Ga0450902_011566 | 3300042137 | Bacteria | 1404 |
| 386 | Ga0450902_012022 | 3300042137 | Bacteria | 1382 |
| 387 | Ga0450902_020343 | 3300042137 | Bacteria | 1093 |
| 388 | Ga0450903_000888 | 3300042138 | Bacteria | 5760 |
| 389 | Ga0450903_005114 | 3300042138 | Bacteria | 2205 |
| 390 | Ga0450903_008281 | 3300042138 | Bacteria | 1701 |
| 391 | Ga0450903_010641 | 3300042138 | Bacteria | 1486 |
| 392 | Ga0450904_000070 | 3300042139 | Bacteria | 22975 |
| 393 | Ga0450904_009766 | 3300042139 | Bacteria | 945 |
| 394 | Ga0450905_000013 | 3300042142 | Bacteria | 16288 |
| 395 | Ga0450906_005538 | 3300042145 | Bacteria | 2590 |
| 396 | Ga0450906_007871 | 3300042145 | Bacteria | 2088 |
| 397 | Ga0450906_017450 | 3300042145 | Bacteria | 1295 |
| 398 | Ga0450907_000886 | 3300042146 | Bacteria | 7169 |
| 399 | Ga0450907_003896 | 3300042146 | Bacteria | 2607 |
| 400 | Ga0450907_010066 | 3300042146 | Bacteria | 1568 |
| 401 | Ga0450910_009274 | 3300042147 | Bacteria | 1393 |
| 402 | Ga0439446_0000025 | 3300042156 | Bacteria | 25767 |
| 403 | Ga0439446_0004646 | 3300042156 | Bacteria | 3486 |
| 404 | Ga0439446_0007666 | 3300042156 | Bacteria | 2844 |
| 405 | Ga0439446_0009996 | 3300042156 | Bacteria | 2548 |
| 406 | Ga0439446_0070386 | 3300042156 | Bacteria | 1069 |
| 407 | Ga0450908_005360 | 3300042184 | Bacteria | 2461 |
| 408 | Ga0450908_015101 | 3300042184 | Bacteria | 1384 |
| 409 | Ga0450909_008860 | 3300042185 | Bacteria | 1465 |
| 410 | Ga0439434_0004198 | 3300042435 | Bacteria | 4208 |
| 411 | Ga0439434_0012865 | 3300042435 | Bacteria | 2479 |
| 412 | Ga0439464_0001247 | 3300042439 | Bacteria | 5919 |
| 413 | Ga0439464_0035486 | 3300042439 | Bacteria | 1408 |
| 414 | Ga0439460_0000852 | 3300042461 | Bacteria | 6960 |
| 415 | Ga0439460_0008496 | 3300042461 | Bacteria | 2595 |
| 416 | Ga0439460_0012014 | 3300042461 | Bacteria | 2239 |
| 417 | Ga0450916_000038 | 3300042530 | Bacteria | 6906 |
| 418 | Ga0450918_009504 | 3300042531 | Bacteria | 1704 |
| 419 | Ga0450893_0007920 | 3300042532 | Bacteria | 1727 |
| 420 | Ga0450901_000048 | 3300042533 | Bacteria | 11693 |
| 421 | Ga0439440_0009943 | 3300042993 | Bacteria | 1978 |
| 422 | Ga0439440_0032157 | 3300042993 | Bacteria | 1244 |
| 423 | Ga0495617_002358 | 3300046452 | Bacteria | 7553 |
| 424 | Ga0495617_015696 | 3300046452 | Bacteria | 2564 |
| 425 | Ga0495617_022214 | 3300046452 | Bacteria | 2144 |
| 426 | Ga0495617_024135 | 3300046452 | Bacteria | 2052 |
| 427 | Ga0495617_033181 | 3300046452 | Bacteria | 1732 |
| 428 | Ga0495617_055831 | 3300046452 | Bacteria | 1309 |
| 429 | Ga0495617_085540 | 3300046452 | Bacteria | 1031 |
| 430 | Ga0495627_000240 | 3300046453 | Bacteria | 57483 |
| 431 | Ga0495627_023259 | 3300046453 | Bacteria | 2031 |
| 432 | Ga0495627_027522 | 3300046453 | Bacteria | 1823 |
| 433 | Ga0495627_054275 | 3300046453 | Bacteria | 1198 |
| 434 | Ga0495627_149580 | 3300046453 | Bacteria | 652 |
| 435 | Ga0495603_0059308 | 3300046455 | Bacteria | 2262 |
| 436 | Ga0495603_0165944 | 3300046455 | Bacteria | 1280 |
| 437 | Ga0495590_0002766 | 3300046457 | Bacteria | 7235 |
| 438 | Ga0495590_0029825 | 3300046457 | Bacteria | 1911 |
| 439 | Ga0495590_0069397 | 3300046457 | Bacteria | 1235 |
| 440 | Ga0495590_0083238 | 3300046457 | Bacteria | 1127 |
| 441 | Ga0495591_000113 | 3300046458 | Bacteria | 93452 |
| 442 | Ga0495591_004557 | 3300046458 | Bacteria | 6721 |
| 443 | Ga0495591_012333 | 3300046458 | Bacteria | 3187 |
| 444 | Ga0495591_022831 | 3300046458 | Bacteria | 2015 |
| 445 | Ga0495591_023760 | 3300046458 | Bacteria | 1956 |
| 446 | Ga0495591_035354 | 3300046458 | Bacteria | 1463 |
| 447 | Ga0495591_035540 | 3300046458 | Bacteria | 1457 |
| 448 | Ga0495638_0055504 | 3300046460 | Bacteria | 2459 |
| 449 | Ga0495638_0080407 | 3300046460 | Bacteria | 1980 |
| 450 | Ga0495638_0178236 | 3300046460 | Bacteria | 1214 |
| 451 | Ga0495638_0188024 | 3300046460 | Bacteria | 1173 |
| 452 | Ga0495638_0196986 | 3300046460 | Bacteria | 1139 |
| 453 | Ga0495638_0205675 | 3300046460 | Bacteria | 1108 |
| 454 | Ga0495638_0292096 | 3300046460 | Bacteria | 881 |
| 455 | Ga0495653_0001669 | 3300046463 | Bacteria | 17443 |
| 456 | Ga0495653_0012018 | 3300046463 | Bacteria | 7067 |
| 457 | Ga0495653_0115551 | 3300046463 | Bacteria | 1920 |
| 458 | Ga0495650_0006917 | 3300046471 | Bacteria | 6947 |
| 459 | Ga0495650_0008400 | 3300046471 | Bacteria | 6033 |
| 460 | Ga0495650_0008780 | 3300046471 | Bacteria | 5847 |
| 461 | Ga0495650_0013739 | 3300046471 | Bacteria | 4260 |
| 462 | Ga0495650_0038471 | 3300046471 | Bacteria | 2072 |
| 463 | Ga0495650_0105120 | 3300046471 | Bacteria | 1055 |
| 464 | Ga0495650_0109138 | 3300046471 | Bacteria | 1029 |
| 465 | Ga0495582_0005176 | 3300046473 | Bacteria | 7293 |
| 466 | Ga0495605_0000122 | 3300046474 | Bacteria | 101994 |
| 467 | Ga0495605_0008842 | 3300046474 | Bacteria | 5679 |
| 468 | Ga0495605_0009980 | 3300046474 | Bacteria | 5321 |
| 469 | Ga0495605_0011141 | 3300046474 | Bacteria | 5024 |
| 470 | Ga0495605_0033186 | 3300046474 | Bacteria | 2623 |
| 471 | Ga0495605_0042881 | 3300046474 | Bacteria | 2245 |
| 472 | Ga0495605_0053116 | 3300046474 | Bacteria | 1966 |
| 473 | Ga0495605_0069972 | 3300046474 | Bacteria | 1660 |
| 474 | Ga0495605_0088608 | 3300046474 | Bacteria | 1437 |
| 475 | Ga0495605_0209245 | 3300046474 | Bacteria | 847 |
| 476 | Ga0495639_0002876 | 3300046475 | Bacteria | 7491 |
| 477 | Ga0495639_0006199 | 3300046475 | Bacteria | 5133 |
| 478 | Ga0495584_0022861 | 3300046491 | Bacteria | 3172 |
| 479 | Ga0495584_0032656 | 3300046491 | Bacteria | 2633 |
| 480 | Ga0495584_0034962 | 3300046491 | Bacteria | 2541 |
| 481 | Ga0495584_0044524 | 3300046491 | Bacteria | 2239 |
| 482 | Ga0495584_0176287 | 3300046491 | Bacteria | 1086 |
| 483 | Ga0495584_0216165 | 3300046491 | Bacteria | 974 |
| 484 | Ga0495585_0011036 | 3300046492 | Bacteria | 5364 |
| 485 | Ga0495585_0048377 | 3300046492 | Bacteria | 2365 |
| 486 | Ga0495585_0050496 | 3300046492 | Bacteria | 2307 |
| 487 | Ga0495585_0051093 | 3300046492 | Bacteria | 2291 |
| 488 | Ga0495585_0153652 | 3300046492 | Bacteria | 1198 |
| 489 | Ga0495594_0000760 | 3300046499 | Bacteria | 16556 |
| 490 | Ga0495596_0137788 | 3300046500 | Bacteria | 947 |
| 491 | Ga0495596_0162795 | 3300046500 | Bacteria | 867 |
| 492 | Ga0495607_0000478 | 3300046501 | Bacteria | 40040 |
| 493 | Ga0495607_0000778 | 3300046501 | Bacteria | 30559 |
| 494 | Ga0495607_0001277 | 3300046501 | Bacteria | 22527 |
| 495 | Ga0495607_0002257 | 3300046501 | Bacteria | 15915 |
| 496 | Ga0495607_0007199 | 3300046501 | Bacteria | 7724 |
| 497 | Ga0495607_0008693 | 3300046501 | Bacteria | 6923 |
| 498 | Ga0495607_0017458 | 3300046501 | Bacteria | 4606 |
| 499 | Ga0495607_0034176 | 3300046501 | Bacteria | 3086 |
| 500 | Ga0495607_0039928 | 3300046501 | Bacteria | 2798 |
| 501 | Ga0495607_0047267 | 3300046501 | Bacteria | 2522 |
| 502 | Ga0495607_0059808 | 3300046501 | Bacteria | 2171 |
| 503 | Ga0495607_0065103 | 3300046501 | Bacteria | 2056 |
| 504 | Ga0495607_0114392 | 3300046501 | Bacteria | 1426 |
| 505 | Ga0495607_0143474 | 3300046501 | Bacteria | 1229 |
| 506 | Ga0495607_0149383 | 3300046501 | Bacteria | 1197 |
| 507 | Ga0495607_0208027 | 3300046501 | Bacteria | 964 |
| 508 | Ga0495583_0000174 | 3300046506 | Bacteria | 109079 |
| 509 | Ga0495583_0006222 | 3300046506 | Bacteria | 7858 |
| 510 | Ga0495583_0006464 | 3300046506 | Bacteria | 7659 |
| 511 | Ga0495583_0010507 | 3300046506 | Bacteria | 5394 |
| 512 | Ga0495583_0012972 | 3300046506 | Bacteria | 4679 |
| 513 | Ga0495583_0107964 | 3300046506 | Bacteria | 1181 |
| 514 | Ga0495606_0002681 | 3300046507 | Bacteria | 20169 |
| 515 | Ga0495606_0007809 | 3300046507 | Bacteria | 9459 |
| 516 | Ga0495606_0016882 | 3300046507 | Bacteria | 5543 |
| 517 | Ga0495606_0056490 | 3300046507 | Bacteria | 2533 |
| 518 | Ga0495606_0070273 | 3300046507 | Bacteria | 2208 |
| 519 | Ga0495606_0104356 | 3300046507 | Bacteria | 1720 |
| 520 | Ga0495606_0144161 | 3300046507 | Bacteria | 1404 |
| 521 | Ga0495606_0241656 | 3300046507 | Bacteria | 1006 |
| 522 | Ga0495610_0005689 | 3300046512 | Bacteria | 8789 |
| 523 | Ga0495610_0019337 | 3300046512 | Bacteria | 3816 |
| 524 | Ga0495610_0053195 | 3300046512 | Bacteria | 1962 |
| 525 | Ga0495610_0091854 | 3300046512 | Bacteria | 1374 |
| 526 | Ga0495610_0107221 | 3300046512 | Bacteria | 1242 |
| 527 | Ga0495610_0131059 | 3300046512 | Bacteria | 1088 |
| 528 | Ga0495610_0131362 | 3300046512 | Bacteria | 1087 |
| 529 | Ga0495610_0176321 | 3300046512 | Bacteria | 892 |
| 530 | Ga0495616_0005700 | 3300046513 | Bacteria | 7628 |
| 531 | Ga0495616_0037105 | 3300046513 | Bacteria | 2509 |
| 532 | Ga0495616_0038138 | 3300046513 | Bacteria | 2468 |
| 533 | Ga0495616_0051797 | 3300046513 | Bacteria | 2045 |
| 534 | Ga0495616_0058052 | 3300046513 | Bacteria | 1906 |
| 535 | Ga0495620_0000416 | 3300046515 | Bacteria | 28487 |
| 536 | Ga0495620_0002395 | 3300046515 | Bacteria | 10864 |
| 537 | Ga0495620_0003579 | 3300046515 | Bacteria | 8876 |
| 538 | Ga0495620_0006189 | 3300046515 | Bacteria | 6593 |
| 539 | Ga0495620_0016757 | 3300046515 | Bacteria | 3668 |
| 540 | Ga0495620_0036081 | 3300046515 | Bacteria | 2215 |
| 541 | Ga0495620_0053282 | 3300046515 | Bacteria | 1713 |
| 542 | Ga0495620_0101069 | 3300046515 | Bacteria | 1149 |
| 543 | Ga0495628_0098203 | 3300046516 | Bacteria | 2262 |
| 544 | Ga0495630_0025282 | 3300046517 | Bacteria | 4389 |
| 545 | Ga0495630_0036230 | 3300046517 | Bacteria | 3688 |
| 546 | Ga0495630_0049044 | 3300046517 | Bacteria | 3160 |
| 547 | Ga0495631_0001646 | 3300046518 | Bacteria | 13298 |
| 548 | Ga0495631_0006612 | 3300046518 | Bacteria | 5966 |
| 549 | Ga0495631_0019434 | 3300046518 | Bacteria | 3185 |
| 550 | Ga0495631_0027595 | 3300046518 | Bacteria | 2596 |
| 551 | Ga0495631_0036736 | 3300046518 | Bacteria | 2186 |
| 552 | Ga0495631_0040362 | 3300046518 | Bacteria | 2068 |
| 553 | Ga0495631_0108159 | 3300046518 | Bacteria | 1195 |
| 554 | Ga0495632_0012473 | 3300046519 | Bacteria | 4900 |
| 555 | Ga0495632_0041205 | 3300046519 | Bacteria | 2321 |
| 556 | Ga0495632_0046692 | 3300046519 | Bacteria | 2150 |
| 557 | Ga0495632_0050015 | 3300046519 | Bacteria | 2063 |
| 558 | Ga0495632_0054902 | 3300046519 | Bacteria | 1951 |
| 559 | Ga0495632_0111427 | 3300046519 | Bacteria | 1284 |
| 560 | Ga0495637_0003284 | 3300046520 | Bacteria | 8603 |
| 561 | Ga0495637_0021261 | 3300046520 | Bacteria | 2977 |
| 562 | Ga0495637_0025002 | 3300046520 | Bacteria | 2697 |
| 563 | Ga0495637_0026501 | 3300046520 | Bacteria | 2600 |
| 564 | Ga0495637_0028895 | 3300046520 | Bacteria | 2472 |
| 565 | Ga0495637_0031158 | 3300046520 | Bacteria | 2360 |
| 566 | Ga0495637_0032530 | 3300046520 | Bacteria | 2296 |
| 567 | Ga0495637_0043560 | 3300046520 | Bacteria | 1914 |
| 568 | Ga0495637_0045404 | 3300046520 | Bacteria | 1864 |
| 569 | Ga0495637_0118315 | 3300046520 | Bacteria | 1021 |
| 570 | Ga0495637_0123030 | 3300046520 | Bacteria | 996 |
| 571 | Ga0495637_0128900 | 3300046520 | Bacteria | 967 |
| 572 | Ga0495637_0162633 | 3300046520 | Bacteria | 836 |
| 573 | Ga0495643_0001185 | 3300046522 | Bacteria | 25410 |
| 574 | Ga0495643_0001285 | 3300046522 | Bacteria | 23963 |
| 575 | Ga0495643_0007601 | 3300046522 | Bacteria | 6966 |
| 576 | Ga0495643_0054869 | 3300046522 | Bacteria | 2131 |
| 577 | Ga0495643_0064573 | 3300046522 | Bacteria | 1933 |
| 578 | Ga0495643_0086273 | 3300046522 | Bacteria | 1626 |
| 579 | Ga0495643_0143064 | 3300046522 | Bacteria | 1191 |
| 580 | Ga0495648_0004462 | 3300046524 | Bacteria | 11951 |
| 581 | Ga0495648_0039772 | 3300046524 | Bacteria | 2988 |
| 582 | Ga0495648_0048788 | 3300046524 | Bacteria | 2602 |
| 583 | Ga0495648_0055438 | 3300046524 | Bacteria | 2389 |
| 584 | Ga0495648_0059157 | 3300046524 | Bacteria | 2287 |
| 585 | Ga0495648_0062578 | 3300046524 | Bacteria | 2202 |
| 586 | Ga0495648_0068696 | 3300046524 | Bacteria | 2065 |
| 587 | Ga0495648_0137095 | 3300046524 | Bacteria | 1292 |
| 588 | Ga0495648_0181991 | 3300046524 | Bacteria | 1067 |
| 589 | Ga0495648_0182542 | 3300046524 | Bacteria | 1065 |
| 590 | Ga0495648_0203960 | 3300046524 | Bacteria | 987 |
| 591 | Ga0495666_0004665 | 3300046526 | Bacteria | 6933 |
| 592 | Ga0495666_0037368 | 3300046526 | Bacteria | 2362 |
| 593 | Ga0495666_0092574 | 3300046526 | Bacteria | 1426 |
| 594 | Ga0495642_0018992 | 3300046528 | Bacteria | 2691 |
| 595 | Ga0495642_0024333 | 3300046528 | Bacteria | 2395 |
| 596 | Ga0495642_0026052 | 3300046528 | Bacteria | 2320 |
| 597 | Ga0495652_0034352 | 3300046529 | Bacteria | 4420 |
| 598 | Ga0495654_0005080 | 3300046530 | Bacteria | 7699 |
| 599 | Ga0495654_0005459 | 3300046530 | Bacteria | 7380 |
| 600 | Ga0495654_0005992 | 3300046530 | Bacteria | 6983 |
| 601 | Ga0495654_0009976 | 3300046530 | Bacteria | 5187 |
| 602 | Ga0495654_0026347 | 3300046530 | Bacteria | 2988 |
| 603 | Ga0495654_0030895 | 3300046530 | Bacteria | 2721 |
| 604 | Ga0495654_0032736 | 3300046530 | Bacteria | 2634 |
| 605 | Ga0495654_0033359 | 3300046530 | Bacteria | 2606 |
| 606 | Ga0495654_0045024 | 3300046530 | Bacteria | 2178 |
| 607 | Ga0495654_0047030 | 3300046530 | Bacteria | 2122 |
| 608 | Ga0495654_0101697 | 3300046530 | Bacteria | 1322 |
| 609 | Ga0495654_0105128 | 3300046530 | Bacteria | 1294 |
| 610 | Ga0495654_0118497 | 3300046530 | Bacteria | 1200 |
| 611 | Ga0495654_0150127 | 3300046530 | Bacteria | 1031 |
| 612 | Ga0495654_0153463 | 3300046530 | Bacteria | 1016 |
| 613 | Ga0495586_0065831 | 3300046535 | Bacteria | 1975 |
| 614 | Ga0495609_0000023 | 3300046538 | Bacteria | 269702 |
| 615 | Ga0495609_0000088 | 3300046538 | Bacteria | 109269 |
| 616 | Ga0495609_0037517 | 3300046538 | Bacteria | 2185 |
| 617 | Ga0495609_0073777 | 3300046538 | Bacteria | 1497 |
| 618 | Ga0495609_0074412 | 3300046538 | Bacteria | 1489 |
| 619 | Ga0495609_0074493 | 3300046538 | Bacteria | 1489 |
| 620 | Ga0495609_0094626 | 3300046538 | Bacteria | 1297 |
| 621 | Ga0495609_0168547 | 3300046538 | Bacteria | 925 |
| 622 | Ga0495609_0288217 | 3300046538 | Bacteria | 670 |
| 623 | Ga0495597_0000240 | 3300046542 | Bacteria | 49641 |
| 624 | Ga0495597_0008804 | 3300046542 | Bacteria | 5038 |
| 625 | Ga0495597_0027317 | 3300046542 | Bacteria | 2617 |
| 626 | Ga0495597_0047251 | 3300046542 | Bacteria | 1905 |
| 627 | Ga0495597_0080678 | 3300046542 | Bacteria | 1391 |
| 628 | Ga0495597_0111045 | 3300046542 | Bacteria | 1149 |
| 629 | Ga0495597_0125215 | 3300046542 | Bacteria | 1068 |
| 630 | Ga0495645_0018495 | 3300046543 | Bacteria | 5006 |
| 631 | Ga0495622_0003524 | 3300046557 | Bacteria | 7360 |
| 632 | Ga0495622_0007559 | 3300046557 | Bacteria | 5045 |
| 633 | Ga0495622_0025526 | 3300046557 | Bacteria | 2759 |
| 634 | Ga0495622_0030861 | 3300046557 | Bacteria | 2505 |
| 635 | Ga0495622_0033115 | 3300046557 | Bacteria | 2412 |
| 636 | Ga0495633_0000777 | 3300046558 | Bacteria | 28543 |
| 637 | Ga0495633_0020974 | 3300046558 | Bacteria | 3275 |
| 638 | Ga0495633_0031356 | 3300046558 | Bacteria | 2577 |
| 639 | Ga0495633_0040643 | 3300046558 | Bacteria | 2214 |
| 640 | Ga0495633_0212496 | 3300046558 | Bacteria | 886 |
| 641 | Ga0495656_0036041 | 3300046615 | Bacteria | 2035 |
| 642 | Ga0495668_0100493 | 3300046616 | Bacteria | 1582 |
| 643 | Ga0495668_0134319 | 3300046616 | Bacteria | 1354 |
| 644 | Ga0495634_0008463 | 3300046642 | Bacteria | 7655 |
| 645 | Ga0495611_0001264 | 3300046648 | Bacteria | 13020 |
| 646 | Ga0495611_0003869 | 3300046648 | Bacteria | 6532 |
| 647 | Ga0495611_0006161 | 3300046648 | Bacteria | 5118 |
| 648 | Ga0495611_0131055 | 3300046648 | Bacteria | 1169 |
| 649 | Ga0495625_0024930 | 3300046660 | Bacteria | 4543 |
| 650 | Ga0495625_0082894 | 3300046660 | Bacteria | 2229 |
| 651 | Ga0495625_0088730 | 3300046660 | Bacteria | 2141 |
| 652 | Ga0495625_0101778 | 3300046660 | Bacteria | 1972 |
| 653 | Ga0495625_0146840 | 3300046660 | Bacteria | 1587 |
| 654 | Ga0495625_0151691 | 3300046660 | Bacteria | 1557 |
| 655 | Ga0495625_0349415 | 3300046660 | Bacteria | 935 |
| 656 | Ga0495625_0362354 | 3300046660 | Bacteria | 913 |
| 657 | Ga0495625_0384839 | 3300046660 | Bacteria | 879 |
| 658 | Ga0495635_0081337 | 3300046663 | Bacteria | 2217 |
| 659 | Ga0495659_0001715 | 3300046664 | Bacteria | 7307 |
| 660 | Ga0495659_0013278 | 3300046664 | Bacteria | 2681 |
| 661 | Ga0495659_0117338 | 3300046664 | Bacteria | 1044 |
| 662 | Ga0495659_0128793 | 3300046664 | Bacteria | 1002 |
| 663 | Ga0495661_0000036 | 3300046665 | Bacteria | 164694 |
| 664 | Ga0495661_0000072 | 3300046665 | Bacteria | 120743 |
| 665 | Ga0495661_0000841 | 3300046665 | Bacteria | 28595 |
| 666 | Ga0495661_0004540 | 3300046665 | Bacteria | 9999 |
| 667 | Ga0495661_0016542 | 3300046665 | Bacteria | 4886 |
| 668 | Ga0495661_0053107 | 3300046665 | Bacteria | 2439 |
| 669 | Ga0495661_0084689 | 3300046665 | Bacteria | 1818 |
| 670 | Ga0495661_0194082 | 3300046665 | Bacteria | 1067 |
| 671 | Ga0495661_0203120 | 3300046665 | Bacteria | 1036 |
| 672 | Ga0495661_0375639 | 3300046665 | Bacteria | 695 |
| 673 | Ga0495588_0037981 | 3300046674 | Bacteria | 2448 |
| 674 | Ga0495588_0163590 | 3300046674 | Bacteria | 1176 |
| 675 | Ga0495623_0047544 | 3300046679 | Bacteria | 2723 |
| 676 | Ga0495646_0084018 | 3300046680 | Bacteria | 1849 |
| 677 | Ga0495669_0074044 | 3300046684 | Bacteria | 1556 |
| 678 | Ga0495669_0184597 | 3300046684 | Bacteria | 994 |
| 679 | Ga0495613_0016807 | 3300046689 | Bacteria | 5448 |
| 680 | Ga0495613_0462386 | 3300046689 | Bacteria | 858 |
| 681 | Ga0495624_0225933 | 3300046690 | Bacteria | 1134 |
| 682 | Ga0495670_0042657 | 3300046691 | Bacteria | 2263 |
| 683 | Ga0495670_0135705 | 3300046691 | Bacteria | 1284 |
| 684 | Ga0495670_0137147 | 3300046691 | Bacteria | 1277 |
| 685 | Ga0495670_0197192 | 3300046691 | Bacteria | 1065 |
| 686 | Ga0495670_0254012 | 3300046691 | Bacteria | 937 |
| 687 | Ga0495670_0266139 | 3300046691 | Bacteria | 915 |
| 688 | Ga0495671_0002531 | 3300046692 | Bacteria | 11494 |
| 689 | Ga0495671_0004905 | 3300046692 | Bacteria | 7912 |
| 690 | Ga0495671_0033036 | 3300046692 | Bacteria | 2637 |
| 691 | Ga0495671_0034433 | 3300046692 | Bacteria | 2574 |
| 692 | Ga0495671_0070049 | 3300046692 | Bacteria | 1723 |
| 693 | Ga0495671_0092767 | 3300046692 | Bacteria | 1477 |
| 694 | Ga0495671_0134330 | 3300046692 | Bacteria | 1206 |
| 695 | Ga0495671_0159270 | 3300046692 | Bacteria | 1098 |
| 696 | Ga0495671_0171557 | 3300046692 | Bacteria | 1054 |
| 697 | Ga0495671_0210095 | 3300046692 | Bacteria | 943 |
| 698 | Ga0495671_0217740 | 3300046692 | Bacteria | 924 |
| 699 | Ga0495671_0269658 | 3300046692 | Bacteria | 821 |
| 700 | Ga0495671_0339307 | 3300046692 | Bacteria | 721 |
| 701 | Ga0495671_0395729 | 3300046692 | Bacteria | 661 |
| 702 | Ga0495649_0037029 | 3300046694 | Bacteria | 2678 |
| 703 | Ga0495649_0039601 | 3300046694 | Bacteria | 2583 |
| 704 | Ga0495649_0042047 | 3300046694 | Bacteria | 2497 |
| 705 | Ga0495649_0059716 | 3300046694 | Bacteria | 2052 |
| 706 | Ga0495649_0072309 | 3300046694 | Bacteria | 1848 |
| 707 | Ga0495649_0099819 | 3300046694 | Bacteria | 1543 |
| 708 | Ga0495649_0140861 | 3300046694 | Bacteria | 1269 |
| 709 | Ga0495649_0207288 | 3300046694 | Bacteria | 1016 |
| 710 | Ga0495649_0266782 | 3300046694 | Bacteria | 876 |
| 711 | Ga0495649_0319243 | 3300046694 | Bacteria | 788 |
| 712 | Ga0495589_0011296 | 3300046794 | Bacteria | 4635 |
| 713 | Ga0495589_0013649 | 3300046794 | Bacteria | 4188 |
| 714 | Ga0495589_0045432 | 3300046794 | Bacteria | 2181 |
| 715 | Ga0495589_0048656 | 3300046794 | Bacteria | 2098 |
| 716 | Ga0495589_0052425 | 3300046794 | Bacteria | 2015 |
| 717 | Ga0495589_0053754 | 3300046794 | Bacteria | 1986 |
| 718 | Ga0495589_0166640 | 3300046794 | Bacteria | 1048 |
| 719 | Ga0495589_0215727 | 3300046794 | Bacteria | 902 |
| 720 | Ga0495600_0041929 | 3300046809 | Bacteria | 2983 |
| 721 | Ga0495600_0226873 | 3300046809 | Bacteria | 1193 |
| 722 | Ga0495660_0003678 | 3300046810 | Bacteria | 9435 |
| 723 | Ga0495660_0022952 | 3300046810 | Bacteria | 3560 |
| 724 | Ga0495660_0049110 | 3300046810 | Bacteria | 2305 |
| 725 | Ga0495660_0057487 | 3300046810 | Bacteria | 2098 |
| 726 | Ga0495660_0073515 | 3300046810 | Bacteria | 1807 |
| 727 | Ga0495660_0099117 | 3300046810 | Bacteria | 1502 |
| 728 | Ga0495660_0106038 | 3300046810 | Bacteria | 1440 |
| 729 | Ga0495660_0142536 | 3300046810 | Bacteria | 1190 |
| 730 | Ga0495660_0188062 | 3300046810 | Bacteria | 994 |
| 731 | Ga0495660_0194413 | 3300046810 | Bacteria | 972 |
| 732 | Ga0495660_0204231 | 3300046810 | Bacteria | 941 |
| 733 | Ga0495581_0010505 | 3300047315 | Bacteria | 5351 |
| 734 | Ga0495581_0172361 | 3300047315 | Bacteria | 1265 |
| 735 | Ga0495604_0022114 | 3300047317 | Bacteria | 5075 |
| 736 | Ga0495604_0033048 | 3300047317 | Bacteria | 4096 |
| 737 | Ga0495604_0358485 | 3300047317 | Bacteria | 967 |
| 738 | Ga0495636_0002081 | 3300047318 | Bacteria | 7686 |
| 739 | Ga0495672_0002477 | 3300047320 | Bacteria | 16960 |
| 740 | Ga0495672_0004169 | 3300047320 | Bacteria | 11998 |
| 741 | Ga0495672_0006578 | 3300047320 | Bacteria | 8952 |
| 742 | Ga0495672_0008744 | 3300047320 | Bacteria | 7424 |
| 743 | Ga0495672_0009426 | 3300047320 | Bacteria | 7075 |
| 744 | Ga0495672_0021543 | 3300047320 | Bacteria | 4202 |
| 745 | Ga0495672_0056080 | 3300047320 | Bacteria | 2295 |
| 746 | Ga0495672_0109996 | 3300047320 | Bacteria | 1480 |
| 747 | Ga0495672_0194564 | 3300047320 | Bacteria | 1017 |
| 748 | Ga0495676_0037892 | 3300047321 | Bacteria | 4008 |
| 749 | Ga0495680_0004392 | 3300047322 | Bacteria | 13496 |
| 750 | Ga0495680_0081134 | 3300047322 | Bacteria | 2449 |
| 751 | Ga0495683_0000028 | 3300047323 | Bacteria | 153672 |
| 752 | Ga0495683_0000070 | 3300047323 | Bacteria | 108186 |
| 753 | Ga0495683_0000898 | 3300047323 | Bacteria | 21004 |
| 754 | Ga0495683_0045272 | 3300047323 | Bacteria | 2211 |
| 755 | Ga0495683_0048309 | 3300047323 | Bacteria | 2133 |
| 756 | Ga0495683_0085208 | 3300047323 | Bacteria | 1536 |
| 757 | Ga0495683_0136837 | 3300047323 | Bacteria | 1150 |
| 758 | Ga0495687_028998 | 3300047443 | Bacteria | 2566 |
| 759 | Ga0495687_032126 | 3300047443 | Bacteria | 2400 |
| 760 | Ga0495687_035691 | 3300047443 | Bacteria | 2232 |
| 761 | Ga0495687_035850 | 3300047443 | Bacteria | 2225 |
| 762 | Ga0495677_0016451 | 3300047445 | Bacteria | 2684 |
| 763 | Ga0495677_0112523 | 3300047445 | Bacteria | 1035 |
| 764 | Ga0495679_000814 | 3300047446 | Bacteria | 19816 |
| 765 | Ga0495679_005870 | 3300047446 | Bacteria | 5385 |
| 766 | Ga0495679_022077 | 3300047446 | Bacteria | 2184 |
| 767 | Ga0495679_026268 | 3300047446 | Bacteria | 1935 |
| 768 | Ga0495679_031328 | 3300047446 | Bacteria | 1716 |
| 769 | Ga0495679_035243 | 3300047446 | Bacteria | 1587 |
| 770 | Ga0495673_0002493 | 3300047469 | Bacteria | 12887 |
| 771 | Ga0495673_0002965 | 3300047469 | Bacteria | 11438 |
| 772 | Ga0495673_0003154 | 3300047469 | Bacteria | 11035 |
| 773 | Ga0495673_0008092 | 3300047469 | Bacteria | 5953 |
| 774 | Ga0495673_0011343 | 3300047469 | Bacteria | 4798 |
| 775 | Ga0495673_0036054 | 3300047469 | Bacteria | 2272 |
| 776 | Ga0495673_0041925 | 3300047469 | Bacteria | 2057 |
| 777 | Ga0495681_0009957 | 3300047470 | Bacteria | 5798 |
| 778 | Ga0495681_0016326 | 3300047470 | Bacteria | 4166 |
| 779 | Ga0495681_0025678 | 3300047470 | Bacteria | 3078 |
| 780 | Ga0495681_0026288 | 3300047470 | Bacteria | 3033 |
| 781 | Ga0495681_0035896 | 3300047470 | Bacteria | 2457 |
| 782 | Ga0495681_0041032 | 3300047470 | Bacteria | 2250 |
| 783 | Ga0495681_0041880 | 3300047470 | Bacteria | 2220 |
| 784 | Ga0495681_0088633 | 3300047470 | Bacteria | 1369 |
| 785 | Ga0495681_0115021 | 3300047470 | Bacteria | 1160 |
| 786 | Ga0495681_0134746 | 3300047470 | Bacteria | 1048 |
| 787 | Ga0495681_0219740 | 3300047470 | Bacteria | 762 |
| 788 | Ga0495684_0057302 | 3300047471 | Bacteria | 2969 |
| 789 | Ga0495686_0185947 | 3300047472 | Bacteria | 1200 |
| 790 | Ga0495593_0010740 | 3300047673 | Bacteria | 5279 |
| 791 | Ga0495593_0080546 | 3300047673 | Bacteria | 1684 |
| 792 | Ga0495593_0149994 | 3300047673 | Bacteria | 1179 |
| 793 | Ga0495593_0290405 | 3300047673 | Bacteria | 817 |
| 794 | Ga0495626_0000783 | 3300048091 | Bacteria | 28914 |
| 795 | Ga0495626_0005462 | 3300048091 | Bacteria | 7427 |
| 796 | Ga0495626_0024380 | 3300048091 | Bacteria | 2966 |
| 797 | Ga0495626_0041164 | 3300048091 | Bacteria | 2178 |
| 798 | Ga0495626_0068061 | 3300048091 | Bacteria | 1606 |
| 799 | Ga0495626_0119488 | 3300048091 | Bacteria | 1134 |
| 800 | Ga0496110_0158592 | 3300048913 | Bacteria | 2050 |
| 801 | Ga0496111_0065965 | 3300048914 | Bacteria | 2628 |
| 802 | Ga0496112_0402032 | 3300048915 | Bacteria | 1309 |
| 803 | Ga0496114_0005726 | 3300048917 | Bacteria | 9750 |
| 804 | Ga0496114_0432005 | 3300048917 | Bacteria | 1166 |
| 805 | Ga0496116_0004519 | 3300048919 | Bacteria | 13237 |
| 806 | Ga0496116_0009047 | 3300048919 | Bacteria | 8546 |
| 807 | Ga0496116_0019644 | 3300048919 | Bacteria | 5164 |
| 808 | Ga0496116_0077604 | 3300048919 | Bacteria | 2074 |
| 809 | Ga0496116_0212838 | 3300048919 | Bacteria | 999 |
| 810 | Ga0496117_0001531 | 3300048920 | Bacteria | 33002 |
| 811 | Ga0496117_0005978 | 3300048920 | Bacteria | 12544 |
| 812 | Ga0496117_0008162 | 3300048920 | Bacteria | 9999 |
| 813 | Ga0496117_0080786 | 3300048920 | Bacteria | 2136 |
| 814 | Ga0496117_0155439 | 3300048920 | Bacteria | 1347 |
| 815 | Ga0496118_0001596 | 3300048921 | Bacteria | 33532 |
| 816 | Ga0496118_0038456 | 3300048921 | Bacteria | 3835 |
| 817 | Ga0496118_0090108 | 3300048921 | Bacteria | 2114 |
| 818 | Ga0496118_0092729 | 3300048921 | Bacteria | 2071 |
| 819 | Ga0496118_0096639 | 3300048921 | Bacteria | 2012 |
| 820 | Ga0496118_0147727 | 3300048921 | Bacteria | 1476 |
| 821 | Ga0496118_0258940 | 3300048921 | Bacteria | 983 |
| 822 | Ga0496119_0001575 | 3300048922 | Bacteria | 27130 |
| 823 | Ga0496119_0204364 | 3300048922 | Bacteria | 1020 |
| 824 | Ga0496120_0002964 | 3300048923 | Bacteria | 16148 |
| 825 | Ga0496120_0023342 | 3300048923 | Bacteria | 3872 |
| 826 | Ga0496121_0007491 | 3300048924 | Bacteria | 13180 |
| 827 | Ga0496121_0015134 | 3300048924 | Bacteria | 8114 |
| 828 | Ga0496121_0051541 | 3300048924 | Bacteria | 3465 |
| 829 | Ga0496121_0082304 | 3300048924 | Bacteria | 2545 |
| 830 | Ga0496121_0163481 | 3300048924 | Bacteria | 1625 |
| 831 | Ga0496121_0206656 | 3300048924 | Bacteria | 1394 |
| 832 | Ga0496121_0227311 | 3300048924 | Bacteria | 1309 |
| 833 | Ga0496121_0315586 | 3300048924 | Bacteria | 1054 |
| 834 | Ga0496122_0000398 | 3300048925 | Bacteria | 92491 |
| 835 | Ga0496122_0002086 | 3300048925 | Bacteria | 29621 |
| 836 | Ga0496122_0015271 | 3300048925 | Bacteria | 7347 |
| 837 | Ga0496122_0023896 | 3300048925 | Bacteria | 5366 |
| 838 | Ga0496122_0294342 | 3300048925 | Bacteria | 879 |
| 839 | Ga0496122_0302998 | 3300048925 | Bacteria | 860 |
| 840 | Ga0496122_0322514 | 3300048925 | Bacteria | 820 |
| 841 | Ga0496123_0000178 | 3300048926 | Bacteria | 128587 |
| 842 | Ga0496123_0000302 | 3300048926 | Bacteria | 95750 |
| 843 | Ga0496123_0010583 | 3300048926 | Bacteria | 8121 |
| 844 | Ga0496123_0013707 | 3300048926 | Bacteria | 6779 |
| 845 | Ga0496123_0075956 | 3300048926 | Bacteria | 2070 |
| 846 | Ga0496123_0121074 | 3300048926 | Bacteria | 1472 |
| 847 | Ga0496123_0144328 | 3300048926 | Bacteria | 1295 |
| 848 | Ga0496124_0000073 | 3300048927 | Bacteria | 219306 |
| 849 | Ga0496124_0002969 | 3300048927 | Bacteria | 21267 |
| 850 | Ga0496124_0006941 | 3300048927 | Bacteria | 12169 |
| 851 | Ga0496124_0009601 | 3300048927 | Bacteria | 9919 |
| 852 | Ga0496124_0015975 | 3300048927 | Bacteria | 7164 |
| 853 | Ga0496124_0035061 | 3300048927 | Bacteria | 4393 |
| 854 | Ga0496124_0044228 | 3300048927 | Bacteria | 3822 |
| 855 | Ga0496124_0051784 | 3300048927 | Bacteria | 3491 |
| 856 | Ga0496124_0082749 | 3300048927 | Bacteria | 2634 |
| 857 | Ga0496124_0100389 | 3300048927 | Bacteria | 2346 |
| 858 | Ga0496124_0245801 | 3300048927 | Bacteria | 1327 |
| 859 | Ga0496124_0463390 | 3300048927 | Bacteria | 860 |
| 860 | Ga0496125_0009053 | 3300048928 | Bacteria | 10308 |
| 861 | Ga0496125_0011937 | 3300048928 | Bacteria | 8655 |
| 862 | Ga0496125_0015843 | 3300048928 | Bacteria | 7263 |
| 863 | Ga0496125_0059673 | 3300048928 | Bacteria | 3071 |
| 864 | Ga0496125_0084010 | 3300048928 | Bacteria | 2419 |
| 865 | Ga0496125_0116334 | 3300048928 | Bacteria | 1920 |
| 866 | Ga0496125_0198260 | 3300048928 | Bacteria | 1317 |
| 867 | Ga0496125_0254836 | 3300048928 | Bacteria | 1104 |
| 868 | Ga0496126_0026483 | 3300048929 | Bacteria | 5559 |
| 869 | Ga0496126_0037042 | 3300048929 | Bacteria | 4555 |
| 870 | Ga0496126_0064262 | 3300048929 | Bacteria | 3288 |
| 871 | Ga0495678_000325 | 3300049459 | Bacteria | 50656 |
| 872 | Ga0495678_000692 | 3300049459 | Bacteria | 30773 |
| 873 | Ga0495678_009187 | 3300049459 | Bacteria | 4918 |
| 874 | Ga0495678_009597 | 3300049459 | Bacteria | 4773 |
| 875 | Ga0495678_024369 | 3300049459 | Bacteria | 2613 |
| 876 | Ga0495678_029829 | 3300049459 | Bacteria | 2287 |
| 877 | Ga0495678_098792 | 3300049459 | Bacteria | 1014 |
| 878 | Ga0495678_101257 | 3300049459 | Bacteria | 997 |
| 879 | Ga0495678_105112 | 3300049459 | Bacteria | 972 |
| 880 | Ga0495678_118821 | 3300049459 | Bacteria | 890 |
| 881 | Ga0495682_0001120 | 3300049460 | Bacteria | 15578 |
| 882 | Ga0495682_0025393 | 3300049460 | Bacteria | 2205 |
| 883 | Ga0495682_0072043 | 3300049460 | Bacteria | 1243 |
| 884 | Ga0495682_0092891 | 3300049460 | Bacteria | 1083 |
| 885 | Ga0501034_0000143 | 3300049571 | Bacteria | 133317 |
| 886 | Ga0501257_049804 | 3300049686 | Bacteria | 1043 |
| 887 | Ga0501241_001729 | 3300049758 | Bacteria | 4340 |
| 888 | Ga0501226_000001 | 3300049853 | Bacteria | 432595 |
| 889 | nmdc:mga00v17_352525_c1 | 3300050491 | Bacteria | 957 |
| 890 | Ga0500618_053680 | 3300053125 | Bacteria | 910 |
| 891 | Ga0500659_0002144 | 3300053135 | Bacteria | 11999 |
| 892 | Ga0500573_0084370 | 3300053140 | Bacteria | 1802 |
| 893 | Ga0500577_0013072 | 3300053142 | Bacteria | 2526 |
| 894 | Ga0500586_140073 | 3300053145 | Bacteria | 832 |
| 895 | Ga0500634_0009844 | 3300053161 | Bacteria | 4860 |
| 896 | 2511254827 | 2511231004 | Bacteria | 6669789 |
| 897 | 2511266044 | 2511231006 | Bacteria | 6794709 |
| 898 | 2511273354 | 2511231007 | Bacteria | 6306603 |
| 899 | 2511275066 | 2511231008 | Bacteria | 6624100 |
| 900 | 2511288486 | 2511231010 | Bacteria | 6373152 |
| 901 | 2511304006 | 2511231012 | Bacteria | 6738011 |
| 902 | 2511311976 | 2511231014 | Bacteria | 6462302 |
| 903 | 2511323421 | 2511231015 | Bacteria | 6598026 |
| 904 | 2511327983 | 2511231016 | Bacteria | 6704427 |
| 905 | 2511329698 | 2511231017 | Bacteria | 6503007 |
| 906 | 2511335868 | 2511231018 | Bacteria | 6436256 |
| 907 | 2511344768 | 2511231019 | Bacteria | 6520662 |
| 908 | 2511349531 | 2511231020 | Bacteria | 6115223 |
| 909 | 2511365969 | 2511231022 | Bacteria | 6719296 |
| 910 | 2511369011 | 2511231023 | Bacteria | 6808468 |
| 911 | 2511412149 | 2511231031 | Bacteria | 6558529 |
| 912 | 2511827665 | 2511231156 | Bacteria | 6845832 |
| 913 | 2512326647 | 2512047018 | Bacteria | 6663241 |
| 914 | 2555672871 | 2554235341 | Bacteria | 6867980 |
| 915 | 2583795698 | 2582580891 | Bacteria | 6800976 |
| 916 | 2597860908 | 2597489887 | Bacteria | 6666321 |
| 917 | 2597866655 | 2597489888 | Bacteria | 6179543 |
| 918 | 2597872511 | 2597489889 | Bacteria | 6297495 |
| 919 | 2599327533 | 2599185155 | Bacteria | 5827168 |
| 920 | 2599355923 | 2599185160 | Bacteria | 6844013 |
| 921 | 2599362675 | 2599185161 | Bacteria | 6960462 |
| 922 | 2599369019 | 2599185162 | Bacteria | 6957254 |
| 923 | 2599375784 | 2599185163 | Bacteria | 6995158 |
| 924 | 2599381029 | 2599185164 | Bacteria | 6841688 |
| 925 | 2599387455 | 2599185165 | Bacteria | 6843250 |
| 926 | 2599394642 | 2599185166 | Bacteria | 6959206 |
| 927 | 2599400515 | 2599185167 | Bacteria | 6353609 |
| 928 | 2599406407 | 2599185168 | Bacteria | 6997636 |
| 929 | 2599449839 | 2599185179 | Bacteria | 6611171 |
| 930 | 2599462757 | 2599185181 | Bacteria | 6844519 |
| 931 | 2599467820 | 2599185182 | Bacteria | 6883168 |
| 932 | 2599485857 | 2599185185 | Bacteria | 6652270 |
| 933 | 2599491774 | 2599185186 | Bacteria | 6831633 |
| 934 | 2599500287 | 2599185188 | Bacteria | 6164180 |
| 935 | 2599505775 | 2599185189 | Bacteria | 5862825 |
| 936 | 2599511913 | 2599185190 | Bacteria | 6285678 |
| 937 | 2599516897 | 2599185191 | Bacteria | 6297582 |
| 938 | 2599614455 | 2599185212 | Bacteria | 6765997 |
| 939 | 2599768121 | 2599185248 | Bacteria | 6696816 |
| 940 | 2599804638 | 2599185257 | Bacteria | 6492581 |
| 941 | 2599879061 | 2599185288 | Bacteria | 6666191 |
| 942 | 2599885557 | 2599185289 | Bacteria | 6778765 |
| 943 | 2599892725 | 2599185290 | Bacteria | 6289611 |
| 944 | 2599897271 | 2599185291 | Bacteria | 6775623 |
| 945 | 2599930690 | 2599185300 | Bacteria | 6062622 |
| 946 | 2599942328 | 2599185302 | Bacteria | 5954930 |
| 947 | 2599951475 | 2599185303 | Bacteria | 6512725 |
| 948 | 2599954259 | 2599185304 | Bacteria | 5951361 |
| 949 | 2599961942 | 2599185305 | Bacteria | 6748700 |
| 950 | 2599965965 | 2599185306 | Bacteria | 6637356 |
| 951 | 2599972333 | 2599185307 | Bacteria | 6194719 |
| 952 | 2599977985 | 2599185308 | Bacteria | 6621546 |
| 953 | 2599982898 | 2599185309 | Bacteria | 5969593 |
| 954 | 2599988352 | 2599185310 | Bacteria | 6014457 |
| 955 | 2599994016 | 2599185311 | Bacteria | 6354990 |
| 956 | 2599999147 | 2599185312 | Bacteria | 5912071 |
| 957 | 2600004284 | 2599185313 | Bacteria | 6658188 |
| 958 | 2600012152 | 2599185314 | Bacteria | 6621749 |
| 959 | 2600020426 | 2599185315 | Bacteria | 6771107 |
| 960 | 2600026316 | 2599185316 | Bacteria | 6320029 |
| 961 | 2600032062 | 2599185317 | Bacteria | 6435722 |
| 962 | 2600035998 | 2599185318 | Bacteria | 6961590 |
| 963 | 2600042363 | 2599185319 | Bacteria | 6637840 |
| 964 | 2600046678 | 2599185320 | Bacteria | 5963263 |
| 965 | 2600054896 | 2599185321 | Bacteria | 6764560 |
| 966 | 2600061073 | 2599185322 | Bacteria | 6763055 |
| 967 | 2600066343 | 2599185323 | Bacteria | 6688755 |
| 968 | 2600071893 | 2599185324 | Bacteria | 6590677 |
| 969 | 2600076514 | 2599185325 | Bacteria | 6324919 |
| 970 | 2600215383 | 2599185356 | Bacteria | 6843884 |
| 971 | 2600358965 | 2600254930 | Bacteria | 6431253 |
| 972 | 2600363523 | 2600254931 | Bacteria | 6734225 |
| 973 | 2601627433 | 2600255283 | Bacteria | 6061572 |
| 974 | 2601693420 | 2600255296 | Bacteria | 5784754 |
| 975 | 2601775549 | 2600255313 | Bacteria | 6842543 |
| 976 | 2601798536 | 2600255318 | Bacteria | 6383414 |
| 977 | 2602008403 | 2600255389 | Bacteria | 5275336 |
| 978 | 2606077430 | 2603880185 | Bacteria | 6379190 |
| 979 | 2606129324 | 2603880199 | Bacteria | 6377649 |
| 980 | 2621296822 | 2619619299 | Bacteria | 6649820 |
| 981 | 2624483435 | 2623620443 | Bacteria | 6427864 |
| 982 | 2624494958 | 2623620446 | Bacteria | 6500345 |
| 983 | 2643842988 | 2643221565 | Bacteria | 6216018 |
| 984 | 2643872288 | 2643221571 | Bacteria | 6228673 |
| 985 | 2643955607 | 2643221589 | Bacteria | 6250934 |
| 986 | 2644020401 | 2643221602 | Bacteria | 6249926 |
| 987 | 2644184454 | 2643221633 | Bacteria | 6733554 |
| 988 | 2644283203 | 2643221650 | Bacteria | 7029547 |
| 989 | 2644620192 | 2643221713 | Bacteria | 6554480 |
| 990 | 2652547405 | 2651869719 | Bacteria | 6047974 |
| 991 | 2671089579 | 2667528170 | Bacteria | 6786960 |
| 992 | 2671099315 | 2667528171 | Bacteria | 6900659 |
| 993 | 2671128560 | 2667528176 | Bacteria | 6724917 |
| 994 | 2671771645 | 2671180172 | Bacteria | 6495783 |
| 995 | 2677897154 | 2675903420 | Bacteria | 6247433 |
| 996 | 2678266174 | 2675903515 | Bacteria | 6580491 |
| 997 | 2715749806 | 2713897148 | Bacteria | 5883533 |
| 998 | 2715754824 | 2713897149 | Bacteria | 6506249 |
| 999 | 2718636637 | 2718217725 | Bacteria | 5758958 |
| 1000 | 2723251391 | 2721755607 | Bacteria | 5841722 |
| 1001 | 2729146757 | 2728369097 | Bacteria | 4333476 |
| 1002 | 2738671642 | 2738541265 | Bacteria | 6594665 |
| 1003 | 2738750036 | 2738541282 | Bacteria | 6593925 |
| 1004 | 2738807277 | 2738541294 | Bacteria | 6925949 |
| 1005 | 2738859076 | 2738541303 | Bacteria | 6591772 |
| 1006 | 2738894637 | 2738541309 | Bacteria | 6926455 |
| 1007 | 2739199084 | 2738543004 | Bacteria | 6381073 |
| 1008 | 2739259026 | 2738543015 | Bacteria | 6750701 |
| 1009 | 2739288706 | 2738543020 | Bacteria | 5718238 |
| 1010 | 2739294018 | 2738543021 | Bacteria | 5718241 |
| 1011 | 2739312481 | 2738543025 | Bacteria | 6600348 |
| 1012 | 2743740448 | 2740892503 | Bacteria | 6855563 |
| 1013 | 2745007406 | 2744054620 | Bacteria | 6551379 |
| 1014 | 2774118352 | 2773857670 | Bacteria | 6407454 |
| 1015 | 2774135544 | 2773857673 | Bacteria | 6513460 |
| 1016 | 2784261794 | 2784132063 | Bacteria | 6262788 |
| 1017 | 2784313599 | 2784132072 | Bacteria | 6596533 |
| 1018 | 2794593815 | 2791355520 | Bacteria | 5948615 |
| 1019 | 2808855672 | 2808606361 | Bacteria | 6136259 |
| 1020 | 2808926533 | 2808606376 | Bacteria | 6248667 |
| 1021 | 2808928419 | 2808606377 | Bacteria | 6646337 |
| 1022 | 2808935491 | 2808606378 | Bacteria | 6177535 |
| 1023 | 2808939896 | 2808606379 | Bacteria | 5022697 |
| 1024 | 2808948694 | 2808606380 | Bacteria | 6248705 |
| 1025 | 2808950398 | 2808606381 | Bacteria | 6646461 |
| 1026 | 2808959817 | 2808606382 | Bacteria | 6841132 |
| 1027 | 2808964099 | 2808606383 | Bacteria | 6138645 |
| 1028 | 2808976173 | 2808606385 | Bacteria | 6711065 |
| 1029 | 2808994364 | 2808606388 | Bacteria | 6706662 |
| 1030 | 2808999065 | 2808606389 | Bacteria | 6138126 |
| 1031 | 2812369518 | 2811994881 | Bacteria | 6298475 |
| 1032 | 2817494065 | 2816332298 | Bacteria | 6852809 |
| 1033 | 2819655154 | 2818991456 | Bacteria | 6123676 |
| 1034 | 2819704437 | 2818991464 | Bacteria | 6907494 |
| 1035 | 2825655071 | 2825651385 | Bacteria | 6715909 |
| 1036 | 2826581876 | 2826581358 | Bacteria | 5963467 |
| 1037 | 2834030976 | 2834028612 | Bacteria | 6354979 |
| 1038 | 2842807979 | 2842805378 | Bacteria | 5385175 |
| 1039 | 2842816869 | 2842815866 | Bacteria | 5947510 |
| 1040 | 2842831262 | 2842826826 | Bacteria | 5974129 |
| 1041 | 2842833483 | 2842832357 | Bacteria | 5959113 |
| 1042 | 2842837924 | 2842837860 | Bacteria | 6066181 |
| 1043 | 2842845713 | 2842843487 | Bacteria | 6004777 |
| 1044 | 2842855646 | 2842854478 | Bacteria | 6143501 |
| 1045 | 2852616375 | 2852612431 | Bacteria | 6885235 |
| 1046 | 2852659700 | 2852657418 | Bacteria | 6472974 |
| 1047 | 2852671343 | 2852667396 | Bacteria | 6885555 |
| 1048 | 2878035377 | 2878029506 | Bacteria | 6418441 |
| 1049 | 2880236018 | 2880230671 | Bacteria | 6140320 |
| 1050 | 2904518935 | 2904518522 | Bacteria | 6068986 |
| 1051 | 2904551389 | 2904550169 | Bacteria | 6221258 |
| 1052 | 2908452608 | 2908446538 | Bacteria | 6829095 |
| 1053 | 2912968909 | 2912963787 | Bacteria | 5646108 |
| 1054 | 2913042554 | 2913036834 | Bacteria | 6704877 |
| 1055 | 2917076769 | 2917070673 | Bacteria | 6868303 |
| 1056 | 2919065493 | 2919063839 | Bacteria | 6302690 |
| 1057 | 2919155928 | 2919155634 | Bacteria | 4860545 |
| 1058 | 2919389166 | 2919385768 | Bacteria | 5897293 |
| 1059 | 2919457573 | 2919456309 | Bacteria | 6586567 |
| 1060 | 2919485681 | 2919481497 | Bacteria | 6907839 |
| 1061 | 2919488143 | 2919487758 | Bacteria | 5929766 |
| 1062 | 2919502487 | 2919501602 | Bacteria | 5286340 |
| 1063 | 2919700550 | 2919697872 | Bacteria | 6553725 |
| 1064 | 2923159541 | 2923153595 | Bacteria | 6870622 |
| 1065 | 2923523604 | 2923519811 | Bacteria | 6298479 |
| 1066 | 2923589024 | 2923586266 | Bacteria | 6565975 |
| 1067 | 2926064160 | 2926063275 | Bacteria | 5285848 |
| 1068 | 2929149944 | 2929144301 | Bacteria | 6622272 |
| 1069 | 2929195177 | 2929189879 | Bacteria | 5930554 |
| 1070 | 2931372615 | 2931369376 | Bacteria | 6847892 |
| 1071 | 2931396436 | 2931390751 | Bacteria | 6273349 |
| 1072 | 2931398104 | 2931396565 | Bacteria | 7251677 |
| 1073 | 2935358264 | 2935353572 | Unclassified | 6955622 |
| 1074 | 2939640780 | 2939636861 | Bacteria | 6297853 |
| 1075 | 2939656676 | 2939651529 | Bacteria | 5895393 |
| 1076 | 2945930887 | 2945928738 | Bacteria | 6053221 |
| 1077 | 2945966882 | 2945961074 | Bacteria | 7342064 |
| 1078 | 2946013259 | 2946006987 | Bacteria | 6705746 |
| 1079 | 2946027928 | 2946027586 | Bacteria | 6049274 |
| 1080 | 2947234448 | 2947233263 | Bacteria | 6439278 |
| 1081 | 2969310197 | 2969304461 | Bacteria | 6601805 |
| 1082 | 2974294056 | 2974289157 | Bacteria | 6080362 |
| 1083 | 2984286573 | 2984286254 | Bacteria | 6702062 |
| 1084 | 2988731484 | 2988728565 | Bacteria | 6124362 |
| 1085 | 2990197172 | 2990196909 | Bacteria | 4054280 |
| 1086 | 2998145421 | 2998139840 | Bacteria | 6073514 |
| 1087 | 3007399374 | 3007395558 | Bacteria | 6755444 |
| 1088 | 3007425753 | 3007419365 | Bacteria | 7026924 |
| 1089 | 3007517206 | 3007511990 | Bacteria | 6481491 |
| 1090 | 3007618881 | 3007614139 | Bacteria | 6053559 |
| 1091 | 3007620708 | 3007619802 | Bacteria | 6411688 |
| 1092 | 3007721781 | 3007718800 | Bacteria | 5971527 |
| 1093 | 3007859216 | 3007855910 | Bacteria | 5637581 |
| 1094 | 3007865080 | 3007861166 | Bacteria | 6045338 |
| 1095 | 3007866756 | 3007866637 | Bacteria | 5899198 |
| 1096 | 640490015 | 640427133 | Bacteria | 4567418 |
| 1097 | 651178096 | 651053060 | Bacteria | 4689946 |
| 1098 | 8011351039 | 8011350971 | Bacteria | 6158957 |
| 1099 | 8015693639 | 8015687852 | Bacteria | 6613826 |
| 1100 | 8019769733 | 8019769354 | Bacteria | 6924660 |
| 1101 | 8019777657 | 8019775933 | Bacteria | 6858656 |
| 1102 | 8029995481 | 8029995093 | Bacteria | 5990776 |
| 1103 | 8034965069 | 8034962539 | Bacteria | 4884839 |
| 1104 | 8052494820 | 8052494512 | Bacteria | 5765634 |
| 1105 | 8054285701 | 8054285046 | Bacteria | 6919322 |
| 1106 | 8054349559 | 8054347763 | Bacteria | 5901107 |
| 1107 | 8054508959 | 8054503363 | Bacteria | 6101651 |
| 1108 | 8055776886 | 8055770955 | Bacteria | 6827675 |
| 1109 | 8055823930 | 8055817908 | Bacteria | 6609162 |
| 1110 | 8055880747 | 8055878733 | Bacteria | 5907058 |
| 1111 | 8056120930 | 8056120720 | Bacteria | 5758328 |
| 1112 | 8056131632 | 8056125926 | Bacteria | 6228218 |
| 1113 | 8056137334 | 8056131705 | Bacteria | 6107031 |
| 1114 | 8056148795 | 8056143049 | Bacteria | 6307666 |
| 1115 | 8056151470 | 8056148874 | Bacteria | 6479865 |
| 1116 | 8056159729 | 8056155041 | Bacteria | 6486948 |
| 1117 | 8056163655 | 8056161164 | Bacteria | 6106669 |
| 1118 | 8056171284 | 8056166840 | Bacteria | 5820959 |
| 1119 | 8056177384 | 8056172158 | Bacteria | 6133900 |
| 1120 | 8056182024 | 8056177738 | Bacteria | 6748268 |
| 1121 | 8056570488 | 8056569372 | Bacteria | 5997322 |
| 1122 | Ga0439466_0004233 | |||
| 1123 | MRS2a_Contig_718 | |||
| 1124 | SwRhRL2b_contig_161795 | |||
| 1125 | JGI25162J39368_1001123 | |||
| 1126 | JGI25154J39366_1008844 | |||
| 1127 | JGI25163J39215_1000851 | |||
| 1128 | JGI25164J39214_1000593 | |||
| 1129 | JGI25164J39214_1000683 | |||
| 1130 | JGI25165J46597_1001173 | |||
| 1131 | JGI25165J46597_1001371 | |||
| 1132 | Ga0055538_1000032 | |||
| 1133 | Ga0055539_1000043 | |||
| 1134 | Ga0055533_1000052 | |||
| 1135 | Ga0055532_1000047 | |||
| 1136 | Ga0055525_1000062 | |||
| 1137 | Ga0055525_1007718 | |||
| 1138 | Ga0055535_1005441 | |||
| 1139 | Ga0055536_1001844 | |||
| 1140 | Ga0055536_1004928 | |||
| 1141 | Ga0055536_1005802 | |||
| 1142 | Ga0055536_1014573 | |||
| 1143 | Ga0055536_1066533 | |||
| 1144 | Ga0055530_10001310 | |||
| 1145 | Ga0055530_10001782 | |||
| 1146 | Ga0055530_10002801 | |||
| 1147 | Ga0055540_1000960 | |||
| 1148 | Ga0055540_1001320 | |||
| 1149 | Ga0055540_1002155 | |||
| 1150 | Ga0055531_10000404 | |||
| 1151 | Ga0055531_10000483 | |||
| 1152 | Ga0055541_1000030 | |||
| 1153 | Ga0065714_10000055 | |||
| 1154 | Ga0065714_10002460 | |||
| 1155 | Ga0065714_10014268 | |||
| 1156 | Ga0065714_10091252 | |||
| 1157 | Ga0065714_10138216 | |||
| 1158 | Ga0065714_10182728 | |||
| 1159 | Ga0065714_10192388 | |||
| 1160 | Ga0065704_10070757 | |||
| 1161 | Ga0065704_10162785 | |||
| 1162 | Ga0065712_10005777 | |||
| 1163 | Ga0065712_10134151 | |||
| 1164 | Ga0070676_10101728 | |||
| 1165 | Ga0070670_100634682 | |||
| 1166 | Ga0070670_100641333 | |||
| 1167 | Ga0070660_100203528 | |||
| 1168 | Ga0070669_100012886 | |||
| 1169 | Ga0070662_100000101 | |||
| 1170 | Ga0070662_100004142 | |||
| 1171 | Ga0070665_100079093 | |||
| 1172 | Ga0070665_100447967 | |||
| 1173 | Ga0070665_100943068 | |||
| 1174 | Ga0070664_100001357 | |||
| 1175 | Ga0070664_100901955 | |||
| 1176 | Ga0068854_100000622 | |||
| 1177 | Ga0068851_10000007 | |||
| 1178 | Ga0075364_10204207 | |||
| 1179 | Ga0075432_10018293 | |||
| 1180 | Ga0075432_10043859 | |||
| 1181 | Ga0075432_10081572 | |||
| 1182 | Ga0075362_10197469 | |||
| 1183 | Ga0075369_10047689 | |||
| 1184 | Ga0075436_100068775 | |||
| 1185 | Ga0099823_1001854 | |||
| 1186 | Ga0079104_1000424 | |||
| 1187 | Ga0099826_10121352 | |||
| 1188 | Ga0105251_10000009 | |||
| 1189 | Ga0105251_10001765 | |||
| 1190 | Ga0105251_10004948 | |||
| 1191 | Ga0105251_10022693 | |||
| 1192 | Ga0105251_10024812 | |||
| 1193 | Ga0105251_10138009 | |||
| 1194 | Ga0105251_10189540 | |||
| 1195 | Ga0105251_10298735 | |||
| 1196 | Ga0105244_10001453 | |||
| 1197 | Ga0105244_10009780 | |||
| 1198 | Ga0105244_10034436 | |||
| 1199 | Ga0105244_10082557 | |||
| 1200 | Ga0105244_10084012 | |||
| 1201 | Ga0105244_10147001 | |||
| 1202 | Ga0105244_10163344 | |||
| 1203 | Ga0105244_10167813 | |||
| 1204 | Ga0105244_10173634 | |||
| 1205 | Ga0105244_10224399 | |||
| 1206 | Ga0105244_10225852 | |||
| 1207 | Ga0105244_10233955 | |||
| 1208 | Ga0105250_10000981 | |||
| 1209 | Ga0105250_10001636 | |||
| 1210 | Ga0105250_10003448 | |||
| 1211 | Ga0105250_10023864 | |||
| 1212 | Ga0105250_10026458 | |||
| 1213 | Ga0105250_10050855 | |||
| 1214 | Ga0105250_10059707 | |||
| 1215 | Ga0105250_10086868 | |||
| 1216 | Ga0105250_10124664 | |||
| 1217 | Ga0105250_10141591 | |||
| 1218 | Ga0105250_10181982 | |||
| 1219 | Ga0105243_10005105 | |||
| 1220 | Ga0105243_10007458 | |||
| 1221 | Ga0105243_10071746 | |||
| 1222 | Ga0105243_10095656 | |||
| 1223 | Ga0105237_10003007 | |||
| 1224 | Ga0105237_10322881 | |||
| 1225 | Ga0105238_10851491 | |||
| 1226 | Ga0105249_10030735 | |||
| 1227 | Ga0105246_10003490 | |||
| 1228 | Ga0105246_10021361 | |||
| 1229 | Ga0105246_10344282 | |||
| 1230 | Ga0105246_10603161 | |||
| 1231 | Ga0157345_1000031 | |||
| 1232 | Ga0157373_10004112 | |||
| 1233 | Ga0157373_10010865 | |||
| 1234 | Ga0157373_10057696 | |||
| 1235 | Ga0157373_10084616 | |||
| 1236 | Ga0157373_10130294 | |||
| 1237 | Ga0157373_10203738 | |||
| 1238 | Ga0157373_10432176 | |||
| 1239 | Ga0157371_10000039 | |||
| 1240 | Ga0157371_10003709 | |||
| 1241 | Ga0157371_10187850 | |||
| 1242 | Ga0157371_10479631 | |||
| 1243 | Ga0157370_10000698 | |||
| 1244 | Ga0157370_10027157 | |||
| 1245 | Ga0157370_10201559 | |||
| 1246 | Ga0157370_10229481 | |||
| 1247 | Ga0157370_10437336 | |||
| 1248 | Ga0157370_10521352 | |||
| 1249 | Ga0157369_10522253 | |||
| 1250 | Ga0157369_10880321 | |||
| 1251 | Ga0163162_10000591 | |||
| 1252 | Ga0163162_10623210 | |||
| 1253 | Ga0163162_10686186 | |||
| 1254 | Ga0163162_10858521 | |||
| 1255 | Ga0157372_10003012 | |||
| 1256 | Ga0157372_10082770 | |||
| 1257 | Ga0157372_10232559 | |||
| 1258 | Ga0157375_10013258 | |||
| 1259 | Ga0157375_11471119 | |||
| 1260 | Ga0182008_10002828 | |||
| 1261 | Ga0182008_10005751 | |||
| 1262 | Ga0182008_10042782 | |||
| 1263 | Ga0182008_10199641 | |||
| 1264 | Ga0182008_10205642 | |||
| 1265 | Ga0182008_10259326 | |||
| 1266 | Ga0182006_1004316 | |||
| 1267 | Ga0182006_1004328 | |||
| 1268 | Ga0182006_1022719 | |||
| 1269 | Ga0182006_1096404 | |||
| 1270 | Ga0182006_1099482 | |||
| 1271 | Ga0182006_1129371 | |||
| 1272 | Ga0182007_10003731 | |||
| 1273 | Ga0182005_1012359 | |||
| 1274 | Ga0182005_1049830 | |||
| 1275 | Ga0182005_1066671 | |||
| 1276 | Ga0182005_1077440 | |||
| 1277 | Ga0182005_1106917 | |||
| 1278 | Ga0182005_1111437 | |||
| 1279 | Ga0163161_10063034 | |||
| 1280 | Ga0163161_10081806 | |||
| 1281 | Ga0163161_10193053 | |||
| 1282 | Ga0163161_10407145 | |||
| 1283 | Ga0163161_10526570 | |||
| 1284 | Ga0163161_10528683 | |||
| 1285 | Ga0163161_10623789 | |||
| 1286 | Ga0163161_10682889 | |||
| 1287 | Ga0209435_100567 | |||
| 1288 | Ga0209760_100027 | |||
| 1289 | Ga0209784_100007 | |||
| 1290 | Ga0209566_100009 | |||
| 1291 | Ga0209674_100021 | |||
| 1292 | Ga0209147_100009 | |||
| 1293 | Ga0209563_100018 | |||
| 1294 | Ga0209563_100496 | |||
| 1295 | Ga0207427_100006 | |||
| 1296 | Ga0209437_100013 | |||
| 1297 | Ga0209258_100169 | |||
| 1298 | Ga0209646_1000184 | |||
| 1299 | Ga0209677_100012 | |||
| 1300 | Ga0209759_1002680 | |||
| 1301 | Ga0209759_1006804 | |||
| 1302 | Ga0209233_1000022 | |||
| 1303 | Ga0209675_1000989 | |||
| 1304 | Ga0209676_1000015 | |||
| 1305 | Ga0209676_1000030 | |||
| 1306 | Ga0209676_1000041 | |||
| 1307 | Ga0209676_1001202 | |||
| 1308 | Ga0209676_1001662 | |||
| 1309 | Ga0209050_1000024 | |||
| 1310 | Ga0209050_1000030 | |||
| 1311 | Ga0209050_1002563 | |||
| 1312 | Ga0209050_1070810 | |||
| 1313 | Ga0209051_1000012 | |||
| 1314 | Ga0209051_1000023 | |||
| 1315 | Ga0209051_1001294 | |||
| 1316 | Ga0209051_1045388 | |||
| 1317 | Ga0209257_1004425 | |||
| 1318 | Ga0207656_10000006 | |||
| 1319 | Ga0207696_1000020 | |||
| 1320 | Ga0207696_1000031 | |||
| 1321 | Ga0207696_1000357 | |||
| 1322 | Ga0207696_1002203 | |||
| 1323 | Ga0207696_1004533 | |||
| 1324 | Ga0207696_1010677 | |||
| 1325 | Ga0207696_1015406 | |||
| 1326 | Ga0207696_1068712 | |||
| 1327 | Ga0207655_1000033 | |||
| 1328 | Ga0207655_1000202 | |||
| 1329 | Ga0207655_1000388 | |||
| 1330 | Ga0207655_1000740 | |||
| 1331 | Ga0207655_1001122 | |||
| 1332 | Ga0207655_1003253 | |||
| 1333 | Ga0207655_1008819 | |||
| 1334 | Ga0207655_1010284 | |||
| 1335 | Ga0207655_1011686 | |||
| 1336 | Ga0207655_1012207 | |||
| 1337 | Ga0207655_1012984 | |||
| 1338 | Ga0207655_1054888 | |||
| 1339 | Ga0207655_1063083 | |||
| 1340 | Ga0207655_1095770 | |||
| 1341 | Ga0207655_1104868 | |||
| 1342 | Ga0207713_1000032 | |||
| 1343 | Ga0207713_1000079 | |||
| 1344 | Ga0207713_1000659 | |||
| 1345 | Ga0207713_1000817 | |||
| 1346 | Ga0207713_1001352 | |||
| 1347 | Ga0207713_1001441 | |||
| 1348 | Ga0207713_1001720 | |||
| 1349 | Ga0207713_1002171 | |||
| 1350 | Ga0207713_1006631 | |||
| 1351 | Ga0207713_1015407 | |||
| 1352 | Ga0207713_1021631 | |||
| 1353 | Ga0207713_1025828 | |||
| 1354 | Ga0207713_1033932 | |||
| 1355 | Ga0207671_10000131 | |||
| 1356 | Ga0207649_10000012 | |||
| 1357 | Ga0207681_10000099 | |||
| 1358 | Ga0207650_10000564 | |||
| 1359 | Ga0207650_10551593 | |||
| 1360 | Ga0207706_10000580 | |||
| 1361 | Ga0207706_10001804 | |||
| 1362 | Ga0207686_10001491 | |||
| 1363 | Ga0207709_10000248 | |||
| 1364 | Ga0207709_10002118 | |||
| 1365 | Ga0207709_10357584 | |||
| 1366 | Ga0207709_10597052 | |||
| 1367 | Ga0207679_10000015 | |||
| 1368 | Ga0207640_10005871 | |||
| 1369 | Ga0207639_10000286 | |||
| 1370 | Ga0207674_10156707 | |||
| 1371 | Ga0209281_1000016 | |||
| 1372 | Ga0209281_1000019 | |||
| 1373 | Ga0209281_1003717 | |||
| 1374 | Ga0209389_1000017 | |||
| 1375 | Ga0209969_1007700 | |||
| 1376 | Ga0209981_1014325 | |||
| 1377 | Ga0209981_1042174 | |||
| 1378 | Ga0209995_1028086 | |||
| 1379 | Ga0209968_1015559 | |||
| 1380 | Ga0209982_1003756 | |||
| 1381 | Ga0209983_1001665 | |||
| 1382 | Ga0209282_1101649 | |||
| 1383 | Ga0209971_1001664 | |||
| 1384 | Ga0209974_10062237 | |||
| 1385 | Ga0207428_10016610 | |||
| 1386 | Ga0207428_10048306 | |||
| 1387 | Ga0207428_10137020 | |||
| 1388 | Ga0207428_10165605 | |||
| 1389 | Ga0207428_10287698 | |||
| 1390 | Ga0207428_10298391 | |||
| 1391 | Ga0207428_10299708 | |||
| 1392 | Ga0268266_10017876 | |||
| 1393 | Ga0268266_10478876 | |||
| 1394 | Ga0268266_11153684 | |||
| 1395 | Ga0307517_10153724 | |||
| 1396 | Ga0307511_10070889 | |||
| 1397 | Ga0307511_10151688 | |||
| 1398 | Ga0307511_10183664 | |||
| 1399 | Ga0314311_1104385 | |||
| 1400 | Ga0316179_1036317 | |||
| 1401 | Ga0316178_1008333 | |||
| 1402 | Ga0316183_1004754 | |||
| 1403 | Ga0316181_1288553 | |||
| 1404 | Ga0265316_10269923 | |||
| 1405 | Ga0307408_100005271 | |||
| 1406 | Ga0307408_100008555 | |||
| 1407 | Ga0307408_100103715 | |||
| 1408 | Ga0307408_100693438 | |||
| 1409 | Ga0307408_100842006 | |||
| 1410 | Ga0307405_10003779 | |||
| 1411 | Ga0307405_10004147 | |||
| 1412 | Ga0307405_10064288 | |||
| 1413 | Ga0307405_10607513 | |||
| 1414 | Ga0307405_10794221 | |||
| 1415 | Ga0307413_10094356 | |||
| 1416 | Ga0307413_10154103 | |||
| 1417 | Ga0307413_10726668 | |||
| 1418 | Ga0307410_10438158 | |||
| 1419 | Ga0307410_10540971 | |||
| 1420 | Ga0307406_10689935 | |||
| 1421 | Ga0307407_10447050 | |||
| 1422 | Ga0307412_10006197 | |||
| 1423 | Ga0307412_10465829 | |||
| 1424 | Ga0307412_10519535 | |||
| 1425 | Ga0307412_10909961 | |||
| 1426 | Ga0307409_100344684 | |||
| 1427 | Ga0307409_100602868 | |||
| 1428 | Ga0307414_10002861 | |||
| 1429 | Ga0307414_10122898 | |||
| 1430 | Ga0307414_10156416 | |||
| 1431 | Ga0307414_10432860 | |||
| 1432 | Ga0307414_10597130 | |||
| 1433 | Ga0307414_10798460 | |||
| 1434 | Ga0307411_10007691 | |||
| 1435 | Ga0307411_10628882 | |||
| 1436 | Ga0307510_10349447 | |||
| 1437 | Ga0237819_01191 | |||
| 1438 | Ga0439438_000209 | |||
| 1439 | Ga0439438_012727 | |||
| 1440 | Ga0439438_015936 | |||
| 1441 | Ga0439438_016124 | |||
| 1442 | Ga0439438_016870 | |||
| 1443 | Ga0439438_016916 | |||
| 1444 | Ga0439438_017934 | |||
| 1445 | Ga0439438_030726 | |||
| 1446 | Ga0439438_063821 | |||
| 1447 | Ga0439447_001101 | |||
| 1448 | Ga0439447_012357 | |||
| 1449 | Ga0439447_021405 | |||
| 1450 | Ga0439447_023721 | |||
| 1451 | Ga0439447_036701 | |||
| 1452 | Ga0439461_0081573 | |||
| 1453 | Ga0439466_0002901 | |||
| 1454 | Ga0439466_0008382 | |||
| 1455 | Ga0439466_0023219 | |||
| 1456 | Ga0439466_0052913 | |||
| 1457 | Ga0439466_0054140 | |||
| 1458 | Ga0439466_0078341 | |||
| 1459 | Ga0439466_0108165 | |||
| 1460 | Ga0439465_0061146 | |||
| 1461 | Ga0451807_1222440 | |||
| 1462 | Ga0439431_0061360 | |||
| 1463 | Ga0439445_0032612 | |||
| 1464 | Ga0439432_000624 | |||
| 1465 | Ga0439432_000891 | |||
| 1466 | Ga0439432_001206 | |||
| 1467 | Ga0439432_017152 | |||
| 1468 | Ga0439432_020886 | |||
| 1469 | Ga0439432_022277 | |||
| 1470 | Ga0439432_034740 | |||
| 1471 | Ga0439432_091089 | |||
| 1472 | Ga0439451_008479 | |||
| 1473 | Ga0439451_030542 | |||
| 1474 | Ga0439452_007339 | |||
| 1475 | Ga0439452_010715 | |||
| 1476 | Ga0439452_011277 | |||
| 1477 | Ga0439452_013405 | |||
| 1478 | Ga0439452_015833 | |||
| 1479 | Ga0439452_017966 | |||
| 1480 | Ga0439452_028064 | |||
| 1481 | Ga0439452_041491 | |||
| 1482 | Ga0439452_059049 | |||
| 1483 | Ga0439456_000869 | |||
| 1484 | Ga0439456_001655 | |||
| 1485 | Ga0439456_016370 | |||
| 1486 | Ga0439456_023406 | |||
| 1487 | Ga0439463_000040 | |||
| 1488 | Ga0439463_001722 | |||
| 1489 | Ga0439463_019203 | |||
| 1490 | Ga0439463_025124 | |||
| 1491 | Ga0439463_042538 | |||
| 1492 | Ga0439463_063179 | |||
| 1493 | Ga0439463_065752 | |||
| 1494 | Ga0439463_088081 | |||
| 1495 | Ga0450911_004396 | |||
| 1496 | Ga0450911_006640 | |||
| 1497 | Ga0450917_003063 | |||
| 1498 | Ga0450919_002904 | |||
| 1499 | Ga0450920_006650 | |||
| 1500 | Ga0450922_001332 | |||
| 1501 | Ga0450923_009887 | |||
| 1502 | Ga0450890_000276 | |||
| 1503 | Ga0450891_010271 | |||
| 1504 | Ga0450892_002627 | |||
| 1505 | Ga0450902_000025 | |||
| 1506 | Ga0450902_011566 | |||
| 1507 | Ga0450902_012022 | |||
| 1508 | Ga0450902_020343 | |||
| 1509 | Ga0450903_000888 | |||
| 1510 | Ga0450903_005114 | |||
| 1511 | Ga0450903_008281 | |||
| 1512 | Ga0450903_010641 | |||
| 1513 | Ga0450904_000070 | |||
| 1514 | Ga0450904_009766 | |||
| 1515 | Ga0450905_000013 | |||
| 1516 | Ga0450906_005538 | |||
| 1517 | Ga0450906_007871 | |||
| 1518 | Ga0450906_017450 | |||
| 1519 | Ga0450907_000886 | |||
| 1520 | Ga0450907_003896 | |||
| 1521 | Ga0450907_010066 | |||
| 1522 | Ga0450910_009274 | |||
| 1523 | Ga0439446_0000025 | |||
| 1524 | Ga0439446_0004646 | |||
| 1525 | Ga0439446_0007666 | |||
| 1526 | Ga0439446_0009996 | |||
| 1527 | Ga0439446_0070386 | |||
| 1528 | Ga0450908_005360 | |||
| 1529 | Ga0450908_015101 | |||
| 1530 | Ga0450909_008860 | |||
| 1531 | Ga0439434_0004198 | |||
| 1532 | Ga0439434_0012865 | |||
| 1533 | Ga0439464_0001247 | |||
| 1534 | Ga0439464_0035486 | |||
| 1535 | Ga0439460_0000852 | |||
| 1536 | Ga0439460_0008496 | |||
| 1537 | Ga0439460_0012014 | |||
| 1538 | Ga0450916_000038 | |||
| 1539 | Ga0450918_009504 | |||
| 1540 | Ga0450893_0007920 | |||
| 1541 | Ga0450901_000048 | |||
| 1542 | Ga0439440_0009943 | |||
| 1543 | Ga0439440_0032157 | |||
| 1544 | Ga0495617_002358 | |||
| 1545 | Ga0495617_015696 | |||
| 1546 | Ga0495617_022214 | |||
| 1547 | Ga0495617_024135 | |||
| 1548 | Ga0495617_033181 | |||
| 1549 | Ga0495617_055831 | |||
| 1550 | Ga0495617_085540 | |||
| 1551 | Ga0495627_000240 | |||
| 1552 | Ga0495627_023259 | |||
| 1553 | Ga0495627_027522 | |||
| 1554 | Ga0495627_054275 | |||
| 1555 | Ga0495627_149580 | |||
| 1556 | Ga0495603_0059308 | |||
| 1557 | Ga0495603_0165944 | |||
| 1558 | Ga0495590_0002766 | |||
| 1559 | Ga0495590_0029825 | |||
| 1560 | Ga0495590_0069397 | |||
| 1561 | Ga0495590_0083238 | |||
| 1562 | Ga0495591_000113 | |||
| 1563 | Ga0495591_004557 | |||
| 1564 | Ga0495591_012333 | |||
| 1565 | Ga0495591_022831 | |||
| 1566 | Ga0495591_023760 | |||
| 1567 | Ga0495591_035354 | |||
| 1568 | Ga0495591_035540 | |||
| 1569 | Ga0495638_0055504 | |||
| 1570 | Ga0495638_0080407 | |||
| 1571 | Ga0495638_0178236 | |||
| 1572 | Ga0495638_0188024 | |||
| 1573 | Ga0495638_0196986 | |||
| 1574 | Ga0495638_0205675 | |||
| 1575 | Ga0495638_0292096 | |||
| 1576 | Ga0495653_0001669 | |||
| 1577 | Ga0495653_0012018 | |||
| 1578 | Ga0495653_0115551 | |||
| 1579 | Ga0495650_0006917 | |||
| 1580 | Ga0495650_0008400 | |||
| 1581 | Ga0495650_0008780 | |||
| 1582 | Ga0495650_0013739 | |||
| 1583 | Ga0495650_0038471 | |||
| 1584 | Ga0495650_0105120 | |||
| 1585 | Ga0495650_0109138 | |||
| 1586 | Ga0495582_0005176 | |||
| 1587 | Ga0495605_0000122 | |||
| 1588 | Ga0495605_0008842 | |||
| 1589 | Ga0495605_0009980 | |||
| 1590 | Ga0495605_0011141 | |||
| 1591 | Ga0495605_0033186 | |||
| 1592 | Ga0495605_0042881 | |||
| 1593 | Ga0495605_0053116 | |||
| 1594 | Ga0495605_0069972 | |||
| 1595 | Ga0495605_0088608 | |||
| 1596 | Ga0495605_0209245 | |||
| 1597 | Ga0495639_0002876 | |||
| 1598 | Ga0495639_0006199 | |||
| 1599 | Ga0495584_0022861 | |||
| 1600 | Ga0495584_0032656 | |||
| 1601 | Ga0495584_0034962 | |||
| 1602 | Ga0495584_0044524 | |||
| 1603 | Ga0495584_0176287 | |||
| 1604 | Ga0495584_0216165 | |||
| 1605 | Ga0495585_0011036 | |||
| 1606 | Ga0495585_0048377 | |||
| 1607 | Ga0495585_0050496 | |||
| 1608 | Ga0495585_0051093 | |||
| 1609 | Ga0495585_0153652 | |||
| 1610 | Ga0495594_0000760 | |||
| 1611 | Ga0495596_0137788 | |||
| 1612 | Ga0495596_0162795 | |||
| 1613 | Ga0495607_0000478 | |||
| 1614 | Ga0495607_0000778 | |||
| 1615 | Ga0495607_0001277 | |||
| 1616 | Ga0495607_0002257 | |||
| 1617 | Ga0495607_0007199 | |||
| 1618 | Ga0495607_0008693 | |||
| 1619 | Ga0495607_0017458 | |||
| 1620 | Ga0495607_0034176 | |||
| 1621 | Ga0495607_0039928 | |||
| 1622 | Ga0495607_0047267 | |||
| 1623 | Ga0495607_0059808 | |||
| 1624 | Ga0495607_0065103 | |||
| 1625 | Ga0495607_0114392 | |||
| 1626 | Ga0495607_0143474 | |||
| 1627 | Ga0495607_0149383 | |||
| 1628 | Ga0495607_0208027 | |||
| 1629 | Ga0495583_0000174 | |||
| 1630 | Ga0495583_0006222 | |||
| 1631 | Ga0495583_0006464 | |||
| 1632 | Ga0495583_0010507 | |||
| 1633 | Ga0495583_0012972 | |||
| 1634 | Ga0495583_0107964 | |||
| 1635 | Ga0495606_0002681 | |||
| 1636 | Ga0495606_0007809 | |||
| 1637 | Ga0495606_0016882 | |||
| 1638 | Ga0495606_0056490 | |||
| 1639 | Ga0495606_0070273 | |||
| 1640 | Ga0495606_0104356 | |||
| 1641 | Ga0495606_0144161 | |||
| 1642 | Ga0495606_0241656 | |||
| 1643 | Ga0495610_0005689 | |||
| 1644 | Ga0495610_0019337 | |||
| 1645 | Ga0495610_0053195 | |||
| 1646 | Ga0495610_0091854 | |||
| 1647 | Ga0495610_0107221 | |||
| 1648 | Ga0495610_0131059 | |||
| 1649 | Ga0495610_0131362 | |||
| 1650 | Ga0495610_0176321 | |||
| 1651 | Ga0495616_0005700 | |||
| 1652 | Ga0495616_0037105 | |||
| 1653 | Ga0495616_0038138 | |||
| 1654 | Ga0495616_0051797 | |||
| 1655 | Ga0495616_0058052 | |||
| 1656 | Ga0495620_0000416 | |||
| 1657 | Ga0495620_0002395 | |||
| 1658 | Ga0495620_0003579 | |||
| 1659 | Ga0495620_0006189 | |||
| 1660 | Ga0495620_0016757 | |||
| 1661 | Ga0495620_0036081 | |||
| 1662 | Ga0495620_0053282 | |||
| 1663 | Ga0495620_0101069 | |||
| 1664 | Ga0495628_0098203 | |||
| 1665 | Ga0495630_0025282 | |||
| 1666 | Ga0495630_0036230 | |||
| 1667 | Ga0495630_0049044 | |||
| 1668 | Ga0495631_0001646 | |||
| 1669 | Ga0495631_0006612 | |||
| 1670 | Ga0495631_0019434 | |||
| 1671 | Ga0495631_0027595 | |||
| 1672 | Ga0495631_0036736 | |||
| 1673 | Ga0495631_0040362 | |||
| 1674 | Ga0495631_0108159 | |||
| 1675 | Ga0495632_0012473 | |||
| 1676 | Ga0495632_0041205 | |||
| 1677 | Ga0495632_0046692 | |||
| 1678 | Ga0495632_0050015 | |||
| 1679 | Ga0495632_0054902 | |||
| 1680 | Ga0495632_0111427 | |||
| 1681 | Ga0495637_0003284 | |||
| 1682 | Ga0495637_0021261 | |||
| 1683 | Ga0495637_0025002 | |||
| 1684 | Ga0495637_0026501 | |||
| 1685 | Ga0495637_0028895 | |||
| 1686 | Ga0495637_0031158 | |||
| 1687 | Ga0495637_0032530 | |||
| 1688 | Ga0495637_0043560 | |||
| 1689 | Ga0495637_0045404 | |||
| 1690 | Ga0495637_0118315 | |||
| 1691 | Ga0495637_0123030 | |||
| 1692 | Ga0495637_0128900 | |||
| 1693 | Ga0495637_0162633 | |||
| 1694 | Ga0495643_0001185 | |||
| 1695 | Ga0495643_0001285 | |||
| 1696 | Ga0495643_0007601 | |||
| 1697 | Ga0495643_0054869 | |||
| 1698 | Ga0495643_0064573 | |||
| 1699 | Ga0495643_0086273 | |||
| 1700 | Ga0495643_0143064 | |||
| 1701 | Ga0495648_0004462 | |||
| 1702 | Ga0495648_0039772 | |||
| 1703 | Ga0495648_0048788 | |||
| 1704 | Ga0495648_0055438 | |||
| 1705 | Ga0495648_0059157 | |||
| 1706 | Ga0495648_0062578 | |||
| 1707 | Ga0495648_0068696 | |||
| 1708 | Ga0495648_0137095 | |||
| 1709 | Ga0495648_0181991 | |||
| 1710 | Ga0495648_0182542 | |||
| 1711 | Ga0495648_0203960 | |||
| 1712 | Ga0495666_0004665 | |||
| 1713 | Ga0495666_0037368 | |||
| 1714 | Ga0495666_0092574 | |||
| 1715 | Ga0495642_0018992 | |||
| 1716 | Ga0495642_0024333 | |||
| 1717 | Ga0495642_0026052 | |||
| 1718 | Ga0495652_0034352 | |||
| 1719 | Ga0495654_0005080 | |||
| 1720 | Ga0495654_0005459 | |||
| 1721 | Ga0495654_0005992 | |||
| 1722 | Ga0495654_0009976 | |||
| 1723 | Ga0495654_0026347 | |||
| 1724 | Ga0495654_0030895 | |||
| 1725 | Ga0495654_0032736 | |||
| 1726 | Ga0495654_0033359 | |||
| 1727 | Ga0495654_0045024 | |||
| 1728 | Ga0495654_0047030 | |||
| 1729 | Ga0495654_0101697 | |||
| 1730 | Ga0495654_0105128 | |||
| 1731 | Ga0495654_0118497 | |||
| 1732 | Ga0495654_0150127 | |||
| 1733 | Ga0495654_0153463 | |||
| 1734 | Ga0495586_0065831 | |||
| 1735 | Ga0495609_0000023 | |||
| 1736 | Ga0495609_0000088 | |||
| 1737 | Ga0495609_0037517 | |||
| 1738 | Ga0495609_0073777 | |||
| 1739 | Ga0495609_0074412 | |||
| 1740 | Ga0495609_0074493 | |||
| 1741 | Ga0495609_0094626 | |||
| 1742 | Ga0495609_0168547 | |||
| 1743 | Ga0495609_0288217 | |||
| 1744 | Ga0495597_0000240 | |||
| 1745 | Ga0495597_0008804 | |||
| 1746 | Ga0495597_0027317 | |||
| 1747 | Ga0495597_0047251 | |||
| 1748 | Ga0495597_0080678 | |||
| 1749 | Ga0495597_0111045 | |||
| 1750 | Ga0495597_0125215 | |||
| 1751 | Ga0495645_0018495 | |||
| 1752 | Ga0495622_0003524 | |||
| 1753 | Ga0495622_0007559 | |||
| 1754 | Ga0495622_0025526 | |||
| 1755 | Ga0495622_0030861 | |||
| 1756 | Ga0495622_0033115 | |||
| 1757 | Ga0495633_0000777 | |||
| 1758 | Ga0495633_0020974 | |||
| 1759 | Ga0495633_0031356 | |||
| 1760 | Ga0495633_0040643 | |||
| 1761 | Ga0495633_0212496 | |||
| 1762 | Ga0495656_0036041 | |||
| 1763 | Ga0495668_0100493 | |||
| 1764 | Ga0495668_0134319 | |||
| 1765 | Ga0495634_0008463 | |||
| 1766 | Ga0495611_0001264 | |||
| 1767 | Ga0495611_0003869 | |||
| 1768 | Ga0495611_0006161 | |||
| 1769 | Ga0495611_0131055 | |||
| 1770 | Ga0495625_0024930 | |||
| 1771 | Ga0495625_0082894 | |||
| 1772 | Ga0495625_0088730 | |||
| 1773 | Ga0495625_0101778 | |||
| 1774 | Ga0495625_0146840 | |||
| 1775 | Ga0495625_0151691 | |||
| 1776 | Ga0495625_0349415 | |||
| 1777 | Ga0495625_0362354 | |||
| 1778 | Ga0495625_0384839 | |||
| 1779 | Ga0495635_0081337 | |||
| 1780 | Ga0495659_0001715 | |||
| 1781 | Ga0495659_0013278 | |||
| 1782 | Ga0495659_0117338 | |||
| 1783 | Ga0495659_0128793 | |||
| 1784 | Ga0495661_0000036 | |||
| 1785 | Ga0495661_0000072 | |||
| 1786 | Ga0495661_0000841 | |||
| 1787 | Ga0495661_0004540 | |||
| 1788 | Ga0495661_0016542 | |||
| 1789 | Ga0495661_0053107 | |||
| 1790 | Ga0495661_0084689 | |||
| 1791 | Ga0495661_0194082 | |||
| 1792 | Ga0495661_0203120 | |||
| 1793 | Ga0495661_0375639 | |||
| 1794 | Ga0495588_0037981 | |||
| 1795 | Ga0495588_0163590 | |||
| 1796 | Ga0495623_0047544 | |||
| 1797 | Ga0495646_0084018 | |||
| 1798 | Ga0495669_0074044 | |||
| 1799 | Ga0495669_0184597 | |||
| 1800 | Ga0495613_0016807 | |||
| 1801 | Ga0495613_0462386 | |||
| 1802 | Ga0495624_0225933 | |||
| 1803 | Ga0495670_0042657 | |||
| 1804 | Ga0495670_0135705 | |||
| 1805 | Ga0495670_0137147 | |||
| 1806 | Ga0495670_0197192 | |||
| 1807 | Ga0495670_0254012 | |||
| 1808 | Ga0495670_0266139 | |||
| 1809 | Ga0495671_0002531 | |||
| 1810 | Ga0495671_0004905 | |||
| 1811 | Ga0495671_0033036 | |||
| 1812 | Ga0495671_0034433 | |||
| 1813 | Ga0495671_0070049 | |||
| 1814 | Ga0495671_0092767 | |||
| 1815 | Ga0495671_0134330 | |||
| 1816 | Ga0495671_0159270 | |||
| 1817 | Ga0495671_0171557 | |||
| 1818 | Ga0495671_0210095 | |||
| 1819 | Ga0495671_0217740 | |||
| 1820 | Ga0495671_0269658 | |||
| 1821 | Ga0495671_0339307 | |||
| 1822 | Ga0495671_0395729 | |||
| 1823 | Ga0495649_0037029 | |||
| 1824 | Ga0495649_0039601 | |||
| 1825 | Ga0495649_0042047 | |||
| 1826 | Ga0495649_0059716 | |||
| 1827 | Ga0495649_0072309 | |||
| 1828 | Ga0495649_0099819 | |||
| 1829 | Ga0495649_0140861 | |||
| 1830 | Ga0495649_0207288 | |||
| 1831 | Ga0495649_0266782 | |||
| 1832 | Ga0495649_0319243 | |||
| 1833 | Ga0495589_0011296 | |||
| 1834 | Ga0495589_0013649 | |||
| 1835 | Ga0495589_0045432 | |||
| 1836 | Ga0495589_0048656 | |||
| 1837 | Ga0495589_0052425 | |||
| 1838 | Ga0495589_0053754 | |||
| 1839 | Ga0495589_0166640 | |||
| 1840 | Ga0495589_0215727 | |||
| 1841 | Ga0495600_0041929 | |||
| 1842 | Ga0495600_0226873 | |||
| 1843 | Ga0495660_0003678 | |||
| 1844 | Ga0495660_0022952 | |||
| 1845 | Ga0495660_0049110 | |||
| 1846 | Ga0495660_0057487 | |||
| 1847 | Ga0495660_0073515 | |||
| 1848 | Ga0495660_0099117 | |||
| 1849 | Ga0495660_0106038 | |||
| 1850 | Ga0495660_0142536 | |||
| 1851 | Ga0495660_0188062 | |||
| 1852 | Ga0495660_0194413 | |||
| 1853 | Ga0495660_0204231 | |||
| 1854 | Ga0495581_0010505 | |||
| 1855 | Ga0495581_0172361 | |||
| 1856 | Ga0495604_0022114 | |||
| 1857 | Ga0495604_0033048 | |||
| 1858 | Ga0495604_0358485 | |||
| 1859 | Ga0495636_0002081 | |||
| 1860 | Ga0495672_0002477 | |||
| 1861 | Ga0495672_0004169 | |||
| 1862 | Ga0495672_0006578 | |||
| 1863 | Ga0495672_0008744 | |||
| 1864 | Ga0495672_0009426 | |||
| 1865 | Ga0495672_0021543 | |||
| 1866 | Ga0495672_0056080 | |||
| 1867 | Ga0495672_0109996 | |||
| 1868 | Ga0495672_0194564 | |||
| 1869 | Ga0495676_0037892 | |||
| 1870 | Ga0495680_0004392 | |||
| 1871 | Ga0495680_0081134 | |||
| 1872 | Ga0495683_0000028 | |||
| 1873 | Ga0495683_0000070 | |||
| 1874 | Ga0495683_0000898 | |||
| 1875 | Ga0495683_0045272 | |||
| 1876 | Ga0495683_0048309 | |||
| 1877 | Ga0495683_0085208 | |||
| 1878 | Ga0495683_0136837 | |||
| 1879 | Ga0495687_028998 | |||
| 1880 | Ga0495687_032126 | |||
| 1881 | Ga0495687_035691 | |||
| 1882 | Ga0495687_035850 | |||
| 1883 | Ga0495677_0016451 | |||
| 1884 | Ga0495677_0112523 | |||
| 1885 | Ga0495679_000814 | |||
| 1886 | Ga0495679_005870 | |||
| 1887 | Ga0495679_022077 | |||
| 1888 | Ga0495679_026268 | |||
| 1889 | Ga0495679_031328 | |||
| 1890 | Ga0495679_035243 | |||
| 1891 | Ga0495673_0002493 | |||
| 1892 | Ga0495673_0002965 | |||
| 1893 | Ga0495673_0003154 | |||
| 1894 | Ga0495673_0008092 | |||
| 1895 | Ga0495673_0011343 | |||
| 1896 | Ga0495673_0036054 | |||
| 1897 | Ga0495673_0041925 | |||
| 1898 | Ga0495681_0009957 | |||
| 1899 | Ga0495681_0016326 | |||
| 1900 | Ga0495681_0025678 | |||
| 1901 | Ga0495681_0026288 | |||
| 1902 | Ga0495681_0035896 | |||
| 1903 | Ga0495681_0041032 | |||
| 1904 | Ga0495681_0041880 | |||
| 1905 | Ga0495681_0088633 | |||
| 1906 | Ga0495681_0115021 | |||
| 1907 | Ga0495681_0134746 | |||
| 1908 | Ga0495681_0219740 | |||
| 1909 | Ga0495684_0057302 | |||
| 1910 | Ga0495686_0185947 | |||
| 1911 | Ga0495593_0010740 | |||
| 1912 | Ga0495593_0080546 | |||
| 1913 | Ga0495593_0149994 | |||
| 1914 | Ga0495593_0290405 | |||
| 1915 | Ga0495626_0000783 | |||
| 1916 | Ga0495626_0005462 | |||
| 1917 | Ga0495626_0024380 | |||
| 1918 | Ga0495626_0041164 | |||
| 1919 | Ga0495626_0068061 | |||
| 1920 | Ga0495626_0119488 | |||
| 1921 | Ga0496110_0158592 | |||
| 1922 | Ga0496111_0065965 | |||
| 1923 | Ga0496112_0402032 | |||
| 1924 | Ga0496114_0005726 | |||
| 1925 | Ga0496114_0432005 | |||
| 1926 | Ga0496116_0004519 | |||
| 1927 | Ga0496116_0009047 | |||
| 1928 | Ga0496116_0019644 | |||
| 1929 | Ga0496116_0077604 | |||
| 1930 | Ga0496116_0212838 | |||
| 1931 | Ga0496117_0001531 | |||
| 1932 | Ga0496117_0005978 | |||
| 1933 | Ga0496117_0008162 | |||
| 1934 | Ga0496117_0080786 | |||
| 1935 | Ga0496117_0155439 | |||
| 1936 | Ga0496118_0001596 | |||
| 1937 | Ga0496118_0038456 | |||
| 1938 | Ga0496118_0090108 | |||
| 1939 | Ga0496118_0092729 | |||
| 1940 | Ga0496118_0096639 | |||
| 1941 | Ga0496118_0147727 | |||
| 1942 | Ga0496118_0258940 | |||
| 1943 | Ga0496119_0001575 | |||
| 1944 | Ga0496119_0204364 | |||
| 1945 | Ga0496120_0002964 | |||
| 1946 | Ga0496120_0023342 | |||
| 1947 | Ga0496121_0007491 | |||
| 1948 | Ga0496121_0015134 | |||
| 1949 | Ga0496121_0051541 | |||
| 1950 | Ga0496121_0082304 | |||
| 1951 | Ga0496121_0163481 | |||
| 1952 | Ga0496121_0206656 | |||
| 1953 | Ga0496121_0227311 | |||
| 1954 | Ga0496121_0315586 | |||
| 1955 | Ga0496122_0000398 | |||
| 1956 | Ga0496122_0002086 | |||
| 1957 | Ga0496122_0015271 | |||
| 1958 | Ga0496122_0023896 | |||
| 1959 | Ga0496122_0294342 | |||
| 1960 | Ga0496122_0302998 | |||
| 1961 | Ga0496122_0322514 | |||
| 1962 | Ga0496123_0000178 | |||
| 1963 | Ga0496123_0000302 | |||
| 1964 | Ga0496123_0010583 | |||
| 1965 | Ga0496123_0013707 | |||
| 1966 | Ga0496123_0075956 | |||
| 1967 | Ga0496123_0121074 | |||
| 1968 | Ga0496123_0144328 | |||
| 1969 | Ga0496124_0000073 | |||
| 1970 | Ga0496124_0002969 | |||
| 1971 | Ga0496124_0006941 | |||
| 1972 | Ga0496124_0009601 | |||
| 1973 | Ga0496124_0015975 | |||
| 1974 | Ga0496124_0035061 | |||
| 1975 | Ga0496124_0044228 | |||
| 1976 | Ga0496124_0051784 | |||
| 1977 | Ga0496124_0082749 | |||
| 1978 | Ga0496124_0100389 | |||
| 1979 | Ga0496124_0245801 | |||
| 1980 | Ga0496124_0463390 | |||
| 1981 | Ga0496125_0009053 | |||
| 1982 | Ga0496125_0011937 | |||
| 1983 | Ga0496125_0015843 | |||
| 1984 | Ga0496125_0059673 | |||
| 1985 | Ga0496125_0084010 | |||
| 1986 | Ga0496125_0116334 | |||
| 1987 | Ga0496125_0198260 | |||
| 1988 | Ga0496125_0254836 | |||
| 1989 | Ga0496126_0026483 | |||
| 1990 | Ga0496126_0037042 | |||
| 1991 | Ga0496126_0064262 | |||
| 1992 | Ga0495678_000325 | |||
| 1993 | Ga0495678_000692 | |||
| 1994 | Ga0495678_009187 | |||
| 1995 | Ga0495678_009597 | |||
| 1996 | Ga0495678_024369 | |||
| 1997 | Ga0495678_029829 | |||
| 1998 | Ga0495678_098792 | |||
| 1999 | Ga0495678_101257 | |||
| 2000 | Ga0495678_105112 | |||
| 2001 | Ga0495678_118821 | |||
| 2002 | Ga0495682_0001120 | |||
| 2003 | Ga0495682_0025393 | |||
| 2004 | Ga0495682_0072043 | |||
| 2005 | Ga0495682_0092891 | |||
| 2006 | Ga0501034_0000143 | |||
| 2007 | Ga0501257_049804 | |||
| 2008 | Ga0501241_001729 | |||
| 2009 | Ga0501226_000001 | |||
| 2010 | nmdc:mga00v17_352525_c1 | |||
| 2011 | Ga0500618_053680 | |||
| 2012 | Ga0500659_0002144 | |||
| 2013 | Ga0500573_0084370 | |||
| 2014 | Ga0500577_0013072 | |||
| 2015 | Ga0500586_140073 | |||
| 2016 | Ga0500634_0009844 | |||
| 2017 | 2511254827 | |||
| 2018 | 2511266044 | |||
| 2019 | 2511273354 | |||
| 2020 | 2511275066 | |||
| 2021 | 2511288486 | |||
| 2022 | 2511304006 | |||
| 2023 | 2511311976 | |||
| 2024 | 2511323421 | |||
| 2025 | 2511327983 | |||
| 2026 | 2511329698 | |||
| 2027 | 2511335868 | |||
| 2028 | 2511344768 | |||
| 2029 | 2511349531 | |||
| 2030 | 2511365969 | |||
| 2031 | 2511369011 | |||
| 2032 | 2511412149 | |||
| 2033 | 2511827665 | |||
| 2034 | 2512326647 | |||
| 2035 | 2555672871 | |||
| 2036 | 2583795698 | |||
| 2037 | 2597860908 | |||
| 2038 | 2597866655 | |||
| 2039 | 2597872511 | |||
| 2040 | 2599327533 | |||
| 2041 | 2599355923 | |||
| 2042 | 2599362675 | |||
| 2043 | 2599369019 | |||
| 2044 | 2599375784 | |||
| 2045 | 2599381029 | |||
| 2046 | 2599387455 | |||
| 2047 | 2599394642 | |||
| 2048 | 2599400515 | |||
| 2049 | 2599406407 | |||
| 2050 | 2599449839 | |||
| 2051 | 2599462757 | |||
| 2052 | 2599467820 | |||
| 2053 | 2599485857 | |||
| 2054 | 2599491774 | |||
| 2055 | 2599500287 | |||
| 2056 | 2599505775 | |||
| 2057 | 2599511913 | |||
| 2058 | 2599516897 | |||
| 2059 | 2599614455 | |||
| 2060 | 2599768121 | |||
| 2061 | 2599804638 | |||
| 2062 | 2599879061 | |||
| 2063 | 2599885557 | |||
| 2064 | 2599892725 | |||
| 2065 | 2599897271 | |||
| 2066 | 2599930690 | |||
| 2067 | 2599942328 | |||
| 2068 | 2599951475 | |||
| 2069 | 2599954259 | |||
| 2070 | 2599961942 | |||
| 2071 | 2599965965 | |||
| 2072 | 2599972333 | |||
| 2073 | 2599977985 | |||
| 2074 | 2599982898 | |||
| 2075 | 2599988352 | |||
| 2076 | 2599994016 | |||
| 2077 | 2599999147 | |||
| 2078 | 2600004284 | |||
| 2079 | 2600012152 | |||
| 2080 | 2600020426 | |||
| 2081 | 2600026316 | |||
| 2082 | 2600032062 | |||
| 2083 | 2600035998 | |||
| 2084 | 2600042363 | |||
| 2085 | 2600046678 | |||
| 2086 | 2600054896 | |||
| 2087 | 2600061073 | |||
| 2088 | 2600066343 | |||
| 2089 | 2600071893 | |||
| 2090 | 2600076514 | |||
| 2091 | 2600215383 | |||
| 2092 | 2600358965 | |||
| 2093 | 2600363523 | |||
| 2094 | 2601627433 | |||
| 2095 | 2601693420 | |||
| 2096 | 2601775549 | |||
| 2097 | 2601798536 | |||
| 2098 | 2602008403 | |||
| 2099 | 2606077430 | |||
| 2100 | 2606129324 | |||
| 2101 | 2621296822 | |||
| 2102 | 2624483435 | |||
| 2103 | 2624494958 | |||
| 2104 | 2643842988 | |||
| 2105 | 2643872288 | |||
| 2106 | 2643955607 | |||
| 2107 | 2644020401 | |||
| 2108 | 2644184454 | |||
| 2109 | 2644283203 | |||
| 2110 | 2644620192 | |||
| 2111 | 2652547405 | |||
| 2112 | 2671089579 | |||
| 2113 | 2671099315 | |||
| 2114 | 2671128560 | |||
| 2115 | 2671771645 | |||
| 2116 | 2677897154 | |||
| 2117 | 2678266174 | |||
| 2118 | 2715749806 | |||
| 2119 | 2715754824 | |||
| 2120 | 2718636637 | |||
| 2121 | 2723251391 | |||
| 2122 | 2729146757 | |||
| 2123 | 2738671642 | |||
| 2124 | 2738750036 | |||
| 2125 | 2738807277 | |||
| 2126 | 2738859076 | |||
| 2127 | 2738894637 | |||
| 2128 | 2739199084 | |||
| 2129 | 2739259026 | |||
| 2130 | 2739288706 | |||
| 2131 | 2739294018 | |||
| 2132 | 2739312481 | |||
| 2133 | 2743740448 | |||
| 2134 | 2745007406 | |||
| 2135 | 2774118352 | |||
| 2136 | 2774135544 | |||
| 2137 | 2784261794 | |||
| 2138 | 2784313599 | |||
| 2139 | 2794593815 | |||
| 2140 | 2808855672 | |||
| 2141 | 2808926533 | |||
| 2142 | 2808928419 | |||
| 2143 | 2808935491 | |||
| 2144 | 2808939896 | |||
| 2145 | 2808948694 | |||
| 2146 | 2808950398 | |||
| 2147 | 2808959817 | |||
| 2148 | 2808964099 | |||
| 2149 | 2808976173 | |||
| 2150 | 2808994364 | |||
| 2151 | 2808999065 | |||
| 2152 | 2812369518 | |||
| 2153 | 2817494065 | |||
| 2154 | 2819655154 | |||
| 2155 | 2819704437 | |||
| 2156 | 2825655071 | |||
| 2157 | 2826581876 | |||
| 2158 | 2834030976 | |||
| 2159 | 2842807979 | |||
| 2160 | 2842816869 | |||
| 2161 | 2842831262 | |||
| 2162 | 2842833483 | |||
| 2163 | 2842837924 | |||
| 2164 | 2842845713 | |||
| 2165 | 2842855646 | |||
| 2166 | 2852616375 | |||
| 2167 | 2852659700 | |||
| 2168 | 2852671343 | |||
| 2169 | 2878035377 | |||
| 2170 | 2880236018 | |||
| 2171 | 2904518935 | |||
| 2172 | 2904551389 | |||
| 2173 | 2908452608 | |||
| 2174 | 2912968909 | |||
| 2175 | 2913042554 | |||
| 2176 | 2917076769 | |||
| 2177 | 2919065493 | |||
| 2178 | 2919155928 | |||
| 2179 | 2919389166 | |||
| 2180 | 2919457573 | |||
| 2181 | 2919485681 | |||
| 2182 | 2919488143 | |||
| 2183 | 2919502487 | |||
| 2184 | 2919700550 | |||
| 2185 | 2923159541 | |||
| 2186 | 2923523604 | |||
| 2187 | 2923589024 | |||
| 2188 | 2926064160 | |||
| 2189 | 2929149944 | |||
| 2190 | 2929195177 | |||
| 2191 | 2931372615 | |||
| 2192 | 2931396436 | |||
| 2193 | 2931398104 | |||
| 2194 | 2935358264 | |||
| 2195 | 2939640780 | |||
| 2196 | 2939656676 | |||
| 2197 | 2945930887 | |||
| 2198 | 2945966882 | |||
| 2199 | 2946013259 | |||
| 2200 | 2946027928 | |||
| 2201 | 2947234448 | |||
| 2202 | 2969310197 | |||
| 2203 | 2974294056 | |||
| 2204 | 2984286573 | |||
| 2205 | 2988731484 | |||
| 2206 | 2990197172 | |||
| 2207 | 2998145421 | |||
| 2208 | 3007399374 | |||
| 2209 | 3007425753 | |||
| 2210 | 3007517206 | |||
| 2211 | 3007618881 | |||
| 2212 | 3007620708 | |||
| 2213 | 3007721781 | |||
| 2214 | 3007859216 | |||
| 2215 | 3007865080 | |||
| 2216 | 3007866756 | |||
| 2217 | 640490015 | |||
| 2218 | 651178096 | |||
| 2219 | 8011351039 | |||
| 2220 | 8015693639 | |||
| 2221 | 8019769733 | |||
| 2222 | 8019777657 | |||
| 2223 | 8029995481 | |||
| 2224 | 8034965069 | |||
| 2225 | 8052494820 | |||
| 2226 | 8054285701 | |||
| 2227 | 8054349559 | |||
| 2228 | 8054508959 | |||
| 2229 | 8055776886 | |||
| 2230 | 8055823930 | |||
| 2231 | 8055880747 | |||
| 2232 | 8056120930 | |||
| 2233 | 8056131632 | |||
| 2234 | 8056137334 | |||
| 2235 | 8056148795 | |||
| 2236 | 8056151470 | |||
| 2237 | 8056159729 | |||
| 2238 | 8056163655 | |||
| 2239 | 8056171284 | |||
| 2240 | 8056177384 | |||
| 2241 | 8056182024 | |||
| 2242 | 8056570488 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2jcb-assembly2.cif.gz_B | the crystal structure of 5-formyl-tetrahydrofolate cycloligase from bacillus anthracis (ba4489) | 0.8874 | 11 | 199 |
| 1sou-assembly1.cif.gz_A | nmr structure of aquifex aeolicus 5,10-methenyltetrahydrofolate synthetase: northeast structural genomics consortium target qr46 | 0.8677 | 10 | 200 |
| 3hy6-assembly1.cif.gz_A | structure of human mthfs with adp | 0.8564 | 10 | 193 |
| 2jcb-assembly2.cif.gz_B | the crystal structure of 5-formyl-tetrahydrofolate cycloligase from bacillus anthracis (ba4489) | 0.8442 | 11 | 199 |
| 1wkc-assembly1.cif.gz_A | crystal structure of a 5-formyltetrahydrofolate cycloligase-related protein from thermus thermophilus hb8 | 0.8338 | 7 | 200 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AC28_1_181_3.40.50.10420 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like | 0.9278 | 15 | 198 | 3.40.50.10420 |
| af_P0AC28_1_181_3.40.50.10420 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like | 0.9181 | 15 | 198 | 3.40.50.10420 |
| 2jcbB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like | 0.8874 | 11 | 199 | 3.40.50.10420 |
| af_Q2FY23_1_179_3.40.50.10420 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like | 0.874 | 7 | 191 | 3.40.50.10420 |
| 1souA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like | 0.8677 | 10 | 200 | 3.40.50.10420 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0F7M2P2-F1-model_v4 | 5-formyltetrahydrofolate cyclo-ligase (EC 6.3.3.2) | 0.9405 | 10 | 201 |
GO:0005524
GO:0009396 GO:0030272 GO:0035999 GO:0046872 |
| AF-A0A2E7E7M7-F1-model_v4 | 5-formyltetrahydrofolate cyclo-ligase (EC 6.3.3.2) | 0.9394 | 7 | 201 |
GO:0005524
GO:0009396 GO:0030272 GO:0035999 GO:0046872 |
| AF-A0A4P9VIM1-F1-model_v4 | 5-formyltetrahydrofolate cyclo-ligase (EC 6.3.3.2) | 0.9379 | 6 | 199 |
GO:0005524
GO:0009396 GO:0030272 GO:0035999 GO:0046872 |
| AF-A0A7Z9WSF4-F1-model_v4 | 5-formyltetrahydrofolate cyclo-ligase (EC 6.3.3.2) | 0.937 | 7 | 150 |
GO:0005524
GO:0009396 GO:0030272 GO:0035999 GO:0046872 |
| AF-A0A2E2W1Q9-F1-model_v4 | 5-formyltetrahydrofolate cyclo-ligase (EC 6.3.3.2) | 0.9363 | 7 | 201 |
GO:0005524
GO:0009396 GO:0030272 GO:0035999 GO:0046872 |