F490449
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1124 | 391 | 2248 | 243 |
Family's Representative Sequence
| Representative Sequence | 3300046474|Ga0495605_0000003|Ga0495605_0000003_221849_222676 |
| Length | 275 |
| Sequence | MPSTTTKLKKPSRKSAVQSKNPPKFSNKESEMTDVTRPSGRAVDALRTLRLTRDYTKHAEGSVLIECGDTKVICTASIEDKVPGFLKGKGQGWLTAEYGMLPRSTHTRMDREAAKGKQSGRTQEIQRLIGRSLRAAFDLEAFGERTLHLDCDVIQADGGTRTASITGAMVAAYDAFSKLAARGAIPAIPLKNFVAAISVGVYQGTPVLDLDYIEDSGCDTDMNVVMTDAGHFIEVQGTAEGVAFDRAGMNRLLDLAQAGIADLVKLQKQALGIAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 3 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 4 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 6 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 8 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 9 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 10 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 11 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 12 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 13 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 14 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 15 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 25 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 26 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 27 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 28 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 30 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 31 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 52 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 54 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 55 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 56 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 57 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 58 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 59 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 60 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 61 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 62 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 63 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 76 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 78 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 79 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 80 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 82 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 83 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 94 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 95 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 96 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 99 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 100 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 102 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 104 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 106 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 111 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 137 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 138 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 140 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 141 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 142 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 143 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 144 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 145 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 146 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 147 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 148 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 149 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 150 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 151 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 152 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 153 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 154 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 155 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 156 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 157 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 158 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 159 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 160 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 161 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 162 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 163 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 164 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 165 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 166 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 167 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 168 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 169 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 170 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 171 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 172 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 173 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 174 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 175 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 176 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 177 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 178 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 179 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 180 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 181 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 182 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 183 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 184 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 185 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 186 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 187 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 188 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 189 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 190 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 191 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 192 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 193 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 286 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 287 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 288 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 289 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 292 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 293 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 294 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 295 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 296 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 297 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 298 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 299 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 300 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 301 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 302 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 303 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 304 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 305 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 311 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 312 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 313 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 315 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 316 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 317 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 318 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 319 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 320 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 322 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 323 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 324 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 325 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 326 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 327 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 328 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 329 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 330 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 331 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 332 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 333 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 334 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 335 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 336 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 337 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 338 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 339 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 340 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 341 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 342 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 343 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 344 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 345 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 346 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 347 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 348 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 349 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 350 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 351 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 352 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 353 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 354 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 355 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 356 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 357 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 358 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 359 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 360 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 361 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 362 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 363 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 364 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 365 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 366 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 367 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 368 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 369 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 370 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 371 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 372 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 373 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 374 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 375 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 376 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 377 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 378 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 379 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 380 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 381 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 382 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 383 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 384 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 385 | 2919497567 | Shewanella putrefaciens 3469 | Isolate | Unclassified |
| 386 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 387 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 388 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 389 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 390 | 8002745576 | Marinomonas spartinae USM8 | Isolate | Rhizosphere |
| 391 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.66 |
| Metatranscriptomes | 0.09 |
| Isolates | 5.25 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.26 |
| Nodule | 0.71 |
| Rhizoplane | 3.91 |
| Rhizosphere | 73.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495605_0000003 | 3300046474 | Bacteria | 491502 |
| 2 | JGI25155J39150_1000109 | 3300002704 | Bacteria | 43954 |
| 3 | JGI25155J39150_1000164 | 3300002704 | Bacteria | 29251 |
| 4 | JGI25156J39149_1000106 | 3300002705 | Bacteria | 60506 |
| 5 | JGI25156J39149_1002732 | 3300002705 | Bacteria | 6144 |
| 6 | JGI25162J39368_1000142 | 3300002737 | Bacteria | 77413 |
| 7 | JGI25162J39368_1008765 | 3300002737 | Bacteria | 1417 |
| 8 | JGI25154J39366_1000038 | 3300002738 | Bacteria | 155793 |
| 9 | JGI25154J39366_1000194 | 3300002738 | Bacteria | 44573 |
| 10 | JGI25154J39366_1003728 | 3300002738 | Bacteria | 3042 |
| 11 | JGI25158J39367_1000363 | 3300002739 | Bacteria | 9791 |
| 12 | JGI25157J39369_1000119 | 3300002741 | Bacteria | 67906 |
| 13 | JGI25152J39213_1000053 | 3300002773 | Bacteria | 77432 |
| 14 | JGI25150J39212_1001820 | 3300002774 | Bacteria | 5657 |
| 15 | JGI25150J39212_1002317 | 3300002774 | Bacteria | 4792 |
| 16 | JGI25150J39212_1003312 | 3300002774 | Bacteria | 3794 |
| 17 | JGI25159J45721_1003565 | 3300002987 | Bacteria | 5460 |
| 18 | JGI25159J45721_1004512 | 3300002987 | Bacteria | 4606 |
| 19 | JGI25159J45721_1004857 | 3300002987 | Bacteria | 4339 |
| 20 | JGI25151J46595_10039083 | 3300003187 | Bacteria | 1757 |
| 21 | JGI25165J46597_1000064 | 3300003214 | Bacteria | 199878 |
| 22 | JGI25153J46596_10006073 | 3300003215 | Bacteria | 6204 |
| 23 | JGI25161J50226_1002547 | 3300003374 | Bacteria | 4610 |
| 24 | JGI25161J50226_1002750 | 3300003374 | Bacteria | 4339 |
| 25 | Ga0055538_1000002 | 3300003751 | Bacteria | 999437 |
| 26 | Ga0055538_1000031 | 3300003751 | Bacteria | 199878 |
| 27 | Ga0055539_1000002 | 3300003752 | Bacteria | 999437 |
| 28 | Ga0055539_1000041 | 3300003752 | Bacteria | 199878 |
| 29 | Ga0055533_1000004 | 3300003756 | Bacteria | 999437 |
| 30 | Ga0055533_1000051 | 3300003756 | Bacteria | 199878 |
| 31 | Ga0055532_1000023 | 3300003758 | Bacteria | 248212 |
| 32 | Ga0055525_1000002 | 3300003759 | Bacteria | 999437 |
| 33 | Ga0055525_1000061 | 3300003759 | Bacteria | 199878 |
| 34 | Ga0055525_1000105 | 3300003759 | Bacteria | 134026 |
| 35 | Ga0055529_1000185 | 3300003763 | Bacteria | 85584 |
| 36 | Ga0055529_1000208 | 3300003763 | Bacteria | 77951 |
| 37 | Ga0055526_1000077 | 3300003771 | Bacteria | 92111 |
| 38 | Ga0055526_1000094 | 3300003771 | Bacteria | 80954 |
| 39 | Ga0055526_1000715 | 3300003771 | Bacteria | 25185 |
| 40 | Ga0055526_1004659 | 3300003771 | Bacteria | 8157 |
| 41 | Ga0055537_1000072 | 3300003773 | Bacteria | 73276 |
| 42 | Ga0055537_1022606 | 3300003773 | Bacteria | 914 |
| 43 | Ga0055524_1000007 | 3300003775 | Bacteria | 298766 |
| 44 | Ga0055524_1005877 | 3300003775 | Bacteria | 5411 |
| 45 | Ga0055524_1008398 | 3300003775 | Bacteria | 4293 |
| 46 | Ga0055524_1017700 | 3300003775 | Bacteria | 2504 |
| 47 | Ga0055524_1026883 | 3300003775 | Bacteria | 1763 |
| 48 | Ga0055534_1000136 | 3300003784 | Bacteria | 55242 |
| 49 | Ga0055534_1005658 | 3300003784 | Bacteria | 3297 |
| 50 | Ga0055528_1000444 | 3300003790 | Bacteria | 33075 |
| 51 | Ga0055530_10006305 | 3300003791 | Bacteria | 5332 |
| 52 | Ga0055530_10007353 | 3300003791 | Bacteria | 4661 |
| 53 | Ga0055530_10014781 | 3300003791 | Bacteria | 2581 |
| 54 | Ga0055531_10003104 | 3300003794 | Bacteria | 10728 |
| 55 | Ga0055531_10010360 | 3300003794 | Bacteria | 4641 |
| 56 | Ga0055541_1000002 | 3300003841 | Bacteria | 896405 |
| 57 | Ga0055541_1000028 | 3300003841 | Bacteria | 199878 |
| 58 | Ga0055543_1002610 | 3300004625 | Bacteria | 5820 |
| 59 | Ga0055543_1003660 | 3300004625 | Bacteria | 4428 |
| 60 | Ga0065165_1000094 | 3300005262 | Bacteria | 146099 |
| 61 | Ga0065165_1003718 | 3300005262 | Bacteria | 10306 |
| 62 | Ga0065165_1015311 | 3300005262 | Bacteria | 2930 |
| 63 | Ga0065714_10014176 | 3300005288 | Bacteria | 1880 |
| 64 | Ga0065714_10076239 | 3300005288 | Bacteria | 2814 |
| 65 | Ga0065714_10089047 | 3300005288 | Bacteria | 1994 |
| 66 | Ga0065715_10174354 | 3300005293 | Bacteria | 1519 |
| 67 | Ga0070658_10068793 | 3300005327 | Bacteria | 2895 |
| 68 | Ga0070658_10070302 | 3300005327 | Bacteria | 2865 |
| 69 | Ga0070660_100005270 | 3300005339 | Bacteria | 8940 |
| 70 | Ga0070660_100028029 | 3300005339 | Bacteria | 4210 |
| 71 | Ga0070661_100015147 | 3300005344 | Bacteria | 5442 |
| 72 | Ga0070692_10223709 | 3300005345 | Bacteria | 1114 |
| 73 | Ga0070659_100011305 | 3300005366 | Bacteria | 6599 |
| 74 | Ga0070659_100050361 | 3300005366 | Bacteria | 3274 |
| 75 | Ga0070659_100059051 | 3300005366 | Bacteria | 3028 |
| 76 | Ga0070708_100079133 | 3300005445 | Bacteria | 2973 |
| 77 | Ga0070662_100092248 | 3300005457 | Bacteria | 2276 |
| 78 | Ga0070681_10204421 | 3300005458 | Bacteria | 1892 |
| 79 | Ga0070706_100038547 | 3300005467 | Bacteria | 4410 |
| 80 | Ga0070706_100050112 | 3300005467 | Bacteria | 3853 |
| 81 | Ga0070707_100026476 | 3300005468 | Bacteria | 5507 |
| 82 | Ga0070697_100088920 | 3300005536 | Bacteria | 2551 |
| 83 | Ga0070697_100170433 | 3300005536 | Bacteria | 1842 |
| 84 | Ga0070697_100349889 | 3300005536 | Bacteria | 1276 |
| 85 | Ga0070695_100382016 | 3300005545 | Bacteria | 1063 |
| 86 | Ga0070704_100011744 | 3300005549 | Bacteria | 5383 |
| 87 | Ga0068855_100012325 | 3300005563 | Bacteria | 10327 |
| 88 | Ga0068855_100034937 | 3300005563 | Bacteria | 5990 |
| 89 | Ga0068855_100088605 | 3300005563 | Bacteria | 3574 |
| 90 | Ga0068855_100519098 | 3300005563 | Bacteria | 1292 |
| 91 | Ga0070664_100030676 | 3300005564 | Bacteria | 4487 |
| 92 | Ga0068854_100004482 | 3300005578 | Bacteria | 8809 |
| 93 | Ga0068856_100552255 | 3300005614 | Bacteria | 1173 |
| 94 | Ga0068852_100015995 | 3300005616 | Bacteria | 5840 |
| 95 | Ga0068860_100128098 | 3300005843 | Bacteria | 2434 |
| 96 | Ga0070717_10324117 | 3300006028 | Bacteria | 1373 |
| 97 | Ga0075365_10018477 | 3300006038 | Bacteria | 4288 |
| 98 | Ga0075368_10029429 | 3300006042 | Bacteria | 2123 |
| 99 | Ga0075363_100000825 | 3300006048 | Bacteria | 10740 |
| 100 | Ga0075364_10000090 | 3300006051 | Bacteria | 36621 |
| 101 | Ga0075364_10001278 | 3300006051 | Bacteria | 13546 |
| 102 | Ga0075367_10228038 | 3300006178 | Bacteria | 1166 |
| 103 | Ga0075366_10031563 | 3300006195 | Bacteria | 3118 |
| 104 | Ga0075370_10106646 | 3300006353 | Bacteria | 1625 |
| 105 | Ga0075434_100053749 | 3300006871 | Bacteria | 4002 |
| 106 | Ga0079104_1042746 | 3300006946 | Bacteria | 1048 |
| 107 | Ga0099826_10000003 | 3300006948 | Bacteria | 1067817 |
| 108 | Ga0105251_10059993 | 3300009011 | Bacteria | 1793 |
| 109 | Ga0105244_10000758 | 3300009036 | Bacteria | 27588 |
| 110 | Ga0105244_10004717 | 3300009036 | Bacteria | 9276 |
| 111 | Ga0105240_10005406 | 3300009093 | Bacteria | 19045 |
| 112 | Ga0105240_10016939 | 3300009093 | Bacteria | 9849 |
| 113 | Ga0105240_10028682 | 3300009093 | Bacteria | 7263 |
| 114 | Ga0105245_10153024 | 3300009098 | Bacteria | 2183 |
| 115 | Ga0105243_10018589 | 3300009148 | Bacteria | 5267 |
| 116 | Ga0105242_10098100 | 3300009176 | Bacteria | 2478 |
| 117 | Ga0105237_10012915 | 3300009545 | Bacteria | 8775 |
| 118 | Ga0105237_10169883 | 3300009545 | Bacteria | 2180 |
| 119 | Ga0105238_10000356 | 3300009551 | Bacteria | 49238 |
| 120 | Ga0105238_10015319 | 3300009551 | Bacteria | 7767 |
| 121 | Ga0105238_10716044 | 3300009551 | Bacteria | 1013 |
| 122 | Ga0105239_10217792 | 3300010375 | Bacteria | 2141 |
| 123 | Ga0105239_10533237 | 3300010375 | Bacteria | 1336 |
| 124 | Ga0157373_10092056 | 3300013100 | Bacteria | 2135 |
| 125 | Ga0157371_10000001 | 3300013102 | Bacteria | 1162285 |
| 126 | Ga0157372_10222308 | 3300013307 | Bacteria | 2189 |
| 127 | Ga0157372_10566937 | 3300013307 | Bacteria | 1323 |
| 128 | Ga0182008_10001031 | 3300014497 | Bacteria | 19379 |
| 129 | Ga0182008_10036723 | 3300014497 | Bacteria | 2451 |
| 130 | Ga0157376_10215799 | 3300014969 | Bacteria | 1774 |
| 131 | Ga0157376_10404870 | 3300014969 | Bacteria | 1320 |
| 132 | Ga0182006_1000075 | 3300015261 | Bacteria | 130239 |
| 133 | Ga0182006_1000163 | 3300015261 | Bacteria | 70369 |
| 134 | Ga0182006_1002368 | 3300015261 | Bacteria | 10330 |
| 135 | Ga0182006_1010376 | 3300015261 | Bacteria | 4143 |
| 136 | Ga0182007_10000135 | 3300015262 | Bacteria | 51737 |
| 137 | Ga0182007_10008464 | 3300015262 | Bacteria | 4224 |
| 138 | Ga0182005_1000020 | 3300015265 | Bacteria | 278671 |
| 139 | Ga0182005_1000106 | 3300015265 | Bacteria | 63464 |
| 140 | Ga0182005_1000656 | 3300015265 | Bacteria | 16502 |
| 141 | Ga0163161_10008676 | 3300017792 | Bacteria | 7028 |
| 142 | Ga0163161_10169924 | 3300017792 | Bacteria | 1666 |
| 143 | Ga0213872_10000002 | 3300021361 | Bacteria | 554092 |
| 144 | Ga0213872_10000290 | 3300021361 | Bacteria | 42933 |
| 145 | Ga0213872_10000317 | 3300021361 | Bacteria | 41076 |
| 146 | Ga0213872_10014873 | 3300021361 | Bacteria | 3623 |
| 147 | Ga0213872_10015342 | 3300021361 | Bacteria | 3565 |
| 148 | Ga0209435_100013 | 3300025206 | Bacteria | 366789 |
| 149 | Ga0209436_101021 | 3300025208 | Bacteria | 10724 |
| 150 | Ga0209436_107202 | 3300025208 | Bacteria | 2353 |
| 151 | Ga0209784_100002 | 3300025224 | Bacteria | 1753105 |
| 152 | Ga0209784_100039 | 3300025224 | Bacteria | 232021 |
| 153 | Ga0209566_100003 | 3300025225 | Bacteria | 1753105 |
| 154 | Ga0209566_100023 | 3300025225 | Bacteria | 396571 |
| 155 | Ga0209674_100004 | 3300025226 | Bacteria | 1753105 |
| 156 | Ga0209674_100040 | 3300025226 | Bacteria | 396571 |
| 157 | Ga0209672_103061 | 3300025228 | Bacteria | 3645 |
| 158 | Ga0209147_100030 | 3300025229 | Bacteria | 366789 |
| 159 | Ga0209563_100006 | 3300025230 | Bacteria | 1753105 |
| 160 | Ga0209563_100007 | 3300025230 | Bacteria | 1579402 |
| 161 | Ga0209563_100072 | 3300025230 | Bacteria | 232021 |
| 162 | Ga0207427_100911 | 3300025231 | Bacteria | 12741 |
| 163 | Ga0209437_100097 | 3300025233 | Bacteria | 232021 |
| 164 | Ga0209437_100208 | 3300025233 | Bacteria | 111481 |
| 165 | Ga0209258_100205 | 3300025242 | Bacteria | 119727 |
| 166 | Ga0207425_1000001 | 3300025245 | Bacteria | 2525432 |
| 167 | Ga0207425_1000322 | 3300025245 | Bacteria | 34215 |
| 168 | Ga0207425_1000936 | 3300025245 | Bacteria | 13892 |
| 169 | Ga0209646_1000028 | 3300025246 | Bacteria | 387986 |
| 170 | Ga0209646_1000034 | 3300025246 | Bacteria | 366789 |
| 171 | Ga0209646_1000135 | 3300025246 | Bacteria | 124235 |
| 172 | Ga0209026_1000022 | 3300025250 | Bacteria | 366789 |
| 173 | Ga0209026_1000946 | 3300025250 | Bacteria | 14585 |
| 174 | Ga0209026_1010459 | 3300025250 | Bacteria | 1729 |
| 175 | Ga0209026_1013767 | 3300025250 | Bacteria | 1367 |
| 176 | Ga0209677_100003 | 3300025253 | Bacteria | 1753105 |
| 177 | Ga0209677_100041 | 3300025253 | Bacteria | 232021 |
| 178 | Ga0209148_1000476 | 3300025254 | Bacteria | 42273 |
| 179 | Ga0209759_1000018 | 3300025256 | Bacteria | 366789 |
| 180 | Ga0209759_1000133 | 3300025256 | Bacteria | 126928 |
| 181 | Ga0209129_1000001 | 3300025258 | Bacteria | 1452436 |
| 182 | Ga0209233_1000122 | 3300025261 | Bacteria | 232021 |
| 183 | Ga0209565_1000009 | 3300025263 | Bacteria | 751701 |
| 184 | Ga0209565_1000705 | 3300025263 | Bacteria | 20479 |
| 185 | Ga0209565_1004151 | 3300025263 | Bacteria | 4496 |
| 186 | Ga0209565_1004259 | 3300025263 | Bacteria | 4419 |
| 187 | Ga0209565_1005731 | 3300025263 | Bacteria | 3577 |
| 188 | Ga0209565_1007149 | 3300025263 | Bacteria | 3042 |
| 189 | Ga0209565_1010047 | 3300025263 | Bacteria | 2364 |
| 190 | Ga0209565_1027266 | 3300025263 | Bacteria | 1138 |
| 191 | Ga0209455_1000049 | 3300025272 | Bacteria | 374414 |
| 192 | Ga0209455_1006443 | 3300025272 | Bacteria | 3460 |
| 193 | Ga0209673_1000036 | 3300025273 | Bacteria | 323162 |
| 194 | Ga0209130_1000455 | 3300025284 | Bacteria | 43009 |
| 195 | Ga0209130_1002444 | 3300025284 | Bacteria | 9300 |
| 196 | Ga0209130_1006012 | 3300025284 | Bacteria | 4040 |
| 197 | Ga0209675_1000013 | 3300025291 | Bacteria | 448220 |
| 198 | Ga0209675_1012992 | 3300025291 | Bacteria | 2639 |
| 199 | Ga0209675_1013388 | 3300025291 | Bacteria | 2569 |
| 200 | Ga0209025_1026583 | 3300025294 | Bacteria | 2899 |
| 201 | Ga0209564_1000009 | 3300025295 | Bacteria | 950196 |
| 202 | Ga0209564_1000045 | 3300025295 | Bacteria | 376549 |
| 203 | Ga0209564_1000175 | 3300025295 | Bacteria | 153109 |
| 204 | Ga0209564_1000240 | 3300025295 | Bacteria | 118922 |
| 205 | Ga0209564_1022560 | 3300025295 | Bacteria | 2220 |
| 206 | Ga0209564_1059486 | 3300025295 | Bacteria | 865 |
| 207 | Ga0209758_1000230 | 3300025297 | Bacteria | 119426 |
| 208 | Ga0209758_1000945 | 3300025297 | Bacteria | 39123 |
| 209 | Ga0209050_1000339 | 3300025298 | Bacteria | 92915 |
| 210 | Ga0209050_1001385 | 3300025298 | Bacteria | 26414 |
| 211 | Ga0209050_1007374 | 3300025298 | Bacteria | 6180 |
| 212 | Ga0209256_1000005 | 3300025299 | Bacteria | 1315082 |
| 213 | Ga0209256_1000052 | 3300025299 | Bacteria | 299374 |
| 214 | Ga0209256_1000763 | 3300025299 | Bacteria | 41818 |
| 215 | Ga0209256_1001302 | 3300025299 | Bacteria | 26875 |
| 216 | Ga0209256_1011167 | 3300025299 | Bacteria | 3631 |
| 217 | Ga0209256_1015557 | 3300025299 | Bacteria | 2650 |
| 218 | Ga0207426_1003996 | 3300025302 | Bacteria | 7489 |
| 219 | Ga0209051_1063193 | 3300025303 | Bacteria | 1154 |
| 220 | Ga0209257_1000486 | 3300025304 | Bacteria | 71627 |
| 221 | Ga0209257_1005302 | 3300025304 | Bacteria | 9159 |
| 222 | Ga0207655_1008380 | 3300025728 | Bacteria | 6571 |
| 223 | Ga0207655_1013288 | 3300025728 | Bacteria | 4739 |
| 224 | Ga0207680_10362955 | 3300025903 | Bacteria | 1019 |
| 225 | Ga0207705_10017834 | 3300025909 | Bacteria | 5076 |
| 226 | Ga0207705_10154796 | 3300025909 | Bacteria | 1719 |
| 227 | Ga0207654_10012122 | 3300025911 | Bacteria | 4412 |
| 228 | Ga0207707_10022182 | 3300025912 | Bacteria | 5550 |
| 229 | Ga0207695_10000926 | 3300025913 | Bacteria | 52365 |
| 230 | Ga0207695_10004209 | 3300025913 | Bacteria | 19770 |
| 231 | Ga0207695_10025569 | 3300025913 | Bacteria | 6606 |
| 232 | Ga0207695_10026240 | 3300025913 | Bacteria | 6504 |
| 233 | Ga0207695_10715473 | 3300025913 | Bacteria | 882 |
| 234 | Ga0207657_10036548 | 3300025919 | Bacteria | 4395 |
| 235 | Ga0207657_10036676 | 3300025919 | Bacteria | 4386 |
| 236 | Ga0207649_10057441 | 3300025920 | Bacteria | 2433 |
| 237 | Ga0207646_10036884 | 3300025922 | Bacteria | 4411 |
| 238 | Ga0207646_10050124 | 3300025922 | Bacteria | 3737 |
| 239 | Ga0207694_10007661 | 3300025924 | Bacteria | 8179 |
| 240 | Ga0207694_10392172 | 3300025924 | Bacteria | 1154 |
| 241 | Ga0207650_10331501 | 3300025925 | Bacteria | 1248 |
| 242 | Ga0207687_10423925 | 3300025927 | Bacteria | 1098 |
| 243 | Ga0207690_10005549 | 3300025932 | Bacteria | 7448 |
| 244 | Ga0207690_10082591 | 3300025932 | Bacteria | 2248 |
| 245 | Ga0207706_10158523 | 3300025933 | Bacteria | 1990 |
| 246 | Ga0207686_10136445 | 3300025934 | Bacteria | 1690 |
| 247 | Ga0207709_10022835 | 3300025935 | Bacteria | 3553 |
| 248 | Ga0207679_10016991 | 3300025945 | Bacteria | 4840 |
| 249 | Ga0207679_10023048 | 3300025945 | Bacteria | 4250 |
| 250 | Ga0207679_10128291 | 3300025945 | Bacteria | 2031 |
| 251 | Ga0207667_10000036 | 3300025949 | Bacteria | 297966 |
| 252 | Ga0207667_10045284 | 3300025949 | Bacteria | 4661 |
| 253 | Ga0207667_10070215 | 3300025949 | Bacteria | 3646 |
| 254 | Ga0207667_10095980 | 3300025949 | Bacteria | 3060 |
| 255 | Ga0207703_10078380 | 3300026035 | Bacteria | 2745 |
| 256 | Ga0207678_10066367 | 3300026067 | Bacteria | 3099 |
| 257 | Ga0207702_10085040 | 3300026078 | Bacteria | 2756 |
| 258 | Ga0207648_10082384 | 3300026089 | Bacteria | 2806 |
| 259 | Ga0209281_1005749 | 3300027111 | Bacteria | 3364 |
| 260 | Ga0209281_1018666 | 3300027111 | Bacteria | 1382 |
| 261 | Ga0209282_1000002 | 3300027666 | Bacteria | 1067825 |
| 262 | Ga0209813_10005603 | 3300027866 | Bacteria | 3058 |
| 263 | Ga0265336_10002052 | 3300028666 | Bacteria | 8575 |
| 264 | Ga0307515_10251276 | 3300028794 | Bacteria | 1520 |
| 265 | Ga0265324_10000004 | 3300029957 | Bacteria | 356972 |
| 266 | Ga0265324_10000750 | 3300029957 | Bacteria | 21570 |
| 267 | Ga0265324_10020602 | 3300029957 | Bacteria | 2368 |
| 268 | Ga0316178_1092679 | 3300030735 | Bacteria | 1325 |
| 269 | Ga0316180_1083533 | 3300030736 | Bacteria | 2003 |
| 270 | Ga0316181_1218906 | 3300030744 | Bacteria | 3752 |
| 271 | Ga0316182_1015863 | 3300030745 | Bacteria | 2909 |
| 272 | Ga0265330_10003267 | 3300031235 | Bacteria | 8532 |
| 273 | Ga0265328_10000223 | 3300031239 | Bacteria | 25984 |
| 274 | Ga0265328_10016697 | 3300031239 | Bacteria | 2851 |
| 275 | Ga0265325_10000146 | 3300031241 | Bacteria | 49815 |
| 276 | Ga0265325_10011135 | 3300031241 | Bacteria | 5178 |
| 277 | Ga0265329_10074880 | 3300031242 | Bacteria | 1071 |
| 278 | Ga0265331_10000259 | 3300031250 | Bacteria | 60879 |
| 279 | Ga0265331_10001924 | 3300031250 | Bacteria | 14556 |
| 280 | Ga0265331_10007469 | 3300031250 | Bacteria | 6319 |
| 281 | Ga0265331_10008292 | 3300031250 | Bacteria | 5920 |
| 282 | Ga0265331_10011692 | 3300031250 | Bacteria | 4797 |
| 283 | Ga0265331_10064998 | 3300031250 | Bacteria | 1716 |
| 284 | Ga0265331_10093584 | 3300031250 | Bacteria | 1388 |
| 285 | Ga0265327_10000547 | 3300031251 | Bacteria | 64250 |
| 286 | Ga0265327_10000595 | 3300031251 | Bacteria | 60289 |
| 287 | Ga0265327_10003077 | 3300031251 | Bacteria | 16467 |
| 288 | Ga0265327_10008275 | 3300031251 | Bacteria | 7788 |
| 289 | Ga0265327_10047095 | 3300031251 | Bacteria | 2277 |
| 290 | Ga0265327_10145718 | 3300031251 | Bacteria | 1103 |
| 291 | Ga0265316_10044341 | 3300031344 | Bacteria | 3538 |
| 292 | Ga0307408_100000182 | 3300031548 | Bacteria | 69692 |
| 293 | Ga0307408_100000200 | 3300031548 | Bacteria | 65177 |
| 294 | Ga0307408_100036740 | 3300031548 | Bacteria | 3445 |
| 295 | Ga0307408_100116226 | 3300031548 | Bacteria | 2064 |
| 296 | Ga0307408_100126310 | 3300031548 | Bacteria | 1989 |
| 297 | Ga0307408_100136613 | 3300031548 | Bacteria | 1919 |
| 298 | Ga0316575_10004657 | 3300031665 | Bacteria | 4832 |
| 299 | Ga0265314_10000772 | 3300031711 | Bacteria | 38169 |
| 300 | Ga0265314_10083540 | 3300031711 | Bacteria | 2099 |
| 301 | Ga0265314_10089855 | 3300031711 | Bacteria | 2002 |
| 302 | Ga0307518_10030626 | 3300031838 | Bacteria | 3897 |
| 303 | Ga0307416_100009909 | 3300032002 | Bacteria | 6267 |
| 304 | Ga0307411_10265398 | 3300032005 | Bacteria | 1358 |
| 305 | Ga0316583_10017757 | 3300032133 | Bacteria | 2556 |
| 306 | Ga0373927_0040419 | 3300035695 | Bacteria | 3025 |
| 307 | Ga0373937_0268062 | 3300036401 | Bacteria | 1611 |
| 308 | Ga0373925_0261868 | 3300037068 | Bacteria | 1389 |
| 309 | Ga0395899_0000473 | 3300037312 | Bacteria | 45449 |
| 310 | Ga0395899_0001163 | 3300037312 | Bacteria | 23230 |
| 311 | Ga0395899_0092321 | 3300037312 | Bacteria | 2192 |
| 312 | Ga0395899_0140211 | 3300037312 | Bacteria | 1720 |
| 313 | Ga0395899_0166830 | 3300037312 | Bacteria | 1553 |
| 314 | Ga0395900_0000928 | 3300037418 | Bacteria | 38433 |
| 315 | Ga0395900_0009234 | 3300037418 | Bacteria | 10113 |
| 316 | Ga0395900_0030934 | 3300037418 | Bacteria | 5498 |
| 317 | Ga0395900_0047818 | 3300037418 | Bacteria | 4406 |
| 318 | Ga0395900_0057430 | 3300037418 | Bacteria | 4006 |
| 319 | Ga0395900_0100136 | 3300037418 | Bacteria | 2976 |
| 320 | Ga0395900_0195343 | 3300037418 | Bacteria | 2050 |
| 321 | Ga0395898_0235867 | 3300037466 | Bacteria | 1744 |
| 322 | Ga0395898_0496756 | 3300037466 | Bacteria | 1160 |
| 323 | Ga0395905_0005821 | 3300037471 | Bacteria | 12528 |
| 324 | Ga0395905_0006637 | 3300037471 | Bacteria | 11602 |
| 325 | Ga0395905_0074276 | 3300037471 | Bacteria | 3186 |
| 326 | Ga0395905_0147572 | 3300037471 | Bacteria | 2213 |
| 327 | Ga0395901_0000082 | 3300038443 | Bacteria | 130230 |
| 328 | Ga0395901_0004962 | 3300038443 | Bacteria | 13426 |
| 329 | Ga0395901_0029900 | 3300038443 | Bacteria | 5611 |
| 330 | Ga0395901_0054991 | 3300038443 | Bacteria | 4138 |
| 331 | Ga0395901_0163036 | 3300038443 | Bacteria | 2341 |
| 332 | Ga0395901_0453087 | 3300038443 | Bacteria | 1312 |
| 333 | Ga0395901_0568217 | 3300038443 | Bacteria | 1147 |
| 334 | Ga0400488_52448 | 3300038741 | Bacteria | 1173 |
| 335 | Ga0436361_0090971 | 3300039447 | Bacteria | 12275 |
| 336 | Ga0436361_0365798 | 3300039447 | Bacteria | 966 |
| 337 | Ga0436361_0419080 | 3300039447 | Bacteria | 4098 |
| 338 | Ga0436361_0428527 | 3300039447 | Bacteria | 18142 |
| 339 | Ga0436361_0570400 | 3300039447 | Bacteria | 111725 |
| 340 | Ga0436361_0642890 | 3300039447 | Bacteria | 2893 |
| 341 | Ga0436361_0722347 | 3300039447 | Bacteria | 2262 |
| 342 | Ga0436361_0750950 | 3300039447 | Bacteria | 14740 |
| 343 | Ga0439448_0000610 | 3300042005 | Bacteria | 8406 |
| 344 | Ga0439448_0059670 | 3300042005 | Bacteria | 1259 |
| 345 | Ga0439449_0039772 | 3300042007 | Bacteria | 1748 |
| 346 | Ga0439455_0008678 | 3300042012 | Bacteria | 2184 |
| 347 | Ga0439455_0089167 | 3300042012 | Bacteria | 844 |
| 348 | Ga0450904_000028 | 3300042139 | Bacteria | 33382 |
| 349 | Ga0439458_0017212 | 3300042157 | Bacteria | 1648 |
| 350 | Ga0450909_017228 | 3300042185 | Bacteria | 1070 |
| 351 | Ga0451577_0000002 | 3300042876 | Bacteria | 1731375 |
| 352 | Ga0451577_0000100 | 3300042876 | Bacteria | 191528 |
| 353 | Ga0451577_0000659 | 3300042876 | Bacteria | 54455 |
| 354 | Ga0451577_0002327 | 3300042876 | Bacteria | 22911 |
| 355 | Ga0451577_0098849 | 3300042876 | Bacteria | 2606 |
| 356 | Ga0466969_0027275 | 3300044656 | Bacteria | 2925 |
| 357 | Ga0466972_0000005 | 3300044658 | Bacteria | 289640 |
| 358 | Ga0466972_0008752 | 3300044658 | Bacteria | 5077 |
| 359 | Ga0466982_0117722 | 3300044672 | Bacteria | 1640 |
| 360 | Ga0453683_0000013 | 3300044673 | Bacteria | 371932 |
| 361 | Ga0453683_0031359 | 3300044673 | Bacteria | 3359 |
| 362 | Ga0466965_0009673 | 3300044683 | Bacteria | 4481 |
| 363 | Ga0466965_0023348 | 3300044683 | Bacteria | 2986 |
| 364 | Ga0466965_0031717 | 3300044683 | Bacteria | 2577 |
| 365 | Ga0466966_0004082 | 3300044684 | Bacteria | 9638 |
| 366 | Ga0466966_0007622 | 3300044684 | Bacteria | 7171 |
| 367 | Ga0466966_0070931 | 3300044684 | Bacteria | 2183 |
| 368 | Ga0466963_0078961 | 3300044694 | Bacteria | 2226 |
| 369 | Ga0466964_0001134 | 3300044706 | Bacteria | 8977 |
| 370 | Ga0466964_0003974 | 3300044706 | Bacteria | 5435 |
| 371 | Ga0466964_0126622 | 3300044706 | Bacteria | 1158 |
| 372 | Ga0466964_0225796 | 3300044706 | Bacteria | 911 |
| 373 | Ga0453684_0000002 | 3300044712 | Bacteria | 1731375 |
| 374 | Ga0453684_0000040 | 3300044712 | Bacteria | 690210 |
| 375 | Ga0453684_0007368 | 3300044712 | Bacteria | 20287 |
| 376 | Ga0453684_0164947 | 3300044712 | Bacteria | 2616 |
| 377 | Ga0453684_0241626 | 3300044712 | Bacteria | 2078 |
| 378 | Ga0466971_0044569 | 3300044719 | Bacteria | 1992 |
| 379 | Ga0466971_0054395 | 3300044719 | Bacteria | 1804 |
| 380 | Ga0466968_0003420 | 3300044735 | Bacteria | 5870 |
| 381 | Ga0466968_0100711 | 3300044735 | Bacteria | 1289 |
| 382 | Ga0466970_0040908 | 3300044765 | Bacteria | 2462 |
| 383 | Ga0466970_0044419 | 3300044765 | Bacteria | 2365 |
| 384 | Ga0466957_0015628 | 3300044842 | Bacteria | 4435 |
| 385 | Ga0466957_0043048 | 3300044842 | Bacteria | 2732 |
| 386 | Ga0466957_0045349 | 3300044842 | Bacteria | 2666 |
| 387 | Ga0466957_0262387 | 3300044842 | Bacteria | 1151 |
| 388 | Ga0466959_0049305 | 3300045049 | Bacteria | 3093 |
| 389 | Ga0466959_0084712 | 3300045049 | Bacteria | 2282 |
| 390 | Ga0451576_0000006 | 3300045051 | Bacteria | 949698 |
| 391 | Ga0451576_0000037 | 3300045051 | Bacteria | 372173 |
| 392 | Ga0451576_0002901 | 3300045051 | Bacteria | 24469 |
| 393 | Ga0451576_0004762 | 3300045051 | Bacteria | 17412 |
| 394 | Ga0451576_0010104 | 3300045051 | Bacteria | 10868 |
| 395 | Ga0451576_0049120 | 3300045051 | Bacteria | 4428 |
| 396 | Ga0451576_0057154 | 3300045051 | Bacteria | 4078 |
| 397 | Ga0451576_0180546 | 3300045051 | Bacteria | 2204 |
| 398 | Ga0466967_0026422 | 3300045976 | Bacteria | 4809 |
| 399 | Ga0495617_000006 | 3300046452 | Bacteria | 398279 |
| 400 | Ga0495617_000008 | 3300046452 | Bacteria | 340369 |
| 401 | Ga0495617_000266 | 3300046452 | Bacteria | 30248 |
| 402 | Ga0495617_001477 | 3300046452 | Bacteria | 10279 |
| 403 | Ga0495627_000005 | 3300046453 | Bacteria | 630805 |
| 404 | Ga0495627_000875 | 3300046453 | Bacteria | 21309 |
| 405 | Ga0495627_005133 | 3300046453 | Bacteria | 5342 |
| 406 | Ga0495627_005900 | 3300046453 | Bacteria | 4868 |
| 407 | Ga0495627_005949 | 3300046453 | Bacteria | 4847 |
| 408 | Ga0495603_0004305 | 3300046455 | Bacteria | 8486 |
| 409 | Ga0495603_0053314 | 3300046455 | Bacteria | 2399 |
| 410 | Ga0495603_0097017 | 3300046455 | Bacteria | 1722 |
| 411 | Ga0495590_0000003 | 3300046457 | Bacteria | 478593 |
| 412 | Ga0495590_0000017 | 3300046457 | Bacteria | 216944 |
| 413 | Ga0495590_0000503 | 3300046457 | Bacteria | 19192 |
| 414 | Ga0495590_0002375 | 3300046457 | Bacteria | 7800 |
| 415 | Ga0495590_0020540 | 3300046457 | Bacteria | 2346 |
| 416 | Ga0495591_000422 | 3300046458 | Bacteria | 35248 |
| 417 | Ga0495591_005545 | 3300046458 | Bacteria | 5810 |
| 418 | Ga0495629_0011641 | 3300046459 | Bacteria | 6386 |
| 419 | Ga0495629_0017844 | 3300046459 | Bacteria | 5086 |
| 420 | Ga0495629_0055565 | 3300046459 | Bacteria | 2768 |
| 421 | Ga0495629_0153862 | 3300046459 | Bacteria | 1598 |
| 422 | Ga0495638_0000118 | 3300046460 | Bacteria | 127657 |
| 423 | Ga0495638_0006736 | 3300046460 | Bacteria | 8323 |
| 424 | Ga0495638_0006752 | 3300046460 | Bacteria | 8311 |
| 425 | Ga0495638_0009676 | 3300046460 | Bacteria | 6739 |
| 426 | Ga0495638_0017799 | 3300046460 | Bacteria | 4730 |
| 427 | Ga0495638_0064674 | 3300046460 | Bacteria | 2253 |
| 428 | Ga0495638_0165865 | 3300046460 | Bacteria | 1270 |
| 429 | Ga0495651_0005122 | 3300046462 | Bacteria | 10000 |
| 430 | Ga0495651_0160577 | 3300046462 | Bacteria | 1610 |
| 431 | Ga0495653_0000011 | 3300046463 | Bacteria | 272314 |
| 432 | Ga0495653_0005746 | 3300046463 | Bacteria | 10149 |
| 433 | Ga0495653_0026997 | 3300046463 | Bacteria | 4597 |
| 434 | Ga0495653_0125048 | 3300046463 | Bacteria | 1827 |
| 435 | Ga0495653_0203607 | 3300046463 | Bacteria | 1341 |
| 436 | Ga0495650_0000015 | 3300046471 | Bacteria | 557595 |
| 437 | Ga0495650_0000131 | 3300046471 | Bacteria | 174698 |
| 438 | Ga0495650_0000147 | 3300046471 | Bacteria | 160862 |
| 439 | Ga0495650_0000195 | 3300046471 | Bacteria | 131338 |
| 440 | Ga0495650_0000235 | 3300046471 | Bacteria | 111830 |
| 441 | Ga0495650_0000544 | 3300046471 | Bacteria | 53879 |
| 442 | Ga0495650_0007013 | 3300046471 | Bacteria | 6874 |
| 443 | Ga0495650_0008107 | 3300046471 | Bacteria | 6186 |
| 444 | Ga0495650_0017789 | 3300046471 | Bacteria | 3553 |
| 445 | Ga0495650_0130183 | 3300046471 | Bacteria | 918 |
| 446 | Ga0495582_0053778 | 3300046473 | Bacteria | 2220 |
| 447 | Ga0495582_0108862 | 3300046473 | Bacteria | 1556 |
| 448 | Ga0495605_0000083 | 3300046474 | Bacteria | 124953 |
| 449 | Ga0495605_0000217 | 3300046474 | Bacteria | 71011 |
| 450 | Ga0495605_0004393 | 3300046474 | Bacteria | 8298 |
| 451 | Ga0495605_0006723 | 3300046474 | Bacteria | 6577 |
| 452 | Ga0495605_0008428 | 3300046474 | Bacteria | 5828 |
| 453 | Ga0495605_0016725 | 3300046474 | Bacteria | 3964 |
| 454 | Ga0495605_0021516 | 3300046474 | Bacteria | 3415 |
| 455 | Ga0495605_0021532 | 3300046474 | Bacteria | 3413 |
| 456 | Ga0495605_0028280 | 3300046474 | Bacteria | 2895 |
| 457 | Ga0495605_0042170 | 3300046474 | Bacteria | 2270 |
| 458 | Ga0495605_0048261 | 3300046474 | Bacteria | 2085 |
| 459 | Ga0495605_0096857 | 3300046474 | Bacteria | 1360 |
| 460 | Ga0495639_0218680 | 3300046475 | Bacteria | 936 |
| 461 | Ga0495584_0000299 | 3300046491 | Bacteria | 34978 |
| 462 | Ga0495584_0000342 | 3300046491 | Bacteria | 32246 |
| 463 | Ga0495584_0000705 | 3300046491 | Bacteria | 22028 |
| 464 | Ga0495584_0000746 | 3300046491 | Bacteria | 21471 |
| 465 | Ga0495584_0000845 | 3300046491 | Bacteria | 19802 |
| 466 | Ga0495584_0004000 | 3300046491 | Bacteria | 7954 |
| 467 | Ga0495584_0007583 | 3300046491 | Bacteria | 5657 |
| 468 | Ga0495584_0015337 | 3300046491 | Bacteria | 3904 |
| 469 | Ga0495584_0024923 | 3300046491 | Bacteria | 3033 |
| 470 | Ga0495584_0028659 | 3300046491 | Bacteria | 2822 |
| 471 | Ga0495584_0031332 | 3300046491 | Bacteria | 2692 |
| 472 | Ga0495584_0033227 | 3300046491 | Bacteria | 2609 |
| 473 | Ga0495584_0108558 | 3300046491 | Bacteria | 1403 |
| 474 | Ga0495585_0000220 | 3300046492 | Bacteria | 59319 |
| 475 | Ga0495585_0000528 | 3300046492 | Bacteria | 36112 |
| 476 | Ga0495585_0000602 | 3300046492 | Bacteria | 33597 |
| 477 | Ga0495585_0000632 | 3300046492 | Bacteria | 32470 |
| 478 | Ga0495585_0000698 | 3300046492 | Bacteria | 30500 |
| 479 | Ga0495585_0001112 | 3300046492 | Bacteria | 22162 |
| 480 | Ga0495585_0002112 | 3300046492 | Bacteria | 14531 |
| 481 | Ga0495585_0008887 | 3300046492 | Bacteria | 6061 |
| 482 | Ga0495585_0010467 | 3300046492 | Bacteria | 5516 |
| 483 | Ga0495585_0016155 | 3300046492 | Bacteria | 4326 |
| 484 | Ga0495585_0021725 | 3300046492 | Bacteria | 3685 |
| 485 | Ga0495585_0041232 | 3300046492 | Bacteria | 2589 |
| 486 | Ga0495585_0045008 | 3300046492 | Bacteria | 2464 |
| 487 | Ga0495585_0054828 | 3300046492 | Bacteria | 2203 |
| 488 | Ga0495585_0082473 | 3300046492 | Bacteria | 1740 |
| 489 | Ga0495585_0091941 | 3300046492 | Bacteria | 1633 |
| 490 | Ga0495585_0096659 | 3300046492 | Bacteria | 1584 |
| 491 | Ga0495585_0128676 | 3300046492 | Bacteria | 1334 |
| 492 | Ga0495585_0167632 | 3300046492 | Bacteria | 1136 |
| 493 | Ga0495585_0250307 | 3300046492 | Bacteria | 884 |
| 494 | Ga0495594_0018879 | 3300046499 | Bacteria | 3658 |
| 495 | Ga0495594_0042392 | 3300046499 | Bacteria | 2492 |
| 496 | Ga0495594_0047774 | 3300046499 | Bacteria | 2350 |
| 497 | Ga0495594_0065917 | 3300046499 | Bacteria | 2008 |
| 498 | Ga0495594_0073300 | 3300046499 | Bacteria | 1905 |
| 499 | Ga0495594_0173538 | 3300046499 | Bacteria | 1226 |
| 500 | Ga0495596_0001508 | 3300046500 | Bacteria | 13314 |
| 501 | Ga0495596_0001881 | 3300046500 | Bacteria | 11652 |
| 502 | Ga0495596_0002776 | 3300046500 | Bacteria | 9175 |
| 503 | Ga0495596_0003502 | 3300046500 | Bacteria | 7921 |
| 504 | Ga0495596_0003776 | 3300046500 | Bacteria | 7558 |
| 505 | Ga0495596_0013407 | 3300046500 | Bacteria | 3479 |
| 506 | Ga0495596_0013489 | 3300046500 | Bacteria | 3465 |
| 507 | Ga0495596_0018135 | 3300046500 | Bacteria | 2904 |
| 508 | Ga0495596_0021112 | 3300046500 | Bacteria | 2660 |
| 509 | Ga0495596_0028276 | 3300046500 | Bacteria | 2252 |
| 510 | Ga0495596_0166268 | 3300046500 | Bacteria | 857 |
| 511 | Ga0495607_0002851 | 3300046501 | Bacteria | 13697 |
| 512 | Ga0495607_0003020 | 3300046501 | Bacteria | 13134 |
| 513 | Ga0495607_0003492 | 3300046501 | Bacteria | 12024 |
| 514 | Ga0495607_0006266 | 3300046501 | Bacteria | 8388 |
| 515 | Ga0495607_0019094 | 3300046501 | Bacteria | 4358 |
| 516 | Ga0495607_0038851 | 3300046501 | Bacteria | 2847 |
| 517 | Ga0495607_0040829 | 3300046501 | Bacteria | 2759 |
| 518 | Ga0495607_0078683 | 3300046501 | Bacteria | 1818 |
| 519 | Ga0495583_0000049 | 3300046506 | Bacteria | 216069 |
| 520 | Ga0495583_0000079 | 3300046506 | Bacteria | 169681 |
| 521 | Ga0495583_0000104 | 3300046506 | Bacteria | 142553 |
| 522 | Ga0495583_0000165 | 3300046506 | Bacteria | 111940 |
| 523 | Ga0495583_0002165 | 3300046506 | Bacteria | 17538 |
| 524 | Ga0495583_0002622 | 3300046506 | Bacteria | 15031 |
| 525 | Ga0495583_0006440 | 3300046506 | Bacteria | 7677 |
| 526 | Ga0495583_0009396 | 3300046506 | Bacteria | 5846 |
| 527 | Ga0495583_0013169 | 3300046506 | Bacteria | 4631 |
| 528 | Ga0495583_0164270 | 3300046506 | Bacteria | 914 |
| 529 | Ga0495606_0000185 | 3300046507 | Bacteria | 109977 |
| 530 | Ga0495606_0000284 | 3300046507 | Bacteria | 88119 |
| 531 | Ga0495606_0000345 | 3300046507 | Bacteria | 79767 |
| 532 | Ga0495606_0000420 | 3300046507 | Bacteria | 70941 |
| 533 | Ga0495606_0001704 | 3300046507 | Bacteria | 28383 |
| 534 | Ga0495606_0008082 | 3300046507 | Bacteria | 9233 |
| 535 | Ga0495606_0008707 | 3300046507 | Bacteria | 8739 |
| 536 | Ga0495606_0014205 | 3300046507 | Bacteria | 6231 |
| 537 | Ga0495606_0017585 | 3300046507 | Bacteria | 5397 |
| 538 | Ga0495606_0018936 | 3300046507 | Bacteria | 5144 |
| 539 | Ga0495606_0120033 | 3300046507 | Bacteria | 1574 |
| 540 | Ga0495606_0285430 | 3300046507 | Bacteria | 900 |
| 541 | Ga0495608_0003435 | 3300046511 | Bacteria | 11346 |
| 542 | Ga0495610_0000004 | 3300046512 | Bacteria | 1006135 |
| 543 | Ga0495610_0002736 | 3300046512 | Bacteria | 14494 |
| 544 | Ga0495610_0008234 | 3300046512 | Bacteria | 6791 |
| 545 | Ga0495610_0024787 | 3300046512 | Bacteria | 3232 |
| 546 | Ga0495610_0026324 | 3300046512 | Bacteria | 3107 |
| 547 | Ga0495610_0085542 | 3300046512 | Bacteria | 1438 |
| 548 | Ga0495610_0152305 | 3300046512 | Bacteria | 985 |
| 549 | Ga0495616_0000042 | 3300046513 | Bacteria | 120923 |
| 550 | Ga0495616_0000050 | 3300046513 | Bacteria | 108049 |
| 551 | Ga0495616_0004009 | 3300046513 | Bacteria | 9361 |
| 552 | Ga0495616_0004772 | 3300046513 | Bacteria | 8493 |
| 553 | Ga0495616_0005062 | 3300046513 | Bacteria | 8201 |
| 554 | Ga0495616_0005894 | 3300046513 | Bacteria | 7475 |
| 555 | Ga0495616_0006157 | 3300046513 | Bacteria | 7307 |
| 556 | Ga0495616_0007182 | 3300046513 | Bacteria | 6677 |
| 557 | Ga0495616_0008372 | 3300046513 | Bacteria | 6134 |
| 558 | Ga0495616_0011401 | 3300046513 | Bacteria | 5094 |
| 559 | Ga0495616_0033068 | 3300046513 | Bacteria | 2697 |
| 560 | Ga0495616_0034885 | 3300046513 | Bacteria | 2607 |
| 561 | Ga0495616_0059030 | 3300046513 | Bacteria | 1887 |
| 562 | Ga0495616_0069344 | 3300046513 | Bacteria | 1709 |
| 563 | Ga0495616_0083259 | 3300046513 | Bacteria | 1526 |
| 564 | Ga0495618_0014933 | 3300046514 | Bacteria | 4736 |
| 565 | Ga0495620_0031914 | 3300046515 | Bacteria | 2406 |
| 566 | Ga0495628_0002806 | 3300046516 | Bacteria | 15641 |
| 567 | Ga0495628_0038904 | 3300046516 | Bacteria | 3805 |
| 568 | Ga0495630_0005242 | 3300046517 | Bacteria | 9139 |
| 569 | Ga0495631_0000987 | 3300046518 | Bacteria | 17648 |
| 570 | Ga0495631_0006001 | 3300046518 | Bacteria | 6316 |
| 571 | Ga0495631_0011111 | 3300046518 | Bacteria | 4438 |
| 572 | Ga0495631_0011754 | 3300046518 | Bacteria | 4293 |
| 573 | Ga0495631_0014350 | 3300046518 | Bacteria | 3826 |
| 574 | Ga0495631_0083084 | 3300046518 | Bacteria | 1380 |
| 575 | Ga0495631_0166860 | 3300046518 | Bacteria | 944 |
| 576 | Ga0495632_0000065 | 3300046519 | Bacteria | 116086 |
| 577 | Ga0495632_0000366 | 3300046519 | Bacteria | 43010 |
| 578 | Ga0495632_0001943 | 3300046519 | Bacteria | 16506 |
| 579 | Ga0495632_0003798 | 3300046519 | Bacteria | 10539 |
| 580 | Ga0495632_0007490 | 3300046519 | Bacteria | 6848 |
| 581 | Ga0495632_0008727 | 3300046519 | Bacteria | 6180 |
| 582 | Ga0495632_0014198 | 3300046519 | Bacteria | 4516 |
| 583 | Ga0495632_0016346 | 3300046519 | Bacteria | 4131 |
| 584 | Ga0495632_0075798 | 3300046519 | Bacteria | 1609 |
| 585 | Ga0495637_0000026 | 3300046520 | Bacteria | 158526 |
| 586 | Ga0495637_0002176 | 3300046520 | Bacteria | 10961 |
| 587 | Ga0495637_0012789 | 3300046520 | Bacteria | 4005 |
| 588 | Ga0495637_0089006 | 3300046520 | Bacteria | 1220 |
| 589 | Ga0495643_0000072 | 3300046522 | Bacteria | 168679 |
| 590 | Ga0495643_0000505 | 3300046522 | Bacteria | 48848 |
| 591 | Ga0495643_0001311 | 3300046522 | Bacteria | 23623 |
| 592 | Ga0495643_0005672 | 3300046522 | Bacteria | 8365 |
| 593 | Ga0495643_0007665 | 3300046522 | Bacteria | 6923 |
| 594 | Ga0495643_0020093 | 3300046522 | Bacteria | 3857 |
| 595 | Ga0495643_0020179 | 3300046522 | Bacteria | 3848 |
| 596 | Ga0495643_0024033 | 3300046522 | Bacteria | 3459 |
| 597 | Ga0495643_0225335 | 3300046522 | Bacteria | 887 |
| 598 | Ga0495644_0000141 | 3300046523 | Bacteria | 34630 |
| 599 | Ga0495644_0002000 | 3300046523 | Bacteria | 8191 |
| 600 | Ga0495644_0006632 | 3300046523 | Bacteria | 4486 |
| 601 | Ga0495644_0011914 | 3300046523 | Bacteria | 3343 |
| 602 | Ga0495644_0012414 | 3300046523 | Bacteria | 3277 |
| 603 | Ga0495644_0025488 | 3300046523 | Bacteria | 2244 |
| 604 | Ga0495644_0027233 | 3300046523 | Bacteria | 2166 |
| 605 | Ga0495644_0067709 | 3300046523 | Bacteria | 1341 |
| 606 | Ga0495648_0000055 | 3300046524 | Bacteria | 158686 |
| 607 | Ga0495648_0000070 | 3300046524 | Bacteria | 136680 |
| 608 | Ga0495648_0001095 | 3300046524 | Bacteria | 27577 |
| 609 | Ga0495648_0002247 | 3300046524 | Bacteria | 18047 |
| 610 | Ga0495648_0002560 | 3300046524 | Bacteria | 16660 |
| 611 | Ga0495648_0007064 | 3300046524 | Bacteria | 9048 |
| 612 | Ga0495648_0009431 | 3300046524 | Bacteria | 7570 |
| 613 | Ga0495648_0010832 | 3300046524 | Bacteria | 6923 |
| 614 | Ga0495648_0011490 | 3300046524 | Bacteria | 6663 |
| 615 | Ga0495648_0017601 | 3300046524 | Bacteria | 5101 |
| 616 | Ga0495648_0030317 | 3300046524 | Bacteria | 3578 |
| 617 | Ga0495648_0050631 | 3300046524 | Bacteria | 2536 |
| 618 | Ga0495648_0110937 | 3300046524 | Bacteria | 1493 |
| 619 | Ga0495648_0112078 | 3300046524 | Bacteria | 1482 |
| 620 | Ga0495666_0001731 | 3300046526 | Bacteria | 10764 |
| 621 | Ga0495666_0003697 | 3300046526 | Bacteria | 7729 |
| 622 | Ga0495666_0022422 | 3300046526 | Bacteria | 3127 |
| 623 | Ga0495666_0069571 | 3300046526 | Bacteria | 1674 |
| 624 | Ga0495666_0105333 | 3300046526 | Bacteria | 1327 |
| 625 | Ga0495642_0000666 | 3300046528 | Bacteria | 17171 |
| 626 | Ga0495642_0003405 | 3300046528 | Bacteria | 6277 |
| 627 | Ga0495642_0007840 | 3300046528 | Bacteria | 4092 |
| 628 | Ga0495642_0007918 | 3300046528 | Bacteria | 4072 |
| 629 | Ga0495642_0008448 | 3300046528 | Bacteria | 3940 |
| 630 | Ga0495642_0009122 | 3300046528 | Bacteria | 3797 |
| 631 | Ga0495642_0016062 | 3300046528 | Bacteria | 2914 |
| 632 | Ga0495642_0023119 | 3300046528 | Bacteria | 2452 |
| 633 | Ga0495642_0031834 | 3300046528 | Bacteria | 2115 |
| 634 | Ga0495642_0091922 | 3300046528 | Bacteria | 1285 |
| 635 | Ga0495652_0004262 | 3300046529 | Bacteria | 13739 |
| 636 | Ga0495652_0012306 | 3300046529 | Bacteria | 7725 |
| 637 | Ga0495652_0034750 | 3300046529 | Bacteria | 4392 |
| 638 | Ga0495652_0214554 | 3300046529 | Bacteria | 1450 |
| 639 | Ga0495652_0243868 | 3300046529 | Bacteria | 1335 |
| 640 | Ga0495654_0000035 | 3300046530 | Bacteria | 192768 |
| 641 | Ga0495654_0003918 | 3300046530 | Bacteria | 8986 |
| 642 | Ga0495654_0003954 | 3300046530 | Bacteria | 8943 |
| 643 | Ga0495654_0022609 | 3300046530 | Bacteria | 3262 |
| 644 | Ga0495654_0054188 | 3300046530 | Bacteria | 1946 |
| 645 | Ga0495665_0002989 | 3300046531 | Bacteria | 9136 |
| 646 | Ga0495665_0047907 | 3300046531 | Bacteria | 2267 |
| 647 | Ga0495640_0011612 | 3300046533 | Bacteria | 6768 |
| 648 | Ga0495586_0008531 | 3300046535 | Bacteria | 5454 |
| 649 | Ga0495586_0020084 | 3300046535 | Bacteria | 3558 |
| 650 | Ga0495587_0042307 | 3300046536 | Bacteria | 2717 |
| 651 | Ga0495587_0294362 | 3300046536 | Bacteria | 908 |
| 652 | Ga0495609_0000002 | 3300046538 | Bacteria | 739816 |
| 653 | Ga0495609_0001001 | 3300046538 | Bacteria | 20074 |
| 654 | Ga0495609_0001049 | 3300046538 | Bacteria | 19390 |
| 655 | Ga0495609_0001257 | 3300046538 | Bacteria | 17406 |
| 656 | Ga0495609_0003784 | 3300046538 | Bacteria | 8521 |
| 657 | Ga0495609_0008596 | 3300046538 | Bacteria | 4986 |
| 658 | Ga0495609_0011101 | 3300046538 | Bacteria | 4301 |
| 659 | Ga0495609_0024337 | 3300046538 | Bacteria | 2778 |
| 660 | Ga0495609_0043774 | 3300046538 | Bacteria | 2009 |
| 661 | Ga0495621_0088182 | 3300046539 | Bacteria | 1166 |
| 662 | Ga0495597_0000206 | 3300046542 | Bacteria | 53783 |
| 663 | Ga0495597_0000336 | 3300046542 | Bacteria | 42095 |
| 664 | Ga0495597_0000583 | 3300046542 | Bacteria | 30220 |
| 665 | Ga0495597_0000881 | 3300046542 | Bacteria | 23360 |
| 666 | Ga0495597_0001302 | 3300046542 | Bacteria | 18321 |
| 667 | Ga0495597_0001581 | 3300046542 | Bacteria | 16005 |
| 668 | Ga0495597_0042685 | 3300046542 | Bacteria | 2021 |
| 669 | Ga0495645_0013625 | 3300046543 | Bacteria | 5758 |
| 670 | Ga0495645_0124220 | 3300046543 | Bacteria | 1815 |
| 671 | Ga0495622_0000004 | 3300046557 | Bacteria | 258984 |
| 672 | Ga0495622_0000439 | 3300046557 | Bacteria | 26982 |
| 673 | Ga0495622_0007502 | 3300046557 | Bacteria | 5061 |
| 674 | Ga0495622_0020800 | 3300046557 | Bacteria | 3054 |
| 675 | Ga0495622_0047789 | 3300046557 | Bacteria | 1988 |
| 676 | Ga0495622_0057549 | 3300046557 | Bacteria | 1802 |
| 677 | Ga0495622_0094466 | 3300046557 | Bacteria | 1372 |
| 678 | Ga0495633_0000164 | 3300046558 | Bacteria | 87086 |
| 679 | Ga0495633_0000543 | 3300046558 | Bacteria | 37615 |
| 680 | Ga0495633_0000586 | 3300046558 | Bacteria | 35284 |
| 681 | Ga0495633_0001593 | 3300046558 | Bacteria | 17200 |
| 682 | Ga0495633_0003096 | 3300046558 | Bacteria | 11293 |
| 683 | Ga0495633_0003665 | 3300046558 | Bacteria | 10147 |
| 684 | Ga0495633_0005280 | 3300046558 | Bacteria | 7949 |
| 685 | Ga0495633_0005319 | 3300046558 | Bacteria | 7902 |
| 686 | Ga0495633_0016848 | 3300046558 | Bacteria | 3752 |
| 687 | Ga0495633_0039482 | 3300046558 | Bacteria | 2252 |
| 688 | Ga0495633_0062630 | 3300046558 | Bacteria | 1741 |
| 689 | Ga0495667_0084750 | 3300046559 | Bacteria | 2057 |
| 690 | Ga0495656_0016272 | 3300046615 | Bacteria | 2820 |
| 691 | Ga0495656_0019489 | 3300046615 | Bacteria | 2618 |
| 692 | Ga0495656_0039628 | 3300046615 | Bacteria | 1958 |
| 693 | Ga0495668_0000094 | 3300046616 | Bacteria | 141412 |
| 694 | Ga0495668_0000168 | 3300046616 | Bacteria | 97230 |
| 695 | Ga0495668_0000817 | 3300046616 | Bacteria | 35718 |
| 696 | Ga0495668_0001384 | 3300046616 | Bacteria | 23652 |
| 697 | Ga0495668_0001922 | 3300046616 | Bacteria | 18473 |
| 698 | Ga0495668_0002470 | 3300046616 | Bacteria | 15205 |
| 699 | Ga0495668_0004743 | 3300046616 | Bacteria | 9520 |
| 700 | Ga0495668_0007391 | 3300046616 | Bacteria | 7032 |
| 701 | Ga0495668_0007896 | 3300046616 | Bacteria | 6721 |
| 702 | Ga0495668_0010480 | 3300046616 | Bacteria | 5607 |
| 703 | Ga0495668_0031173 | 3300046616 | Bacteria | 3005 |
| 704 | Ga0495668_0033683 | 3300046616 | Bacteria | 2876 |
| 705 | Ga0495668_0037535 | 3300046616 | Bacteria | 2710 |
| 706 | Ga0495668_0042253 | 3300046616 | Bacteria | 2538 |
| 707 | Ga0495668_0044266 | 3300046616 | Bacteria | 2474 |
| 708 | Ga0495668_0045102 | 3300046616 | Bacteria | 2449 |
| 709 | Ga0495668_0080586 | 3300046616 | Bacteria | 1786 |
| 710 | Ga0495634_0004336 | 3300046642 | Bacteria | 11179 |
| 711 | Ga0495611_0000096 | 3300046648 | Bacteria | 60765 |
| 712 | Ga0495611_0004154 | 3300046648 | Bacteria | 6303 |
| 713 | Ga0495611_0007960 | 3300046648 | Bacteria | 4501 |
| 714 | Ga0495611_0017073 | 3300046648 | Bacteria | 3102 |
| 715 | Ga0495611_0018218 | 3300046648 | Bacteria | 3009 |
| 716 | Ga0495611_0026951 | 3300046648 | Bacteria | 2509 |
| 717 | Ga0495611_0067917 | 3300046648 | Bacteria | 1627 |
| 718 | Ga0495611_0118764 | 3300046648 | Bacteria | 1232 |
| 719 | Ga0495611_0192620 | 3300046648 | Bacteria | 951 |
| 720 | Ga0495611_0203646 | 3300046648 | Bacteria | 922 |
| 721 | Ga0495625_0000038 | 3300046660 | Bacteria | 211808 |
| 722 | Ga0495625_0002151 | 3300046660 | Bacteria | 21922 |
| 723 | Ga0495625_0005938 | 3300046660 | Bacteria | 10987 |
| 724 | Ga0495625_0007321 | 3300046660 | Bacteria | 9641 |
| 725 | Ga0495625_0009931 | 3300046660 | Bacteria | 7915 |
| 726 | Ga0495625_0041884 | 3300046660 | Bacteria | 3331 |
| 727 | Ga0495625_0069064 | 3300046660 | Bacteria | 2482 |
| 728 | Ga0495625_0083440 | 3300046660 | Bacteria | 2221 |
| 729 | Ga0495625_0099004 | 3300046660 | Bacteria | 2005 |
| 730 | Ga0495625_0100150 | 3300046660 | Bacteria | 1992 |
| 731 | Ga0495635_0009877 | 3300046663 | Bacteria | 6670 |
| 732 | Ga0495659_0000031 | 3300046664 | Bacteria | 65868 |
| 733 | Ga0495659_0000720 | 3300046664 | Bacteria | 11881 |
| 734 | Ga0495659_0002794 | 3300046664 | Bacteria | 5607 |
| 735 | Ga0495661_0000364 | 3300046665 | Bacteria | 49059 |
| 736 | Ga0495661_0001138 | 3300046665 | Bacteria | 23241 |
| 737 | Ga0495661_0001818 | 3300046665 | Bacteria | 17111 |
| 738 | Ga0495661_0004336 | 3300046665 | Bacteria | 10266 |
| 739 | Ga0495661_0009595 | 3300046665 | Bacteria | 6632 |
| 740 | Ga0495661_0014691 | 3300046665 | Bacteria | 5243 |
| 741 | Ga0495661_0016170 | 3300046665 | Bacteria | 4954 |
| 742 | Ga0495661_0021194 | 3300046665 | Bacteria | 4238 |
| 743 | Ga0495661_0037875 | 3300046665 | Bacteria | 3008 |
| 744 | Ga0495661_0044678 | 3300046665 | Bacteria | 2714 |
| 745 | Ga0495661_0045137 | 3300046665 | Bacteria | 2696 |
| 746 | Ga0495661_0051648 | 3300046665 | Bacteria | 2481 |
| 747 | Ga0495661_0053093 | 3300046665 | Bacteria | 2439 |
| 748 | Ga0495661_0081428 | 3300046665 | Bacteria | 1865 |
| 749 | Ga0495661_0142514 | 3300046665 | Bacteria | 1302 |
| 750 | Ga0495661_0284887 | 3300046665 | Bacteria | 831 |
| 751 | Ga0495588_0000067 | 3300046674 | Bacteria | 238958 |
| 752 | Ga0495588_0003514 | 3300046674 | Bacteria | 6835 |
| 753 | Ga0495588_0006100 | 3300046674 | Bacteria | 5410 |
| 754 | Ga0495588_0009883 | 3300046674 | Bacteria | 4423 |
| 755 | Ga0495588_0016723 | 3300046674 | Bacteria | 3548 |
| 756 | Ga0495588_0025591 | 3300046674 | Bacteria | 2941 |
| 757 | Ga0495588_0035193 | 3300046674 | Bacteria | 2537 |
| 758 | Ga0495588_0110679 | 3300046674 | Bacteria | 1446 |
| 759 | Ga0495588_0118948 | 3300046674 | Bacteria | 1392 |
| 760 | Ga0495657_0083231 | 3300046675 | Bacteria | 2066 |
| 761 | Ga0495599_0077411 | 3300046678 | Bacteria | 2076 |
| 762 | Ga0495623_0010056 | 3300046679 | Bacteria | 6125 |
| 763 | Ga0495623_0045450 | 3300046679 | Bacteria | 2789 |
| 764 | Ga0495623_0098508 | 3300046679 | Bacteria | 1784 |
| 765 | Ga0495623_0166649 | 3300046679 | Bacteria | 1290 |
| 766 | Ga0495623_0273503 | 3300046679 | Bacteria | 942 |
| 767 | Ga0495646_0010988 | 3300046680 | Bacteria | 5752 |
| 768 | Ga0495646_0017130 | 3300046680 | Bacteria | 4599 |
| 769 | Ga0495658_0340154 | 3300046683 | Bacteria | 953 |
| 770 | Ga0495669_0000177 | 3300046684 | Bacteria | 40130 |
| 771 | Ga0495669_0003158 | 3300046684 | Bacteria | 6785 |
| 772 | Ga0495669_0003891 | 3300046684 | Bacteria | 6142 |
| 773 | Ga0495669_0005299 | 3300046684 | Bacteria | 5374 |
| 774 | Ga0495669_0006175 | 3300046684 | Bacteria | 4998 |
| 775 | Ga0495669_0011457 | 3300046684 | Bacteria | 3764 |
| 776 | Ga0495669_0014271 | 3300046684 | Bacteria | 3397 |
| 777 | Ga0495613_0286399 | 3300046689 | Bacteria | 1143 |
| 778 | Ga0495624_0007465 | 3300046690 | Bacteria | 7672 |
| 779 | Ga0495624_0010581 | 3300046690 | Bacteria | 6356 |
| 780 | Ga0495624_0345217 | 3300046690 | Bacteria | 895 |
| 781 | Ga0495670_0002112 | 3300046691 | Bacteria | 9811 |
| 782 | Ga0495670_0002534 | 3300046691 | Bacteria | 9027 |
| 783 | Ga0495670_0002838 | 3300046691 | Bacteria | 8565 |
| 784 | Ga0495670_0006434 | 3300046691 | Bacteria | 5768 |
| 785 | Ga0495670_0007570 | 3300046691 | Bacteria | 5337 |
| 786 | Ga0495670_0009893 | 3300046691 | Bacteria | 4689 |
| 787 | Ga0495670_0011053 | 3300046691 | Bacteria | 4439 |
| 788 | Ga0495670_0098079 | 3300046691 | Bacteria | 1506 |
| 789 | Ga0495670_0100308 | 3300046691 | Bacteria | 1490 |
| 790 | Ga0495671_0000001 | 3300046692 | Bacteria | 1169494 |
| 791 | Ga0495671_0000109 | 3300046692 | Bacteria | 74002 |
| 792 | Ga0495671_0001415 | 3300046692 | Bacteria | 16132 |
| 793 | Ga0495671_0003874 | 3300046692 | Bacteria | 9095 |
| 794 | Ga0495671_0006218 | 3300046692 | Bacteria | 6922 |
| 795 | Ga0495671_0007902 | 3300046692 | Bacteria | 6015 |
| 796 | Ga0495671_0058007 | 3300046692 | Bacteria | 1915 |
| 797 | Ga0495649_0001646 | 3300046694 | Bacteria | 16617 |
| 798 | Ga0495649_0005874 | 3300046694 | Bacteria | 7714 |
| 799 | Ga0495649_0006349 | 3300046694 | Bacteria | 7356 |
| 800 | Ga0495649_0008724 | 3300046694 | Bacteria | 6081 |
| 801 | Ga0495649_0028656 | 3300046694 | Bacteria | 3086 |
| 802 | Ga0495649_0032533 | 3300046694 | Bacteria | 2872 |
| 803 | Ga0495649_0107756 | 3300046694 | Bacteria | 1478 |
| 804 | Ga0495589_0000009 | 3300046794 | Bacteria | 256265 |
| 805 | Ga0495589_0000256 | 3300046794 | Bacteria | 43404 |
| 806 | Ga0495589_0001110 | 3300046794 | Bacteria | 16053 |
| 807 | Ga0495589_0002070 | 3300046794 | Bacteria | 11356 |
| 808 | Ga0495589_0012135 | 3300046794 | Bacteria | 4467 |
| 809 | Ga0495589_0019379 | 3300046794 | Bacteria | 3488 |
| 810 | Ga0495589_0027938 | 3300046794 | Bacteria | 2851 |
| 811 | Ga0495589_0078240 | 3300046794 | Bacteria | 1610 |
| 812 | Ga0495589_0161251 | 3300046794 | Bacteria | 1068 |
| 813 | Ga0495600_0000501 | 3300046809 | Bacteria | 20345 |
| 814 | Ga0495660_0000308 | 3300046810 | Bacteria | 44364 |
| 815 | Ga0495660_0000424 | 3300046810 | Bacteria | 35801 |
| 816 | Ga0495660_0002261 | 3300046810 | Bacteria | 12387 |
| 817 | Ga0495660_0006124 | 3300046810 | Bacteria | 7142 |
| 818 | Ga0495660_0006898 | 3300046810 | Bacteria | 6689 |
| 819 | Ga0495660_0024061 | 3300046810 | Bacteria | 3470 |
| 820 | Ga0495660_0024988 | 3300046810 | Bacteria | 3396 |
| 821 | Ga0495660_0030453 | 3300046810 | Bacteria | 3039 |
| 822 | Ga0495660_0036047 | 3300046810 | Bacteria | 2760 |
| 823 | Ga0495660_0095910 | 3300046810 | Bacteria | 1533 |
| 824 | Ga0495660_0114609 | 3300046810 | Bacteria | 1371 |
| 825 | Ga0495581_0005282 | 3300047315 | Bacteria | 7470 |
| 826 | Ga0495581_0064928 | 3300047315 | Bacteria | 2109 |
| 827 | Ga0495604_0006239 | 3300047317 | Bacteria | 9458 |
| 828 | Ga0495604_0007130 | 3300047317 | Bacteria | 8860 |
| 829 | Ga0495604_0037609 | 3300047317 | Bacteria | 3810 |
| 830 | Ga0495604_0039700 | 3300047317 | Bacteria | 3698 |
| 831 | Ga0495604_0119954 | 3300047317 | Bacteria | 1905 |
| 832 | Ga0495636_0001712 | 3300047318 | Bacteria | 8365 |
| 833 | Ga0495636_0002924 | 3300047318 | Bacteria | 6607 |
| 834 | Ga0495636_0003699 | 3300047318 | Bacteria | 5948 |
| 835 | Ga0495636_0032036 | 3300047318 | Bacteria | 2155 |
| 836 | Ga0495636_0036621 | 3300047318 | Bacteria | 2024 |
| 837 | Ga0495674_0027636 | 3300047319 | Bacteria | 5182 |
| 838 | Ga0495672_0000195 | 3300047320 | Bacteria | 86608 |
| 839 | Ga0495672_0000209 | 3300047320 | Bacteria | 83909 |
| 840 | Ga0495672_0000580 | 3300047320 | Bacteria | 41398 |
| 841 | Ga0495672_0000715 | 3300047320 | Bacteria | 36439 |
| 842 | Ga0495672_0000886 | 3300047320 | Bacteria | 31476 |
| 843 | Ga0495672_0001063 | 3300047320 | Bacteria | 28042 |
| 844 | Ga0495672_0002048 | 3300047320 | Bacteria | 18938 |
| 845 | Ga0495672_0012412 | 3300047320 | Bacteria | 5946 |
| 846 | Ga0495672_0023031 | 3300047320 | Bacteria | 4038 |
| 847 | Ga0495672_0048673 | 3300047320 | Bacteria | 2513 |
| 848 | Ga0495672_0064463 | 3300047320 | Bacteria | 2098 |
| 849 | Ga0495672_0200460 | 3300047320 | Bacteria | 998 |
| 850 | Ga0495676_0000037 | 3300047321 | Bacteria | 115856 |
| 851 | Ga0495676_0005490 | 3300047321 | Bacteria | 11631 |
| 852 | Ga0495676_0038777 | 3300047321 | Bacteria | 3954 |
| 853 | Ga0495683_0000430 | 3300047323 | Bacteria | 33332 |
| 854 | Ga0495683_0001600 | 3300047323 | Bacteria | 14579 |
| 855 | Ga0495683_0009442 | 3300047323 | Bacteria | 5196 |
| 856 | Ga0495683_0016755 | 3300047323 | Bacteria | 3803 |
| 857 | Ga0495683_0028397 | 3300047323 | Bacteria | 2860 |
| 858 | Ga0495683_0028490 | 3300047323 | Bacteria | 2854 |
| 859 | Ga0495683_0080948 | 3300047323 | Bacteria | 1584 |
| 860 | Ga0495683_0189835 | 3300047323 | Bacteria | 933 |
| 861 | Ga0495687_000013 | 3300047443 | Bacteria | 371058 |
| 862 | Ga0495687_000064 | 3300047443 | Bacteria | 163468 |
| 863 | Ga0495687_000116 | 3300047443 | Bacteria | 122687 |
| 864 | Ga0495687_000173 | 3300047443 | Bacteria | 95361 |
| 865 | Ga0495687_003092 | 3300047443 | Bacteria | 12465 |
| 866 | Ga0495687_004504 | 3300047443 | Bacteria | 9367 |
| 867 | Ga0495687_005106 | 3300047443 | Bacteria | 8507 |
| 868 | Ga0495687_011449 | 3300047443 | Bacteria | 4769 |
| 869 | Ga0495687_021312 | 3300047443 | Bacteria | 3138 |
| 870 | Ga0495687_035164 | 3300047443 | Bacteria | 2256 |
| 871 | Ga0495675_0004671 | 3300047444 | Bacteria | 8318 |
| 872 | Ga0495675_0183360 | 3300047444 | Bacteria | 1280 |
| 873 | Ga0495677_0000142 | 3300047445 | Bacteria | 34317 |
| 874 | Ga0495677_0000264 | 3300047445 | Bacteria | 22980 |
| 875 | Ga0495677_0002086 | 3300047445 | Bacteria | 7952 |
| 876 | Ga0495677_0002485 | 3300047445 | Bacteria | 7233 |
| 877 | Ga0495677_0002532 | 3300047445 | Bacteria | 7145 |
| 878 | Ga0495677_0003780 | 3300047445 | Bacteria | 5853 |
| 879 | Ga0495677_0005167 | 3300047445 | Bacteria | 4967 |
| 880 | Ga0495677_0011190 | 3300047445 | Bacteria | 3284 |
| 881 | Ga0495677_0013174 | 3300047445 | Bacteria | 3008 |
| 882 | Ga0495677_0014300 | 3300047445 | Bacteria | 2890 |
| 883 | Ga0495677_0018362 | 3300047445 | Bacteria | 2535 |
| 884 | Ga0495677_0032203 | 3300047445 | Bacteria | 1909 |
| 885 | Ga0495677_0035682 | 3300047445 | Bacteria | 1814 |
| 886 | Ga0495677_0037294 | 3300047445 | Bacteria | 1776 |
| 887 | Ga0495677_0052839 | 3300047445 | Bacteria | 1497 |
| 888 | Ga0495679_001737 | 3300047446 | Bacteria | 12015 |
| 889 | Ga0495679_003435 | 3300047446 | Bacteria | 7617 |
| 890 | Ga0495679_007148 | 3300047446 | Bacteria | 4695 |
| 891 | Ga0495679_013320 | 3300047446 | Bacteria | 3094 |
| 892 | Ga0495679_016784 | 3300047446 | Bacteria | 2639 |
| 893 | Ga0495679_059123 | 3300047446 | Bacteria | 1128 |
| 894 | Ga0495685_000096 | 3300047447 | Bacteria | 31951 |
| 895 | Ga0495685_001373 | 3300047447 | Bacteria | 7456 |
| 896 | Ga0495685_003881 | 3300047447 | Bacteria | 4796 |
| 897 | Ga0495673_0000006 | 3300047469 | Bacteria | 908691 |
| 898 | Ga0495673_0000014 | 3300047469 | Bacteria | 599202 |
| 899 | Ga0495673_0000090 | 3300047469 | Bacteria | 188187 |
| 900 | Ga0495673_0047519 | 3300047469 | Bacteria | 1896 |
| 901 | Ga0495673_0075357 | 3300047469 | Bacteria | 1409 |
| 902 | Ga0495681_0002284 | 3300047470 | Bacteria | 13781 |
| 903 | Ga0495681_0007418 | 3300047470 | Bacteria | 7009 |
| 904 | Ga0495681_0007422 | 3300047470 | Bacteria | 7007 |
| 905 | Ga0495681_0008848 | 3300047470 | Bacteria | 6259 |
| 906 | Ga0495681_0025213 | 3300047470 | Bacteria | 3114 |
| 907 | Ga0495681_0040297 | 3300047470 | Bacteria | 2275 |
| 908 | Ga0495681_0069582 | 3300047470 | Bacteria | 1598 |
| 909 | Ga0495681_0116043 | 3300047470 | Bacteria | 1154 |
| 910 | Ga0495686_0000188 | 3300047472 | Bacteria | 115937 |
| 911 | Ga0495686_0000225 | 3300047472 | Bacteria | 104121 |
| 912 | Ga0495686_0001183 | 3300047472 | Bacteria | 30424 |
| 913 | Ga0495686_0012293 | 3300047472 | Bacteria | 5994 |
| 914 | Ga0495686_0012382 | 3300047472 | Bacteria | 5968 |
| 915 | Ga0495686_0013166 | 3300047472 | Bacteria | 5752 |
| 916 | Ga0495686_0032075 | 3300047472 | Bacteria | 3402 |
| 917 | Ga0495686_0100727 | 3300047472 | Bacteria | 1742 |
| 918 | Ga0495593_0019247 | 3300047673 | Bacteria | 3828 |
| 919 | Ga0495593_0050902 | 3300047673 | Bacteria | 2193 |
| 920 | Ga0495602_0001408 | 3300048088 | Bacteria | 23797 |
| 921 | Ga0495602_0136183 | 3300048088 | Bacteria | 1950 |
| 922 | Ga0495602_0184401 | 3300048088 | Bacteria | 1606 |
| 923 | Ga0495614_0023123 | 3300048089 | Bacteria | 2680 |
| 924 | Ga0495614_0035268 | 3300048089 | Bacteria | 2149 |
| 925 | Ga0495615_0035230 | 3300048090 | Bacteria | 1222 |
| 926 | Ga0495615_0037565 | 3300048090 | Bacteria | 1193 |
| 927 | Ga0495626_0000003 | 3300048091 | Bacteria | 427774 |
| 928 | Ga0495626_0001947 | 3300048091 | Bacteria | 15338 |
| 929 | Ga0495626_0002144 | 3300048091 | Bacteria | 14273 |
| 930 | Ga0495626_0006082 | 3300048091 | Bacteria | 6929 |
| 931 | Ga0495626_0006122 | 3300048091 | Bacteria | 6903 |
| 932 | Ga0495626_0009346 | 3300048091 | Bacteria | 5303 |
| 933 | Ga0495626_0009495 | 3300048091 | Bacteria | 5255 |
| 934 | Ga0495626_0016260 | 3300048091 | Bacteria | 3783 |
| 935 | Ga0495626_0021176 | 3300048091 | Bacteria | 3229 |
| 936 | Ga0495626_0037012 | 3300048091 | Bacteria | 2321 |
| 937 | Ga0495626_0053850 | 3300048091 | Bacteria | 1850 |
| 938 | Ga0495626_0069792 | 3300048091 | Bacteria | 1582 |
| 939 | Ga0495626_0194258 | 3300048091 | Bacteria | 835 |
| 940 | Ga0496100_0129632 | 3300048903 | Bacteria | 1775 |
| 941 | Ga0496100_0204338 | 3300048903 | Bacteria | 1441 |
| 942 | Ga0496100_0265092 | 3300048903 | Bacteria | 1275 |
| 943 | Ga0496101_0068371 | 3300048904 | Bacteria | 2597 |
| 944 | Ga0496101_0118516 | 3300048904 | Bacteria | 1999 |
| 945 | Ga0496102_0000193 | 3300048905 | Bacteria | 83162 |
| 946 | Ga0496102_0000645 | 3300048905 | Bacteria | 35369 |
| 947 | Ga0496102_0015277 | 3300048905 | Bacteria | 6685 |
| 948 | Ga0496102_0030652 | 3300048905 | Bacteria | 4814 |
| 949 | Ga0496102_0080767 | 3300048905 | Bacteria | 2996 |
| 950 | Ga0496102_0643884 | 3300048905 | Bacteria | 983 |
| 951 | Ga0496103_0006373 | 3300048906 | Bacteria | 7048 |
| 952 | Ga0496103_0006702 | 3300048906 | Bacteria | 6872 |
| 953 | Ga0496103_0007178 | 3300048906 | Bacteria | 6643 |
| 954 | Ga0496106_0116295 | 3300048909 | Bacteria | 2086 |
| 955 | Ga0496106_0156399 | 3300048909 | Bacteria | 1801 |
| 956 | Ga0496106_0234681 | 3300048909 | Bacteria | 1465 |
| 957 | Ga0496106_0275314 | 3300048909 | Bacteria | 1348 |
| 958 | Ga0496107_0216966 | 3300048910 | Bacteria | 1423 |
| 959 | Ga0496107_0253157 | 3300048910 | Bacteria | 1310 |
| 960 | Ga0496108_0221172 | 3300048911 | Bacteria | 1645 |
| 961 | Ga0496108_0589433 | 3300048911 | Bacteria | 969 |
| 962 | Ga0496109_0109573 | 3300048912 | Bacteria | 2567 |
| 963 | Ga0496109_0236275 | 3300048912 | Bacteria | 1720 |
| 964 | Ga0496110_0000275 | 3300048913 | Bacteria | 33355 |
| 965 | Ga0496110_0007309 | 3300048913 | Bacteria | 8812 |
| 966 | Ga0496110_0376258 | 3300048913 | Bacteria | 1294 |
| 967 | Ga0496110_0395250 | 3300048913 | Bacteria | 1260 |
| 968 | Ga0496110_0797577 | 3300048913 | Bacteria | 849 |
| 969 | Ga0496111_0066786 | 3300048914 | Bacteria | 2612 |
| 970 | Ga0496111_0078649 | 3300048914 | Bacteria | 2405 |
| 971 | Ga0496111_0309685 | 3300048914 | Bacteria | 1170 |
| 972 | Ga0496112_0441159 | 3300048915 | Bacteria | 1240 |
| 973 | Ga0496113_0023334 | 3300048916 | Bacteria | 4387 |
| 974 | Ga0496114_0074039 | 3300048917 | Bacteria | 2867 |
| 975 | Ga0496114_0085143 | 3300048917 | Bacteria | 2677 |
| 976 | Ga0496114_0361969 | 3300048917 | Bacteria | 1283 |
| 977 | Ga0496114_0657363 | 3300048917 | Bacteria | 921 |
| 978 | Ga0496115_0030629 | 3300048918 | Bacteria | 4234 |
| 979 | Ga0496115_0031809 | 3300048918 | Bacteria | 4159 |
| 980 | Ga0496115_0070105 | 3300048918 | Bacteria | 2841 |
| 981 | Ga0496115_0255813 | 3300048918 | Bacteria | 1441 |
| 982 | Ga0496115_0270237 | 3300048918 | Bacteria | 1397 |
| 983 | Ga0496116_0011005 | 3300048919 | Bacteria | 7529 |
| 984 | Ga0496116_0020373 | 3300048919 | Bacteria | 5038 |
| 985 | Ga0496116_0048807 | 3300048919 | Bacteria | 2837 |
| 986 | Ga0496117_0000001 | 3300048920 | Bacteria | 2526244 |
| 987 | Ga0496118_0000008 | 3300048921 | Bacteria | 644537 |
| 988 | Ga0496121_0022417 | 3300048924 | Bacteria | 6131 |
| 989 | Ga0496121_0046914 | 3300048924 | Bacteria | 3691 |
| 990 | Ga0496121_0051337 | 3300048924 | Bacteria | 3474 |
| 991 | Ga0496121_0062269 | 3300048924 | Bacteria | 3057 |
| 992 | Ga0496121_0068150 | 3300048924 | Bacteria | 2880 |
| 993 | Ga0496121_0155519 | 3300048924 | Bacteria | 1678 |
| 994 | Ga0496121_0155987 | 3300048924 | Bacteria | 1675 |
| 995 | Ga0496121_0316324 | 3300048924 | Bacteria | 1053 |
| 996 | Ga0496122_0000382 | 3300048925 | Bacteria | 94878 |
| 997 | Ga0496122_0003122 | 3300048925 | Bacteria | 22189 |
| 998 | Ga0496122_0005042 | 3300048925 | Bacteria | 15966 |
| 999 | Ga0496122_0010712 | 3300048925 | Bacteria | 9409 |
| 1000 | Ga0496122_0014619 | 3300048925 | Bacteria | 7575 |
| 1001 | Ga0496122_0029491 | 3300048925 | Bacteria | 4626 |
| 1002 | Ga0496123_0000122 | 3300048926 | Bacteria | 158966 |
| 1003 | Ga0496123_0004901 | 3300048926 | Bacteria | 13747 |
| 1004 | Ga0496123_0020123 | 3300048926 | Bacteria | 5233 |
| 1005 | Ga0496123_0054958 | 3300048926 | Bacteria | 2616 |
| 1006 | Ga0496123_0061833 | 3300048926 | Bacteria | 2403 |
| 1007 | Ga0496124_0008972 | 3300048927 | Bacteria | 10351 |
| 1008 | Ga0496124_0009148 | 3300048927 | Bacteria | 10231 |
| 1009 | Ga0496124_0013661 | 3300048927 | Bacteria | 7913 |
| 1010 | Ga0496124_0053929 | 3300048927 | Bacteria | 3405 |
| 1011 | Ga0496124_0054155 | 3300048927 | Bacteria | 3397 |
| 1012 | Ga0496125_0000794 | 3300048928 | Bacteria | 51484 |
| 1013 | Ga0496125_0002645 | 3300048928 | Bacteria | 22909 |
| 1014 | Ga0496125_0003227 | 3300048928 | Bacteria | 20112 |
| 1015 | Ga0496125_0050421 | 3300048928 | Bacteria | 3446 |
| 1016 | Ga0495678_000016 | 3300049459 | Bacteria | 303426 |
| 1017 | Ga0495678_000203 | 3300049459 | Bacteria | 69724 |
| 1018 | Ga0495678_000315 | 3300049459 | Bacteria | 51749 |
| 1019 | Ga0495678_000459 | 3300049459 | Bacteria | 40493 |
| 1020 | Ga0495678_001055 | 3300049459 | Bacteria | 23319 |
| 1021 | Ga0495678_001277 | 3300049459 | Bacteria | 20425 |
| 1022 | Ga0495678_002374 | 3300049459 | Bacteria | 12907 |
| 1023 | Ga0495678_007339 | 3300049459 | Bacteria | 5724 |
| 1024 | Ga0495678_012755 | 3300049459 | Bacteria | 3970 |
| 1025 | Ga0495678_022194 | 3300049459 | Bacteria | 2779 |
| 1026 | Ga0495678_031035 | 3300049459 | Bacteria | 2232 |
| 1027 | Ga0495678_041595 | 3300049459 | Bacteria | 1837 |
| 1028 | Ga0495682_0000233 | 3300049460 | Bacteria | 43866 |
| 1029 | Ga0495682_0000716 | 3300049460 | Bacteria | 21678 |
| 1030 | Ga0495682_0002181 | 3300049460 | Bacteria | 9470 |
| 1031 | Ga0495682_0002325 | 3300049460 | Bacteria | 9043 |
| 1032 | Ga0495682_0004437 | 3300049460 | Bacteria | 6006 |
| 1033 | Ga0495682_0017786 | 3300049460 | Bacteria | 2679 |
| 1034 | Ga0501031_0028954 | 3300049568 | Bacteria | 3611 |
| 1035 | Ga0501038_0001264 | 3300049574 | Bacteria | 22976 |
| 1036 | Ga0501047_0500479 | 3300049581 | Bacteria | 1042 |
| 1037 | Ga0501238_003684 | 3300049671 | Bacteria | 1891 |
| 1038 | Ga0501249_006871 | 3300049679 | Bacteria | 2346 |
| 1039 | Ga0501269_000690 | 3300049766 | Bacteria | 5653 |
| 1040 | Ga0501035_0034648 | 3300049822 | Bacteria | 4586 |
| 1041 | nmdc:mga03683_33136_c1 | 3300050489 | Bacteria | 2082 |
| 1042 | nmdc:mga00v17_14216_c1 | 3300050491 | Bacteria | 4439 |
| 1043 | nmdc:mga00v17_1575_c1 | 3300050491 | Bacteria | 11912 |
| 1044 | nmdc:mga00v17_80587_c1 | 3300050491 | Bacteria | 2032 |
| 1045 | nmdc:mga0yw44_392_c1 | 3300050492 | Bacteria | 4352 |
| 1046 | nmdc:mga0k408_197197_c1 | 3300050493 | Bacteria | 1202 |
| 1047 | nmdc:mga06z11_42015_c1 | 3300050494 | Bacteria | 2291 |
| 1048 | nmdc:mga06z11_565693_c1 | 3300050494 | Bacteria | 691 |
| 1049 | nmdc:mga07m45_33451_c2 | 3300050496 | Bacteria | 2177 |
| 1050 | Ga0495601_0161224 | 3300053077 | Bacteria | 1466 |
| 1051 | Ga0500650_0125108 | 3300053098 | Bacteria | 1197 |
| 1052 | Ga0500595_003939 | 3300053119 | Bacteria | 6793 |
| 1053 | Ga0500607_014530 | 3300053121 | Bacteria | 4560 |
| 1054 | Ga0500618_000371 | 3300053125 | Bacteria | 31102 |
| 1055 | Ga0500618_002593 | 3300053125 | Bacteria | 6672 |
| 1056 | Ga0500618_005119 | 3300053125 | Bacteria | 4037 |
| 1057 | Ga0500618_047322 | 3300053125 | Bacteria | 978 |
| 1058 | Ga0500559_0055681 | 3300053136 | Bacteria | 1755 |
| 1059 | Ga0500574_001697 | 3300053141 | Bacteria | 3384 |
| 1060 | Ga0500586_009114 | 3300053145 | Bacteria | 2737 |
| 1061 | Ga0500588_0000160 | 3300053146 | Bacteria | 8978 |
| 1062 | Ga0500636_0000020 | 3300053177 | Bacteria | 96868 |
| 1063 | Ga0500637_0095057 | 3300053178 | Bacteria | 1726 |
| 1064 | Ga0500609_024413 | 3300053731 | Bacteria | 828 |
| 1065 | Ga0587076_010224 | 3300059645 | Bacteria | 1351 |
| 1066 | 2511250824 | 2511231003 | Bacteria | 5606035 |
| 1067 | 2511383943 | 2511231026 | Bacteria | 5225445 |
| 1068 | 2521558091 | 2521172590 | Bacteria | 5047645 |
| 1069 | 2550695659 | 2548876994 | Bacteria | 4904866 |
| 1070 | 2553003216 | 2551306416 | Bacteria | 6152985 |
| 1071 | 2601670849 | 2600255292 | Bacteria | 6300551 |
| 1072 | 2643788196 | 2643221554 | Bacteria | 6603920 |
| 1073 | 2643798289 | 2643221556 | Bacteria | 7251154 |
| 1074 | 2644028213 | 2643221603 | Bacteria | 6147767 |
| 1075 | 2644213863 | 2643221638 | Bacteria | 6579467 |
| 1076 | 2644253992 | 2643221645 | Bacteria | 7207331 |
| 1077 | 2644356761 | 2643221664 | Bacteria | 7272945 |
| 1078 | 2644475292 | 2643221684 | Bacteria | 7145183 |
| 1079 | 2738742050 | 2738541280 | Bacteria | 6630198 |
| 1080 | 2738825000 | 2738541297 | Bacteria | 6549566 |
| 1081 | 2738844505 | 2738541300 | Bacteria | 6675882 |
| 1082 | 2739148797 | 2738541357 | Bacteria | 6549408 |
| 1083 | 2739190716 | 2738543003 | Bacteria | 6549560 |
| 1084 | 2739277083 | 2738543018 | Bacteria | 6718814 |
| 1085 | 2739317193 | 2738543026 | Bacteria | 6549408 |
| 1086 | 2739335434 | 2738543029 | Bacteria | 6549249 |
| 1087 | 2739345976 | 2738543030 | Bacteria | 6719714 |
| 1088 | 2765569220 | 2765235838 | Bacteria | 5445269 |
| 1089 | 2808983910 | 2808606386 | Bacteria | 4471946 |
| 1090 | 2809130996 | 2808606415 | Bacteria | 4576710 |
| 1091 | 2809144740 | 2808606418 | Bacteria | 6724496 |
| 1092 | 2809150669 | 2808606419 | Bacteria | 4576925 |
| 1093 | 2819541170 | 2818991436 | Bacteria | 5376622 |
| 1094 | 2819591660 | 2818991445 | Bacteria | 4955017 |
| 1095 | 2819614764 | 2818991449 | Bacteria | 5518009 |
| 1096 | 2821133610 | 2821131069 | Bacteria | 6108407 |
| 1097 | 2839095894 | 2839094727 | Bacteria | 5534556 |
| 1098 | 2842716781 | 2842711865 | Bacteria | 7155354 |
| 1099 | 2852622186 | 2852618963 | Bacteria | 4577824 |
| 1100 | 2857547620 | 2857547612 | Bacteria | 6179999 |
| 1101 | 2857553720 | 2857553236 | Bacteria | 6166726 |
| 1102 | 2857563882 | 2857558681 | Bacteria | 6617694 |
| 1103 | 2857565399 | 2857564685 | Bacteria | 6290584 |
| 1104 | 2884815023 | 2884811622 | Bacteria | 5552861 |
| 1105 | 2884837471 | 2884836552 | Bacteria | 5219991 |
| 1106 | 2884853762 | 2884852848 | Bacteria | 5221161 |
| 1107 | 2885085353 | 2885080285 | Bacteria | 6355622 |
| 1108 | 2896155121 | 2896154374 | Bacteria | 5221518 |
| 1109 | 2904426709 | 2904424332 | Bacteria | 7633521 |
| 1110 | 2904441135 | 2904439833 | Bacteria | 5931679 |
| 1111 | 2904531924 | 2904530477 | Bacteria | 5876334 |
| 1112 | 2904587850 | 2904584206 | Bacteria | 6028872 |
| 1113 | 2904589990 | 2904589729 | Bacteria | 6113573 |
| 1114 | 2904602624 | 2904601388 | Bacteria | 5884906 |
| 1115 | 2919046555 | 2919046199 | Bacteria | 5567169 |
| 1116 | 2919079872 | 2919079590 | Bacteria | 5946433 |
| 1117 | 2919480349 | 2919476304 | Bacteria | 5888696 |
| 1118 | 2919500875 | 2919497567 | Bacteria | 4408621 |
| 1119 | 2923511338 | 2923510766 | Bacteria | 5926163 |
| 1120 | 2928131271 | 2928130867 | Bacteria | 5467269 |
| 1121 | 2932412229 | 2932410948 | Bacteria | 6312192 |
| 1122 | 2932419744 | 2932416698 | Bacteria | 6315112 |
| 1123 | 8002747634 | 8002745576 | Bacteria | 4840272 |
| 1124 | 8047674391 | 8047673197 | Bacteria | 7395230 |
| 1125 | Ga0495605_0000003 | |||
| 1126 | JGI25155J39150_1000109 | |||
| 1127 | JGI25155J39150_1000164 | |||
| 1128 | JGI25156J39149_1000106 | |||
| 1129 | JGI25156J39149_1002732 | |||
| 1130 | JGI25162J39368_1000142 | |||
| 1131 | JGI25162J39368_1008765 | |||
| 1132 | JGI25154J39366_1000038 | |||
| 1133 | JGI25154J39366_1000194 | |||
| 1134 | JGI25154J39366_1003728 | |||
| 1135 | JGI25158J39367_1000363 | |||
| 1136 | JGI25157J39369_1000119 | |||
| 1137 | JGI25152J39213_1000053 | |||
| 1138 | JGI25150J39212_1001820 | |||
| 1139 | JGI25150J39212_1002317 | |||
| 1140 | JGI25150J39212_1003312 | |||
| 1141 | JGI25159J45721_1003565 | |||
| 1142 | JGI25159J45721_1004512 | |||
| 1143 | JGI25159J45721_1004857 | |||
| 1144 | JGI25151J46595_10039083 | |||
| 1145 | JGI25165J46597_1000064 | |||
| 1146 | JGI25153J46596_10006073 | |||
| 1147 | JGI25161J50226_1002547 | |||
| 1148 | JGI25161J50226_1002750 | |||
| 1149 | Ga0055538_1000002 | |||
| 1150 | Ga0055538_1000031 | |||
| 1151 | Ga0055539_1000002 | |||
| 1152 | Ga0055539_1000041 | |||
| 1153 | Ga0055533_1000004 | |||
| 1154 | Ga0055533_1000051 | |||
| 1155 | Ga0055532_1000023 | |||
| 1156 | Ga0055525_1000002 | |||
| 1157 | Ga0055525_1000061 | |||
| 1158 | Ga0055525_1000105 | |||
| 1159 | Ga0055529_1000185 | |||
| 1160 | Ga0055529_1000208 | |||
| 1161 | Ga0055526_1000077 | |||
| 1162 | Ga0055526_1000094 | |||
| 1163 | Ga0055526_1000715 | |||
| 1164 | Ga0055526_1004659 | |||
| 1165 | Ga0055537_1000072 | |||
| 1166 | Ga0055537_1022606 | |||
| 1167 | Ga0055524_1000007 | |||
| 1168 | Ga0055524_1005877 | |||
| 1169 | Ga0055524_1008398 | |||
| 1170 | Ga0055524_1017700 | |||
| 1171 | Ga0055524_1026883 | |||
| 1172 | Ga0055534_1000136 | |||
| 1173 | Ga0055534_1005658 | |||
| 1174 | Ga0055528_1000444 | |||
| 1175 | Ga0055530_10006305 | |||
| 1176 | Ga0055530_10007353 | |||
| 1177 | Ga0055530_10014781 | |||
| 1178 | Ga0055531_10003104 | |||
| 1179 | Ga0055531_10010360 | |||
| 1180 | Ga0055541_1000002 | |||
| 1181 | Ga0055541_1000028 | |||
| 1182 | Ga0055543_1002610 | |||
| 1183 | Ga0055543_1003660 | |||
| 1184 | Ga0065165_1000094 | |||
| 1185 | Ga0065165_1003718 | |||
| 1186 | Ga0065165_1015311 | |||
| 1187 | Ga0065714_10014176 | |||
| 1188 | Ga0065714_10076239 | |||
| 1189 | Ga0065714_10089047 | |||
| 1190 | Ga0065715_10174354 | |||
| 1191 | Ga0070658_10068793 | |||
| 1192 | Ga0070658_10070302 | |||
| 1193 | Ga0070660_100005270 | |||
| 1194 | Ga0070660_100028029 | |||
| 1195 | Ga0070661_100015147 | |||
| 1196 | Ga0070692_10223709 | |||
| 1197 | Ga0070659_100011305 | |||
| 1198 | Ga0070659_100050361 | |||
| 1199 | Ga0070659_100059051 | |||
| 1200 | Ga0070708_100079133 | |||
| 1201 | Ga0070662_100092248 | |||
| 1202 | Ga0070681_10204421 | |||
| 1203 | Ga0070706_100038547 | |||
| 1204 | Ga0070706_100050112 | |||
| 1205 | Ga0070707_100026476 | |||
| 1206 | Ga0070697_100088920 | |||
| 1207 | Ga0070697_100170433 | |||
| 1208 | Ga0070697_100349889 | |||
| 1209 | Ga0070695_100382016 | |||
| 1210 | Ga0070704_100011744 | |||
| 1211 | Ga0068855_100012325 | |||
| 1212 | Ga0068855_100034937 | |||
| 1213 | Ga0068855_100088605 | |||
| 1214 | Ga0068855_100519098 | |||
| 1215 | Ga0070664_100030676 | |||
| 1216 | Ga0068854_100004482 | |||
| 1217 | Ga0068856_100552255 | |||
| 1218 | Ga0068852_100015995 | |||
| 1219 | Ga0068860_100128098 | |||
| 1220 | Ga0070717_10324117 | |||
| 1221 | Ga0075365_10018477 | |||
| 1222 | Ga0075368_10029429 | |||
| 1223 | Ga0075363_100000825 | |||
| 1224 | Ga0075364_10000090 | |||
| 1225 | Ga0075364_10001278 | |||
| 1226 | Ga0075367_10228038 | |||
| 1227 | Ga0075366_10031563 | |||
| 1228 | Ga0075370_10106646 | |||
| 1229 | Ga0075434_100053749 | |||
| 1230 | Ga0079104_1042746 | |||
| 1231 | Ga0099826_10000003 | |||
| 1232 | Ga0105251_10059993 | |||
| 1233 | Ga0105244_10000758 | |||
| 1234 | Ga0105244_10004717 | |||
| 1235 | Ga0105240_10005406 | |||
| 1236 | Ga0105240_10016939 | |||
| 1237 | Ga0105240_10028682 | |||
| 1238 | Ga0105245_10153024 | |||
| 1239 | Ga0105243_10018589 | |||
| 1240 | Ga0105242_10098100 | |||
| 1241 | Ga0105237_10012915 | |||
| 1242 | Ga0105237_10169883 | |||
| 1243 | Ga0105238_10000356 | |||
| 1244 | Ga0105238_10015319 | |||
| 1245 | Ga0105238_10716044 | |||
| 1246 | Ga0105239_10217792 | |||
| 1247 | Ga0105239_10533237 | |||
| 1248 | Ga0157373_10092056 | |||
| 1249 | Ga0157371_10000001 | |||
| 1250 | Ga0157372_10222308 | |||
| 1251 | Ga0157372_10566937 | |||
| 1252 | Ga0182008_10001031 | |||
| 1253 | Ga0182008_10036723 | |||
| 1254 | Ga0157376_10215799 | |||
| 1255 | Ga0157376_10404870 | |||
| 1256 | Ga0182006_1000075 | |||
| 1257 | Ga0182006_1000163 | |||
| 1258 | Ga0182006_1002368 | |||
| 1259 | Ga0182006_1010376 | |||
| 1260 | Ga0182007_10000135 | |||
| 1261 | Ga0182007_10008464 | |||
| 1262 | Ga0182005_1000020 | |||
| 1263 | Ga0182005_1000106 | |||
| 1264 | Ga0182005_1000656 | |||
| 1265 | Ga0163161_10008676 | |||
| 1266 | Ga0163161_10169924 | |||
| 1267 | Ga0213872_10000002 | |||
| 1268 | Ga0213872_10000290 | |||
| 1269 | Ga0213872_10000317 | |||
| 1270 | Ga0213872_10014873 | |||
| 1271 | Ga0213872_10015342 | |||
| 1272 | Ga0209435_100013 | |||
| 1273 | Ga0209436_101021 | |||
| 1274 | Ga0209436_107202 | |||
| 1275 | Ga0209784_100002 | |||
| 1276 | Ga0209784_100039 | |||
| 1277 | Ga0209566_100003 | |||
| 1278 | Ga0209566_100023 | |||
| 1279 | Ga0209674_100004 | |||
| 1280 | Ga0209674_100040 | |||
| 1281 | Ga0209672_103061 | |||
| 1282 | Ga0209147_100030 | |||
| 1283 | Ga0209563_100006 | |||
| 1284 | Ga0209563_100007 | |||
| 1285 | Ga0209563_100072 | |||
| 1286 | Ga0207427_100911 | |||
| 1287 | Ga0209437_100097 | |||
| 1288 | Ga0209437_100208 | |||
| 1289 | Ga0209258_100205 | |||
| 1290 | Ga0207425_1000001 | |||
| 1291 | Ga0207425_1000322 | |||
| 1292 | Ga0207425_1000936 | |||
| 1293 | Ga0209646_1000028 | |||
| 1294 | Ga0209646_1000034 | |||
| 1295 | Ga0209646_1000135 | |||
| 1296 | Ga0209026_1000022 | |||
| 1297 | Ga0209026_1000946 | |||
| 1298 | Ga0209026_1010459 | |||
| 1299 | Ga0209026_1013767 | |||
| 1300 | Ga0209677_100003 | |||
| 1301 | Ga0209677_100041 | |||
| 1302 | Ga0209148_1000476 | |||
| 1303 | Ga0209759_1000018 | |||
| 1304 | Ga0209759_1000133 | |||
| 1305 | Ga0209129_1000001 | |||
| 1306 | Ga0209233_1000122 | |||
| 1307 | Ga0209565_1000009 | |||
| 1308 | Ga0209565_1000705 | |||
| 1309 | Ga0209565_1004151 | |||
| 1310 | Ga0209565_1004259 | |||
| 1311 | Ga0209565_1005731 | |||
| 1312 | Ga0209565_1007149 | |||
| 1313 | Ga0209565_1010047 | |||
| 1314 | Ga0209565_1027266 | |||
| 1315 | Ga0209455_1000049 | |||
| 1316 | Ga0209455_1006443 | |||
| 1317 | Ga0209673_1000036 | |||
| 1318 | Ga0209130_1000455 | |||
| 1319 | Ga0209130_1002444 | |||
| 1320 | Ga0209130_1006012 | |||
| 1321 | Ga0209675_1000013 | |||
| 1322 | Ga0209675_1012992 | |||
| 1323 | Ga0209675_1013388 | |||
| 1324 | Ga0209025_1026583 | |||
| 1325 | Ga0209564_1000009 | |||
| 1326 | Ga0209564_1000045 | |||
| 1327 | Ga0209564_1000175 | |||
| 1328 | Ga0209564_1000240 | |||
| 1329 | Ga0209564_1022560 | |||
| 1330 | Ga0209564_1059486 | |||
| 1331 | Ga0209758_1000230 | |||
| 1332 | Ga0209758_1000945 | |||
| 1333 | Ga0209050_1000339 | |||
| 1334 | Ga0209050_1001385 | |||
| 1335 | Ga0209050_1007374 | |||
| 1336 | Ga0209256_1000005 | |||
| 1337 | Ga0209256_1000052 | |||
| 1338 | Ga0209256_1000763 | |||
| 1339 | Ga0209256_1001302 | |||
| 1340 | Ga0209256_1011167 | |||
| 1341 | Ga0209256_1015557 | |||
| 1342 | Ga0207426_1003996 | |||
| 1343 | Ga0209051_1063193 | |||
| 1344 | Ga0209257_1000486 | |||
| 1345 | Ga0209257_1005302 | |||
| 1346 | Ga0207655_1008380 | |||
| 1347 | Ga0207655_1013288 | |||
| 1348 | Ga0207680_10362955 | |||
| 1349 | Ga0207705_10017834 | |||
| 1350 | Ga0207705_10154796 | |||
| 1351 | Ga0207654_10012122 | |||
| 1352 | Ga0207707_10022182 | |||
| 1353 | Ga0207695_10000926 | |||
| 1354 | Ga0207695_10004209 | |||
| 1355 | Ga0207695_10025569 | |||
| 1356 | Ga0207695_10026240 | |||
| 1357 | Ga0207695_10715473 | |||
| 1358 | Ga0207657_10036548 | |||
| 1359 | Ga0207657_10036676 | |||
| 1360 | Ga0207649_10057441 | |||
| 1361 | Ga0207646_10036884 | |||
| 1362 | Ga0207646_10050124 | |||
| 1363 | Ga0207694_10007661 | |||
| 1364 | Ga0207694_10392172 | |||
| 1365 | Ga0207650_10331501 | |||
| 1366 | Ga0207687_10423925 | |||
| 1367 | Ga0207690_10005549 | |||
| 1368 | Ga0207690_10082591 | |||
| 1369 | Ga0207706_10158523 | |||
| 1370 | Ga0207686_10136445 | |||
| 1371 | Ga0207709_10022835 | |||
| 1372 | Ga0207679_10016991 | |||
| 1373 | Ga0207679_10023048 | |||
| 1374 | Ga0207679_10128291 | |||
| 1375 | Ga0207667_10000036 | |||
| 1376 | Ga0207667_10045284 | |||
| 1377 | Ga0207667_10070215 | |||
| 1378 | Ga0207667_10095980 | |||
| 1379 | Ga0207703_10078380 | |||
| 1380 | Ga0207678_10066367 | |||
| 1381 | Ga0207702_10085040 | |||
| 1382 | Ga0207648_10082384 | |||
| 1383 | Ga0209281_1005749 | |||
| 1384 | Ga0209281_1018666 | |||
| 1385 | Ga0209282_1000002 | |||
| 1386 | Ga0209813_10005603 | |||
| 1387 | Ga0265336_10002052 | |||
| 1388 | Ga0307515_10251276 | |||
| 1389 | Ga0265324_10000004 | |||
| 1390 | Ga0265324_10000750 | |||
| 1391 | Ga0265324_10020602 | |||
| 1392 | Ga0316178_1092679 | |||
| 1393 | Ga0316180_1083533 | |||
| 1394 | Ga0316181_1218906 | |||
| 1395 | Ga0316182_1015863 | |||
| 1396 | Ga0265330_10003267 | |||
| 1397 | Ga0265328_10000223 | |||
| 1398 | Ga0265328_10016697 | |||
| 1399 | Ga0265325_10000146 | |||
| 1400 | Ga0265325_10011135 | |||
| 1401 | Ga0265329_10074880 | |||
| 1402 | Ga0265331_10000259 | |||
| 1403 | Ga0265331_10001924 | |||
| 1404 | Ga0265331_10007469 | |||
| 1405 | Ga0265331_10008292 | |||
| 1406 | Ga0265331_10011692 | |||
| 1407 | Ga0265331_10064998 | |||
| 1408 | Ga0265331_10093584 | |||
| 1409 | Ga0265327_10000547 | |||
| 1410 | Ga0265327_10000595 | |||
| 1411 | Ga0265327_10003077 | |||
| 1412 | Ga0265327_10008275 | |||
| 1413 | Ga0265327_10047095 | |||
| 1414 | Ga0265327_10145718 | |||
| 1415 | Ga0265316_10044341 | |||
| 1416 | Ga0307408_100000182 | |||
| 1417 | Ga0307408_100000200 | |||
| 1418 | Ga0307408_100036740 | |||
| 1419 | Ga0307408_100116226 | |||
| 1420 | Ga0307408_100126310 | |||
| 1421 | Ga0307408_100136613 | |||
| 1422 | Ga0316575_10004657 | |||
| 1423 | Ga0265314_10000772 | |||
| 1424 | Ga0265314_10083540 | |||
| 1425 | Ga0265314_10089855 | |||
| 1426 | Ga0307518_10030626 | |||
| 1427 | Ga0307416_100009909 | |||
| 1428 | Ga0307411_10265398 | |||
| 1429 | Ga0316583_10017757 | |||
| 1430 | Ga0373927_0040419 | |||
| 1431 | Ga0373937_0268062 | |||
| 1432 | Ga0373925_0261868 | |||
| 1433 | Ga0395899_0000473 | |||
| 1434 | Ga0395899_0001163 | |||
| 1435 | Ga0395899_0092321 | |||
| 1436 | Ga0395899_0140211 | |||
| 1437 | Ga0395899_0166830 | |||
| 1438 | Ga0395900_0000928 | |||
| 1439 | Ga0395900_0009234 | |||
| 1440 | Ga0395900_0030934 | |||
| 1441 | Ga0395900_0047818 | |||
| 1442 | Ga0395900_0057430 | |||
| 1443 | Ga0395900_0100136 | |||
| 1444 | Ga0395900_0195343 | |||
| 1445 | Ga0395898_0235867 | |||
| 1446 | Ga0395898_0496756 | |||
| 1447 | Ga0395905_0005821 | |||
| 1448 | Ga0395905_0006637 | |||
| 1449 | Ga0395905_0074276 | |||
| 1450 | Ga0395905_0147572 | |||
| 1451 | Ga0395901_0000082 | |||
| 1452 | Ga0395901_0004962 | |||
| 1453 | Ga0395901_0029900 | |||
| 1454 | Ga0395901_0054991 | |||
| 1455 | Ga0395901_0163036 | |||
| 1456 | Ga0395901_0453087 | |||
| 1457 | Ga0395901_0568217 | |||
| 1458 | Ga0400488_52448 | |||
| 1459 | Ga0436361_0090971 | |||
| 1460 | Ga0436361_0365798 | |||
| 1461 | Ga0436361_0419080 | |||
| 1462 | Ga0436361_0428527 | |||
| 1463 | Ga0436361_0570400 | |||
| 1464 | Ga0436361_0642890 | |||
| 1465 | Ga0436361_0722347 | |||
| 1466 | Ga0436361_0750950 | |||
| 1467 | Ga0439448_0000610 | |||
| 1468 | Ga0439448_0059670 | |||
| 1469 | Ga0439449_0039772 | |||
| 1470 | Ga0439455_0008678 | |||
| 1471 | Ga0439455_0089167 | |||
| 1472 | Ga0450904_000028 | |||
| 1473 | Ga0439458_0017212 | |||
| 1474 | Ga0450909_017228 | |||
| 1475 | Ga0451577_0000002 | |||
| 1476 | Ga0451577_0000100 | |||
| 1477 | Ga0451577_0000659 | |||
| 1478 | Ga0451577_0002327 | |||
| 1479 | Ga0451577_0098849 | |||
| 1480 | Ga0466969_0027275 | |||
| 1481 | Ga0466972_0000005 | |||
| 1482 | Ga0466972_0008752 | |||
| 1483 | Ga0466982_0117722 | |||
| 1484 | Ga0453683_0000013 | |||
| 1485 | Ga0453683_0031359 | |||
| 1486 | Ga0466965_0009673 | |||
| 1487 | Ga0466965_0023348 | |||
| 1488 | Ga0466965_0031717 | |||
| 1489 | Ga0466966_0004082 | |||
| 1490 | Ga0466966_0007622 | |||
| 1491 | Ga0466966_0070931 | |||
| 1492 | Ga0466963_0078961 | |||
| 1493 | Ga0466964_0001134 | |||
| 1494 | Ga0466964_0003974 | |||
| 1495 | Ga0466964_0126622 | |||
| 1496 | Ga0466964_0225796 | |||
| 1497 | Ga0453684_0000002 | |||
| 1498 | Ga0453684_0000040 | |||
| 1499 | Ga0453684_0007368 | |||
| 1500 | Ga0453684_0164947 | |||
| 1501 | Ga0453684_0241626 | |||
| 1502 | Ga0466971_0044569 | |||
| 1503 | Ga0466971_0054395 | |||
| 1504 | Ga0466968_0003420 | |||
| 1505 | Ga0466968_0100711 | |||
| 1506 | Ga0466970_0040908 | |||
| 1507 | Ga0466970_0044419 | |||
| 1508 | Ga0466957_0015628 | |||
| 1509 | Ga0466957_0043048 | |||
| 1510 | Ga0466957_0045349 | |||
| 1511 | Ga0466957_0262387 | |||
| 1512 | Ga0466959_0049305 | |||
| 1513 | Ga0466959_0084712 | |||
| 1514 | Ga0451576_0000006 | |||
| 1515 | Ga0451576_0000037 | |||
| 1516 | Ga0451576_0002901 | |||
| 1517 | Ga0451576_0004762 | |||
| 1518 | Ga0451576_0010104 | |||
| 1519 | Ga0451576_0049120 | |||
| 1520 | Ga0451576_0057154 | |||
| 1521 | Ga0451576_0180546 | |||
| 1522 | Ga0466967_0026422 | |||
| 1523 | Ga0495617_000006 | |||
| 1524 | Ga0495617_000008 | |||
| 1525 | Ga0495617_000266 | |||
| 1526 | Ga0495617_001477 | |||
| 1527 | Ga0495627_000005 | |||
| 1528 | Ga0495627_000875 | |||
| 1529 | Ga0495627_005133 | |||
| 1530 | Ga0495627_005900 | |||
| 1531 | Ga0495627_005949 | |||
| 1532 | Ga0495603_0004305 | |||
| 1533 | Ga0495603_0053314 | |||
| 1534 | Ga0495603_0097017 | |||
| 1535 | Ga0495590_0000003 | |||
| 1536 | Ga0495590_0000017 | |||
| 1537 | Ga0495590_0000503 | |||
| 1538 | Ga0495590_0002375 | |||
| 1539 | Ga0495590_0020540 | |||
| 1540 | Ga0495591_000422 | |||
| 1541 | Ga0495591_005545 | |||
| 1542 | Ga0495629_0011641 | |||
| 1543 | Ga0495629_0017844 | |||
| 1544 | Ga0495629_0055565 | |||
| 1545 | Ga0495629_0153862 | |||
| 1546 | Ga0495638_0000118 | |||
| 1547 | Ga0495638_0006736 | |||
| 1548 | Ga0495638_0006752 | |||
| 1549 | Ga0495638_0009676 | |||
| 1550 | Ga0495638_0017799 | |||
| 1551 | Ga0495638_0064674 | |||
| 1552 | Ga0495638_0165865 | |||
| 1553 | Ga0495651_0005122 | |||
| 1554 | Ga0495651_0160577 | |||
| 1555 | Ga0495653_0000011 | |||
| 1556 | Ga0495653_0005746 | |||
| 1557 | Ga0495653_0026997 | |||
| 1558 | Ga0495653_0125048 | |||
| 1559 | Ga0495653_0203607 | |||
| 1560 | Ga0495650_0000015 | |||
| 1561 | Ga0495650_0000131 | |||
| 1562 | Ga0495650_0000147 | |||
| 1563 | Ga0495650_0000195 | |||
| 1564 | Ga0495650_0000235 | |||
| 1565 | Ga0495650_0000544 | |||
| 1566 | Ga0495650_0007013 | |||
| 1567 | Ga0495650_0008107 | |||
| 1568 | Ga0495650_0017789 | |||
| 1569 | Ga0495650_0130183 | |||
| 1570 | Ga0495582_0053778 | |||
| 1571 | Ga0495582_0108862 | |||
| 1572 | Ga0495605_0000083 | |||
| 1573 | Ga0495605_0000217 | |||
| 1574 | Ga0495605_0004393 | |||
| 1575 | Ga0495605_0006723 | |||
| 1576 | Ga0495605_0008428 | |||
| 1577 | Ga0495605_0016725 | |||
| 1578 | Ga0495605_0021516 | |||
| 1579 | Ga0495605_0021532 | |||
| 1580 | Ga0495605_0028280 | |||
| 1581 | Ga0495605_0042170 | |||
| 1582 | Ga0495605_0048261 | |||
| 1583 | Ga0495605_0096857 | |||
| 1584 | Ga0495639_0218680 | |||
| 1585 | Ga0495584_0000299 | |||
| 1586 | Ga0495584_0000342 | |||
| 1587 | Ga0495584_0000705 | |||
| 1588 | Ga0495584_0000746 | |||
| 1589 | Ga0495584_0000845 | |||
| 1590 | Ga0495584_0004000 | |||
| 1591 | Ga0495584_0007583 | |||
| 1592 | Ga0495584_0015337 | |||
| 1593 | Ga0495584_0024923 | |||
| 1594 | Ga0495584_0028659 | |||
| 1595 | Ga0495584_0031332 | |||
| 1596 | Ga0495584_0033227 | |||
| 1597 | Ga0495584_0108558 | |||
| 1598 | Ga0495585_0000220 | |||
| 1599 | Ga0495585_0000528 | |||
| 1600 | Ga0495585_0000602 | |||
| 1601 | Ga0495585_0000632 | |||
| 1602 | Ga0495585_0000698 | |||
| 1603 | Ga0495585_0001112 | |||
| 1604 | Ga0495585_0002112 | |||
| 1605 | Ga0495585_0008887 | |||
| 1606 | Ga0495585_0010467 | |||
| 1607 | Ga0495585_0016155 | |||
| 1608 | Ga0495585_0021725 | |||
| 1609 | Ga0495585_0041232 | |||
| 1610 | Ga0495585_0045008 | |||
| 1611 | Ga0495585_0054828 | |||
| 1612 | Ga0495585_0082473 | |||
| 1613 | Ga0495585_0091941 | |||
| 1614 | Ga0495585_0096659 | |||
| 1615 | Ga0495585_0128676 | |||
| 1616 | Ga0495585_0167632 | |||
| 1617 | Ga0495585_0250307 | |||
| 1618 | Ga0495594_0018879 | |||
| 1619 | Ga0495594_0042392 | |||
| 1620 | Ga0495594_0047774 | |||
| 1621 | Ga0495594_0065917 | |||
| 1622 | Ga0495594_0073300 | |||
| 1623 | Ga0495594_0173538 | |||
| 1624 | Ga0495596_0001508 | |||
| 1625 | Ga0495596_0001881 | |||
| 1626 | Ga0495596_0002776 | |||
| 1627 | Ga0495596_0003502 | |||
| 1628 | Ga0495596_0003776 | |||
| 1629 | Ga0495596_0013407 | |||
| 1630 | Ga0495596_0013489 | |||
| 1631 | Ga0495596_0018135 | |||
| 1632 | Ga0495596_0021112 | |||
| 1633 | Ga0495596_0028276 | |||
| 1634 | Ga0495596_0166268 | |||
| 1635 | Ga0495607_0002851 | |||
| 1636 | Ga0495607_0003020 | |||
| 1637 | Ga0495607_0003492 | |||
| 1638 | Ga0495607_0006266 | |||
| 1639 | Ga0495607_0019094 | |||
| 1640 | Ga0495607_0038851 | |||
| 1641 | Ga0495607_0040829 | |||
| 1642 | Ga0495607_0078683 | |||
| 1643 | Ga0495583_0000049 | |||
| 1644 | Ga0495583_0000079 | |||
| 1645 | Ga0495583_0000104 | |||
| 1646 | Ga0495583_0000165 | |||
| 1647 | Ga0495583_0002165 | |||
| 1648 | Ga0495583_0002622 | |||
| 1649 | Ga0495583_0006440 | |||
| 1650 | Ga0495583_0009396 | |||
| 1651 | Ga0495583_0013169 | |||
| 1652 | Ga0495583_0164270 | |||
| 1653 | Ga0495606_0000185 | |||
| 1654 | Ga0495606_0000284 | |||
| 1655 | Ga0495606_0000345 | |||
| 1656 | Ga0495606_0000420 | |||
| 1657 | Ga0495606_0001704 | |||
| 1658 | Ga0495606_0008082 | |||
| 1659 | Ga0495606_0008707 | |||
| 1660 | Ga0495606_0014205 | |||
| 1661 | Ga0495606_0017585 | |||
| 1662 | Ga0495606_0018936 | |||
| 1663 | Ga0495606_0120033 | |||
| 1664 | Ga0495606_0285430 | |||
| 1665 | Ga0495608_0003435 | |||
| 1666 | Ga0495610_0000004 | |||
| 1667 | Ga0495610_0002736 | |||
| 1668 | Ga0495610_0008234 | |||
| 1669 | Ga0495610_0024787 | |||
| 1670 | Ga0495610_0026324 | |||
| 1671 | Ga0495610_0085542 | |||
| 1672 | Ga0495610_0152305 | |||
| 1673 | Ga0495616_0000042 | |||
| 1674 | Ga0495616_0000050 | |||
| 1675 | Ga0495616_0004009 | |||
| 1676 | Ga0495616_0004772 | |||
| 1677 | Ga0495616_0005062 | |||
| 1678 | Ga0495616_0005894 | |||
| 1679 | Ga0495616_0006157 | |||
| 1680 | Ga0495616_0007182 | |||
| 1681 | Ga0495616_0008372 | |||
| 1682 | Ga0495616_0011401 | |||
| 1683 | Ga0495616_0033068 | |||
| 1684 | Ga0495616_0034885 | |||
| 1685 | Ga0495616_0059030 | |||
| 1686 | Ga0495616_0069344 | |||
| 1687 | Ga0495616_0083259 | |||
| 1688 | Ga0495618_0014933 | |||
| 1689 | Ga0495620_0031914 | |||
| 1690 | Ga0495628_0002806 | |||
| 1691 | Ga0495628_0038904 | |||
| 1692 | Ga0495630_0005242 | |||
| 1693 | Ga0495631_0000987 | |||
| 1694 | Ga0495631_0006001 | |||
| 1695 | Ga0495631_0011111 | |||
| 1696 | Ga0495631_0011754 | |||
| 1697 | Ga0495631_0014350 | |||
| 1698 | Ga0495631_0083084 | |||
| 1699 | Ga0495631_0166860 | |||
| 1700 | Ga0495632_0000065 | |||
| 1701 | Ga0495632_0000366 | |||
| 1702 | Ga0495632_0001943 | |||
| 1703 | Ga0495632_0003798 | |||
| 1704 | Ga0495632_0007490 | |||
| 1705 | Ga0495632_0008727 | |||
| 1706 | Ga0495632_0014198 | |||
| 1707 | Ga0495632_0016346 | |||
| 1708 | Ga0495632_0075798 | |||
| 1709 | Ga0495637_0000026 | |||
| 1710 | Ga0495637_0002176 | |||
| 1711 | Ga0495637_0012789 | |||
| 1712 | Ga0495637_0089006 | |||
| 1713 | Ga0495643_0000072 | |||
| 1714 | Ga0495643_0000505 | |||
| 1715 | Ga0495643_0001311 | |||
| 1716 | Ga0495643_0005672 | |||
| 1717 | Ga0495643_0007665 | |||
| 1718 | Ga0495643_0020093 | |||
| 1719 | Ga0495643_0020179 | |||
| 1720 | Ga0495643_0024033 | |||
| 1721 | Ga0495643_0225335 | |||
| 1722 | Ga0495644_0000141 | |||
| 1723 | Ga0495644_0002000 | |||
| 1724 | Ga0495644_0006632 | |||
| 1725 | Ga0495644_0011914 | |||
| 1726 | Ga0495644_0012414 | |||
| 1727 | Ga0495644_0025488 | |||
| 1728 | Ga0495644_0027233 | |||
| 1729 | Ga0495644_0067709 | |||
| 1730 | Ga0495648_0000055 | |||
| 1731 | Ga0495648_0000070 | |||
| 1732 | Ga0495648_0001095 | |||
| 1733 | Ga0495648_0002247 | |||
| 1734 | Ga0495648_0002560 | |||
| 1735 | Ga0495648_0007064 | |||
| 1736 | Ga0495648_0009431 | |||
| 1737 | Ga0495648_0010832 | |||
| 1738 | Ga0495648_0011490 | |||
| 1739 | Ga0495648_0017601 | |||
| 1740 | Ga0495648_0030317 | |||
| 1741 | Ga0495648_0050631 | |||
| 1742 | Ga0495648_0110937 | |||
| 1743 | Ga0495648_0112078 | |||
| 1744 | Ga0495666_0001731 | |||
| 1745 | Ga0495666_0003697 | |||
| 1746 | Ga0495666_0022422 | |||
| 1747 | Ga0495666_0069571 | |||
| 1748 | Ga0495666_0105333 | |||
| 1749 | Ga0495642_0000666 | |||
| 1750 | Ga0495642_0003405 | |||
| 1751 | Ga0495642_0007840 | |||
| 1752 | Ga0495642_0007918 | |||
| 1753 | Ga0495642_0008448 | |||
| 1754 | Ga0495642_0009122 | |||
| 1755 | Ga0495642_0016062 | |||
| 1756 | Ga0495642_0023119 | |||
| 1757 | Ga0495642_0031834 | |||
| 1758 | Ga0495642_0091922 | |||
| 1759 | Ga0495652_0004262 | |||
| 1760 | Ga0495652_0012306 | |||
| 1761 | Ga0495652_0034750 | |||
| 1762 | Ga0495652_0214554 | |||
| 1763 | Ga0495652_0243868 | |||
| 1764 | Ga0495654_0000035 | |||
| 1765 | Ga0495654_0003918 | |||
| 1766 | Ga0495654_0003954 | |||
| 1767 | Ga0495654_0022609 | |||
| 1768 | Ga0495654_0054188 | |||
| 1769 | Ga0495665_0002989 | |||
| 1770 | Ga0495665_0047907 | |||
| 1771 | Ga0495640_0011612 | |||
| 1772 | Ga0495586_0008531 | |||
| 1773 | Ga0495586_0020084 | |||
| 1774 | Ga0495587_0042307 | |||
| 1775 | Ga0495587_0294362 | |||
| 1776 | Ga0495609_0000002 | |||
| 1777 | Ga0495609_0001001 | |||
| 1778 | Ga0495609_0001049 | |||
| 1779 | Ga0495609_0001257 | |||
| 1780 | Ga0495609_0003784 | |||
| 1781 | Ga0495609_0008596 | |||
| 1782 | Ga0495609_0011101 | |||
| 1783 | Ga0495609_0024337 | |||
| 1784 | Ga0495609_0043774 | |||
| 1785 | Ga0495621_0088182 | |||
| 1786 | Ga0495597_0000206 | |||
| 1787 | Ga0495597_0000336 | |||
| 1788 | Ga0495597_0000583 | |||
| 1789 | Ga0495597_0000881 | |||
| 1790 | Ga0495597_0001302 | |||
| 1791 | Ga0495597_0001581 | |||
| 1792 | Ga0495597_0042685 | |||
| 1793 | Ga0495645_0013625 | |||
| 1794 | Ga0495645_0124220 | |||
| 1795 | Ga0495622_0000004 | |||
| 1796 | Ga0495622_0000439 | |||
| 1797 | Ga0495622_0007502 | |||
| 1798 | Ga0495622_0020800 | |||
| 1799 | Ga0495622_0047789 | |||
| 1800 | Ga0495622_0057549 | |||
| 1801 | Ga0495622_0094466 | |||
| 1802 | Ga0495633_0000164 | |||
| 1803 | Ga0495633_0000543 | |||
| 1804 | Ga0495633_0000586 | |||
| 1805 | Ga0495633_0001593 | |||
| 1806 | Ga0495633_0003096 | |||
| 1807 | Ga0495633_0003665 | |||
| 1808 | Ga0495633_0005280 | |||
| 1809 | Ga0495633_0005319 | |||
| 1810 | Ga0495633_0016848 | |||
| 1811 | Ga0495633_0039482 | |||
| 1812 | Ga0495633_0062630 | |||
| 1813 | Ga0495667_0084750 | |||
| 1814 | Ga0495656_0016272 | |||
| 1815 | Ga0495656_0019489 | |||
| 1816 | Ga0495656_0039628 | |||
| 1817 | Ga0495668_0000094 | |||
| 1818 | Ga0495668_0000168 | |||
| 1819 | Ga0495668_0000817 | |||
| 1820 | Ga0495668_0001384 | |||
| 1821 | Ga0495668_0001922 | |||
| 1822 | Ga0495668_0002470 | |||
| 1823 | Ga0495668_0004743 | |||
| 1824 | Ga0495668_0007391 | |||
| 1825 | Ga0495668_0007896 | |||
| 1826 | Ga0495668_0010480 | |||
| 1827 | Ga0495668_0031173 | |||
| 1828 | Ga0495668_0033683 | |||
| 1829 | Ga0495668_0037535 | |||
| 1830 | Ga0495668_0042253 | |||
| 1831 | Ga0495668_0044266 | |||
| 1832 | Ga0495668_0045102 | |||
| 1833 | Ga0495668_0080586 | |||
| 1834 | Ga0495634_0004336 | |||
| 1835 | Ga0495611_0000096 | |||
| 1836 | Ga0495611_0004154 | |||
| 1837 | Ga0495611_0007960 | |||
| 1838 | Ga0495611_0017073 | |||
| 1839 | Ga0495611_0018218 | |||
| 1840 | Ga0495611_0026951 | |||
| 1841 | Ga0495611_0067917 | |||
| 1842 | Ga0495611_0118764 | |||
| 1843 | Ga0495611_0192620 | |||
| 1844 | Ga0495611_0203646 | |||
| 1845 | Ga0495625_0000038 | |||
| 1846 | Ga0495625_0002151 | |||
| 1847 | Ga0495625_0005938 | |||
| 1848 | Ga0495625_0007321 | |||
| 1849 | Ga0495625_0009931 | |||
| 1850 | Ga0495625_0041884 | |||
| 1851 | Ga0495625_0069064 | |||
| 1852 | Ga0495625_0083440 | |||
| 1853 | Ga0495625_0099004 | |||
| 1854 | Ga0495625_0100150 | |||
| 1855 | Ga0495635_0009877 | |||
| 1856 | Ga0495659_0000031 | |||
| 1857 | Ga0495659_0000720 | |||
| 1858 | Ga0495659_0002794 | |||
| 1859 | Ga0495661_0000364 | |||
| 1860 | Ga0495661_0001138 | |||
| 1861 | Ga0495661_0001818 | |||
| 1862 | Ga0495661_0004336 | |||
| 1863 | Ga0495661_0009595 | |||
| 1864 | Ga0495661_0014691 | |||
| 1865 | Ga0495661_0016170 | |||
| 1866 | Ga0495661_0021194 | |||
| 1867 | Ga0495661_0037875 | |||
| 1868 | Ga0495661_0044678 | |||
| 1869 | Ga0495661_0045137 | |||
| 1870 | Ga0495661_0051648 | |||
| 1871 | Ga0495661_0053093 | |||
| 1872 | Ga0495661_0081428 | |||
| 1873 | Ga0495661_0142514 | |||
| 1874 | Ga0495661_0284887 | |||
| 1875 | Ga0495588_0000067 | |||
| 1876 | Ga0495588_0003514 | |||
| 1877 | Ga0495588_0006100 | |||
| 1878 | Ga0495588_0009883 | |||
| 1879 | Ga0495588_0016723 | |||
| 1880 | Ga0495588_0025591 | |||
| 1881 | Ga0495588_0035193 | |||
| 1882 | Ga0495588_0110679 | |||
| 1883 | Ga0495588_0118948 | |||
| 1884 | Ga0495657_0083231 | |||
| 1885 | Ga0495599_0077411 | |||
| 1886 | Ga0495623_0010056 | |||
| 1887 | Ga0495623_0045450 | |||
| 1888 | Ga0495623_0098508 | |||
| 1889 | Ga0495623_0166649 | |||
| 1890 | Ga0495623_0273503 | |||
| 1891 | Ga0495646_0010988 | |||
| 1892 | Ga0495646_0017130 | |||
| 1893 | Ga0495658_0340154 | |||
| 1894 | Ga0495669_0000177 | |||
| 1895 | Ga0495669_0003158 | |||
| 1896 | Ga0495669_0003891 | |||
| 1897 | Ga0495669_0005299 | |||
| 1898 | Ga0495669_0006175 | |||
| 1899 | Ga0495669_0011457 | |||
| 1900 | Ga0495669_0014271 | |||
| 1901 | Ga0495613_0286399 | |||
| 1902 | Ga0495624_0007465 | |||
| 1903 | Ga0495624_0010581 | |||
| 1904 | Ga0495624_0345217 | |||
| 1905 | Ga0495670_0002112 | |||
| 1906 | Ga0495670_0002534 | |||
| 1907 | Ga0495670_0002838 | |||
| 1908 | Ga0495670_0006434 | |||
| 1909 | Ga0495670_0007570 | |||
| 1910 | Ga0495670_0009893 | |||
| 1911 | Ga0495670_0011053 | |||
| 1912 | Ga0495670_0098079 | |||
| 1913 | Ga0495670_0100308 | |||
| 1914 | Ga0495671_0000001 | |||
| 1915 | Ga0495671_0000109 | |||
| 1916 | Ga0495671_0001415 | |||
| 1917 | Ga0495671_0003874 | |||
| 1918 | Ga0495671_0006218 | |||
| 1919 | Ga0495671_0007902 | |||
| 1920 | Ga0495671_0058007 | |||
| 1921 | Ga0495649_0001646 | |||
| 1922 | Ga0495649_0005874 | |||
| 1923 | Ga0495649_0006349 | |||
| 1924 | Ga0495649_0008724 | |||
| 1925 | Ga0495649_0028656 | |||
| 1926 | Ga0495649_0032533 | |||
| 1927 | Ga0495649_0107756 | |||
| 1928 | Ga0495589_0000009 | |||
| 1929 | Ga0495589_0000256 | |||
| 1930 | Ga0495589_0001110 | |||
| 1931 | Ga0495589_0002070 | |||
| 1932 | Ga0495589_0012135 | |||
| 1933 | Ga0495589_0019379 | |||
| 1934 | Ga0495589_0027938 | |||
| 1935 | Ga0495589_0078240 | |||
| 1936 | Ga0495589_0161251 | |||
| 1937 | Ga0495600_0000501 | |||
| 1938 | Ga0495660_0000308 | |||
| 1939 | Ga0495660_0000424 | |||
| 1940 | Ga0495660_0002261 | |||
| 1941 | Ga0495660_0006124 | |||
| 1942 | Ga0495660_0006898 | |||
| 1943 | Ga0495660_0024061 | |||
| 1944 | Ga0495660_0024988 | |||
| 1945 | Ga0495660_0030453 | |||
| 1946 | Ga0495660_0036047 | |||
| 1947 | Ga0495660_0095910 | |||
| 1948 | Ga0495660_0114609 | |||
| 1949 | Ga0495581_0005282 | |||
| 1950 | Ga0495581_0064928 | |||
| 1951 | Ga0495604_0006239 | |||
| 1952 | Ga0495604_0007130 | |||
| 1953 | Ga0495604_0037609 | |||
| 1954 | Ga0495604_0039700 | |||
| 1955 | Ga0495604_0119954 | |||
| 1956 | Ga0495636_0001712 | |||
| 1957 | Ga0495636_0002924 | |||
| 1958 | Ga0495636_0003699 | |||
| 1959 | Ga0495636_0032036 | |||
| 1960 | Ga0495636_0036621 | |||
| 1961 | Ga0495674_0027636 | |||
| 1962 | Ga0495672_0000195 | |||
| 1963 | Ga0495672_0000209 | |||
| 1964 | Ga0495672_0000580 | |||
| 1965 | Ga0495672_0000715 | |||
| 1966 | Ga0495672_0000886 | |||
| 1967 | Ga0495672_0001063 | |||
| 1968 | Ga0495672_0002048 | |||
| 1969 | Ga0495672_0012412 | |||
| 1970 | Ga0495672_0023031 | |||
| 1971 | Ga0495672_0048673 | |||
| 1972 | Ga0495672_0064463 | |||
| 1973 | Ga0495672_0200460 | |||
| 1974 | Ga0495676_0000037 | |||
| 1975 | Ga0495676_0005490 | |||
| 1976 | Ga0495676_0038777 | |||
| 1977 | Ga0495683_0000430 | |||
| 1978 | Ga0495683_0001600 | |||
| 1979 | Ga0495683_0009442 | |||
| 1980 | Ga0495683_0016755 | |||
| 1981 | Ga0495683_0028397 | |||
| 1982 | Ga0495683_0028490 | |||
| 1983 | Ga0495683_0080948 | |||
| 1984 | Ga0495683_0189835 | |||
| 1985 | Ga0495687_000013 | |||
| 1986 | Ga0495687_000064 | |||
| 1987 | Ga0495687_000116 | |||
| 1988 | Ga0495687_000173 | |||
| 1989 | Ga0495687_003092 | |||
| 1990 | Ga0495687_004504 | |||
| 1991 | Ga0495687_005106 | |||
| 1992 | Ga0495687_011449 | |||
| 1993 | Ga0495687_021312 | |||
| 1994 | Ga0495687_035164 | |||
| 1995 | Ga0495675_0004671 | |||
| 1996 | Ga0495675_0183360 | |||
| 1997 | Ga0495677_0000142 | |||
| 1998 | Ga0495677_0000264 | |||
| 1999 | Ga0495677_0002086 | |||
| 2000 | Ga0495677_0002485 | |||
| 2001 | Ga0495677_0002532 | |||
| 2002 | Ga0495677_0003780 | |||
| 2003 | Ga0495677_0005167 | |||
| 2004 | Ga0495677_0011190 | |||
| 2005 | Ga0495677_0013174 | |||
| 2006 | Ga0495677_0014300 | |||
| 2007 | Ga0495677_0018362 | |||
| 2008 | Ga0495677_0032203 | |||
| 2009 | Ga0495677_0035682 | |||
| 2010 | Ga0495677_0037294 | |||
| 2011 | Ga0495677_0052839 | |||
| 2012 | Ga0495679_001737 | |||
| 2013 | Ga0495679_003435 | |||
| 2014 | Ga0495679_007148 | |||
| 2015 | Ga0495679_013320 | |||
| 2016 | Ga0495679_016784 | |||
| 2017 | Ga0495679_059123 | |||
| 2018 | Ga0495685_000096 | |||
| 2019 | Ga0495685_001373 | |||
| 2020 | Ga0495685_003881 | |||
| 2021 | Ga0495673_0000006 | |||
| 2022 | Ga0495673_0000014 | |||
| 2023 | Ga0495673_0000090 | |||
| 2024 | Ga0495673_0047519 | |||
| 2025 | Ga0495673_0075357 | |||
| 2026 | Ga0495681_0002284 | |||
| 2027 | Ga0495681_0007418 | |||
| 2028 | Ga0495681_0007422 | |||
| 2029 | Ga0495681_0008848 | |||
| 2030 | Ga0495681_0025213 | |||
| 2031 | Ga0495681_0040297 | |||
| 2032 | Ga0495681_0069582 | |||
| 2033 | Ga0495681_0116043 | |||
| 2034 | Ga0495686_0000188 | |||
| 2035 | Ga0495686_0000225 | |||
| 2036 | Ga0495686_0001183 | |||
| 2037 | Ga0495686_0012293 | |||
| 2038 | Ga0495686_0012382 | |||
| 2039 | Ga0495686_0013166 | |||
| 2040 | Ga0495686_0032075 | |||
| 2041 | Ga0495686_0100727 | |||
| 2042 | Ga0495593_0019247 | |||
| 2043 | Ga0495593_0050902 | |||
| 2044 | Ga0495602_0001408 | |||
| 2045 | Ga0495602_0136183 | |||
| 2046 | Ga0495602_0184401 | |||
| 2047 | Ga0495614_0023123 | |||
| 2048 | Ga0495614_0035268 | |||
| 2049 | Ga0495615_0035230 | |||
| 2050 | Ga0495615_0037565 | |||
| 2051 | Ga0495626_0000003 | |||
| 2052 | Ga0495626_0001947 | |||
| 2053 | Ga0495626_0002144 | |||
| 2054 | Ga0495626_0006082 | |||
| 2055 | Ga0495626_0006122 | |||
| 2056 | Ga0495626_0009346 | |||
| 2057 | Ga0495626_0009495 | |||
| 2058 | Ga0495626_0016260 | |||
| 2059 | Ga0495626_0021176 | |||
| 2060 | Ga0495626_0037012 | |||
| 2061 | Ga0495626_0053850 | |||
| 2062 | Ga0495626_0069792 | |||
| 2063 | Ga0495626_0194258 | |||
| 2064 | Ga0496100_0129632 | |||
| 2065 | Ga0496100_0204338 | |||
| 2066 | Ga0496100_0265092 | |||
| 2067 | Ga0496101_0068371 | |||
| 2068 | Ga0496101_0118516 | |||
| 2069 | Ga0496102_0000193 | |||
| 2070 | Ga0496102_0000645 | |||
| 2071 | Ga0496102_0015277 | |||
| 2072 | Ga0496102_0030652 | |||
| 2073 | Ga0496102_0080767 | |||
| 2074 | Ga0496102_0643884 | |||
| 2075 | Ga0496103_0006373 | |||
| 2076 | Ga0496103_0006702 | |||
| 2077 | Ga0496103_0007178 | |||
| 2078 | Ga0496106_0116295 | |||
| 2079 | Ga0496106_0156399 | |||
| 2080 | Ga0496106_0234681 | |||
| 2081 | Ga0496106_0275314 | |||
| 2082 | Ga0496107_0216966 | |||
| 2083 | Ga0496107_0253157 | |||
| 2084 | Ga0496108_0221172 | |||
| 2085 | Ga0496108_0589433 | |||
| 2086 | Ga0496109_0109573 | |||
| 2087 | Ga0496109_0236275 | |||
| 2088 | Ga0496110_0000275 | |||
| 2089 | Ga0496110_0007309 | |||
| 2090 | Ga0496110_0376258 | |||
| 2091 | Ga0496110_0395250 | |||
| 2092 | Ga0496110_0797577 | |||
| 2093 | Ga0496111_0066786 | |||
| 2094 | Ga0496111_0078649 | |||
| 2095 | Ga0496111_0309685 | |||
| 2096 | Ga0496112_0441159 | |||
| 2097 | Ga0496113_0023334 | |||
| 2098 | Ga0496114_0074039 | |||
| 2099 | Ga0496114_0085143 | |||
| 2100 | Ga0496114_0361969 | |||
| 2101 | Ga0496114_0657363 | |||
| 2102 | Ga0496115_0030629 | |||
| 2103 | Ga0496115_0031809 | |||
| 2104 | Ga0496115_0070105 | |||
| 2105 | Ga0496115_0255813 | |||
| 2106 | Ga0496115_0270237 | |||
| 2107 | Ga0496116_0011005 | |||
| 2108 | Ga0496116_0020373 | |||
| 2109 | Ga0496116_0048807 | |||
| 2110 | Ga0496117_0000001 | |||
| 2111 | Ga0496118_0000008 | |||
| 2112 | Ga0496121_0022417 | |||
| 2113 | Ga0496121_0046914 | |||
| 2114 | Ga0496121_0051337 | |||
| 2115 | Ga0496121_0062269 | |||
| 2116 | Ga0496121_0068150 | |||
| 2117 | Ga0496121_0155519 | |||
| 2118 | Ga0496121_0155987 | |||
| 2119 | Ga0496121_0316324 | |||
| 2120 | Ga0496122_0000382 | |||
| 2121 | Ga0496122_0003122 | |||
| 2122 | Ga0496122_0005042 | |||
| 2123 | Ga0496122_0010712 | |||
| 2124 | Ga0496122_0014619 | |||
| 2125 | Ga0496122_0029491 | |||
| 2126 | Ga0496123_0000122 | |||
| 2127 | Ga0496123_0004901 | |||
| 2128 | Ga0496123_0020123 | |||
| 2129 | Ga0496123_0054958 | |||
| 2130 | Ga0496123_0061833 | |||
| 2131 | Ga0496124_0008972 | |||
| 2132 | Ga0496124_0009148 | |||
| 2133 | Ga0496124_0013661 | |||
| 2134 | Ga0496124_0053929 | |||
| 2135 | Ga0496124_0054155 | |||
| 2136 | Ga0496125_0000794 | |||
| 2137 | Ga0496125_0002645 | |||
| 2138 | Ga0496125_0003227 | |||
| 2139 | Ga0496125_0050421 | |||
| 2140 | Ga0495678_000016 | |||
| 2141 | Ga0495678_000203 | |||
| 2142 | Ga0495678_000315 | |||
| 2143 | Ga0495678_000459 | |||
| 2144 | Ga0495678_001055 | |||
| 2145 | Ga0495678_001277 | |||
| 2146 | Ga0495678_002374 | |||
| 2147 | Ga0495678_007339 | |||
| 2148 | Ga0495678_012755 | |||
| 2149 | Ga0495678_022194 | |||
| 2150 | Ga0495678_031035 | |||
| 2151 | Ga0495678_041595 | |||
| 2152 | Ga0495682_0000233 | |||
| 2153 | Ga0495682_0000716 | |||
| 2154 | Ga0495682_0002181 | |||
| 2155 | Ga0495682_0002325 | |||
| 2156 | Ga0495682_0004437 | |||
| 2157 | Ga0495682_0017786 | |||
| 2158 | Ga0501031_0028954 | |||
| 2159 | Ga0501038_0001264 | |||
| 2160 | Ga0501047_0500479 | |||
| 2161 | Ga0501238_003684 | |||
| 2162 | Ga0501249_006871 | |||
| 2163 | Ga0501269_000690 | |||
| 2164 | Ga0501035_0034648 | |||
| 2165 | nmdc:mga03683_33136_c1 | |||
| 2166 | nmdc:mga00v17_14216_c1 | |||
| 2167 | nmdc:mga00v17_1575_c1 | |||
| 2168 | nmdc:mga00v17_80587_c1 | |||
| 2169 | nmdc:mga0yw44_392_c1 | |||
| 2170 | nmdc:mga0k408_197197_c1 | |||
| 2171 | nmdc:mga06z11_42015_c1 | |||
| 2172 | nmdc:mga06z11_565693_c1 | |||
| 2173 | nmdc:mga07m45_33451_c2 | |||
| 2174 | Ga0495601_0161224 | |||
| 2175 | Ga0500650_0125108 | |||
| 2176 | Ga0500595_003939 | |||
| 2177 | Ga0500607_014530 | |||
| 2178 | Ga0500618_000371 | |||
| 2179 | Ga0500618_002593 | |||
| 2180 | Ga0500618_005119 | |||
| 2181 | Ga0500618_047322 | |||
| 2182 | Ga0500559_0055681 | |||
| 2183 | Ga0500574_001697 | |||
| 2184 | Ga0500586_009114 | |||
| 2185 | Ga0500588_0000160 | |||
| 2186 | Ga0500636_0000020 | |||
| 2187 | Ga0500637_0095057 | |||
| 2188 | Ga0500609_024413 | |||
| 2189 | Ga0587076_010224 | |||
| 2190 | 2511250824 | |||
| 2191 | 2511383943 | |||
| 2192 | 2521558091 | |||
| 2193 | 2550695659 | |||
| 2194 | 2553003216 | |||
| 2195 | 2601670849 | |||
| 2196 | 2643788196 | |||
| 2197 | 2643798289 | |||
| 2198 | 2644028213 | |||
| 2199 | 2644213863 | |||
| 2200 | 2644253992 | |||
| 2201 | 2644356761 | |||
| 2202 | 2644475292 | |||
| 2203 | 2738742050 | |||
| 2204 | 2738825000 | |||
| 2205 | 2738844505 | |||
| 2206 | 2739148797 | |||
| 2207 | 2739190716 | |||
| 2208 | 2739277083 | |||
| 2209 | 2739317193 | |||
| 2210 | 2739335434 | |||
| 2211 | 2739345976 | |||
| 2212 | 2765569220 | |||
| 2213 | 2808983910 | |||
| 2214 | 2809130996 | |||
| 2215 | 2809144740 | |||
| 2216 | 2809150669 | |||
| 2217 | 2819541170 | |||
| 2218 | 2819591660 | |||
| 2219 | 2819614764 | |||
| 2220 | 2821133610 | |||
| 2221 | 2839095894 | |||
| 2222 | 2842716781 | |||
| 2223 | 2852622186 | |||
| 2224 | 2857547620 | |||
| 2225 | 2857553720 | |||
| 2226 | 2857563882 | |||
| 2227 | 2857565399 | |||
| 2228 | 2884815023 | |||
| 2229 | 2884837471 | |||
| 2230 | 2884853762 | |||
| 2231 | 2885085353 | |||
| 2232 | 2896155121 | |||
| 2233 | 2904426709 | |||
| 2234 | 2904441135 | |||
| 2235 | 2904531924 | |||
| 2236 | 2904587850 | |||
| 2237 | 2904589990 | |||
| 2238 | 2904602624 | |||
| 2239 | 2919046555 | |||
| 2240 | 2919079872 | |||
| 2241 | 2919480349 | |||
| 2242 | 2919500875 | |||
| 2243 | 2923511338 | |||
| 2244 | 2928131271 | |||
| 2245 | 2932412229 | |||
| 2246 | 2932419744 | |||
| 2247 | 8002747634 | |||
| 2248 | 8047674391 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1oyp-assembly1.cif.gz_A | crystal structure of the phosphorolytic exoribonuclease rnase ph from bacillus subtilis | 0.9799 | 5 | 241 |
| 1oyr-assembly1.cif.gz_C | crystal structure of the phosphorolytic exoribonuclease rnase ph from bacillus subtilis | 0.9798 | 5 | 242 |
| 1udn-assembly1.cif.gz_A | crystal structure of the trna processing enzyme rnase ph from aquifex aeolicus | 0.9751 | 6 | 237 |
| 1udo-assembly1.cif.gz_A | crystal structure of the trna processing enzyme rnase ph r86a mutant from aquifex aeolicus | 0.9748 | 6 | 238 |
| 1uds-assembly1.cif.gz_A | crystal structure of the trna processing enzyme rnase ph r126a mutant from aquifex aeolicus | 0.9745 | 6 | 237 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3dd6A01 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;GHMP Kinase, N-terminal domain | 0.9724 | 17 | 241 | 3.30.230.70 |
| 1oysA01 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;GHMP Kinase, N-terminal domain | 0.9536 | 19 | 239 | 3.30.230.70 |
| 1oysA01 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;GHMP Kinase, N-terminal domain | 0.9443 | 19 | 239 | 3.30.230.70 |
| 3dd6A01 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;GHMP Kinase, N-terminal domain | 0.9396 | 17 | 241 | 3.30.230.70 |
| 2wnrF01 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;GHMP Kinase, N-terminal domain | 0.9394 | 14 | 240 | 3.30.230.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V4G6W3-F1-model_v4 | Ribonuclease PH | 1 | 160 | 241 |
|
| AF-A0A531ADD2-F1-model_v4 | Ribonuclease PH | 0.9974 | 160 | 240 |
|
| AF-A0A3D0DVA3-F1-model_v4 | Ribonuclease PH (EC 2.7.7.56) | 0.9948 | 134 | 244 |
GO:0009022
|
| AF-A0A3D1J113-F1-model_v4 | Ribonuclease PH | 0.9934 | 121 | 244 |
GO:0000049
GO:0006364 GO:0008033 GO:0009022 GO:0016075 |
| AF-A0A377LPC6-F1-model_v4 | Ribonuclease PH (EC 2.7.7.56) | 0.9933 | 163 | 230 |
GO:0009022
|