F490478
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1126 | 515 | 2252 | 100 |
Family's Representative Sequence
| Representative Sequence | 3300020078|Ga0206352_10173797|Ga0206352_101737971 |
| Length | 113 |
| Sequence | MSNIAVSTNRTSAATLQINKDPRDIILKPVVSEKSYSLIDEGKYTFLVDPRASKTEIKLAIEKIFGVKVAAVNTINRVGKARRTRFGTGKRKDTKRAIVTLKSGTIDIFTAVG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 8 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 9 | 3300003157 | Avena fatua rhizosphere microbial communities - H3_Bulk_Litter_17 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 10 | 3300003160 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_22 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 11 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 12 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 13 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 14 | 3300003305 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 15 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 16 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 17 | 3300003559 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 18 | 3300003568 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 19 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 20 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 21 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 22 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 23 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 24 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 25 | 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 26 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300004785 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 28 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 29 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 30 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 35 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 72 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 73 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 74 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 75 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 76 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 78 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 112 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 117 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300023309 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 119 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 122 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 171 | 3300029276 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 172 | 3300029277 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 173 | 3300029283 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctno.R1 | Metatranscriptome | Rhizosphere |
| 174 | 3300029285 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 | Metatranscriptome | Rhizosphere |
| 175 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 176 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 177 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 178 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 179 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 180 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 181 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 182 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 183 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 184 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 185 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 186 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 187 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 188 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 189 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 190 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 191 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 192 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 193 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 194 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 195 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 196 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 197 | 3300041442 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaT | Metatranscriptome | Rhizoplane |
| 198 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 199 | 3300041444 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT | Metatranscriptome | Rhizoplane |
| 200 | 3300041445 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaT | Metatranscriptome | Rhizoplane |
| 201 | 3300041446 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT | Metatranscriptome | Rhizoplane |
| 202 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 203 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 204 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 205 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 206 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 207 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 208 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 209 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 210 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 211 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 212 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 213 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 214 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 215 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 216 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 217 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 218 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 219 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 220 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 221 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 222 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 223 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 224 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 225 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 226 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 227 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 228 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 229 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 230 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 231 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 232 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 233 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 234 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 235 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 236 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 237 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 238 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 239 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 240 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 241 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 242 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 243 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 244 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 283 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 284 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 285 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 286 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 287 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 288 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 291 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 292 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 293 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 294 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 295 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 296 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 297 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 298 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 299 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 300 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 301 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 302 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 303 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 304 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 305 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 306 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 307 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 308 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 309 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 310 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 311 | 3300049131 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 312 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 313 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 314 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 315 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 316 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 317 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 318 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 319 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 320 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 321 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 322 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 323 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 324 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 325 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 326 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 327 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 328 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 329 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 330 | 3300049546 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 331 | 3300049547 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 332 | 3300049548 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 333 | 3300049549 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 334 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 335 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 336 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 337 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 358 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 365 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 366 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 367 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 368 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 369 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 370 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 371 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 373 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 375 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 376 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 377 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 378 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 379 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 380 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 381 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 382 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 383 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 384 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 385 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 386 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 387 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 388 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 389 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 391 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 392 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 393 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 394 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 395 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 396 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 397 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 398 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 399 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 400 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 401 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 402 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 403 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 404 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 405 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 406 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 407 | 3300059514 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 408 | 3300059603 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 62R_AD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 409 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 410 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 411 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 412 | 3300059608 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 413 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 414 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 415 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 416 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 417 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 418 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 419 | 3300059628 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 420 | 3300059629 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 421 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 422 | 3300059631 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 423 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 424 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 425 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 426 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 427 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 428 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 429 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 430 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 431 | 3300059650 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 432 | 3300059651 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 433 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 434 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 435 | 3300059656 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 153R_AW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 436 | 3300059657 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 437 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 438 | 3300059659 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 439 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 440 | 3300060247 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 61R_AD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 441 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 442 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 443 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 444 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 445 | 2585428157 | Microbacterium sp. CF335 | Isolate | Rhizosphere |
| 446 | 2643221542 | Microbacterium sp. Root1433D1 | Isolate | Unclassified |
| 447 | 2643221546 | Microbacterium sp. Root53 | Isolate | Unclassified |
| 448 | 2643221553 | Microbacterium sp. Root553 | Isolate | Unclassified |
| 449 | 2643221566 | Microbacterium sp. Root166 | Isolate | Unclassified |
| 450 | 2643221572 | Leifsonia sp. Root60 | Isolate | Unclassified |
| 451 | 2643221575 | Microbacterium sp. Root61 | Isolate | Unclassified |
| 452 | 2643221597 | Microbacterium sp. Root180 | Isolate | Unclassified |
| 453 | 2643221616 | Leifsonia sp. Root227 | Isolate | Unclassified |
| 454 | 2643221630 | Microbacterium sp. Root322 | Isolate | Unclassified |
| 455 | 2643221635 | Yonghaparkia sp. Root332 | Isolate | Unclassified |
| 456 | 2643221669 | Leifsonia sp. Root1293 | Isolate | Unclassified |
| 457 | 2643221724 | Microbacterium sp. Root280D1 | Isolate | Unclassified |
| 458 | 2728369380 | Microbacterium sp. 1.5R | Isolate | Rhizosphere |
| 459 | 2747842429 | Microbacterium sp. WCS2014-259 | Isolate | Unclassified |
| 460 | 2757320536 | Microbacterium sp. NFIX05 | Isolate | Unclassified |
| 461 | 2773857758 | Microbacterium chocolatum 1320 | Isolate | Unclassified |
| 462 | 2773857759 | Microbacterium sp. 1294 | Isolate | Unclassified |
| 463 | 2773857763 | Microbacterium sp. SAI-030 | Isolate | Unclassified |
| 464 | 2808606306 | Microbacterium sp. SLBN-146 | Isolate | Unclassified |
| 465 | 2808606368 | Microbacterium sp. SLBN-1 | Isolate | Unclassified |
| 466 | 2808606447 | Microbacterium sp. HAR-UPW-R2A-48 | Isolate | Unclassified |
| 467 | 2811994872 | Microbacterium sp. MU4Y-5-1 | Isolate | Unclassified |
| 468 | 2821268502 | Microbacterium sp. YT0620BN | Isolate | Unclassified |
| 469 | 2833709550 | Microbacterium sp. 3290 | Isolate | Rhizosphere |
| 470 | 2844841374 | Leifsonia soli DSM 23871 | Isolate | Rhizosphere |
| 471 | 2844852863 | Herbiconiux flava DSM 26474 | Isolate | Rhizosphere |
| 472 | 2852632344 | Microbacterium sp. AK009 | Isolate | Rhizosphere |
| 473 | 2852643534 | Leifsonia sp. AK011 | Isolate | Rhizosphere |
| 474 | 2852646457 | Microbacterium sp. AK031 | Isolate | Rhizosphere |
| 475 | 2852663356 | Microbacterium sp. JAI119 | Isolate | Rhizosphere |
| 476 | 2852677369 | Pseudoclavibacter sp. JAI123 | Isolate | Rhizosphere |
| 477 | 2857720070 | Microbacterium sp. R-72113 | Isolate | Unclassified |
| 478 | 2857723135 | Microbacterium sp. R-72356 | Isolate | Unclassified |
| 479 | 2857729791 | Plantibacter sp. R-72288 | Isolate | Unclassified |
| 480 | 2857737099 | Lysinimonas sp. R-73066 | Isolate | Unclassified |
| 481 | 2870628048 | Microbacterium thalassium DSM 12511 | Isolate | Rhizosphere |
| 482 | 2884763398 | Leifsonia sp. PS1209 | Isolate | Stem Tuber |
| 483 | 2895660088 | Leifsonia flava SYP-B2174 | Isolate | Rhizosphere |
| 484 | 2904509784 | Microbacterium sp. 1676 | Isolate | Rhizosphere |
| 485 | 2906799679 | Microbacterium karelineae TRM80801 | Isolate | Unclassified |
| 486 | 2908678064 | Microbacterium sp. 1518 | Isolate | Rhizosphere |
| 487 | 2919055335 | Leifsonia sp. 1010 | Isolate | Rhizosphere |
| 488 | 2919069694 | Microbacterium sp. 1154 | Isolate | Unclassified |
| 489 | 2919395869 | Microbacterium resistens 2980 | Isolate | Unclassified |
| 490 | 2919443155 | Agromyces sp. 3263 | Isolate | Rhizosphere |
| 491 | 2928090899 | Microbacterium sp. 1262 | Isolate | Rhizosphere |
| 492 | 2928121344 | Plantibacter flavus 1756 | Isolate | Rhizosphere |
| 493 | 2928153084 | Leifsonia sp. 563 | Isolate | Unclassified |
| 494 | 2945968032 | Microbacterium murale W2I7 | Isolate | Rhizosphere |
| 495 | 2946033335 | Microbacterium sp. W4I4 | Isolate | Rhizosphere |
| 496 | 2946041624 | Microbacterium natoriense W4I9-1 | Isolate | Rhizosphere |
| 497 | 2946080515 | Microbacterium sp. W4I20 | Isolate | Rhizosphere |
| 498 | 2966921586 | Rathayibacter agropyri 617 | Isolate | Rhizosphere |
| 499 | 2966924647 | Frigoribacterium sp. 2355 | Isolate | Rhizosphere |
| 500 | 2974294766 | Microbacterium proteolyticum SORGH_AS 209 | Isolate | Unclassified |
| 501 | 2974324384 | Microbacterium sp. SORGH_AS 344 | Isolate | Unclassified |
| 502 | 2977228692 | Microbacterium sp. SORGH_AS 421 | Isolate | Unclassified |
| 503 | 2977236895 | Microbacterium testaceum SORGH_AS 426 | Isolate | Unclassified |
| 504 | 2977251589 | Microbacterium sp. SORGH_AS 505 | Isolate | Unclassified |
| 505 | 2977264416 | Microbacterium testaceum SORGH_AS 594 | Isolate | Unclassified |
| 506 | 2984542743 | Microbacterium sp. SORGH_AS454 | Isolate | Aerial Root |
| 507 | 2984580707 | Microbacterium paludicola SORGH_AS919 | Isolate | Aerial Root |
| 508 | 2995726249 | Leucobacter zeae CC-MF41 | Isolate | Rhizosphere |
| 509 | 8004182704 | Microbacterium paraoxydans ku-mp | Isolate | Unclassified |
| 510 | 8004212874 | Microbacterium sp. NC79 | Isolate | Rhizosphere |
| 511 | 8016254467 | Microbacterium sp. SLBN-111 (version 3) | Isolate | Rhizosphere |
| 512 | 8045830549 | Microbacterium yannicii DSM 23203 | Isolate | Unclassified |
| 513 | 8055034563 | Leucobacter allii H21R-40 | Isolate | Rhizosphere |
| 514 | 8055037949 | Leucobacter rhizosphaerae H25R-14 | Isolate | Rhizosphere |
| 515 | 8057345674 | Herbiconiux aconitum CPCC 205763 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 66.61 |
| Metatranscriptomes | 27.09 |
| Isolates | 6.31 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.18 |
| Bulb | 0 |
| Endosphere | 7.9 |
| Nodule | 0 |
| Rhizoplane | 6.48 |
| Rhizosphere | 72.56 |
| Stem | 0 |
| Stem Tuber | 0.09 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0206352_10173797 | 3300020078 | Bacteria | 1900 |
| 2 | JGI24740J21852_10000460 | 3300001979 | Bacteria | 17440 |
| 3 | JGI24740J21852_10008552 | 3300001979 | Bacteria | 4069 |
| 4 | JGI24740J21852_10012670 | 3300001979 | Bacteria | 3172 |
| 5 | JGI24740J21852_10050801 | 3300001979 | Bacteria | 1190 |
| 6 | JGI24739J22299_10005224 | 3300001989 | Bacteria | 4947 |
| 7 | JGI24739J22299_10093748 | 3300001989 | Bacteria | 912 |
| 8 | JGI24737J22298_10063151 | 3300001990 | Bacteria | 1112 |
| 9 | JGI24735J21928_10042386 | 3300002067 | Bacteria | 1325 |
| 10 | JGI24735J21928_10064972 | 3300002067 | Bacteria | 1047 |
| 11 | JGI25162J39368_1008761 | 3300002737 | Bacteria | 1418 |
| 12 | JGI25154J39366_1006883 | 3300002738 | Bacteria | 1612 |
| 13 | JGI25164J39214_1000440 | 3300002772 | Bacteria | 22554 |
| 14 | Ga0006774J45829_10761 | 3300003157 | Bacteria | 593 |
| 15 | Ga0006779J45831_102222 | 3300003160 | Bacteria | 5110 |
| 16 | Ga0006778J45830_1023361 | 3300003162 | Bacteria | 1084 |
| 17 | Ga0006778J45830_1037863 | 3300003162 | Bacteria | 2270 |
| 18 | Ga0006759J45824_1032491 | 3300003163 | Bacteria | 614 |
| 19 | JGI25165J46597_1000061 | 3300003214 | Bacteria | 208362 |
| 20 | Ga0006770J48903_1025413 | 3300003305 | Bacteria | 621 |
| 21 | Ga0006777J48905_1024731 | 3300003308 | Bacteria | 1087 |
| 22 | Ga0007417J51691_1036599 | 3300003544 | Bacteria | 937 |
| 23 | Ga0007427J51700_102557 | 3300003559 | Bacteria | 6979 |
| 24 | Ga0006781J51513_1004015 | 3300003568 | Bacteria | 4443 |
| 25 | Ga0007410J51695_1022860 | 3300003574 | Bacteria | 1161 |
| 26 | Ga0007409J51694_1032594 | 3300003575 | Bacteria | 689 |
| 27 | Ga0007416J51690_1023401 | 3300003577 | Bacteria | 1339 |
| 28 | Ga0006562J51391_1024272 | 3300003578 | Bacteria | 2938 |
| 29 | Ga0006562J51391_1024273 | 3300003578 | Bacteria | 2580 |
| 30 | Ga0007429J51699_1022931 | 3300003579 | Bacteria | 1165 |
| 31 | Ga0032354_1037035 | 3300003693 | Bacteria | 547 |
| 32 | Ga0032354_1078778 | 3300003693 | Bacteria | 522 |
| 33 | Ga0006780_1005385 | 3300003735 | Bacteria | 6163 |
| 34 | Ga0006780_1012984 | 3300003735 | Bacteria | 929 |
| 35 | Ga0055542_1016158 | 3300003762 | Bacteria | 1182 |
| 36 | Ga0058858_1046361 | 3300004785 | Bacteria | 647 |
| 37 | Ga0058858_1420510 | 3300004785 | Bacteria | 669 |
| 38 | Ga0058859_11827816 | 3300004798 | Bacteria | 513 |
| 39 | Ga0058860_10000991 | 3300004801 | Bacteria | 645 |
| 40 | Ga0058860_10026029 | 3300004801 | Bacteria | 699 |
| 41 | Ga0058860_12222763 | 3300004801 | Bacteria | 535 |
| 42 | Ga0065714_10155188 | 3300005288 | Bacteria | 1083 |
| 43 | Ga0070658_10009122 | 3300005327 | Bacteria | 7974 |
| 44 | Ga0070658_10220817 | 3300005327 | Bacteria | 1603 |
| 45 | Ga0070658_10542007 | 3300005327 | Bacteria | 1007 |
| 46 | Ga0070670_100851899 | 3300005331 | Bacteria | 825 |
| 47 | Ga0070677_10424709 | 3300005333 | Bacteria | 706 |
| 48 | Ga0068869_100209932 | 3300005334 | Bacteria | 1539 |
| 49 | Ga0068869_100553472 | 3300005334 | Bacteria | 967 |
| 50 | Ga0070682_100038470 | 3300005337 | Bacteria | 2934 |
| 51 | Ga0070682_100116365 | 3300005337 | Bacteria | 1788 |
| 52 | Ga0070682_100705191 | 3300005337 | Bacteria | 810 |
| 53 | Ga0070682_101264025 | 3300005337 | Bacteria | 626 |
| 54 | Ga0068868_100709387 | 3300005338 | Bacteria | 901 |
| 55 | Ga0070660_100057825 | 3300005339 | Bacteria | 3005 |
| 56 | Ga0070660_100400716 | 3300005339 | Bacteria | 1134 |
| 57 | Ga0070661_100351559 | 3300005344 | Bacteria | 1156 |
| 58 | Ga0070692_11119038 | 3300005345 | Bacteria | 557 |
| 59 | Ga0070668_100317440 | 3300005347 | Bacteria | 1311 |
| 60 | Ga0070671_100053010 | 3300005355 | Bacteria | 3372 |
| 61 | Ga0070674_100045759 | 3300005356 | Bacteria | 2990 |
| 62 | Ga0070659_100003025 | 3300005366 | Bacteria | 11966 |
| 63 | Ga0070659_100021971 | 3300005366 | Bacteria | 4867 |
| 64 | Ga0070667_100042795 | 3300005367 | Bacteria | 3800 |
| 65 | Ga0070667_100151748 | 3300005367 | Bacteria | 2036 |
| 66 | Ga0070667_100706796 | 3300005367 | Bacteria | 933 |
| 67 | Ga0070667_101201259 | 3300005367 | Bacteria | 710 |
| 68 | Ga0070714_100511690 | 3300005435 | Bacteria | 1146 |
| 69 | Ga0070714_100600580 | 3300005435 | Bacteria | 1057 |
| 70 | Ga0070714_100974345 | 3300005435 | Bacteria | 825 |
| 71 | Ga0070710_10095608 | 3300005437 | Bacteria | 1760 |
| 72 | Ga0070711_101031561 | 3300005439 | Bacteria | 707 |
| 73 | Ga0070705_101430272 | 3300005440 | Bacteria | 577 |
| 74 | Ga0070663_100016293 | 3300005455 | Bacteria | 4823 |
| 75 | Ga0070663_100829139 | 3300005455 | Bacteria | 795 |
| 76 | Ga0070663_100959306 | 3300005455 | Bacteria | 742 |
| 77 | Ga0070663_101788530 | 3300005455 | Bacteria | 551 |
| 78 | Ga0070663_101938008 | 3300005455 | Bacteria | 530 |
| 79 | Ga0070678_100660439 | 3300005456 | Bacteria | 939 |
| 80 | Ga0070678_102195584 | 3300005456 | Bacteria | 524 |
| 81 | Ga0070685_11138554 | 3300005466 | Bacteria | 591 |
| 82 | Ga0070685_11387074 | 3300005466 | Bacteria | 539 |
| 83 | Ga0070679_100496419 | 3300005530 | Bacteria | 1164 |
| 84 | Ga0070684_100631291 | 3300005535 | Bacteria | 997 |
| 85 | Ga0068853_100068961 | 3300005539 | Bacteria | 3075 |
| 86 | Ga0070672_100066968 | 3300005543 | Bacteria | 2844 |
| 87 | Ga0070672_101003912 | 3300005543 | Bacteria | 740 |
| 88 | Ga0070695_101035290 | 3300005545 | Bacteria | 669 |
| 89 | Ga0070693_100850847 | 3300005547 | Bacteria | 680 |
| 90 | Ga0070665_100083091 | 3300005548 | Bacteria | 3208 |
| 91 | Ga0068855_100047986 | 3300005563 | Bacteria | 5042 |
| 92 | Ga0068855_100261541 | 3300005563 | Bacteria | 1927 |
| 93 | Ga0068855_100427578 | 3300005563 | Bacteria | 1448 |
| 94 | Ga0068855_102444860 | 3300005563 | Bacteria | 521 |
| 95 | Ga0068857_100999643 | 3300005577 | Bacteria | 805 |
| 96 | Ga0070702_101236485 | 3300005615 | Bacteria | 604 |
| 97 | Ga0068852_100120419 | 3300005616 | Bacteria | 2401 |
| 98 | Ga0068852_100417091 | 3300005616 | Bacteria | 1323 |
| 99 | Ga0068859_100456521 | 3300005617 | Bacteria | 1374 |
| 100 | Ga0068864_100318828 | 3300005618 | Bacteria | 1459 |
| 101 | Ga0068861_100790364 | 3300005719 | Bacteria | 890 |
| 102 | Ga0068851_10000022 | 3300005834 | Bacteria | 129607 |
| 103 | Ga0068863_100830072 | 3300005841 | Bacteria | 922 |
| 104 | Ga0068858_100034623 | 3300005842 | Bacteria | 4685 |
| 105 | Ga0068860_100224634 | 3300005843 | Bacteria | 1824 |
| 106 | Ga0068862_101693087 | 3300005844 | Bacteria | 641 |
| 107 | Ga0075365_10012248 | 3300006038 | Bacteria | 5084 |
| 108 | Ga0075365_10020292 | 3300006038 | Bacteria | 4118 |
| 109 | Ga0075365_10113563 | 3300006038 | Bacteria | 1863 |
| 110 | Ga0075365_10207236 | 3300006038 | Bacteria | 1374 |
| 111 | Ga0075365_10476055 | 3300006038 | Bacteria | 882 |
| 112 | Ga0075365_11037567 | 3300006038 | Bacteria | 578 |
| 113 | Ga0075365_11326162 | 3300006038 | Bacteria | 506 |
| 114 | Ga0075368_10014257 | 3300006042 | Bacteria | 2933 |
| 115 | Ga0075368_10110645 | 3300006042 | Bacteria | 1132 |
| 116 | Ga0075363_100132063 | 3300006048 | Bacteria | 1401 |
| 117 | Ga0075363_100994458 | 3300006048 | Bacteria | 517 |
| 118 | Ga0075364_10084726 | 3300006051 | Bacteria | 2098 |
| 119 | Ga0075364_10243007 | 3300006051 | Bacteria | 1223 |
| 120 | Ga0075364_10260286 | 3300006051 | Bacteria | 1179 |
| 121 | Ga0075364_10351716 | 3300006051 | Bacteria | 1004 |
| 122 | Ga0075364_10544300 | 3300006051 | Bacteria | 794 |
| 123 | Ga0075364_10819133 | 3300006051 | Bacteria | 634 |
| 124 | Ga0075432_10179913 | 3300006058 | Bacteria | 827 |
| 125 | Ga0070716_101339101 | 3300006173 | Bacteria | 580 |
| 126 | Ga0075367_10020722 | 3300006178 | Bacteria | 3666 |
| 127 | Ga0075367_10298664 | 3300006178 | Bacteria | 1013 |
| 128 | Ga0075367_10306712 | 3300006178 | Bacteria | 1000 |
| 129 | Ga0075369_10008212 | 3300006186 | Bacteria | 4009 |
| 130 | Ga0075369_10047871 | 3300006186 | Bacteria | 1844 |
| 131 | Ga0075369_10119131 | 3300006186 | Bacteria | 1194 |
| 132 | Ga0075369_10437265 | 3300006186 | Bacteria | 619 |
| 133 | Ga0097621_101150850 | 3300006237 | Bacteria | 730 |
| 134 | Ga0097621_101562109 | 3300006237 | Bacteria | 627 |
| 135 | Ga0075370_10043477 | 3300006353 | Bacteria | 2539 |
| 136 | Ga0075370_10231423 | 3300006353 | Bacteria | 1094 |
| 137 | Ga0068871_100843645 | 3300006358 | Bacteria | 847 |
| 138 | Ga0097620_100456490 | 3300006931 | Bacteria | 1374 |
| 139 | Ga0105251_10056462 | 3300009011 | Bacteria | 1858 |
| 140 | Ga0105244_10004765 | 3300009036 | Bacteria | 9234 |
| 141 | Ga0105244_10096109 | 3300009036 | Bacteria | 1453 |
| 142 | Ga0105245_10212872 | 3300009098 | Bacteria | 1861 |
| 143 | Ga0105245_13198088 | 3300009098 | Bacteria | 508 |
| 144 | Ga0105247_10296667 | 3300009101 | Bacteria | 1120 |
| 145 | Ga0105247_11114506 | 3300009101 | Bacteria | 623 |
| 146 | Ga0105243_10671170 | 3300009148 | Bacteria | 1007 |
| 147 | Ga0105243_12512123 | 3300009148 | Bacteria | 554 |
| 148 | Ga0105243_13023197 | 3300009148 | Bacteria | 510 |
| 149 | Ga0105242_12699972 | 3300009176 | Bacteria | 546 |
| 150 | Ga0105248_10266117 | 3300009177 | Bacteria | 1930 |
| 151 | Ga0105248_10780203 | 3300009177 | Bacteria | 1078 |
| 152 | Ga0105237_10542431 | 3300009545 | Bacteria | 1170 |
| 153 | Ga0105237_10717429 | 3300009545 | Bacteria | 1006 |
| 154 | Ga0105237_10804485 | 3300009545 | Bacteria | 947 |
| 155 | Ga0105237_11204814 | 3300009545 | Bacteria | 764 |
| 156 | Ga0105238_10027288 | 3300009551 | Bacteria | 5817 |
| 157 | Ga0105238_10214305 | 3300009551 | Bacteria | 1902 |
| 158 | Ga0105238_10347193 | 3300009551 | Bacteria | 1473 |
| 159 | Ga0105249_11467249 | 3300009553 | Bacteria | 754 |
| 160 | Ga0105239_10378900 | 3300010375 | Bacteria | 1599 |
| 161 | Ga0105239_10421283 | 3300010375 | Bacteria | 1512 |
| 162 | Ga0105239_12866857 | 3300010375 | Bacteria | 563 |
| 163 | Ga0105246_10750250 | 3300011119 | Bacteria | 861 |
| 164 | Ga0105246_11019891 | 3300011119 | Bacteria | 750 |
| 165 | Ga0105246_11449826 | 3300011119 | Bacteria | 643 |
| 166 | Ga0157373_10522192 | 3300013100 | Bacteria | 859 |
| 167 | Ga0157371_10013796 | 3300013102 | Bacteria | 6121 |
| 168 | Ga0157371_10174660 | 3300013102 | Bacteria | 1536 |
| 169 | Ga0157371_11065031 | 3300013102 | Bacteria | 619 |
| 170 | Ga0157370_10010513 | 3300013104 | Bacteria | 9746 |
| 171 | Ga0157370_10443917 | 3300013104 | Bacteria | 1193 |
| 172 | Ga0157370_10765040 | 3300013104 | Bacteria | 880 |
| 173 | Ga0157370_11133628 | 3300013104 | Bacteria | 706 |
| 174 | Ga0157369_10041722 | 3300013105 | Bacteria | 5008 |
| 175 | Ga0157369_10059481 | 3300013105 | Bacteria | 4120 |
| 176 | Ga0157369_10465961 | 3300013105 | Bacteria | 1308 |
| 177 | Ga0157369_10740957 | 3300013105 | Bacteria | 1011 |
| 178 | Ga0157369_11196541 | 3300013105 | Bacteria | 776 |
| 179 | Ga0171462_1001 | 3300013250 | Bacteria | 1135406 |
| 180 | Ga0157374_10789598 | 3300013296 | Bacteria | 965 |
| 181 | Ga0157374_10950176 | 3300013296 | Bacteria | 878 |
| 182 | Ga0157374_11320556 | 3300013296 | Bacteria | 743 |
| 183 | Ga0157374_11906802 | 3300013296 | Bacteria | 620 |
| 184 | Ga0157374_12265189 | 3300013296 | Bacteria | 570 |
| 185 | Ga0163162_10177320 | 3300013306 | Bacteria | 2257 |
| 186 | Ga0163162_10303139 | 3300013306 | Bacteria | 1730 |
| 187 | Ga0163162_10620717 | 3300013306 | Bacteria | 1206 |
| 188 | Ga0163162_10668866 | 3300013306 | Bacteria | 1161 |
| 189 | Ga0163162_11851247 | 3300013306 | Bacteria | 690 |
| 190 | Ga0157372_10232148 | 3300013307 | Bacteria | 2139 |
| 191 | Ga0157372_10438593 | 3300013307 | Bacteria | 1522 |
| 192 | Ga0157372_10845425 | 3300013307 | Bacteria | 1062 |
| 193 | Ga0157372_11689194 | 3300013307 | Bacteria | 729 |
| 194 | Ga0157372_12253699 | 3300013307 | Bacteria | 626 |
| 195 | Ga0157375_10596593 | 3300013308 | Bacteria | 1264 |
| 196 | Ga0157375_10925170 | 3300013308 | Bacteria | 1015 |
| 197 | Ga0157375_11150802 | 3300013308 | Bacteria | 909 |
| 198 | Ga0163163_11577474 | 3300014325 | Bacteria | 717 |
| 199 | Ga0157380_10453219 | 3300014326 | Bacteria | 1233 |
| 200 | Ga0157380_11040347 | 3300014326 | Bacteria | 854 |
| 201 | Ga0157379_10053997 | 3300014968 | Bacteria | 3590 |
| 202 | Ga0157379_11354817 | 3300014968 | Bacteria | 688 |
| 203 | Ga0157376_10560361 | 3300014969 | Bacteria | 1132 |
| 204 | Ga0163161_10157815 | 3300017792 | Bacteria | 1728 |
| 205 | Ga0197907_10361036 | 3300020069 | Bacteria | 706 |
| 206 | Ga0197907_10498511 | 3300020069 | Bacteria | 1399 |
| 207 | Ga0197907_11223662 | 3300020069 | Bacteria | 1196 |
| 208 | Ga0197907_11245501 | 3300020069 | Bacteria | 1210 |
| 209 | Ga0206349_1034221 | 3300020075 | Bacteria | 2022 |
| 210 | Ga0206349_1250205 | 3300020075 | Bacteria | 1104 |
| 211 | Ga0206349_1521915 | 3300020075 | Bacteria | 2815 |
| 212 | Ga0206349_1604768 | 3300020075 | Bacteria | 966 |
| 213 | Ga0206349_1707418 | 3300020075 | Bacteria | 844 |
| 214 | Ga0206349_1849192 | 3300020075 | Bacteria | 734 |
| 215 | Ga0206355_1041932 | 3300020076 | Bacteria | 1057 |
| 216 | Ga0206355_1129944 | 3300020076 | Bacteria | 581 |
| 217 | Ga0206355_1137396 | 3300020076 | Bacteria | 2655 |
| 218 | Ga0206355_1277111 | 3300020076 | Bacteria | 651 |
| 219 | Ga0206355_1324827 | 3300020076 | Bacteria | 920 |
| 220 | Ga0206355_1605190 | 3300020076 | Bacteria | 995 |
| 221 | Ga0206355_1669966 | 3300020076 | Bacteria | 918 |
| 222 | Ga0206351_10185023 | 3300020077 | Bacteria | 1382 |
| 223 | Ga0206351_10564340 | 3300020077 | Bacteria | 919 |
| 224 | Ga0206351_10632664 | 3300020077 | Bacteria | 592 |
| 225 | Ga0206351_10843496 | 3300020077 | Bacteria | 594 |
| 226 | Ga0206352_10172050 | 3300020078 | Bacteria | 897 |
| 227 | Ga0206352_10209131 | 3300020078 | Bacteria | 1340 |
| 228 | Ga0206352_10305699 | 3300020078 | Bacteria | 4238 |
| 229 | Ga0206352_10498154 | 3300020078 | Bacteria | 729 |
| 230 | Ga0206352_11013222 | 3300020078 | Bacteria | 1084 |
| 231 | Ga0206352_11153687 | 3300020078 | Bacteria | 1615 |
| 232 | Ga0206350_11401627 | 3300020080 | Bacteria | 3011 |
| 233 | Ga0206350_11436187 | 3300020080 | Bacteria | 649 |
| 234 | Ga0206354_10084611 | 3300020081 | Bacteria | 1354 |
| 235 | Ga0206354_11464084 | 3300020081 | Bacteria | 784 |
| 236 | Ga0206354_11671741 | 3300020081 | Bacteria | 1532 |
| 237 | Ga0206353_10160049 | 3300020082 | Bacteria | 596 |
| 238 | Ga0206353_10463612 | 3300020082 | Bacteria | 694 |
| 239 | Ga0206353_11638567 | 3300020082 | Bacteria | 659 |
| 240 | Ga0154015_1476573 | 3300020610 | Bacteria | 1038 |
| 241 | Ga0224712_10083078 | 3300022467 | Bacteria | 1326 |
| 242 | Ga0224712_10153416 | 3300022467 | Bacteria | 1022 |
| 243 | Ga0256744_142576 | 3300023309 | Bacteria | 948 |
| 244 | Ga0207427_100042 | 3300025231 | Bacteria | 254170 |
| 245 | Ga0209437_100510 | 3300025233 | Bacteria | 27572 |
| 246 | Ga0209646_1000013 | 3300025246 | Bacteria | 565830 |
| 247 | Ga0209646_1000014 | 3300025246 | Bacteria | 550484 |
| 248 | Ga0209148_1002314 | 3300025254 | Bacteria | 6797 |
| 249 | Ga0209129_1016695 | 3300025258 | Bacteria | 1464 |
| 250 | Ga0209233_1000001 | 3300025261 | Bacteria | 2992747 |
| 251 | Ga0209130_1039307 | 3300025284 | Bacteria | 922 |
| 252 | Ga0209676_1023744 | 3300025292 | Bacteria | 2001 |
| 253 | Ga0207656_10000005 | 3300025321 | Bacteria | 490514 |
| 254 | Ga0207655_1000386 | 3300025728 | Bacteria | 61740 |
| 255 | Ga0207655_1134228 | 3300025728 | Bacteria | 802 |
| 256 | Ga0207682_10145213 | 3300025893 | Bacteria | 1067 |
| 257 | Ga0207692_10352603 | 3300025898 | Bacteria | 907 |
| 258 | Ga0207710_10758950 | 3300025900 | Bacteria | 510 |
| 259 | Ga0207710_10775627 | 3300025900 | Bacteria | 504 |
| 260 | Ga0207647_10035337 | 3300025904 | Bacteria | 3185 |
| 261 | Ga0207647_10070828 | 3300025904 | Bacteria | 2105 |
| 262 | Ga0207647_10115621 | 3300025904 | Bacteria | 1584 |
| 263 | Ga0207685_10857587 | 3300025905 | Bacteria | 503 |
| 264 | Ga0207643_10091417 | 3300025908 | Bacteria | 1775 |
| 265 | Ga0207705_10000001 | 3300025909 | Bacteria | 2061880 |
| 266 | Ga0207705_10192945 | 3300025909 | Bacteria | 1541 |
| 267 | Ga0207705_10257753 | 3300025909 | Bacteria | 1331 |
| 268 | Ga0207654_10000001 | 3300025911 | Bacteria | 1816198 |
| 269 | Ga0207695_10277353 | 3300025913 | Bacteria | 1571 |
| 270 | Ga0207671_10000016 | 3300025914 | Bacteria | 435413 |
| 271 | Ga0207671_10082507 | 3300025914 | Bacteria | 2412 |
| 272 | Ga0207671_10901436 | 3300025914 | Bacteria | 699 |
| 273 | Ga0207671_11568720 | 3300025914 | Bacteria | 507 |
| 274 | Ga0207657_10005997 | 3300025919 | Bacteria | 12644 |
| 275 | Ga0207657_10372004 | 3300025919 | Bacteria | 1126 |
| 276 | Ga0207649_10165081 | 3300025920 | Bacteria | 1537 |
| 277 | Ga0207646_11316455 | 3300025922 | Bacteria | 630 |
| 278 | Ga0207694_10000057 | 3300025924 | Bacteria | 146441 |
| 279 | Ga0207650_10347892 | 3300025925 | Bacteria | 1219 |
| 280 | Ga0207659_11124255 | 3300025926 | Bacteria | 676 |
| 281 | Ga0207687_10091182 | 3300025927 | Bacteria | 2222 |
| 282 | Ga0207664_10347094 | 3300025929 | Bacteria | 1313 |
| 283 | Ga0207664_10844209 | 3300025929 | Bacteria | 823 |
| 284 | Ga0207644_10132279 | 3300025931 | Bacteria | 1911 |
| 285 | Ga0207690_10003803 | 3300025932 | Bacteria | 8937 |
| 286 | Ga0207690_11430486 | 3300025932 | Bacteria | 578 |
| 287 | Ga0207690_11861409 | 3300025932 | Bacteria | 502 |
| 288 | Ga0207709_10233903 | 3300025935 | Bacteria | 1332 |
| 289 | Ga0207709_10315467 | 3300025935 | Bacteria | 1168 |
| 290 | Ga0207665_10571300 | 3300025939 | Bacteria | 880 |
| 291 | Ga0207665_10584751 | 3300025939 | Bacteria | 870 |
| 292 | Ga0207691_10126653 | 3300025940 | Bacteria | 2259 |
| 293 | Ga0207711_10022131 | 3300025941 | Bacteria | 5314 |
| 294 | Ga0207711_10469680 | 3300025941 | Bacteria | 1171 |
| 295 | Ga0207689_10351692 | 3300025942 | Bacteria | 1225 |
| 296 | Ga0207661_11318852 | 3300025944 | Bacteria | 663 |
| 297 | Ga0207667_10021165 | 3300025949 | Bacteria | 7212 |
| 298 | Ga0207667_10069574 | 3300025949 | Bacteria | 3663 |
| 299 | Ga0207667_10303822 | 3300025949 | Bacteria | 1630 |
| 300 | Ga0207667_11310732 | 3300025949 | Bacteria | 700 |
| 301 | Ga0207667_11695718 | 3300025949 | Bacteria | 598 |
| 302 | Ga0207667_11939989 | 3300025949 | Bacteria | 550 |
| 303 | Ga0207712_11576636 | 3300025961 | Bacteria | 588 |
| 304 | Ga0207668_10525059 | 3300025972 | Bacteria | 1022 |
| 305 | Ga0207668_10584374 | 3300025972 | Bacteria | 971 |
| 306 | Ga0207640_10304432 | 3300025981 | Bacteria | 1262 |
| 307 | Ga0207658_10014016 | 3300025986 | Bacteria | 5487 |
| 308 | Ga0207658_11137653 | 3300025986 | Bacteria | 713 |
| 309 | Ga0207658_11424409 | 3300025986 | Bacteria | 634 |
| 310 | Ga0207658_11592194 | 3300025986 | Bacteria | 597 |
| 311 | Ga0207658_11943280 | 3300025986 | Bacteria | 536 |
| 312 | Ga0207703_10001453 | 3300026035 | Bacteria | 21613 |
| 313 | Ga0207639_10056116 | 3300026041 | Bacteria | 3018 |
| 314 | Ga0207639_11316923 | 3300026041 | Bacteria | 678 |
| 315 | Ga0207678_10027691 | 3300026067 | Bacteria | 4947 |
| 316 | Ga0207678_10329291 | 3300026067 | Bacteria | 1315 |
| 317 | Ga0207678_10387201 | 3300026067 | Bacteria | 1209 |
| 318 | Ga0207708_10290684 | 3300026075 | Bacteria | 1327 |
| 319 | Ga0207702_10029018 | 3300026078 | Bacteria | 4601 |
| 320 | Ga0207702_10208314 | 3300026078 | Bacteria | 1816 |
| 321 | Ga0207683_10168192 | 3300026121 | Bacteria | 1985 |
| 322 | Ga0207698_10139001 | 3300026142 | Bacteria | 2089 |
| 323 | Ga0207698_10304750 | 3300026142 | Bacteria | 1485 |
| 324 | Ga0207698_10339745 | 3300026142 | Bacteria | 1414 |
| 325 | Ga0209813_10207646 | 3300027866 | Bacteria | 728 |
| 326 | Ga0209813_10301414 | 3300027866 | Bacteria | 622 |
| 327 | Ga0268266_10393555 | 3300028379 | Bacteria | 1309 |
| 328 | Ga0268265_10135334 | 3300028380 | Bacteria | 2055 |
| 329 | Ga0307517_10268976 | 3300028786 | Bacteria | 982 |
| 330 | Ga0311004_143717 | 3300029276 | Bacteria | 573 |
| 331 | Ga0311001_1007990 | 3300029277 | Bacteria | 685 |
| 332 | Ga0310982_140508 | 3300029283 | Bacteria | 538 |
| 333 | Ga0310981_1006206 | 3300029285 | Bacteria | 664 |
| 334 | Ga0307513_10282932 | 3300031456 | Bacteria | 1435 |
| 335 | Ga0307513_10547263 | 3300031456 | Bacteria | 870 |
| 336 | Ga0307408_100631993 | 3300031548 | Bacteria | 955 |
| 337 | Ga0307408_100725948 | 3300031548 | Bacteria | 895 |
| 338 | Ga0307408_101247540 | 3300031548 | Bacteria | 695 |
| 339 | Ga0307514_10304681 | 3300031649 | Bacteria | 889 |
| 340 | Ga0307405_10646754 | 3300031731 | Bacteria | 869 |
| 341 | Ga0307405_10686116 | 3300031731 | Bacteria | 846 |
| 342 | Ga0307405_10689973 | 3300031731 | Bacteria | 844 |
| 343 | Ga0307405_10696163 | 3300031731 | Bacteria | 841 |
| 344 | Ga0307405_11098457 | 3300031731 | Bacteria | 683 |
| 345 | Ga0307413_10728988 | 3300031824 | Bacteria | 826 |
| 346 | Ga0307413_11255066 | 3300031824 | Bacteria | 646 |
| 347 | Ga0307413_11802838 | 3300031824 | Bacteria | 548 |
| 348 | Ga0307410_10735200 | 3300031852 | Bacteria | 834 |
| 349 | Ga0307406_10000938 | 3300031901 | Bacteria | 16294 |
| 350 | Ga0307406_10074938 | 3300031901 | Bacteria | 2230 |
| 351 | Ga0307406_10300233 | 3300031901 | Bacteria | 1233 |
| 352 | Ga0307406_10444568 | 3300031901 | Bacteria | 1038 |
| 353 | Ga0307406_10607517 | 3300031901 | Bacteria | 902 |
| 354 | Ga0307406_10834118 | 3300031901 | Bacteria | 780 |
| 355 | Ga0307406_11120531 | 3300031901 | Bacteria | 680 |
| 356 | Ga0307407_10192660 | 3300031903 | Bacteria | 1360 |
| 357 | Ga0307407_10362949 | 3300031903 | Bacteria | 1029 |
| 358 | Ga0307407_10919056 | 3300031903 | Bacteria | 672 |
| 359 | Ga0307412_10038041 | 3300031911 | Bacteria | 3095 |
| 360 | Ga0307412_10708588 | 3300031911 | Bacteria | 865 |
| 361 | Ga0307412_11305184 | 3300031911 | Bacteria | 653 |
| 362 | Ga0307412_12078050 | 3300031911 | Bacteria | 527 |
| 363 | Ga0307412_12177422 | 3300031911 | Bacteria | 516 |
| 364 | Ga0307409_100257187 | 3300031995 | Bacteria | 1600 |
| 365 | Ga0307409_100287294 | 3300031995 | Bacteria | 1523 |
| 366 | Ga0307409_100447884 | 3300031995 | Bacteria | 1245 |
| 367 | Ga0307409_100688508 | 3300031995 | Bacteria | 1020 |
| 368 | Ga0307409_101079594 | 3300031995 | Bacteria | 823 |
| 369 | Ga0307409_101112435 | 3300031995 | Bacteria | 811 |
| 370 | Ga0307416_100528221 | 3300032002 | Bacteria | 1249 |
| 371 | Ga0307416_101566001 | 3300032002 | Bacteria | 764 |
| 372 | Ga0307416_101643799 | 3300032002 | Bacteria | 747 |
| 373 | Ga0307416_102199011 | 3300032002 | Bacteria | 653 |
| 374 | Ga0307416_102363314 | 3300032002 | Bacteria | 631 |
| 375 | Ga0307414_10503976 | 3300032004 | Bacteria | 1071 |
| 376 | Ga0307411_10299553 | 3300032005 | Bacteria | 1289 |
| 377 | Ga0307411_11041070 | 3300032005 | Bacteria | 735 |
| 378 | Ga0307415_100008614 | 3300032126 | Bacteria | 5665 |
| 379 | Ga0307415_100925132 | 3300032126 | Bacteria | 805 |
| 380 | Ga0307415_100939453 | 3300032126 | Bacteria | 800 |
| 381 | Ga0307415_101697904 | 3300032126 | Bacteria | 609 |
| 382 | Ga0395900_0642566 | 3300037418 | Bacteria | 998 |
| 383 | Ga0395900_0700140 | 3300037418 | Bacteria | 947 |
| 384 | Ga0395900_0829724 | 3300037418 | Bacteria | 851 |
| 385 | Ga0395900_1792186 | 3300037418 | Bacteria | 524 |
| 386 | Ga0395898_0019914 | 3300037466 | Bacteria | 6823 |
| 387 | Ga0395898_0105586 | 3300037466 | Bacteria | 2701 |
| 388 | Ga0395898_0167204 | 3300037466 | Bacteria | 2103 |
| 389 | Ga0395901_0051416 | 3300038443 | Bacteria | 4284 |
| 390 | Ga0395901_0141720 | 3300038443 | Bacteria | 2526 |
| 391 | Ga0439436_0090588 | 3300041404 | Bacteria | 852 |
| 392 | Ga0439439_0067856 | 3300041406 | Bacteria | 953 |
| 393 | Ga0439466_0188528 | 3300041411 | Bacteria | 628 |
| 394 | Ga0439465_0045859 | 3300041413 | Bacteria | 1422 |
| 395 | Ga0439465_0117232 | 3300041413 | Bacteria | 931 |
| 396 | Ga0439465_0136287 | 3300041413 | Bacteria | 869 |
| 397 | Ga0451787_006059 | 3300041441 | Bacteria | 651 |
| 398 | Ga0451787_198347 | 3300041441 | Bacteria | 740 |
| 399 | Ga0451787_494371 | 3300041441 | Bacteria | 665 |
| 400 | Ga0451787_698953 | 3300041441 | Bacteria | 555 |
| 401 | Ga0451788_06186 | 3300041442 | Bacteria | 803 |
| 402 | Ga0451789_1026005 | 3300041443 | Bacteria | 879 |
| 403 | Ga0451790_16529 | 3300041444 | Bacteria | 1384 |
| 404 | Ga0451792_08540 | 3300041445 | Bacteria | 541 |
| 405 | Ga0451794_15320 | 3300041446 | Bacteria | 801 |
| 406 | Ga0451794_50422 | 3300041446 | Bacteria | 1199 |
| 407 | Ga0451791_0192690 | 3300041451 | Bacteria | 1357 |
| 408 | Ga0451791_0375613 | 3300041451 | Bacteria | 709 |
| 409 | Ga0451791_1451577 | 3300041451 | Bacteria | 1343 |
| 410 | Ga0451793_1220708 | 3300041452 | Bacteria | 1350 |
| 411 | Ga0451797_0304931 | 3300041453 | Bacteria | 546 |
| 412 | Ga0451797_0960236 | 3300041453 | Bacteria | 828 |
| 413 | Ga0451795_0615518 | 3300041456 | Bacteria | 732 |
| 414 | Ga0451795_0717574 | 3300041456 | Bacteria | 602 |
| 415 | Ga0451795_1155111 | 3300041456 | Bacteria | 539 |
| 416 | Ga0451802_0607156 | 3300041460 | Bacteria | 889 |
| 417 | Ga0451802_1045637 | 3300041460 | Bacteria | 567 |
| 418 | Ga0451805_067564 | 3300041461 | Bacteria | 630 |
| 419 | Ga0451805_083680 | 3300041461 | Bacteria | 577 |
| 420 | Ga0451806_370333 | 3300041462 | Bacteria | 624 |
| 421 | Ga0451804_0004070 | 3300041463 | Bacteria | 513 |
| 422 | Ga0451807_0180144 | 3300041486 | Bacteria | 652 |
| 423 | Ga0451807_1534873 | 3300041486 | Bacteria | 736 |
| 424 | Ga0451807_1605592 | 3300041486 | Bacteria | 614 |
| 425 | Ga0451835_0538675 | 3300041492 | Bacteria | 585 |
| 426 | Ga0451837_0302867 | 3300041494 | Bacteria | 1459 |
| 427 | Ga0451837_1713824 | 3300041494 | Bacteria | 609 |
| 428 | Ga0451841_0622253 | 3300041498 | Bacteria | 757 |
| 429 | Ga0451841_0717519 | 3300041498 | Bacteria | 984 |
| 430 | Ga0451847_0492307 | 3300041503 | Bacteria | 716 |
| 431 | Ga0451843_0686131 | 3300041509 | Bacteria | 1207 |
| 432 | Ga0451853_0693091 | 3300041512 | Bacteria | 864 |
| 433 | Ga0451853_2006119 | 3300041512 | Bacteria | 912 |
| 434 | Ga0451853_3216936 | 3300041512 | Bacteria | 1047 |
| 435 | Ga0439431_0106876 | 3300041997 | Bacteria | 773 |
| 436 | Ga0439433_0036605 | 3300041999 | Bacteria | 1134 |
| 437 | Ga0439449_0338324 | 3300042007 | Bacteria | 569 |
| 438 | Ga0439462_0035379 | 3300042015 | Bacteria | 1328 |
| 439 | Ga0450920_012421 | 3300042122 | Bacteria | 1598 |
| 440 | Ga0450922_041426 | 3300042124 | Bacteria | 522 |
| 441 | Ga0450923_096439 | 3300042125 | Bacteria | 679 |
| 442 | Ga0450905_038500 | 3300042142 | Bacteria | 755 |
| 443 | Ga0450906_047563 | 3300042145 | Bacteria | 757 |
| 444 | Ga0450909_007757 | 3300042185 | Bacteria | 1555 |
| 445 | Ga0439434_0172163 | 3300042435 | Bacteria | 723 |
| 446 | Ga0439459_0192832 | 3300042438 | Bacteria | 553 |
| 447 | Ga0466969_0049679 | 3300044656 | Bacteria | 2069 |
| 448 | Ga0466969_0166999 | 3300044656 | Bacteria | 1010 |
| 449 | Ga0466972_0028315 | 3300044658 | Bacteria | 2764 |
| 450 | Ga0466972_0072420 | 3300044658 | Bacteria | 1643 |
| 451 | Ga0466972_0221483 | 3300044658 | Bacteria | 885 |
| 452 | Ga0466972_0375215 | 3300044658 | Bacteria | 666 |
| 453 | Ga0466965_0000003 | 3300044683 | Bacteria | 265985 |
| 454 | Ga0466965_0053028 | 3300044683 | Bacteria | 2015 |
| 455 | Ga0466965_0072804 | 3300044683 | Bacteria | 1729 |
| 456 | Ga0466965_0261460 | 3300044683 | Bacteria | 930 |
| 457 | Ga0466965_0371437 | 3300044683 | Bacteria | 786 |
| 458 | Ga0466966_0023287 | 3300044684 | Bacteria | 4056 |
| 459 | Ga0466966_0251933 | 3300044684 | Bacteria | 1063 |
| 460 | Ga0466966_0262503 | 3300044684 | Bacteria | 1040 |
| 461 | Ga0466961_0005839 | 3300044693 | Bacteria | 7798 |
| 462 | Ga0466961_0057729 | 3300044693 | Bacteria | 2470 |
| 463 | Ga0466961_0103620 | 3300044693 | Bacteria | 1791 |
| 464 | Ga0466961_0149441 | 3300044693 | Bacteria | 1459 |
| 465 | Ga0466961_0239574 | 3300044693 | Bacteria | 1115 |
| 466 | Ga0466961_0423278 | 3300044693 | Bacteria | 807 |
| 467 | Ga0466963_0541606 | 3300044694 | Bacteria | 822 |
| 468 | Ga0466963_0590903 | 3300044694 | Bacteria | 784 |
| 469 | Ga0466964_0032622 | 3300044706 | Bacteria | 2070 |
| 470 | Ga0466964_0531943 | 3300044706 | Bacteria | 636 |
| 471 | Ga0466971_0033256 | 3300044719 | Bacteria | 2311 |
| 472 | Ga0466971_0179354 | 3300044719 | Bacteria | 995 |
| 473 | Ga0466971_0424543 | 3300044719 | Bacteria | 650 |
| 474 | Ga0466968_0172687 | 3300044735 | Bacteria | 1002 |
| 475 | Ga0466968_0210904 | 3300044735 | Bacteria | 912 |
| 476 | Ga0466970_0000027 | 3300044765 | Bacteria | 56103 |
| 477 | Ga0466970_0036988 | 3300044765 | Bacteria | 2586 |
| 478 | Ga0466970_0113359 | 3300044765 | Bacteria | 1481 |
| 479 | Ga0466970_0121472 | 3300044765 | Bacteria | 1431 |
| 480 | Ga0466970_0234301 | 3300044765 | Bacteria | 1026 |
| 481 | Ga0466970_0511148 | 3300044765 | Bacteria | 692 |
| 482 | Ga0466970_0566948 | 3300044765 | Bacteria | 657 |
| 483 | Ga0466957_0051721 | 3300044842 | Bacteria | 2500 |
| 484 | Ga0466957_0654141 | 3300044842 | Bacteria | 739 |
| 485 | Ga0466957_0851449 | 3300044842 | Bacteria | 650 |
| 486 | Ga0466960_0019431 | 3300044901 | Bacteria | 2994 |
| 487 | Ga0466960_0031018 | 3300044901 | Bacteria | 2463 |
| 488 | Ga0466960_0223077 | 3300044901 | Bacteria | 1038 |
| 489 | Ga0466960_0455257 | 3300044901 | Bacteria | 744 |
| 490 | Ga0466959_0352321 | 3300045049 | Bacteria | 1003 |
| 491 | Ga0466959_0712361 | 3300045049 | Bacteria | 672 |
| 492 | Ga0466958_0023373 | 3300045836 | Bacteria | 3628 |
| 493 | Ga0466958_0089102 | 3300045836 | Bacteria | 1907 |
| 494 | Ga0466958_0328554 | 3300045836 | Bacteria | 983 |
| 495 | Ga0466958_0621732 | 3300045836 | Bacteria | 703 |
| 496 | Ga0466967_0202852 | 3300045976 | Bacteria | 1879 |
| 497 | Ga0466967_0967154 | 3300045976 | Bacteria | 847 |
| 498 | Ga0495627_001687 | 3300046453 | Bacteria | 12164 |
| 499 | Ga0495592_0692055 | 3300046454 | Bacteria | 614 |
| 500 | Ga0495590_0000902 | 3300046457 | Bacteria | 13285 |
| 501 | Ga0495591_111967 | 3300046458 | Bacteria | 670 |
| 502 | Ga0495639_0105309 | 3300046475 | Bacteria | 1335 |
| 503 | Ga0495596_0098554 | 3300046500 | Bacteria | 1135 |
| 504 | Ga0495583_0116370 | 3300046506 | Bacteria | 1129 |
| 505 | Ga0495610_0152610 | 3300046512 | Bacteria | 984 |
| 506 | Ga0495610_0373205 | 3300046512 | Bacteria | 532 |
| 507 | Ga0495620_0046421 | 3300046515 | Bacteria | 1875 |
| 508 | Ga0495620_0114915 | 3300046515 | Bacteria | 1064 |
| 509 | Ga0495631_0015142 | 3300046518 | Bacteria | 3704 |
| 510 | Ga0495632_0334238 | 3300046519 | Bacteria | 668 |
| 511 | Ga0495632_0364624 | 3300046519 | Bacteria | 634 |
| 512 | Ga0495643_0268651 | 3300046522 | Bacteria | 789 |
| 513 | Ga0495663_0258418 | 3300046525 | Bacteria | 620 |
| 514 | Ga0495654_0118549 | 3300046530 | Bacteria | 1200 |
| 515 | Ga0495598_0088631 | 3300046537 | Bacteria | 1005 |
| 516 | Ga0495609_0069765 | 3300046538 | Bacteria | 1545 |
| 517 | Ga0495621_0124588 | 3300046539 | Bacteria | 998 |
| 518 | Ga0495645_0076192 | 3300046543 | Bacteria | 2414 |
| 519 | Ga0495633_0057220 | 3300046558 | Bacteria | 1832 |
| 520 | Ga0495633_0271671 | 3300046558 | Bacteria | 772 |
| 521 | Ga0495656_0029433 | 3300046615 | Bacteria | 2211 |
| 522 | Ga0495656_0175132 | 3300046615 | Bacteria | 1051 |
| 523 | Ga0495668_0793284 | 3300046616 | Bacteria | 524 |
| 524 | Ga0495646_0293386 | 3300046680 | Bacteria | 862 |
| 525 | Ga0495658_1021239 | 3300046683 | Bacteria | 528 |
| 526 | Ga0495624_0799313 | 3300046690 | Bacteria | 558 |
| 527 | Ga0495670_0631421 | 3300046691 | Bacteria | 584 |
| 528 | Ga0495671_0086028 | 3300046692 | Bacteria | 1540 |
| 529 | Ga0495649_0062055 | 3300046694 | Bacteria | 2009 |
| 530 | Ga0495660_0176997 | 3300046810 | Bacteria | 1035 |
| 531 | Ga0495636_0124496 | 3300047318 | Bacteria | 1143 |
| 532 | Ga0495672_0011493 | 3300047320 | Bacteria | 6245 |
| 533 | Ga0495672_0084128 | 3300047320 | Bacteria | 1765 |
| 534 | Ga0495672_0105416 | 3300047320 | Bacteria | 1521 |
| 535 | Ga0495676_0855972 | 3300047321 | Bacteria | 584 |
| 536 | Ga0495673_0286143 | 3300047469 | Bacteria | 594 |
| 537 | Ga0495673_0286889 | 3300047469 | Bacteria | 593 |
| 538 | Ga0495681_0059308 | 3300047470 | Bacteria | 1770 |
| 539 | Ga0495686_0028366 | 3300047472 | Bacteria | 3646 |
| 540 | Ga0495686_0050944 | 3300047472 | Bacteria | 2600 |
| 541 | Ga0495686_0386462 | 3300047472 | Bacteria | 754 |
| 542 | Ga0495615_0036135 | 3300048090 | Bacteria | 1210 |
| 543 | Ga0495615_0190979 | 3300048090 | Bacteria | 628 |
| 544 | Ga0495615_0229528 | 3300048090 | Bacteria | 582 |
| 545 | Ga0495626_0010797 | 3300048091 | Bacteria | 4853 |
| 546 | Ga0496100_0011682 | 3300048903 | Bacteria | 5004 |
| 547 | Ga0496100_0088880 | 3300048903 | Bacteria | 2103 |
| 548 | Ga0496101_0002898 | 3300048904 | Bacteria | 10559 |
| 549 | Ga0496101_0008133 | 3300048904 | Bacteria | 6844 |
| 550 | Ga0496102_0089571 | 3300048905 | Bacteria | 2847 |
| 551 | Ga0496102_0280181 | 3300048905 | Bacteria | 1572 |
| 552 | Ga0496103_0010181 | 3300048906 | Bacteria | 5560 |
| 553 | Ga0496103_0033058 | 3300048906 | Bacteria | 3159 |
| 554 | Ga0496103_0794279 | 3300048906 | Bacteria | 597 |
| 555 | Ga0496104_0003769 | 3300048907 | Bacteria | 13107 |
| 556 | Ga0496104_0015491 | 3300048907 | Bacteria | 6903 |
| 557 | Ga0496104_0052939 | 3300048907 | Bacteria | 3834 |
| 558 | Ga0496104_0812440 | 3300048907 | Bacteria | 841 |
| 559 | Ga0496105_0005038 | 3300048908 | Bacteria | 10001 |
| 560 | Ga0496105_0009192 | 3300048908 | Bacteria | 7715 |
| 561 | Ga0496105_0150981 | 3300048908 | Bacteria | 1909 |
| 562 | Ga0496105_0224039 | 3300048908 | Bacteria | 1530 |
| 563 | Ga0496105_0447361 | 3300048908 | Bacteria | 1020 |
| 564 | Ga0496105_0994965 | 3300048908 | Bacteria | 627 |
| 565 | Ga0496105_1405630 | 3300048908 | Bacteria | 505 |
| 566 | Ga0496106_0530388 | 3300048909 | Bacteria | 945 |
| 567 | Ga0496107_0001328 | 3300048910 | Bacteria | 15168 |
| 568 | Ga0496107_0939130 | 3300048910 | Bacteria | 629 |
| 569 | Ga0496108_0047565 | 3300048911 | Bacteria | 3586 |
| 570 | Ga0496108_0052644 | 3300048911 | Bacteria | 3412 |
| 571 | Ga0496109_0042506 | 3300048912 | Bacteria | 4117 |
| 572 | Ga0496109_0080472 | 3300048912 | Bacteria | 3001 |
| 573 | Ga0496110_0029641 | 3300048913 | Bacteria | 4712 |
| 574 | Ga0496110_0950228 | 3300048913 | Bacteria | 766 |
| 575 | Ga0496111_0012648 | 3300048914 | Bacteria | 5719 |
| 576 | Ga0496111_0269126 | 3300048914 | Bacteria | 1264 |
| 577 | Ga0496111_0543024 | 3300048914 | Bacteria | 854 |
| 578 | Ga0496111_0716449 | 3300048914 | Bacteria | 727 |
| 579 | Ga0496111_1181849 | 3300048914 | Bacteria | 543 |
| 580 | Ga0496112_0231900 | 3300048915 | Bacteria | 1800 |
| 581 | Ga0496112_1478820 | 3300048915 | Bacteria | 593 |
| 582 | Ga0496113_0005620 | 3300048916 | Bacteria | 7845 |
| 583 | Ga0496113_0323369 | 3300048916 | Bacteria | 1236 |
| 584 | Ga0496113_0809195 | 3300048916 | Bacteria | 744 |
| 585 | Ga0496114_0044687 | 3300048917 | Bacteria | 3676 |
| 586 | Ga0496114_0085888 | 3300048917 | Bacteria | 2665 |
| 587 | Ga0496114_0118841 | 3300048917 | Bacteria | 2271 |
| 588 | Ga0496114_0396836 | 3300048917 | Bacteria | 1222 |
| 589 | Ga0496115_0002702 | 3300048918 | Bacteria | 12733 |
| 590 | Ga0496115_0058315 | 3300048918 | Bacteria | 3106 |
| 591 | Ga0496116_0021611 | 3300048919 | Bacteria | 4845 |
| 592 | Ga0496116_0095573 | 3300048919 | Bacteria | 1793 |
| 593 | Ga0496116_0384463 | 3300048919 | Bacteria | 628 |
| 594 | Ga0496117_0000362 | 3300048920 | Bacteria | 79224 |
| 595 | Ga0496117_0004032 | 3300048920 | Bacteria | 16539 |
| 596 | Ga0496117_0006530 | 3300048920 | Bacteria | 11750 |
| 597 | Ga0496117_0008690 | 3300048920 | Bacteria | 9601 |
| 598 | Ga0496117_0009885 | 3300048920 | Bacteria | 8783 |
| 599 | Ga0496117_0010175 | 3300048920 | Bacteria | 8627 |
| 600 | Ga0496117_0018116 | 3300048920 | Bacteria | 5854 |
| 601 | Ga0496117_0111258 | 3300048920 | Bacteria | 1705 |
| 602 | Ga0496118_0043816 | 3300048921 | Bacteria | 3512 |
| 603 | Ga0496118_0049600 | 3300048921 | Bacteria | 3231 |
| 604 | Ga0496118_0081814 | 3300048921 | Bacteria | 2265 |
| 605 | Ga0496118_0103297 | 3300048921 | Bacteria | 1917 |
| 606 | Ga0496118_0106746 | 3300048921 | Bacteria | 1872 |
| 607 | Ga0496118_0195117 | 3300048921 | Bacteria | 1206 |
| 608 | Ga0496118_0427522 | 3300048921 | Bacteria | 679 |
| 609 | Ga0496119_0000720 | 3300048922 | Bacteria | 44520 |
| 610 | Ga0496119_0006250 | 3300048922 | Bacteria | 11123 |
| 611 | Ga0496119_0046717 | 3300048922 | Bacteria | 2700 |
| 612 | Ga0496119_0061767 | 3300048922 | Bacteria | 2235 |
| 613 | Ga0496119_0061774 | 3300048922 | Bacteria | 2235 |
| 614 | Ga0496119_0096444 | 3300048922 | Bacteria | 1668 |
| 615 | Ga0496119_0120060 | 3300048922 | Bacteria | 1446 |
| 616 | Ga0496119_0207019 | 3300048922 | Bacteria | 1011 |
| 617 | Ga0496119_0236420 | 3300048922 | Bacteria | 927 |
| 618 | Ga0496119_0458713 | 3300048922 | Bacteria | 599 |
| 619 | Ga0496119_0492731 | 3300048922 | Bacteria | 571 |
| 620 | Ga0496120_0007276 | 3300048923 | Bacteria | 8270 |
| 621 | Ga0496120_0013513 | 3300048923 | Bacteria | 5495 |
| 622 | Ga0496120_0027437 | 3300048923 | Bacteria | 3502 |
| 623 | Ga0496120_0038694 | 3300048923 | Bacteria | 2820 |
| 624 | Ga0496120_0052424 | 3300048923 | Bacteria | 2324 |
| 625 | Ga0496120_0130693 | 3300048923 | Bacteria | 1286 |
| 626 | Ga0496120_0140755 | 3300048923 | Bacteria | 1225 |
| 627 | Ga0496120_0174191 | 3300048923 | Bacteria | 1062 |
| 628 | Ga0496120_0185392 | 3300048923 | Bacteria | 1018 |
| 629 | Ga0496120_0342639 | 3300048923 | Bacteria | 673 |
| 630 | Ga0496121_0278670 | 3300048924 | Bacteria | 1145 |
| 631 | Ga0496122_0000022 | 3300048925 | Bacteria | 388704 |
| 632 | Ga0496122_0000799 | 3300048925 | Bacteria | 60347 |
| 633 | Ga0496122_0005147 | 3300048925 | Bacteria | 15769 |
| 634 | Ga0496122_0010341 | 3300048925 | Bacteria | 9645 |
| 635 | Ga0496122_0012595 | 3300048925 | Bacteria | 8394 |
| 636 | Ga0496122_0026775 | 3300048925 | Bacteria | 4956 |
| 637 | Ga0496122_0232491 | 3300048925 | Bacteria | 1047 |
| 638 | Ga0496122_0398172 | 3300048925 | Bacteria | 700 |
| 639 | Ga0496123_0000009 | 3300048926 | Bacteria | 509486 |
| 640 | Ga0496123_0000016 | 3300048926 | Bacteria | 424330 |
| 641 | Ga0496123_0019848 | 3300048926 | Bacteria | 5277 |
| 642 | Ga0496123_0020865 | 3300048926 | Bacteria | 5109 |
| 643 | Ga0496123_0068714 | 3300048926 | Bacteria | 2229 |
| 644 | Ga0496123_0080336 | 3300048926 | Bacteria | 1988 |
| 645 | Ga0496123_0084999 | 3300048926 | Bacteria | 1905 |
| 646 | Ga0496123_0117289 | 3300048926 | Bacteria | 1506 |
| 647 | Ga0496123_0120729 | 3300048926 | Bacteria | 1475 |
| 648 | Ga0496123_0169347 | 3300048926 | Bacteria | 1154 |
| 649 | Ga0496124_0002766 | 3300048927 | Bacteria | 22302 |
| 650 | Ga0496124_0046380 | 3300048927 | Bacteria | 3721 |
| 651 | Ga0496124_0059852 | 3300048927 | Bacteria | 3197 |
| 652 | Ga0496124_0086176 | 3300048927 | Bacteria | 2571 |
| 653 | Ga0496124_0206335 | 3300048927 | Bacteria | 1490 |
| 654 | Ga0496125_0001491 | 3300048928 | Bacteria | 33565 |
| 655 | Ga0496125_0002578 | 3300048928 | Bacteria | 23316 |
| 656 | Ga0496125_0007012 | 3300048928 | Bacteria | 12054 |
| 657 | Ga0496125_0016052 | 3300048928 | Bacteria | 7209 |
| 658 | Ga0496125_0109413 | 3300048928 | Bacteria | 2006 |
| 659 | Ga0496125_0133224 | 3300048928 | Bacteria | 1744 |
| 660 | Ga0496125_0376185 | 3300048928 | Bacteria | 839 |
| 661 | Ga0496125_0570307 | 3300048928 | Bacteria | 623 |
| 662 | Ga0496126_0002077 | 3300048929 | Bacteria | 28059 |
| 663 | Ga0496126_0002563 | 3300048929 | Bacteria | 24311 |
| 664 | Ga0496126_0011686 | 3300048929 | Bacteria | 9055 |
| 665 | Ga0496126_0019423 | 3300048929 | Bacteria | 6691 |
| 666 | Ga0496126_0029883 | 3300048929 | Bacteria | 5173 |
| 667 | Ga0496126_0052594 | 3300048929 | Bacteria | 3700 |
| 668 | Ga0496126_0144413 | 3300048929 | Bacteria | 2045 |
| 669 | Ga0496126_0175971 | 3300048929 | Bacteria | 1820 |
| 670 | Ga0496126_0613962 | 3300048929 | Bacteria | 855 |
| 671 | Ga0496126_1271306 | 3300048929 | Bacteria | 537 |
| 672 | Ga0501306_000560 | 3300049127 | Bacteria | 2934 |
| 673 | Ga0501306_001630 | 3300049127 | Bacteria | 2164 |
| 674 | Ga0501306_009766 | 3300049127 | Bacteria | 1196 |
| 675 | Ga0501306_012383 | 3300049127 | Bacteria | 1099 |
| 676 | Ga0501306_021437 | 3300049127 | Bacteria | 905 |
| 677 | Ga0501306_074369 | 3300049127 | Bacteria | 578 |
| 678 | Ga0501306_078472 | 3300049127 | Bacteria | 566 |
| 679 | Ga0501308_004880 | 3300049128 | Bacteria | 1313 |
| 680 | Ga0501308_013611 | 3300049128 | Bacteria | 942 |
| 681 | Ga0501308_066583 | 3300049128 | Bacteria | 553 |
| 682 | Ga0501309_000718 | 3300049129 | Bacteria | 2872 |
| 683 | Ga0501309_049635 | 3300049129 | Bacteria | 657 |
| 684 | Ga0501310_004109 | 3300049130 | Bacteria | 1449 |
| 685 | Ga0501310_006454 | 3300049130 | Bacteria | 1231 |
| 686 | Ga0501310_028960 | 3300049130 | Bacteria | 728 |
| 687 | Ga0501310_048299 | 3300049130 | Bacteria | 610 |
| 688 | Ga0501341_01663 | 3300049131 | Bacteria | 1138 |
| 689 | Ga0501304_002063 | 3300049160 | Bacteria | 1362 |
| 690 | Ga0501304_002642 | 3300049160 | Bacteria | 1260 |
| 691 | Ga0501304_010309 | 3300049160 | Bacteria | 815 |
| 692 | Ga0501305_000734 | 3300049161 | Bacteria | 2858 |
| 693 | Ga0501305_004421 | 3300049161 | Bacteria | 1653 |
| 694 | Ga0501305_010239 | 3300049161 | Bacteria | 1249 |
| 695 | Ga0501305_016506 | 3300049161 | Bacteria | 1054 |
| 696 | Ga0501305_102569 | 3300049161 | Bacteria | 534 |
| 697 | Ga0501305_112221 | 3300049161 | Bacteria | 517 |
| 698 | Ga0501305_120657 | 3300049161 | Bacteria | 503 |
| 699 | Ga0501307_000265 | 3300049162 | Bacteria | 3171 |
| 700 | Ga0501307_005058 | 3300049162 | Bacteria | 1375 |
| 701 | Ga0501307_024831 | 3300049162 | Bacteria | 801 |
| 702 | Ga0501307_025153 | 3300049162 | Bacteria | 798 |
| 703 | Ga0501307_025451 | 3300049162 | Bacteria | 795 |
| 704 | Ga0501307_027312 | 3300049162 | Bacteria | 775 |
| 705 | Ga0501311_000387 | 3300049527 | Bacteria | 2979 |
| 706 | Ga0501311_008374 | 3300049527 | Bacteria | 1211 |
| 707 | Ga0501311_019784 | 3300049527 | Bacteria | 905 |
| 708 | Ga0501311_026229 | 3300049527 | Bacteria | 821 |
| 709 | Ga0501311_084211 | 3300049527 | Bacteria | 545 |
| 710 | Ga0501312_000232 | 3300049528 | Bacteria | 3979 |
| 711 | Ga0501312_087617 | 3300049528 | Bacteria | 571 |
| 712 | Ga0501313_004872 | 3300049529 | Bacteria | 1397 |
| 713 | Ga0501313_010638 | 3300049529 | Bacteria | 1051 |
| 714 | Ga0501314_002087 | 3300049530 | Bacteria | 1514 |
| 715 | Ga0501314_003965 | 3300049530 | Bacteria | 1212 |
| 716 | Ga0501315_005291 | 3300049531 | Bacteria | 1392 |
| 717 | Ga0501315_028725 | 3300049531 | Bacteria | 791 |
| 718 | Ga0501315_029278 | 3300049531 | Bacteria | 785 |
| 719 | Ga0501315_096537 | 3300049531 | Bacteria | 518 |
| 720 | Ga0501316_005648 | 3300049532 | Bacteria | 1305 |
| 721 | Ga0501316_020268 | 3300049532 | Bacteria | 833 |
| 722 | Ga0501317_000092 | 3300049533 | Bacteria | 4572 |
| 723 | Ga0501317_002999 | 3300049533 | Bacteria | 1647 |
| 724 | Ga0501317_004767 | 3300049533 | Bacteria | 1425 |
| 725 | Ga0501317_012140 | 3300049533 | Bacteria | 1059 |
| 726 | Ga0501317_015192 | 3300049533 | Bacteria | 985 |
| 727 | Ga0501317_018134 | 3300049533 | Bacteria | 929 |
| 728 | Ga0501317_073508 | 3300049533 | Bacteria | 581 |
| 729 | Ga0501317_087720 | 3300049533 | Bacteria | 546 |
| 730 | Ga0501317_103749 | 3300049533 | Bacteria | 516 |
| 731 | Ga0501318_001483 | 3300049534 | Bacteria | 1858 |
| 732 | Ga0501318_003859 | 3300049534 | Bacteria | 1404 |
| 733 | Ga0501318_007672 | 3300049534 | Bacteria | 1135 |
| 734 | Ga0501318_007736 | 3300049534 | Bacteria | 1132 |
| 735 | Ga0501318_010758 | 3300049534 | Bacteria | 1022 |
| 736 | Ga0501318_073420 | 3300049534 | Bacteria | 544 |
| 737 | Ga0501319_007607 | 3300049535 | Bacteria | 822 |
| 738 | Ga0501319_009009 | 3300049535 | Bacteria | 776 |
| 739 | Ga0501319_026015 | 3300049535 | Bacteria | 546 |
| 740 | Ga0501320_007464 | 3300049536 | Bacteria | 1053 |
| 741 | Ga0501320_011242 | 3300049536 | Bacteria | 925 |
| 742 | Ga0501320_014435 | 3300049536 | Bacteria | 854 |
| 743 | Ga0501320_028182 | 3300049536 | Bacteria | 686 |
| 744 | Ga0501321_000064 | 3300049537 | Bacteria | 4712 |
| 745 | Ga0501321_002137 | 3300049537 | Bacteria | 1675 |
| 746 | Ga0501321_006408 | 3300049537 | Bacteria | 1196 |
| 747 | Ga0501321_006964 | 3300049537 | Bacteria | 1163 |
| 748 | Ga0501321_008554 | 3300049537 | Bacteria | 1089 |
| 749 | Ga0501321_009527 | 3300049537 | Bacteria | 1050 |
| 750 | Ga0501321_028462 | 3300049537 | Bacteria | 735 |
| 751 | Ga0501322_000562 | 3300049538 | Bacteria | 1799 |
| 752 | Ga0501323_002343 | 3300049539 | Bacteria | 1825 |
| 753 | Ga0501323_020355 | 3300049539 | Bacteria | 871 |
| 754 | Ga0501323_031187 | 3300049539 | Bacteria | 749 |
| 755 | Ga0501324_001672 | 3300049540 | Bacteria | 1514 |
| 756 | Ga0501324_012702 | 3300049540 | Bacteria | 790 |
| 757 | Ga0501324_025687 | 3300049540 | Bacteria | 622 |
| 758 | Ga0501324_026773 | 3300049540 | Bacteria | 613 |
| 759 | Ga0501325_004097 | 3300049541 | Bacteria | 1098 |
| 760 | Ga0501325_004154 | 3300049541 | Bacteria | 1095 |
| 761 | Ga0501325_006462 | 3300049541 | Bacteria | 965 |
| 762 | Ga0501325_014393 | 3300049541 | Bacteria | 769 |
| 763 | Ga0501325_016954 | 3300049541 | Bacteria | 733 |
| 764 | Ga0501325_045302 | 3300049541 | Bacteria | 546 |
| 765 | Ga0501330_001979 | 3300049546 | Bacteria | 1125 |
| 766 | Ga0501330_003718 | 3300049546 | Bacteria | 922 |
| 767 | Ga0501331_06050 | 3300049547 | Bacteria | 701 |
| 768 | Ga0501332_08873 | 3300049548 | Bacteria | 657 |
| 769 | Ga0501332_13759 | 3300049548 | Bacteria | 565 |
| 770 | Ga0501333_006876 | 3300049549 | Bacteria | 763 |
| 771 | Ga0501335_009693 | 3300049551 | Bacteria | 921 |
| 772 | Ga0501336_008255 | 3300049552 | Bacteria | 803 |
| 773 | Ga0501340_003715 | 3300049556 | Bacteria | 936 |
| 774 | Ga0501031_0012276 | 3300049568 | Bacteria | 5584 |
| 775 | Ga0501031_0026550 | 3300049568 | Bacteria | 3775 |
| 776 | Ga0501031_0090099 | 3300049568 | Bacteria | 2000 |
| 777 | Ga0501031_0186178 | 3300049568 | Bacteria | 1356 |
| 778 | Ga0501032_0003386 | 3300049569 | Bacteria | 12226 |
| 779 | Ga0501032_0011095 | 3300049569 | Bacteria | 6474 |
| 780 | Ga0501032_0060246 | 3300049569 | Bacteria | 2545 |
| 781 | Ga0501032_0063351 | 3300049569 | Bacteria | 2476 |
| 782 | Ga0501032_0169713 | 3300049569 | Bacteria | 1431 |
| 783 | Ga0501033_0002214 | 3300049570 | Bacteria | 16754 |
| 784 | Ga0501033_0004032 | 3300049570 | Bacteria | 11861 |
| 785 | Ga0501033_0004858 | 3300049570 | Bacteria | 10708 |
| 786 | Ga0501033_0233744 | 3300049570 | Bacteria | 1305 |
| 787 | Ga0501033_0284185 | 3300049570 | Bacteria | 1167 |
| 788 | Ga0501034_0002490 | 3300049571 | Bacteria | 22119 |
| 789 | Ga0501034_0008687 | 3300049571 | Bacteria | 10701 |
| 790 | Ga0501034_0057847 | 3300049571 | Bacteria | 3897 |
| 791 | Ga0501034_0201798 | 3300049571 | Bacteria | 1946 |
| 792 | Ga0501034_0256960 | 3300049571 | Bacteria | 1690 |
| 793 | Ga0501034_0279349 | 3300049571 | Bacteria | 1609 |
| 794 | Ga0501034_0658423 | 3300049571 | Bacteria | 948 |
| 795 | Ga0501036_0123303 | 3300049572 | Bacteria | 2188 |
| 796 | Ga0501036_0267934 | 3300049572 | Bacteria | 1430 |
| 797 | Ga0501036_0365972 | 3300049572 | Bacteria | 1203 |
| 798 | Ga0501036_0656253 | 3300049572 | Bacteria | 868 |
| 799 | Ga0501037_0001422 | 3300049573 | Bacteria | 17565 |
| 800 | Ga0501037_0050605 | 3300049573 | Bacteria | 3040 |
| 801 | Ga0501037_0084416 | 3300049573 | Bacteria | 2299 |
| 802 | Ga0501037_0099456 | 3300049573 | Bacteria | 2100 |
| 803 | Ga0501037_0347933 | 3300049573 | Bacteria | 1023 |
| 804 | Ga0501038_0003511 | 3300049574 | Bacteria | 14597 |
| 805 | Ga0501038_0021820 | 3300049574 | Bacteria | 5744 |
| 806 | Ga0501038_0187593 | 3300049574 | Bacteria | 1665 |
| 807 | Ga0501038_0188345 | 3300049574 | Bacteria | 1661 |
| 808 | Ga0501038_0339541 | 3300049574 | Bacteria | 1171 |
| 809 | Ga0501038_0655828 | 3300049574 | Bacteria | 790 |
| 810 | Ga0501039_0064692 | 3300049575 | Bacteria | 2835 |
| 811 | Ga0501039_0303888 | 3300049575 | Bacteria | 1254 |
| 812 | Ga0501039_0725069 | 3300049575 | Bacteria | 777 |
| 813 | Ga0501042_0009674 | 3300049578 | Bacteria | 6437 |
| 814 | Ga0501042_0108198 | 3300049578 | Bacteria | 2001 |
| 815 | Ga0501043_0035007 | 3300049579 | Bacteria | 3949 |
| 816 | Ga0501043_0065288 | 3300049579 | Bacteria | 2858 |
| 817 | Ga0501043_0112406 | 3300049579 | Bacteria | 2139 |
| 818 | Ga0501043_0201043 | 3300049579 | Bacteria | 1546 |
| 819 | Ga0501043_0289285 | 3300049579 | Bacteria | 1254 |
| 820 | Ga0501046_0013742 | 3300049580 | Bacteria | 6845 |
| 821 | Ga0501046_0014149 | 3300049580 | Bacteria | 6739 |
| 822 | Ga0501046_0173226 | 3300049580 | Bacteria | 1618 |
| 823 | Ga0501047_0001782 | 3300049581 | Bacteria | 20821 |
| 824 | Ga0501047_0006944 | 3300049581 | Bacteria | 10634 |
| 825 | Ga0501047_0090346 | 3300049581 | Bacteria | 2939 |
| 826 | Ga0501047_0273903 | 3300049581 | Bacteria | 1533 |
| 827 | Ga0501048_0013228 | 3300049582 | Bacteria | 6124 |
| 828 | Ga0501048_0016304 | 3300049582 | Bacteria | 5476 |
| 829 | Ga0501048_0022961 | 3300049582 | Bacteria | 4560 |
| 830 | Ga0501067_0023885 | 3300049583 | Bacteria | 3390 |
| 831 | Ga0501067_0113885 | 3300049583 | Bacteria | 1504 |
| 832 | Ga0501068_0051682 | 3300049584 | Bacteria | 2486 |
| 833 | Ga0501068_0290467 | 3300049584 | Bacteria | 1046 |
| 834 | Ga0501068_0388140 | 3300049584 | Bacteria | 899 |
| 835 | Ga0501068_0391015 | 3300049584 | Bacteria | 896 |
| 836 | Ga0501070_0016910 | 3300049586 | Bacteria | 6121 |
| 837 | Ga0501070_0018992 | 3300049586 | Bacteria | 5765 |
| 838 | Ga0501070_0048708 | 3300049586 | Bacteria | 3519 |
| 839 | Ga0501070_0122688 | 3300049586 | Bacteria | 2147 |
| 840 | Ga0501070_0249362 | 3300049586 | Bacteria | 1452 |
| 841 | Ga0501070_0259936 | 3300049586 | Bacteria | 1419 |
| 842 | Ga0501070_0372507 | 3300049586 | Bacteria | 1157 |
| 843 | Ga0501070_0372724 | 3300049586 | Bacteria | 1157 |
| 844 | Ga0501071_0144813 | 3300049587 | Bacteria | 1771 |
| 845 | Ga0501071_0292580 | 3300049587 | Bacteria | 1234 |
| 846 | Ga0501071_1258995 | 3300049587 | Bacteria | 571 |
| 847 | Ga0501073_0000030 | 3300049589 | Bacteria | 115949 |
| 848 | Ga0501073_0041926 | 3300049589 | Bacteria | 3232 |
| 849 | Ga0501073_0272971 | 3300049589 | Bacteria | 1167 |
| 850 | Ga0501073_0381959 | 3300049589 | Bacteria | 973 |
| 851 | Ga0501074_0028983 | 3300049590 | Bacteria | 4010 |
| 852 | Ga0501075_1001107 | 3300049591 | Bacteria | 635 |
| 853 | Ga0501259_141890 | 3300049688 | Bacteria | 589 |
| 854 | Ga0501079_0758558 | 3300049741 | Bacteria | 764 |
| 855 | Ga0501080_0124926 | 3300049742 | Bacteria | 2383 |
| 856 | Ga0501080_0282609 | 3300049742 | Bacteria | 1508 |
| 857 | Ga0501083_0015538 | 3300049744 | Bacteria | 5329 |
| 858 | Ga0501083_0112793 | 3300049744 | Bacteria | 1786 |
| 859 | Ga0501035_0013885 | 3300049822 | Bacteria | 7432 |
| 860 | Ga0501035_0023629 | 3300049822 | Bacteria | 5640 |
| 861 | Ga0501035_0216432 | 3300049822 | Bacteria | 1637 |
| 862 | Ga0501035_0304302 | 3300049822 | Bacteria | 1342 |
| 863 | Ga0501044_0001531 | 3300049823 | Bacteria | 27116 |
| 864 | Ga0501044_0021477 | 3300049823 | Bacteria | 6884 |
| 865 | Ga0501044_0128262 | 3300049823 | Bacteria | 2532 |
| 866 | Ga0501044_0180571 | 3300049823 | Bacteria | 2077 |
| 867 | Ga0501044_0249314 | 3300049823 | Bacteria | 1717 |
| 868 | Ga0501044_0821298 | 3300049823 | Bacteria | 808 |
| 869 | Ga0501044_1365634 | 3300049823 | Bacteria | 574 |
| 870 | Ga0501045_0012578 | 3300049824 | Bacteria | 5959 |
| 871 | Ga0501045_0245961 | 3300049824 | Bacteria | 1331 |
| 872 | Ga0501045_0427464 | 3300049824 | Bacteria | 985 |
| 873 | nmdc:mga03n38_769481_c1 | 3300050490 | Bacteria | 559 |
| 874 | nmdc:mga03n38_99409_c1 | 3300050490 | Bacteria | 1401 |
| 875 | nmdc:mga00v17_121287_c1 | 3300050491 | Bacteria | 1665 |
| 876 | nmdc:mga00v17_312102_c1 | 3300050491 | Bacteria | 1022 |
| 877 | nmdc:mga00v17_49308_c1 | 3300050491 | Bacteria | 2554 |
| 878 | nmdc:mga00v17_577796_c1 | 3300050491 | Bacteria | 726 |
| 879 | nmdc:mga00v17_6859_c1 | 3300050491 | Bacteria | 6054 |
| 880 | nmdc:mga00v17_88029_c1 | 3300050491 | Bacteria | 1947 |
| 881 | nmdc:mga0yw44_19106_c1 | 3300050492 | Bacteria | 3772 |
| 882 | nmdc:mga0yw44_277_c1 | 3300050492 | Bacteria | 17596 |
| 883 | nmdc:mga0yw44_662928_c1 | 3300050492 | Bacteria | 709 |
| 884 | nmdc:mga0yw44_68280_c1 | 3300050492 | Bacteria | 2199 |
| 885 | nmdc:mga0yw44_82709_c1 | 3300050492 | Bacteria | 2015 |
| 886 | nmdc:mga06z11_23458_c1 | 3300050494 | Bacteria | 2899 |
| 887 | nmdc:mga04h51_120153_c1 | 3300050495 | Bacteria | 978 |
| 888 | nmdc:mga04h51_501755_c1 | 3300050495 | Bacteria | 518 |
| 889 | nmdc:mga07m45_482854_c1 | 3300050496 | Bacteria | 718 |
| 890 | nmdc:mga07m45_8187_c1 | 3300050496 | Bacteria | 5365 |
| 891 | nmdc:mga07m45_873133_c1 | 3300050496 | Bacteria | 515 |
| 892 | nmdc:mga0sz30_10621_c1 | 3300050516 | Bacteria | 3531 |
| 893 | nmdc:mga0sz30_201779_c1 | 3300050516 | Bacteria | 883 |
| 894 | nmdc:mga0sz30_45403_c1 | 3300050516 | Bacteria | 1853 |
| 895 | nmdc:mga0sz30_84375_c1 | 3300050516 | Bacteria | 1377 |
| 896 | Ga0495601_0433583 | 3300053077 | Bacteria | 851 |
| 897 | Ga0500635_0044869 | 3300053080 | Bacteria | 1493 |
| 898 | Ga0495619_0120641 | 3300053085 | Bacteria | 1798 |
| 899 | Ga0500643_001952 | 3300053087 | Bacteria | 11184 |
| 900 | Ga0500651_0004271 | 3300053093 | Bacteria | 7981 |
| 901 | Ga0500556_0000020 | 3300053104 | Bacteria | 185929 |
| 902 | Ga0500556_0000151 | 3300053104 | Bacteria | 57882 |
| 903 | Ga0500562_027326 | 3300053108 | Bacteria | 1497 |
| 904 | Ga0500593_000975 | 3300053117 | Bacteria | 10477 |
| 905 | Ga0500593_041574 | 3300053117 | Bacteria | 2054 |
| 906 | Ga0500608_344112 | 3300053122 | Bacteria | 531 |
| 907 | Ga0500628_071200 | 3300053129 | Bacteria | 871 |
| 908 | Ga0500628_190452 | 3300053129 | Bacteria | 588 |
| 909 | Ga0500655_003771 | 3300053133 | Bacteria | 2731 |
| 910 | Ga0500655_046492 | 3300053133 | Bacteria | 859 |
| 911 | Ga0500559_0000050 | 3300053136 | Bacteria | 93262 |
| 912 | Ga0500559_0052618 | 3300053136 | Bacteria | 1800 |
| 913 | Ga0500559_0304464 | 3300053136 | Bacteria | 748 |
| 914 | Ga0500559_0464170 | 3300053136 | Bacteria | 584 |
| 915 | Ga0500568_0000038 | 3300053139 | Bacteria | 134267 |
| 916 | Ga0500568_0000117 | 3300053139 | Bacteria | 71510 |
| 917 | Ga0500568_0002756 | 3300053139 | Bacteria | 10167 |
| 918 | Ga0500573_0379997 | 3300053140 | Bacteria | 675 |
| 919 | Ga0500590_049090 | 3300053148 | Bacteria | 2148 |
| 920 | Ga0500616_0000027 | 3300053153 | Bacteria | 441053 |
| 921 | Ga0500616_0002723 | 3300053153 | Bacteria | 14334 |
| 922 | Ga0500616_0205028 | 3300053153 | Bacteria | 871 |
| 923 | Ga0500620_000519 | 3300053155 | Bacteria | 6752 |
| 924 | Ga0500611_246722 | 3300053727 | Bacteria | 514 |
| 925 | Ga0501084_0161687 | 3300054114 | Bacteria | 1889 |
| 926 | Ga0501084_0738504 | 3300054114 | Bacteria | 830 |
| 927 | Ga0590075_190435 | 3300059424 | Bacteria | 543 |
| 928 | Ga0587084_000004 | 3300059477 | Bacteria | 10690 |
| 929 | Ga0587084_005686 | 3300059477 | Bacteria | 1488 |
| 930 | Ga0587084_022776 | 3300059477 | Bacteria | 951 |
| 931 | Ga0587084_047149 | 3300059477 | Bacteria | 752 |
| 932 | Ga0587093_058119 | 3300059478 | Bacteria | 626 |
| 933 | Ga0587066_061185 | 3300059490 | Bacteria | 769 |
| 934 | Ga0587066_152503 | 3300059490 | Bacteria | 574 |
| 935 | Ga0587070_000571 | 3300059491 | Bacteria | 3169 |
| 936 | Ga0587070_007980 | 3300059491 | Bacteria | 1486 |
| 937 | Ga0587070_033861 | 3300059491 | Bacteria | 942 |
| 938 | Ga0587070_056277 | 3300059491 | Bacteria | 800 |
| 939 | Ga0587073_0070195 | 3300059492 | Bacteria | 844 |
| 940 | Ga0587077_000501 | 3300059493 | Bacteria | 3391 |
| 941 | Ga0587077_006148 | 3300059493 | Bacteria | 1684 |
| 942 | Ga0587077_014309 | 3300059493 | Bacteria | 1304 |
| 943 | Ga0587077_047866 | 3300059493 | Bacteria | 884 |
| 944 | Ga0587077_065220 | 3300059493 | Bacteria | 800 |
| 945 | Ga0587080_002778 | 3300059503 | Bacteria | 2106 |
| 946 | Ga0587080_009509 | 3300059503 | Bacteria | 1416 |
| 947 | Ga0587080_023505 | 3300059503 | Bacteria | 1029 |
| 948 | Ga0587083_0008351 | 3300059505 | Bacteria | 1617 |
| 949 | Ga0587083_0030595 | 3300059505 | Bacteria | 1069 |
| 950 | Ga0587083_0051089 | 3300059505 | Bacteria | 901 |
| 951 | Ga0587085_007645 | 3300059506 | Bacteria | 1355 |
| 952 | Ga0587085_045682 | 3300059506 | Bacteria | 780 |
| 953 | Ga0587086_009862 | 3300059507 | Bacteria | 1144 |
| 954 | Ga0587086_021908 | 3300059507 | Bacteria | 879 |
| 955 | Ga0587086_050370 | 3300059507 | Bacteria | 670 |
| 956 | Ga0587086_079212 | 3300059507 | Bacteria | 577 |
| 957 | Ga0587088_002140 | 3300059508 | Bacteria | 2192 |
| 958 | Ga0587088_004735 | 3300059508 | Bacteria | 1745 |
| 959 | Ga0587088_005922 | 3300059508 | Bacteria | 1628 |
| 960 | Ga0587088_017488 | 3300059508 | Bacteria | 1155 |
| 961 | Ga0587088_018983 | 3300059508 | Bacteria | 1126 |
| 962 | Ga0587088_029751 | 3300059508 | Bacteria | 969 |
| 963 | Ga0587088_125430 | 3300059508 | Bacteria | 599 |
| 964 | Ga0587088_170796 | 3300059508 | Bacteria | 539 |
| 965 | Ga0587089_004824 | 3300059509 | Bacteria | 1501 |
| 966 | Ga0587089_060024 | 3300059509 | Bacteria | 627 |
| 967 | Ga0587090_000311 | 3300059510 | Bacteria | 3800 |
| 968 | Ga0587090_000846 | 3300059510 | Bacteria | 2830 |
| 969 | Ga0587090_005328 | 3300059510 | Bacteria | 1607 |
| 970 | Ga0587090_005979 | 3300059510 | Bacteria | 1548 |
| 971 | Ga0587090_007195 | 3300059510 | Bacteria | 1455 |
| 972 | Ga0587090_011080 | 3300059510 | Bacteria | 1262 |
| 973 | Ga0587090_054823 | 3300059510 | Bacteria | 741 |
| 974 | Ga0587091_000744 | 3300059511 | Bacteria | 3083 |
| 975 | Ga0587092_001025 | 3300059512 | Bacteria | 2577 |
| 976 | Ga0587092_118976 | 3300059512 | Bacteria | 562 |
| 977 | Ga0587094_001057 | 3300059513 | Bacteria | 2469 |
| 978 | Ga0587094_060111 | 3300059513 | Bacteria | 663 |
| 979 | Ga0587094_095914 | 3300059513 | Bacteria | 567 |
| 980 | Ga0587095_000418 | 3300059514 | Bacteria | 2151 |
| 981 | Ga0587095_002414 | 3300059514 | Bacteria | 1254 |
| 982 | Ga0587095_009270 | 3300059514 | Bacteria | 812 |
| 983 | Ga0587095_018578 | 3300059514 | Bacteria | 652 |
| 984 | Ga0587097_00051 | 3300059603 | Bacteria | 2238 |
| 985 | Ga0587098_000388 | 3300059604 | Bacteria | 2571 |
| 986 | Ga0587106_000996 | 3300059605 | Bacteria | 2340 |
| 987 | Ga0587106_032224 | 3300059605 | Bacteria | 847 |
| 988 | Ga0587106_128274 | 3300059605 | Bacteria | 545 |
| 989 | Ga0587125_000024 | 3300059607 | Bacteria | 4952 |
| 990 | Ga0587129_000773 | 3300059608 | Bacteria | 1556 |
| 991 | Ga0587099_000526 | 3300059622 | Bacteria | 2252 |
| 992 | Ga0587099_018533 | 3300059622 | Bacteria | 769 |
| 993 | Ga0587101_000011 | 3300059623 | Bacteria | 8540 |
| 994 | Ga0587101_003992 | 3300059623 | Bacteria | 1545 |
| 995 | Ga0587101_005295 | 3300059623 | Bacteria | 1425 |
| 996 | Ga0587101_031126 | 3300059623 | Bacteria | 833 |
| 997 | Ga0587101_124407 | 3300059623 | Bacteria | 536 |
| 998 | Ga0587109_036847 | 3300059624 | Bacteria | 954 |
| 999 | Ga0587113_000345 | 3300059625 | Bacteria | 2337 |
| 1000 | Ga0587113_006517 | 3300059625 | Bacteria | 994 |
| 1001 | Ga0587115_000112 | 3300059626 | Bacteria | 4239 |
| 1002 | Ga0587115_006179 | 3300059626 | Bacteria | 1373 |
| 1003 | Ga0587117_001041 | 3300059627 | Bacteria | 2209 |
| 1004 | Ga0587117_050704 | 3300059627 | Bacteria | 688 |
| 1005 | Ga0587122_006132 | 3300059628 | Bacteria | 1028 |
| 1006 | Ga0587127_001361 | 3300059629 | Bacteria | 1360 |
| 1007 | Ga0587128_000332 | 3300059630 | Bacteria | 3269 |
| 1008 | Ga0587128_001735 | 3300059630 | Bacteria | 2130 |
| 1009 | Ga0587128_023345 | 3300059630 | Bacteria | 969 |
| 1010 | Ga0587128_030255 | 3300059630 | Bacteria | 892 |
| 1011 | Ga0587130_003592 | 3300059631 | Bacteria | 1319 |
| 1012 | Ga0587068_010714 | 3300059641 | Bacteria | 1373 |
| 1013 | Ga0587068_035242 | 3300059641 | Bacteria | 886 |
| 1014 | Ga0587068_082069 | 3300059641 | Bacteria | 652 |
| 1015 | Ga0587069_004707 | 3300059642 | Bacteria | 1552 |
| 1016 | Ga0587069_008799 | 3300059642 | Bacteria | 1287 |
| 1017 | Ga0587069_009068 | 3300059642 | Bacteria | 1275 |
| 1018 | Ga0587069_116334 | 3300059642 | Bacteria | 562 |
| 1019 | Ga0587072_020829 | 3300059643 | Bacteria | 1159 |
| 1020 | Ga0587072_053680 | 3300059643 | Bacteria | 814 |
| 1021 | Ga0587076_026060 | 3300059645 | Bacteria | 1004 |
| 1022 | Ga0587076_040920 | 3300059645 | Bacteria | 866 |
| 1023 | Ga0587076_059951 | 3300059645 | Bacteria | 765 |
| 1024 | Ga0587078_047352 | 3300059646 | Bacteria | 622 |
| 1025 | Ga0587078_068160 | 3300059646 | Bacteria | 551 |
| 1026 | Ga0587079_034838 | 3300059647 | Bacteria | 987 |
| 1027 | Ga0587079_044436 | 3300059647 | Bacteria | 910 |
| 1028 | Ga0587079_063695 | 3300059647 | Bacteria | 805 |
| 1029 | Ga0587100_000216 | 3300059648 | Bacteria | 2447 |
| 1030 | Ga0587102_000354 | 3300059649 | Bacteria | 2488 |
| 1031 | Ga0587102_006949 | 3300059649 | Bacteria | 1041 |
| 1032 | Ga0587104_004547 | 3300059650 | Bacteria | 891 |
| 1033 | Ga0587105_005336 | 3300059651 | Bacteria | 852 |
| 1034 | Ga0587107_000716 | 3300059652 | Bacteria | 2359 |
| 1035 | Ga0587107_028075 | 3300059652 | Bacteria | 838 |
| 1036 | Ga0587114_111990 | 3300059655 | Bacteria | 544 |
| 1037 | Ga0587116_20676 | 3300059656 | Bacteria | 504 |
| 1038 | Ga0587118_01369 | 3300059657 | Bacteria | 1461 |
| 1039 | Ga0587118_14663 | 3300059657 | Bacteria | 622 |
| 1040 | Ga0587119_000543 | 3300059658 | Bacteria | 2554 |
| 1041 | Ga0587119_018261 | 3300059658 | Bacteria | 874 |
| 1042 | Ga0587119_072730 | 3300059658 | Bacteria | 548 |
| 1043 | Ga0587120_000682 | 3300059659 | Bacteria | 1854 |
| 1044 | Ga0587120_038302 | 3300059659 | Bacteria | 508 |
| 1045 | Ga0587124_000015 | 3300059660 | Bacteria | 5332 |
| 1046 | Ga0587096_00565 | 3300060247 | Bacteria | 1057 |
| 1047 | Ga0587071_021408 | 3300060344 | Bacteria | 1186 |
| 1048 | Ga0587071_041793 | 3300060344 | Bacteria | 921 |
| 1049 | Ga0587071_052040 | 3300060344 | Bacteria | 849 |
| 1050 | Ga0587071_109149 | 3300060344 | Bacteria | 649 |
| 1051 | Ga0587111_0000485 | 3300060346 | Bacteria | 3808 |
| 1052 | Ga0587111_0006484 | 3300060346 | Bacteria | 1859 |
| 1053 | Ga0587111_0098376 | 3300060346 | Bacteria | 725 |
| 1054 | Ga0501082_0265686 | 3300060353 | Bacteria | 1493 |
| 1055 | Ga0466962_0079520 | 3300061719 | Bacteria | 1567 |
| 1056 | 2588107945 | 2585428157 | Bacteria | 3018951 |
| 1057 | 2643732585 | 2643221542 | Bacteria | 3563959 |
| 1058 | 2643753710 | 2643221546 | Bacteria | 2910897 |
| 1059 | 2643786349 | 2643221553 | Bacteria | 3544260 |
| 1060 | 2643847782 | 2643221566 | Bacteria | 3460379 |
| 1061 | 2643876451 | 2643221572 | Bacteria | 3614809 |
| 1062 | 2643888094 | 2643221575 | Bacteria | 4022601 |
| 1063 | 2643994809 | 2643221597 | Bacteria | 3347721 |
| 1064 | 2644096404 | 2643221616 | Bacteria | 4066575 |
| 1065 | 2644171385 | 2643221630 | Bacteria | 3601215 |
| 1066 | 2644197847 | 2643221635 | Bacteria | 2632343 |
| 1067 | 2644383506 | 2643221669 | Bacteria | 3611286 |
| 1068 | 2644681049 | 2643221724 | Bacteria | 3593515 |
| 1069 | 2730230518 | 2728369380 | Bacteria | 3620317 |
| 1070 | 2747952119 | 2747842429 | Bacteria | 3914386 |
| 1071 | 2758224805 | 2757320536 | Bacteria | 3629334 |
| 1072 | 2774378929 | 2773857758 | Bacteria | 3592392 |
| 1073 | 2774382016 | 2773857759 | Bacteria | 2963774 |
| 1074 | 2774400775 | 2773857763 | Bacteria | 4180068 |
| 1075 | 2808628777 | 2808606306 | Bacteria | 3608896 |
| 1076 | 2808884762 | 2808606368 | Bacteria | 3174172 |
| 1077 | 2809226244 | 2808606447 | Bacteria | 3572005 |
| 1078 | 2812322081 | 2811994872 | Bacteria | 4121241 |
| 1079 | 2821268993 | 2821268502 | Bacteria | 3750023 |
| 1080 | 2833709883 | 2833709550 | Bacteria | 4008291 |
| 1081 | 2844843373 | 2844841374 | Bacteria | 3917147 |
| 1082 | 2844854313 | 2844852863 | Bacteria | 3849151 |
| 1083 | 2852632503 | 2852632344 | Bacteria | 3463163 |
| 1084 | 2852644345 | 2852643534 | Bacteria | 3013378 |
| 1085 | 2852647587 | 2852646457 | Bacteria | 3408613 |
| 1086 | 2852664079 | 2852663356 | Bacteria | 4090475 |
| 1087 | 2852678573 | 2852677369 | Bacteria | 3768884 |
| 1088 | 2857722758 | 2857720070 | Bacteria | 3189373 |
| 1089 | 2857725837 | 2857723135 | Bacteria | 4217853 |
| 1090 | 2857730665 | 2857729791 | Bacteria | 4040535 |
| 1091 | 2857738242 | 2857737099 | Bacteria | 3104305 |
| 1092 | 2870629388 | 2870628048 | Bacteria | 3696012 |
| 1093 | 2884766400 | 2884763398 | Bacteria | 4091164 |
| 1094 | 2895660626 | 2895660088 | Bacteria | 3782833 |
| 1095 | 2904510391 | 2904509784 | Bacteria | 3520416 |
| 1096 | 2906801159 | 2906799679 | Bacteria | 4031749 |
| 1097 | 2908678391 | 2908678064 | Bacteria | 3482747 |
| 1098 | 2919055351 | 2919055335 | Bacteria | 3875751 |
| 1099 | 2919070715 | 2919069694 | Bacteria | 3622919 |
| 1100 | 2919397184 | 2919395869 | Bacteria | 3704152 |
| 1101 | 2919445545 | 2919443155 | Bacteria | 4072969 |
| 1102 | 2928093822 | 2928090899 | Bacteria | 3158267 |
| 1103 | 2928121471 | 2928121344 | Bacteria | 3972376 |
| 1104 | 2928153510 | 2928153084 | Bacteria | 4020257 |
| 1105 | 2945968754 | 2945968032 | Bacteria | 4111363 |
| 1106 | 2946036572 | 2946033335 | Bacteria | 3835514 |
| 1107 | 2946045195 | 2946041624 | Bacteria | 4191385 |
| 1108 | 2946084038 | 2946080515 | Bacteria | 4310960 |
| 1109 | 2966922546 | 2966921586 | Bacteria | 3092803 |
| 1110 | 2966926522 | 2966924647 | Bacteria | 3268643 |
| 1111 | 2974294875 | 2974294766 | Bacteria | 3767688 |
| 1112 | 2974325325 | 2974324384 | Bacteria | 3750535 |
| 1113 | 2977230287 | 2977228692 | Bacteria | 3450105 |
| 1114 | 2977239091 | 2977236895 | Bacteria | 3569373 |
| 1115 | 2977252177 | 2977251589 | Bacteria | 2952848 |
| 1116 | 2977265505 | 2977264416 | Bacteria | 3750737 |
| 1117 | 2984543124 | 2984542743 | Bacteria | 3569378 |
| 1118 | 2984582491 | 2984580707 | Bacteria | 3351387 |
| 1119 | 2995728353 | 2995726249 | Bacteria | 3470435 |
| 1120 | 8004184518 | 8004182704 | Bacteria | 3391155 |
| 1121 | 8004213324 | 8004212874 | Bacteria | 2861420 |
| 1122 | 8016255130 | 8016254467 | Bacteria | 3797036 |
| 1123 | 8045832185 | 8045830549 | Bacteria | 4444727 |
| 1124 | 8055035302 | 8055034563 | Bacteria | 3562128 |
| 1125 | 8055039009 | 8055037949 | Bacteria | 3337834 |
| 1126 | 8057347402 | 8057345674 | Bacteria | 4160394 |
| 1127 | Ga0206352_10173797 | |||
| 1128 | JGI24740J21852_10000460 | |||
| 1129 | JGI24740J21852_10008552 | |||
| 1130 | JGI24740J21852_10012670 | |||
| 1131 | JGI24740J21852_10050801 | |||
| 1132 | JGI24739J22299_10005224 | |||
| 1133 | JGI24739J22299_10093748 | |||
| 1134 | JGI24737J22298_10063151 | |||
| 1135 | JGI24735J21928_10042386 | |||
| 1136 | JGI24735J21928_10064972 | |||
| 1137 | JGI25162J39368_1008761 | |||
| 1138 | JGI25154J39366_1006883 | |||
| 1139 | JGI25164J39214_1000440 | |||
| 1140 | Ga0006774J45829_10761 | |||
| 1141 | Ga0006779J45831_102222 | |||
| 1142 | Ga0006778J45830_1023361 | |||
| 1143 | Ga0006778J45830_1037863 | |||
| 1144 | Ga0006759J45824_1032491 | |||
| 1145 | JGI25165J46597_1000061 | |||
| 1146 | Ga0006770J48903_1025413 | |||
| 1147 | Ga0006777J48905_1024731 | |||
| 1148 | Ga0007417J51691_1036599 | |||
| 1149 | Ga0007427J51700_102557 | |||
| 1150 | Ga0006781J51513_1004015 | |||
| 1151 | Ga0007410J51695_1022860 | |||
| 1152 | Ga0007409J51694_1032594 | |||
| 1153 | Ga0007416J51690_1023401 | |||
| 1154 | Ga0006562J51391_1024272 | |||
| 1155 | Ga0006562J51391_1024273 | |||
| 1156 | Ga0007429J51699_1022931 | |||
| 1157 | Ga0032354_1037035 | |||
| 1158 | Ga0032354_1078778 | |||
| 1159 | Ga0006780_1005385 | |||
| 1160 | Ga0006780_1012984 | |||
| 1161 | Ga0055542_1016158 | |||
| 1162 | Ga0058858_1046361 | |||
| 1163 | Ga0058858_1420510 | |||
| 1164 | Ga0058859_11827816 | |||
| 1165 | Ga0058860_10000991 | |||
| 1166 | Ga0058860_10026029 | |||
| 1167 | Ga0058860_12222763 | |||
| 1168 | Ga0065714_10155188 | |||
| 1169 | Ga0070658_10009122 | |||
| 1170 | Ga0070658_10220817 | |||
| 1171 | Ga0070658_10542007 | |||
| 1172 | Ga0070670_100851899 | |||
| 1173 | Ga0070677_10424709 | |||
| 1174 | Ga0068869_100209932 | |||
| 1175 | Ga0068869_100553472 | |||
| 1176 | Ga0070682_100038470 | |||
| 1177 | Ga0070682_100116365 | |||
| 1178 | Ga0070682_100705191 | |||
| 1179 | Ga0070682_101264025 | |||
| 1180 | Ga0068868_100709387 | |||
| 1181 | Ga0070660_100057825 | |||
| 1182 | Ga0070660_100400716 | |||
| 1183 | Ga0070661_100351559 | |||
| 1184 | Ga0070692_11119038 | |||
| 1185 | Ga0070668_100317440 | |||
| 1186 | Ga0070671_100053010 | |||
| 1187 | Ga0070674_100045759 | |||
| 1188 | Ga0070659_100003025 | |||
| 1189 | Ga0070659_100021971 | |||
| 1190 | Ga0070667_100042795 | |||
| 1191 | Ga0070667_100151748 | |||
| 1192 | Ga0070667_100706796 | |||
| 1193 | Ga0070667_101201259 | |||
| 1194 | Ga0070714_100511690 | |||
| 1195 | Ga0070714_100600580 | |||
| 1196 | Ga0070714_100974345 | |||
| 1197 | Ga0070710_10095608 | |||
| 1198 | Ga0070711_101031561 | |||
| 1199 | Ga0070705_101430272 | |||
| 1200 | Ga0070663_100016293 | |||
| 1201 | Ga0070663_100829139 | |||
| 1202 | Ga0070663_100959306 | |||
| 1203 | Ga0070663_101788530 | |||
| 1204 | Ga0070663_101938008 | |||
| 1205 | Ga0070678_100660439 | |||
| 1206 | Ga0070678_102195584 | |||
| 1207 | Ga0070685_11138554 | |||
| 1208 | Ga0070685_11387074 | |||
| 1209 | Ga0070679_100496419 | |||
| 1210 | Ga0070684_100631291 | |||
| 1211 | Ga0068853_100068961 | |||
| 1212 | Ga0070672_100066968 | |||
| 1213 | Ga0070672_101003912 | |||
| 1214 | Ga0070695_101035290 | |||
| 1215 | Ga0070693_100850847 | |||
| 1216 | Ga0070665_100083091 | |||
| 1217 | Ga0068855_100047986 | |||
| 1218 | Ga0068855_100261541 | |||
| 1219 | Ga0068855_100427578 | |||
| 1220 | Ga0068855_102444860 | |||
| 1221 | Ga0068857_100999643 | |||
| 1222 | Ga0070702_101236485 | |||
| 1223 | Ga0068852_100120419 | |||
| 1224 | Ga0068852_100417091 | |||
| 1225 | Ga0068859_100456521 | |||
| 1226 | Ga0068864_100318828 | |||
| 1227 | Ga0068861_100790364 | |||
| 1228 | Ga0068851_10000022 | |||
| 1229 | Ga0068863_100830072 | |||
| 1230 | Ga0068858_100034623 | |||
| 1231 | Ga0068860_100224634 | |||
| 1232 | Ga0068862_101693087 | |||
| 1233 | Ga0075365_10012248 | |||
| 1234 | Ga0075365_10020292 | |||
| 1235 | Ga0075365_10113563 | |||
| 1236 | Ga0075365_10207236 | |||
| 1237 | Ga0075365_10476055 | |||
| 1238 | Ga0075365_11037567 | |||
| 1239 | Ga0075365_11326162 | |||
| 1240 | Ga0075368_10014257 | |||
| 1241 | Ga0075368_10110645 | |||
| 1242 | Ga0075363_100132063 | |||
| 1243 | Ga0075363_100994458 | |||
| 1244 | Ga0075364_10084726 | |||
| 1245 | Ga0075364_10243007 | |||
| 1246 | Ga0075364_10260286 | |||
| 1247 | Ga0075364_10351716 | |||
| 1248 | Ga0075364_10544300 | |||
| 1249 | Ga0075364_10819133 | |||
| 1250 | Ga0075432_10179913 | |||
| 1251 | Ga0070716_101339101 | |||
| 1252 | Ga0075367_10020722 | |||
| 1253 | Ga0075367_10298664 | |||
| 1254 | Ga0075367_10306712 | |||
| 1255 | Ga0075369_10008212 | |||
| 1256 | Ga0075369_10047871 | |||
| 1257 | Ga0075369_10119131 | |||
| 1258 | Ga0075369_10437265 | |||
| 1259 | Ga0097621_101150850 | |||
| 1260 | Ga0097621_101562109 | |||
| 1261 | Ga0075370_10043477 | |||
| 1262 | Ga0075370_10231423 | |||
| 1263 | Ga0068871_100843645 | |||
| 1264 | Ga0097620_100456490 | |||
| 1265 | Ga0105251_10056462 | |||
| 1266 | Ga0105244_10004765 | |||
| 1267 | Ga0105244_10096109 | |||
| 1268 | Ga0105245_10212872 | |||
| 1269 | Ga0105245_13198088 | |||
| 1270 | Ga0105247_10296667 | |||
| 1271 | Ga0105247_11114506 | |||
| 1272 | Ga0105243_10671170 | |||
| 1273 | Ga0105243_12512123 | |||
| 1274 | Ga0105243_13023197 | |||
| 1275 | Ga0105242_12699972 | |||
| 1276 | Ga0105248_10266117 | |||
| 1277 | Ga0105248_10780203 | |||
| 1278 | Ga0105237_10542431 | |||
| 1279 | Ga0105237_10717429 | |||
| 1280 | Ga0105237_10804485 | |||
| 1281 | Ga0105237_11204814 | |||
| 1282 | Ga0105238_10027288 | |||
| 1283 | Ga0105238_10214305 | |||
| 1284 | Ga0105238_10347193 | |||
| 1285 | Ga0105249_11467249 | |||
| 1286 | Ga0105239_10378900 | |||
| 1287 | Ga0105239_10421283 | |||
| 1288 | Ga0105239_12866857 | |||
| 1289 | Ga0105246_10750250 | |||
| 1290 | Ga0105246_11019891 | |||
| 1291 | Ga0105246_11449826 | |||
| 1292 | Ga0157373_10522192 | |||
| 1293 | Ga0157371_10013796 | |||
| 1294 | Ga0157371_10174660 | |||
| 1295 | Ga0157371_11065031 | |||
| 1296 | Ga0157370_10010513 | |||
| 1297 | Ga0157370_10443917 | |||
| 1298 | Ga0157370_10765040 | |||
| 1299 | Ga0157370_11133628 | |||
| 1300 | Ga0157369_10041722 | |||
| 1301 | Ga0157369_10059481 | |||
| 1302 | Ga0157369_10465961 | |||
| 1303 | Ga0157369_10740957 | |||
| 1304 | Ga0157369_11196541 | |||
| 1305 | Ga0171462_1001 | |||
| 1306 | Ga0157374_10789598 | |||
| 1307 | Ga0157374_10950176 | |||
| 1308 | Ga0157374_11320556 | |||
| 1309 | Ga0157374_11906802 | |||
| 1310 | Ga0157374_12265189 | |||
| 1311 | Ga0163162_10177320 | |||
| 1312 | Ga0163162_10303139 | |||
| 1313 | Ga0163162_10620717 | |||
| 1314 | Ga0163162_10668866 | |||
| 1315 | Ga0163162_11851247 | |||
| 1316 | Ga0157372_10232148 | |||
| 1317 | Ga0157372_10438593 | |||
| 1318 | Ga0157372_10845425 | |||
| 1319 | Ga0157372_11689194 | |||
| 1320 | Ga0157372_12253699 | |||
| 1321 | Ga0157375_10596593 | |||
| 1322 | Ga0157375_10925170 | |||
| 1323 | Ga0157375_11150802 | |||
| 1324 | Ga0163163_11577474 | |||
| 1325 | Ga0157380_10453219 | |||
| 1326 | Ga0157380_11040347 | |||
| 1327 | Ga0157379_10053997 | |||
| 1328 | Ga0157379_11354817 | |||
| 1329 | Ga0157376_10560361 | |||
| 1330 | Ga0163161_10157815 | |||
| 1331 | Ga0197907_10361036 | |||
| 1332 | Ga0197907_10498511 | |||
| 1333 | Ga0197907_11223662 | |||
| 1334 | Ga0197907_11245501 | |||
| 1335 | Ga0206349_1034221 | |||
| 1336 | Ga0206349_1250205 | |||
| 1337 | Ga0206349_1521915 | |||
| 1338 | Ga0206349_1604768 | |||
| 1339 | Ga0206349_1707418 | |||
| 1340 | Ga0206349_1849192 | |||
| 1341 | Ga0206355_1041932 | |||
| 1342 | Ga0206355_1129944 | |||
| 1343 | Ga0206355_1137396 | |||
| 1344 | Ga0206355_1277111 | |||
| 1345 | Ga0206355_1324827 | |||
| 1346 | Ga0206355_1605190 | |||
| 1347 | Ga0206355_1669966 | |||
| 1348 | Ga0206351_10185023 | |||
| 1349 | Ga0206351_10564340 | |||
| 1350 | Ga0206351_10632664 | |||
| 1351 | Ga0206351_10843496 | |||
| 1352 | Ga0206352_10172050 | |||
| 1353 | Ga0206352_10209131 | |||
| 1354 | Ga0206352_10305699 | |||
| 1355 | Ga0206352_10498154 | |||
| 1356 | Ga0206352_11013222 | |||
| 1357 | Ga0206352_11153687 | |||
| 1358 | Ga0206350_11401627 | |||
| 1359 | Ga0206350_11436187 | |||
| 1360 | Ga0206354_10084611 | |||
| 1361 | Ga0206354_11464084 | |||
| 1362 | Ga0206354_11671741 | |||
| 1363 | Ga0206353_10160049 | |||
| 1364 | Ga0206353_10463612 | |||
| 1365 | Ga0206353_11638567 | |||
| 1366 | Ga0154015_1476573 | |||
| 1367 | Ga0224712_10083078 | |||
| 1368 | Ga0224712_10153416 | |||
| 1369 | Ga0256744_142576 | |||
| 1370 | Ga0207427_100042 | |||
| 1371 | Ga0209437_100510 | |||
| 1372 | Ga0209646_1000013 | |||
| 1373 | Ga0209646_1000014 | |||
| 1374 | Ga0209148_1002314 | |||
| 1375 | Ga0209129_1016695 | |||
| 1376 | Ga0209233_1000001 | |||
| 1377 | Ga0209130_1039307 | |||
| 1378 | Ga0209676_1023744 | |||
| 1379 | Ga0207656_10000005 | |||
| 1380 | Ga0207655_1000386 | |||
| 1381 | Ga0207655_1134228 | |||
| 1382 | Ga0207682_10145213 | |||
| 1383 | Ga0207692_10352603 | |||
| 1384 | Ga0207710_10758950 | |||
| 1385 | Ga0207710_10775627 | |||
| 1386 | Ga0207647_10035337 | |||
| 1387 | Ga0207647_10070828 | |||
| 1388 | Ga0207647_10115621 | |||
| 1389 | Ga0207685_10857587 | |||
| 1390 | Ga0207643_10091417 | |||
| 1391 | Ga0207705_10000001 | |||
| 1392 | Ga0207705_10192945 | |||
| 1393 | Ga0207705_10257753 | |||
| 1394 | Ga0207654_10000001 | |||
| 1395 | Ga0207695_10277353 | |||
| 1396 | Ga0207671_10000016 | |||
| 1397 | Ga0207671_10082507 | |||
| 1398 | Ga0207671_10901436 | |||
| 1399 | Ga0207671_11568720 | |||
| 1400 | Ga0207657_10005997 | |||
| 1401 | Ga0207657_10372004 | |||
| 1402 | Ga0207649_10165081 | |||
| 1403 | Ga0207646_11316455 | |||
| 1404 | Ga0207694_10000057 | |||
| 1405 | Ga0207650_10347892 | |||
| 1406 | Ga0207659_11124255 | |||
| 1407 | Ga0207687_10091182 | |||
| 1408 | Ga0207664_10347094 | |||
| 1409 | Ga0207664_10844209 | |||
| 1410 | Ga0207644_10132279 | |||
| 1411 | Ga0207690_10003803 | |||
| 1412 | Ga0207690_11430486 | |||
| 1413 | Ga0207690_11861409 | |||
| 1414 | Ga0207709_10233903 | |||
| 1415 | Ga0207709_10315467 | |||
| 1416 | Ga0207665_10571300 | |||
| 1417 | Ga0207665_10584751 | |||
| 1418 | Ga0207691_10126653 | |||
| 1419 | Ga0207711_10022131 | |||
| 1420 | Ga0207711_10469680 | |||
| 1421 | Ga0207689_10351692 | |||
| 1422 | Ga0207661_11318852 | |||
| 1423 | Ga0207667_10021165 | |||
| 1424 | Ga0207667_10069574 | |||
| 1425 | Ga0207667_10303822 | |||
| 1426 | Ga0207667_11310732 | |||
| 1427 | Ga0207667_11695718 | |||
| 1428 | Ga0207667_11939989 | |||
| 1429 | Ga0207712_11576636 | |||
| 1430 | Ga0207668_10525059 | |||
| 1431 | Ga0207668_10584374 | |||
| 1432 | Ga0207640_10304432 | |||
| 1433 | Ga0207658_10014016 | |||
| 1434 | Ga0207658_11137653 | |||
| 1435 | Ga0207658_11424409 | |||
| 1436 | Ga0207658_11592194 | |||
| 1437 | Ga0207658_11943280 | |||
| 1438 | Ga0207703_10001453 | |||
| 1439 | Ga0207639_10056116 | |||
| 1440 | Ga0207639_11316923 | |||
| 1441 | Ga0207678_10027691 | |||
| 1442 | Ga0207678_10329291 | |||
| 1443 | Ga0207678_10387201 | |||
| 1444 | Ga0207708_10290684 | |||
| 1445 | Ga0207702_10029018 | |||
| 1446 | Ga0207702_10208314 | |||
| 1447 | Ga0207683_10168192 | |||
| 1448 | Ga0207698_10139001 | |||
| 1449 | Ga0207698_10304750 | |||
| 1450 | Ga0207698_10339745 | |||
| 1451 | Ga0209813_10207646 | |||
| 1452 | Ga0209813_10301414 | |||
| 1453 | Ga0268266_10393555 | |||
| 1454 | Ga0268265_10135334 | |||
| 1455 | Ga0307517_10268976 | |||
| 1456 | Ga0311004_143717 | |||
| 1457 | Ga0311001_1007990 | |||
| 1458 | Ga0310982_140508 | |||
| 1459 | Ga0310981_1006206 | |||
| 1460 | Ga0307513_10282932 | |||
| 1461 | Ga0307513_10547263 | |||
| 1462 | Ga0307408_100631993 | |||
| 1463 | Ga0307408_100725948 | |||
| 1464 | Ga0307408_101247540 | |||
| 1465 | Ga0307514_10304681 | |||
| 1466 | Ga0307405_10646754 | |||
| 1467 | Ga0307405_10686116 | |||
| 1468 | Ga0307405_10689973 | |||
| 1469 | Ga0307405_10696163 | |||
| 1470 | Ga0307405_11098457 | |||
| 1471 | Ga0307413_10728988 | |||
| 1472 | Ga0307413_11255066 | |||
| 1473 | Ga0307413_11802838 | |||
| 1474 | Ga0307410_10735200 | |||
| 1475 | Ga0307406_10000938 | |||
| 1476 | Ga0307406_10074938 | |||
| 1477 | Ga0307406_10300233 | |||
| 1478 | Ga0307406_10444568 | |||
| 1479 | Ga0307406_10607517 | |||
| 1480 | Ga0307406_10834118 | |||
| 1481 | Ga0307406_11120531 | |||
| 1482 | Ga0307407_10192660 | |||
| 1483 | Ga0307407_10362949 | |||
| 1484 | Ga0307407_10919056 | |||
| 1485 | Ga0307412_10038041 | |||
| 1486 | Ga0307412_10708588 | |||
| 1487 | Ga0307412_11305184 | |||
| 1488 | Ga0307412_12078050 | |||
| 1489 | Ga0307412_12177422 | |||
| 1490 | Ga0307409_100257187 | |||
| 1491 | Ga0307409_100287294 | |||
| 1492 | Ga0307409_100447884 | |||
| 1493 | Ga0307409_100688508 | |||
| 1494 | Ga0307409_101079594 | |||
| 1495 | Ga0307409_101112435 | |||
| 1496 | Ga0307416_100528221 | |||
| 1497 | Ga0307416_101566001 | |||
| 1498 | Ga0307416_101643799 | |||
| 1499 | Ga0307416_102199011 | |||
| 1500 | Ga0307416_102363314 | |||
| 1501 | Ga0307414_10503976 | |||
| 1502 | Ga0307411_10299553 | |||
| 1503 | Ga0307411_11041070 | |||
| 1504 | Ga0307415_100008614 | |||
| 1505 | Ga0307415_100925132 | |||
| 1506 | Ga0307415_100939453 | |||
| 1507 | Ga0307415_101697904 | |||
| 1508 | Ga0395900_0642566 | |||
| 1509 | Ga0395900_0700140 | |||
| 1510 | Ga0395900_0829724 | |||
| 1511 | Ga0395900_1792186 | |||
| 1512 | Ga0395898_0019914 | |||
| 1513 | Ga0395898_0105586 | |||
| 1514 | Ga0395898_0167204 | |||
| 1515 | Ga0395901_0051416 | |||
| 1516 | Ga0395901_0141720 | |||
| 1517 | Ga0439436_0090588 | |||
| 1518 | Ga0439439_0067856 | |||
| 1519 | Ga0439466_0188528 | |||
| 1520 | Ga0439465_0045859 | |||
| 1521 | Ga0439465_0117232 | |||
| 1522 | Ga0439465_0136287 | |||
| 1523 | Ga0451787_006059 | |||
| 1524 | Ga0451787_198347 | |||
| 1525 | Ga0451787_494371 | |||
| 1526 | Ga0451787_698953 | |||
| 1527 | Ga0451788_06186 | |||
| 1528 | Ga0451789_1026005 | |||
| 1529 | Ga0451790_16529 | |||
| 1530 | Ga0451792_08540 | |||
| 1531 | Ga0451794_15320 | |||
| 1532 | Ga0451794_50422 | |||
| 1533 | Ga0451791_0192690 | |||
| 1534 | Ga0451791_0375613 | |||
| 1535 | Ga0451791_1451577 | |||
| 1536 | Ga0451793_1220708 | |||
| 1537 | Ga0451797_0304931 | |||
| 1538 | Ga0451797_0960236 | |||
| 1539 | Ga0451795_0615518 | |||
| 1540 | Ga0451795_0717574 | |||
| 1541 | Ga0451795_1155111 | |||
| 1542 | Ga0451802_0607156 | |||
| 1543 | Ga0451802_1045637 | |||
| 1544 | Ga0451805_067564 | |||
| 1545 | Ga0451805_083680 | |||
| 1546 | Ga0451806_370333 | |||
| 1547 | Ga0451804_0004070 | |||
| 1548 | Ga0451807_0180144 | |||
| 1549 | Ga0451807_1534873 | |||
| 1550 | Ga0451807_1605592 | |||
| 1551 | Ga0451835_0538675 | |||
| 1552 | Ga0451837_0302867 | |||
| 1553 | Ga0451837_1713824 | |||
| 1554 | Ga0451841_0622253 | |||
| 1555 | Ga0451841_0717519 | |||
| 1556 | Ga0451847_0492307 | |||
| 1557 | Ga0451843_0686131 | |||
| 1558 | Ga0451853_0693091 | |||
| 1559 | Ga0451853_2006119 | |||
| 1560 | Ga0451853_3216936 | |||
| 1561 | Ga0439431_0106876 | |||
| 1562 | Ga0439433_0036605 | |||
| 1563 | Ga0439449_0338324 | |||
| 1564 | Ga0439462_0035379 | |||
| 1565 | Ga0450920_012421 | |||
| 1566 | Ga0450922_041426 | |||
| 1567 | Ga0450923_096439 | |||
| 1568 | Ga0450905_038500 | |||
| 1569 | Ga0450906_047563 | |||
| 1570 | Ga0450909_007757 | |||
| 1571 | Ga0439434_0172163 | |||
| 1572 | Ga0439459_0192832 | |||
| 1573 | Ga0466969_0049679 | |||
| 1574 | Ga0466969_0166999 | |||
| 1575 | Ga0466972_0028315 | |||
| 1576 | Ga0466972_0072420 | |||
| 1577 | Ga0466972_0221483 | |||
| 1578 | Ga0466972_0375215 | |||
| 1579 | Ga0466965_0000003 | |||
| 1580 | Ga0466965_0053028 | |||
| 1581 | Ga0466965_0072804 | |||
| 1582 | Ga0466965_0261460 | |||
| 1583 | Ga0466965_0371437 | |||
| 1584 | Ga0466966_0023287 | |||
| 1585 | Ga0466966_0251933 | |||
| 1586 | Ga0466966_0262503 | |||
| 1587 | Ga0466961_0005839 | |||
| 1588 | Ga0466961_0057729 | |||
| 1589 | Ga0466961_0103620 | |||
| 1590 | Ga0466961_0149441 | |||
| 1591 | Ga0466961_0239574 | |||
| 1592 | Ga0466961_0423278 | |||
| 1593 | Ga0466963_0541606 | |||
| 1594 | Ga0466963_0590903 | |||
| 1595 | Ga0466964_0032622 | |||
| 1596 | Ga0466964_0531943 | |||
| 1597 | Ga0466971_0033256 | |||
| 1598 | Ga0466971_0179354 | |||
| 1599 | Ga0466971_0424543 | |||
| 1600 | Ga0466968_0172687 | |||
| 1601 | Ga0466968_0210904 | |||
| 1602 | Ga0466970_0000027 | |||
| 1603 | Ga0466970_0036988 | |||
| 1604 | Ga0466970_0113359 | |||
| 1605 | Ga0466970_0121472 | |||
| 1606 | Ga0466970_0234301 | |||
| 1607 | Ga0466970_0511148 | |||
| 1608 | Ga0466970_0566948 | |||
| 1609 | Ga0466957_0051721 | |||
| 1610 | Ga0466957_0654141 | |||
| 1611 | Ga0466957_0851449 | |||
| 1612 | Ga0466960_0019431 | |||
| 1613 | Ga0466960_0031018 | |||
| 1614 | Ga0466960_0223077 | |||
| 1615 | Ga0466960_0455257 | |||
| 1616 | Ga0466959_0352321 | |||
| 1617 | Ga0466959_0712361 | |||
| 1618 | Ga0466958_0023373 | |||
| 1619 | Ga0466958_0089102 | |||
| 1620 | Ga0466958_0328554 | |||
| 1621 | Ga0466958_0621732 | |||
| 1622 | Ga0466967_0202852 | |||
| 1623 | Ga0466967_0967154 | |||
| 1624 | Ga0495627_001687 | |||
| 1625 | Ga0495592_0692055 | |||
| 1626 | Ga0495590_0000902 | |||
| 1627 | Ga0495591_111967 | |||
| 1628 | Ga0495639_0105309 | |||
| 1629 | Ga0495596_0098554 | |||
| 1630 | Ga0495583_0116370 | |||
| 1631 | Ga0495610_0152610 | |||
| 1632 | Ga0495610_0373205 | |||
| 1633 | Ga0495620_0046421 | |||
| 1634 | Ga0495620_0114915 | |||
| 1635 | Ga0495631_0015142 | |||
| 1636 | Ga0495632_0334238 | |||
| 1637 | Ga0495632_0364624 | |||
| 1638 | Ga0495643_0268651 | |||
| 1639 | Ga0495663_0258418 | |||
| 1640 | Ga0495654_0118549 | |||
| 1641 | Ga0495598_0088631 | |||
| 1642 | Ga0495609_0069765 | |||
| 1643 | Ga0495621_0124588 | |||
| 1644 | Ga0495645_0076192 | |||
| 1645 | Ga0495633_0057220 | |||
| 1646 | Ga0495633_0271671 | |||
| 1647 | Ga0495656_0029433 | |||
| 1648 | Ga0495656_0175132 | |||
| 1649 | Ga0495668_0793284 | |||
| 1650 | Ga0495646_0293386 | |||
| 1651 | Ga0495658_1021239 | |||
| 1652 | Ga0495624_0799313 | |||
| 1653 | Ga0495670_0631421 | |||
| 1654 | Ga0495671_0086028 | |||
| 1655 | Ga0495649_0062055 | |||
| 1656 | Ga0495660_0176997 | |||
| 1657 | Ga0495636_0124496 | |||
| 1658 | Ga0495672_0011493 | |||
| 1659 | Ga0495672_0084128 | |||
| 1660 | Ga0495672_0105416 | |||
| 1661 | Ga0495676_0855972 | |||
| 1662 | Ga0495673_0286143 | |||
| 1663 | Ga0495673_0286889 | |||
| 1664 | Ga0495681_0059308 | |||
| 1665 | Ga0495686_0028366 | |||
| 1666 | Ga0495686_0050944 | |||
| 1667 | Ga0495686_0386462 | |||
| 1668 | Ga0495615_0036135 | |||
| 1669 | Ga0495615_0190979 | |||
| 1670 | Ga0495615_0229528 | |||
| 1671 | Ga0495626_0010797 | |||
| 1672 | Ga0496100_0011682 | |||
| 1673 | Ga0496100_0088880 | |||
| 1674 | Ga0496101_0002898 | |||
| 1675 | Ga0496101_0008133 | |||
| 1676 | Ga0496102_0089571 | |||
| 1677 | Ga0496102_0280181 | |||
| 1678 | Ga0496103_0010181 | |||
| 1679 | Ga0496103_0033058 | |||
| 1680 | Ga0496103_0794279 | |||
| 1681 | Ga0496104_0003769 | |||
| 1682 | Ga0496104_0015491 | |||
| 1683 | Ga0496104_0052939 | |||
| 1684 | Ga0496104_0812440 | |||
| 1685 | Ga0496105_0005038 | |||
| 1686 | Ga0496105_0009192 | |||
| 1687 | Ga0496105_0150981 | |||
| 1688 | Ga0496105_0224039 | |||
| 1689 | Ga0496105_0447361 | |||
| 1690 | Ga0496105_0994965 | |||
| 1691 | Ga0496105_1405630 | |||
| 1692 | Ga0496106_0530388 | |||
| 1693 | Ga0496107_0001328 | |||
| 1694 | Ga0496107_0939130 | |||
| 1695 | Ga0496108_0047565 | |||
| 1696 | Ga0496108_0052644 | |||
| 1697 | Ga0496109_0042506 | |||
| 1698 | Ga0496109_0080472 | |||
| 1699 | Ga0496110_0029641 | |||
| 1700 | Ga0496110_0950228 | |||
| 1701 | Ga0496111_0012648 | |||
| 1702 | Ga0496111_0269126 | |||
| 1703 | Ga0496111_0543024 | |||
| 1704 | Ga0496111_0716449 | |||
| 1705 | Ga0496111_1181849 | |||
| 1706 | Ga0496112_0231900 | |||
| 1707 | Ga0496112_1478820 | |||
| 1708 | Ga0496113_0005620 | |||
| 1709 | Ga0496113_0323369 | |||
| 1710 | Ga0496113_0809195 | |||
| 1711 | Ga0496114_0044687 | |||
| 1712 | Ga0496114_0085888 | |||
| 1713 | Ga0496114_0118841 | |||
| 1714 | Ga0496114_0396836 | |||
| 1715 | Ga0496115_0002702 | |||
| 1716 | Ga0496115_0058315 | |||
| 1717 | Ga0496116_0021611 | |||
| 1718 | Ga0496116_0095573 | |||
| 1719 | Ga0496116_0384463 | |||
| 1720 | Ga0496117_0000362 | |||
| 1721 | Ga0496117_0004032 | |||
| 1722 | Ga0496117_0006530 | |||
| 1723 | Ga0496117_0008690 | |||
| 1724 | Ga0496117_0009885 | |||
| 1725 | Ga0496117_0010175 | |||
| 1726 | Ga0496117_0018116 | |||
| 1727 | Ga0496117_0111258 | |||
| 1728 | Ga0496118_0043816 | |||
| 1729 | Ga0496118_0049600 | |||
| 1730 | Ga0496118_0081814 | |||
| 1731 | Ga0496118_0103297 | |||
| 1732 | Ga0496118_0106746 | |||
| 1733 | Ga0496118_0195117 | |||
| 1734 | Ga0496118_0427522 | |||
| 1735 | Ga0496119_0000720 | |||
| 1736 | Ga0496119_0006250 | |||
| 1737 | Ga0496119_0046717 | |||
| 1738 | Ga0496119_0061767 | |||
| 1739 | Ga0496119_0061774 | |||
| 1740 | Ga0496119_0096444 | |||
| 1741 | Ga0496119_0120060 | |||
| 1742 | Ga0496119_0207019 | |||
| 1743 | Ga0496119_0236420 | |||
| 1744 | Ga0496119_0458713 | |||
| 1745 | Ga0496119_0492731 | |||
| 1746 | Ga0496120_0007276 | |||
| 1747 | Ga0496120_0013513 | |||
| 1748 | Ga0496120_0027437 | |||
| 1749 | Ga0496120_0038694 | |||
| 1750 | Ga0496120_0052424 | |||
| 1751 | Ga0496120_0130693 | |||
| 1752 | Ga0496120_0140755 | |||
| 1753 | Ga0496120_0174191 | |||
| 1754 | Ga0496120_0185392 | |||
| 1755 | Ga0496120_0342639 | |||
| 1756 | Ga0496121_0278670 | |||
| 1757 | Ga0496122_0000022 | |||
| 1758 | Ga0496122_0000799 | |||
| 1759 | Ga0496122_0005147 | |||
| 1760 | Ga0496122_0010341 | |||
| 1761 | Ga0496122_0012595 | |||
| 1762 | Ga0496122_0026775 | |||
| 1763 | Ga0496122_0232491 | |||
| 1764 | Ga0496122_0398172 | |||
| 1765 | Ga0496123_0000009 | |||
| 1766 | Ga0496123_0000016 | |||
| 1767 | Ga0496123_0019848 | |||
| 1768 | Ga0496123_0020865 | |||
| 1769 | Ga0496123_0068714 | |||
| 1770 | Ga0496123_0080336 | |||
| 1771 | Ga0496123_0084999 | |||
| 1772 | Ga0496123_0117289 | |||
| 1773 | Ga0496123_0120729 | |||
| 1774 | Ga0496123_0169347 | |||
| 1775 | Ga0496124_0002766 | |||
| 1776 | Ga0496124_0046380 | |||
| 1777 | Ga0496124_0059852 | |||
| 1778 | Ga0496124_0086176 | |||
| 1779 | Ga0496124_0206335 | |||
| 1780 | Ga0496125_0001491 | |||
| 1781 | Ga0496125_0002578 | |||
| 1782 | Ga0496125_0007012 | |||
| 1783 | Ga0496125_0016052 | |||
| 1784 | Ga0496125_0109413 | |||
| 1785 | Ga0496125_0133224 | |||
| 1786 | Ga0496125_0376185 | |||
| 1787 | Ga0496125_0570307 | |||
| 1788 | Ga0496126_0002077 | |||
| 1789 | Ga0496126_0002563 | |||
| 1790 | Ga0496126_0011686 | |||
| 1791 | Ga0496126_0019423 | |||
| 1792 | Ga0496126_0029883 | |||
| 1793 | Ga0496126_0052594 | |||
| 1794 | Ga0496126_0144413 | |||
| 1795 | Ga0496126_0175971 | |||
| 1796 | Ga0496126_0613962 | |||
| 1797 | Ga0496126_1271306 | |||
| 1798 | Ga0501306_000560 | |||
| 1799 | Ga0501306_001630 | |||
| 1800 | Ga0501306_009766 | |||
| 1801 | Ga0501306_012383 | |||
| 1802 | Ga0501306_021437 | |||
| 1803 | Ga0501306_074369 | |||
| 1804 | Ga0501306_078472 | |||
| 1805 | Ga0501308_004880 | |||
| 1806 | Ga0501308_013611 | |||
| 1807 | Ga0501308_066583 | |||
| 1808 | Ga0501309_000718 | |||
| 1809 | Ga0501309_049635 | |||
| 1810 | Ga0501310_004109 | |||
| 1811 | Ga0501310_006454 | |||
| 1812 | Ga0501310_028960 | |||
| 1813 | Ga0501310_048299 | |||
| 1814 | Ga0501341_01663 | |||
| 1815 | Ga0501304_002063 | |||
| 1816 | Ga0501304_002642 | |||
| 1817 | Ga0501304_010309 | |||
| 1818 | Ga0501305_000734 | |||
| 1819 | Ga0501305_004421 | |||
| 1820 | Ga0501305_010239 | |||
| 1821 | Ga0501305_016506 | |||
| 1822 | Ga0501305_102569 | |||
| 1823 | Ga0501305_112221 | |||
| 1824 | Ga0501305_120657 | |||
| 1825 | Ga0501307_000265 | |||
| 1826 | Ga0501307_005058 | |||
| 1827 | Ga0501307_024831 | |||
| 1828 | Ga0501307_025153 | |||
| 1829 | Ga0501307_025451 | |||
| 1830 | Ga0501307_027312 | |||
| 1831 | Ga0501311_000387 | |||
| 1832 | Ga0501311_008374 | |||
| 1833 | Ga0501311_019784 | |||
| 1834 | Ga0501311_026229 | |||
| 1835 | Ga0501311_084211 | |||
| 1836 | Ga0501312_000232 | |||
| 1837 | Ga0501312_087617 | |||
| 1838 | Ga0501313_004872 | |||
| 1839 | Ga0501313_010638 | |||
| 1840 | Ga0501314_002087 | |||
| 1841 | Ga0501314_003965 | |||
| 1842 | Ga0501315_005291 | |||
| 1843 | Ga0501315_028725 | |||
| 1844 | Ga0501315_029278 | |||
| 1845 | Ga0501315_096537 | |||
| 1846 | Ga0501316_005648 | |||
| 1847 | Ga0501316_020268 | |||
| 1848 | Ga0501317_000092 | |||
| 1849 | Ga0501317_002999 | |||
| 1850 | Ga0501317_004767 | |||
| 1851 | Ga0501317_012140 | |||
| 1852 | Ga0501317_015192 | |||
| 1853 | Ga0501317_018134 | |||
| 1854 | Ga0501317_073508 | |||
| 1855 | Ga0501317_087720 | |||
| 1856 | Ga0501317_103749 | |||
| 1857 | Ga0501318_001483 | |||
| 1858 | Ga0501318_003859 | |||
| 1859 | Ga0501318_007672 | |||
| 1860 | Ga0501318_007736 | |||
| 1861 | Ga0501318_010758 | |||
| 1862 | Ga0501318_073420 | |||
| 1863 | Ga0501319_007607 | |||
| 1864 | Ga0501319_009009 | |||
| 1865 | Ga0501319_026015 | |||
| 1866 | Ga0501320_007464 | |||
| 1867 | Ga0501320_011242 | |||
| 1868 | Ga0501320_014435 | |||
| 1869 | Ga0501320_028182 | |||
| 1870 | Ga0501321_000064 | |||
| 1871 | Ga0501321_002137 | |||
| 1872 | Ga0501321_006408 | |||
| 1873 | Ga0501321_006964 | |||
| 1874 | Ga0501321_008554 | |||
| 1875 | Ga0501321_009527 | |||
| 1876 | Ga0501321_028462 | |||
| 1877 | Ga0501322_000562 | |||
| 1878 | Ga0501323_002343 | |||
| 1879 | Ga0501323_020355 | |||
| 1880 | Ga0501323_031187 | |||
| 1881 | Ga0501324_001672 | |||
| 1882 | Ga0501324_012702 | |||
| 1883 | Ga0501324_025687 | |||
| 1884 | Ga0501324_026773 | |||
| 1885 | Ga0501325_004097 | |||
| 1886 | Ga0501325_004154 | |||
| 1887 | Ga0501325_006462 | |||
| 1888 | Ga0501325_014393 | |||
| 1889 | Ga0501325_016954 | |||
| 1890 | Ga0501325_045302 | |||
| 1891 | Ga0501330_001979 | |||
| 1892 | Ga0501330_003718 | |||
| 1893 | Ga0501331_06050 | |||
| 1894 | Ga0501332_08873 | |||
| 1895 | Ga0501332_13759 | |||
| 1896 | Ga0501333_006876 | |||
| 1897 | Ga0501335_009693 | |||
| 1898 | Ga0501336_008255 | |||
| 1899 | Ga0501340_003715 | |||
| 1900 | Ga0501031_0012276 | |||
| 1901 | Ga0501031_0026550 | |||
| 1902 | Ga0501031_0090099 | |||
| 1903 | Ga0501031_0186178 | |||
| 1904 | Ga0501032_0003386 | |||
| 1905 | Ga0501032_0011095 | |||
| 1906 | Ga0501032_0060246 | |||
| 1907 | Ga0501032_0063351 | |||
| 1908 | Ga0501032_0169713 | |||
| 1909 | Ga0501033_0002214 | |||
| 1910 | Ga0501033_0004032 | |||
| 1911 | Ga0501033_0004858 | |||
| 1912 | Ga0501033_0233744 | |||
| 1913 | Ga0501033_0284185 | |||
| 1914 | Ga0501034_0002490 | |||
| 1915 | Ga0501034_0008687 | |||
| 1916 | Ga0501034_0057847 | |||
| 1917 | Ga0501034_0201798 | |||
| 1918 | Ga0501034_0256960 | |||
| 1919 | Ga0501034_0279349 | |||
| 1920 | Ga0501034_0658423 | |||
| 1921 | Ga0501036_0123303 | |||
| 1922 | Ga0501036_0267934 | |||
| 1923 | Ga0501036_0365972 | |||
| 1924 | Ga0501036_0656253 | |||
| 1925 | Ga0501037_0001422 | |||
| 1926 | Ga0501037_0050605 | |||
| 1927 | Ga0501037_0084416 | |||
| 1928 | Ga0501037_0099456 | |||
| 1929 | Ga0501037_0347933 | |||
| 1930 | Ga0501038_0003511 | |||
| 1931 | Ga0501038_0021820 | |||
| 1932 | Ga0501038_0187593 | |||
| 1933 | Ga0501038_0188345 | |||
| 1934 | Ga0501038_0339541 | |||
| 1935 | Ga0501038_0655828 | |||
| 1936 | Ga0501039_0064692 | |||
| 1937 | Ga0501039_0303888 | |||
| 1938 | Ga0501039_0725069 | |||
| 1939 | Ga0501042_0009674 | |||
| 1940 | Ga0501042_0108198 | |||
| 1941 | Ga0501043_0035007 | |||
| 1942 | Ga0501043_0065288 | |||
| 1943 | Ga0501043_0112406 | |||
| 1944 | Ga0501043_0201043 | |||
| 1945 | Ga0501043_0289285 | |||
| 1946 | Ga0501046_0013742 | |||
| 1947 | Ga0501046_0014149 | |||
| 1948 | Ga0501046_0173226 | |||
| 1949 | Ga0501047_0001782 | |||
| 1950 | Ga0501047_0006944 | |||
| 1951 | Ga0501047_0090346 | |||
| 1952 | Ga0501047_0273903 | |||
| 1953 | Ga0501048_0013228 | |||
| 1954 | Ga0501048_0016304 | |||
| 1955 | Ga0501048_0022961 | |||
| 1956 | Ga0501067_0023885 | |||
| 1957 | Ga0501067_0113885 | |||
| 1958 | Ga0501068_0051682 | |||
| 1959 | Ga0501068_0290467 | |||
| 1960 | Ga0501068_0388140 | |||
| 1961 | Ga0501068_0391015 | |||
| 1962 | Ga0501070_0016910 | |||
| 1963 | Ga0501070_0018992 | |||
| 1964 | Ga0501070_0048708 | |||
| 1965 | Ga0501070_0122688 | |||
| 1966 | Ga0501070_0249362 | |||
| 1967 | Ga0501070_0259936 | |||
| 1968 | Ga0501070_0372507 | |||
| 1969 | Ga0501070_0372724 | |||
| 1970 | Ga0501071_0144813 | |||
| 1971 | Ga0501071_0292580 | |||
| 1972 | Ga0501071_1258995 | |||
| 1973 | Ga0501073_0000030 | |||
| 1974 | Ga0501073_0041926 | |||
| 1975 | Ga0501073_0272971 | |||
| 1976 | Ga0501073_0381959 | |||
| 1977 | Ga0501074_0028983 | |||
| 1978 | Ga0501075_1001107 | |||
| 1979 | Ga0501259_141890 | |||
| 1980 | Ga0501079_0758558 | |||
| 1981 | Ga0501080_0124926 | |||
| 1982 | Ga0501080_0282609 | |||
| 1983 | Ga0501083_0015538 | |||
| 1984 | Ga0501083_0112793 | |||
| 1985 | Ga0501035_0013885 | |||
| 1986 | Ga0501035_0023629 | |||
| 1987 | Ga0501035_0216432 | |||
| 1988 | Ga0501035_0304302 | |||
| 1989 | Ga0501044_0001531 | |||
| 1990 | Ga0501044_0021477 | |||
| 1991 | Ga0501044_0128262 | |||
| 1992 | Ga0501044_0180571 | |||
| 1993 | Ga0501044_0249314 | |||
| 1994 | Ga0501044_0821298 | |||
| 1995 | Ga0501044_1365634 | |||
| 1996 | Ga0501045_0012578 | |||
| 1997 | Ga0501045_0245961 | |||
| 1998 | Ga0501045_0427464 | |||
| 1999 | nmdc:mga03n38_769481_c1 | |||
| 2000 | nmdc:mga03n38_99409_c1 | |||
| 2001 | nmdc:mga00v17_121287_c1 | |||
| 2002 | nmdc:mga00v17_312102_c1 | |||
| 2003 | nmdc:mga00v17_49308_c1 | |||
| 2004 | nmdc:mga00v17_577796_c1 | |||
| 2005 | nmdc:mga00v17_6859_c1 | |||
| 2006 | nmdc:mga00v17_88029_c1 | |||
| 2007 | nmdc:mga0yw44_19106_c1 | |||
| 2008 | nmdc:mga0yw44_277_c1 | |||
| 2009 | nmdc:mga0yw44_662928_c1 | |||
| 2010 | nmdc:mga0yw44_68280_c1 | |||
| 2011 | nmdc:mga0yw44_82709_c1 | |||
| 2012 | nmdc:mga06z11_23458_c1 | |||
| 2013 | nmdc:mga04h51_120153_c1 | |||
| 2014 | nmdc:mga04h51_501755_c1 | |||
| 2015 | nmdc:mga07m45_482854_c1 | |||
| 2016 | nmdc:mga07m45_8187_c1 | |||
| 2017 | nmdc:mga07m45_873133_c1 | |||
| 2018 | nmdc:mga0sz30_10621_c1 | |||
| 2019 | nmdc:mga0sz30_201779_c1 | |||
| 2020 | nmdc:mga0sz30_45403_c1 | |||
| 2021 | nmdc:mga0sz30_84375_c1 | |||
| 2022 | Ga0495601_0433583 | |||
| 2023 | Ga0500635_0044869 | |||
| 2024 | Ga0495619_0120641 | |||
| 2025 | Ga0500643_001952 | |||
| 2026 | Ga0500651_0004271 | |||
| 2027 | Ga0500556_0000020 | |||
| 2028 | Ga0500556_0000151 | |||
| 2029 | Ga0500562_027326 | |||
| 2030 | Ga0500593_000975 | |||
| 2031 | Ga0500593_041574 | |||
| 2032 | Ga0500608_344112 | |||
| 2033 | Ga0500628_071200 | |||
| 2034 | Ga0500628_190452 | |||
| 2035 | Ga0500655_003771 | |||
| 2036 | Ga0500655_046492 | |||
| 2037 | Ga0500559_0000050 | |||
| 2038 | Ga0500559_0052618 | |||
| 2039 | Ga0500559_0304464 | |||
| 2040 | Ga0500559_0464170 | |||
| 2041 | Ga0500568_0000038 | |||
| 2042 | Ga0500568_0000117 | |||
| 2043 | Ga0500568_0002756 | |||
| 2044 | Ga0500573_0379997 | |||
| 2045 | Ga0500590_049090 | |||
| 2046 | Ga0500616_0000027 | |||
| 2047 | Ga0500616_0002723 | |||
| 2048 | Ga0500616_0205028 | |||
| 2049 | Ga0500620_000519 | |||
| 2050 | Ga0500611_246722 | |||
| 2051 | Ga0501084_0161687 | |||
| 2052 | Ga0501084_0738504 | |||
| 2053 | Ga0590075_190435 | |||
| 2054 | Ga0587084_000004 | |||
| 2055 | Ga0587084_005686 | |||
| 2056 | Ga0587084_022776 | |||
| 2057 | Ga0587084_047149 | |||
| 2058 | Ga0587093_058119 | |||
| 2059 | Ga0587066_061185 | |||
| 2060 | Ga0587066_152503 | |||
| 2061 | Ga0587070_000571 | |||
| 2062 | Ga0587070_007980 | |||
| 2063 | Ga0587070_033861 | |||
| 2064 | Ga0587070_056277 | |||
| 2065 | Ga0587073_0070195 | |||
| 2066 | Ga0587077_000501 | |||
| 2067 | Ga0587077_006148 | |||
| 2068 | Ga0587077_014309 | |||
| 2069 | Ga0587077_047866 | |||
| 2070 | Ga0587077_065220 | |||
| 2071 | Ga0587080_002778 | |||
| 2072 | Ga0587080_009509 | |||
| 2073 | Ga0587080_023505 | |||
| 2074 | Ga0587083_0008351 | |||
| 2075 | Ga0587083_0030595 | |||
| 2076 | Ga0587083_0051089 | |||
| 2077 | Ga0587085_007645 | |||
| 2078 | Ga0587085_045682 | |||
| 2079 | Ga0587086_009862 | |||
| 2080 | Ga0587086_021908 | |||
| 2081 | Ga0587086_050370 | |||
| 2082 | Ga0587086_079212 | |||
| 2083 | Ga0587088_002140 | |||
| 2084 | Ga0587088_004735 | |||
| 2085 | Ga0587088_005922 | |||
| 2086 | Ga0587088_017488 | |||
| 2087 | Ga0587088_018983 | |||
| 2088 | Ga0587088_029751 | |||
| 2089 | Ga0587088_125430 | |||
| 2090 | Ga0587088_170796 | |||
| 2091 | Ga0587089_004824 | |||
| 2092 | Ga0587089_060024 | |||
| 2093 | Ga0587090_000311 | |||
| 2094 | Ga0587090_000846 | |||
| 2095 | Ga0587090_005328 | |||
| 2096 | Ga0587090_005979 | |||
| 2097 | Ga0587090_007195 | |||
| 2098 | Ga0587090_011080 | |||
| 2099 | Ga0587090_054823 | |||
| 2100 | Ga0587091_000744 | |||
| 2101 | Ga0587092_001025 | |||
| 2102 | Ga0587092_118976 | |||
| 2103 | Ga0587094_001057 | |||
| 2104 | Ga0587094_060111 | |||
| 2105 | Ga0587094_095914 | |||
| 2106 | Ga0587095_000418 | |||
| 2107 | Ga0587095_002414 | |||
| 2108 | Ga0587095_009270 | |||
| 2109 | Ga0587095_018578 | |||
| 2110 | Ga0587097_00051 | |||
| 2111 | Ga0587098_000388 | |||
| 2112 | Ga0587106_000996 | |||
| 2113 | Ga0587106_032224 | |||
| 2114 | Ga0587106_128274 | |||
| 2115 | Ga0587125_000024 | |||
| 2116 | Ga0587129_000773 | |||
| 2117 | Ga0587099_000526 | |||
| 2118 | Ga0587099_018533 | |||
| 2119 | Ga0587101_000011 | |||
| 2120 | Ga0587101_003992 | |||
| 2121 | Ga0587101_005295 | |||
| 2122 | Ga0587101_031126 | |||
| 2123 | Ga0587101_124407 | |||
| 2124 | Ga0587109_036847 | |||
| 2125 | Ga0587113_000345 | |||
| 2126 | Ga0587113_006517 | |||
| 2127 | Ga0587115_000112 | |||
| 2128 | Ga0587115_006179 | |||
| 2129 | Ga0587117_001041 | |||
| 2130 | Ga0587117_050704 | |||
| 2131 | Ga0587122_006132 | |||
| 2132 | Ga0587127_001361 | |||
| 2133 | Ga0587128_000332 | |||
| 2134 | Ga0587128_001735 | |||
| 2135 | Ga0587128_023345 | |||
| 2136 | Ga0587128_030255 | |||
| 2137 | Ga0587130_003592 | |||
| 2138 | Ga0587068_010714 | |||
| 2139 | Ga0587068_035242 | |||
| 2140 | Ga0587068_082069 | |||
| 2141 | Ga0587069_004707 | |||
| 2142 | Ga0587069_008799 | |||
| 2143 | Ga0587069_009068 | |||
| 2144 | Ga0587069_116334 | |||
| 2145 | Ga0587072_020829 | |||
| 2146 | Ga0587072_053680 | |||
| 2147 | Ga0587076_026060 | |||
| 2148 | Ga0587076_040920 | |||
| 2149 | Ga0587076_059951 | |||
| 2150 | Ga0587078_047352 | |||
| 2151 | Ga0587078_068160 | |||
| 2152 | Ga0587079_034838 | |||
| 2153 | Ga0587079_044436 | |||
| 2154 | Ga0587079_063695 | |||
| 2155 | Ga0587100_000216 | |||
| 2156 | Ga0587102_000354 | |||
| 2157 | Ga0587102_006949 | |||
| 2158 | Ga0587104_004547 | |||
| 2159 | Ga0587105_005336 | |||
| 2160 | Ga0587107_000716 | |||
| 2161 | Ga0587107_028075 | |||
| 2162 | Ga0587114_111990 | |||
| 2163 | Ga0587116_20676 | |||
| 2164 | Ga0587118_01369 | |||
| 2165 | Ga0587118_14663 | |||
| 2166 | Ga0587119_000543 | |||
| 2167 | Ga0587119_018261 | |||
| 2168 | Ga0587119_072730 | |||
| 2169 | Ga0587120_000682 | |||
| 2170 | Ga0587120_038302 | |||
| 2171 | Ga0587124_000015 | |||
| 2172 | Ga0587096_00565 | |||
| 2173 | Ga0587071_021408 | |||
| 2174 | Ga0587071_041793 | |||
| 2175 | Ga0587071_052040 | |||
| 2176 | Ga0587071_109149 | |||
| 2177 | Ga0587111_0000485 | |||
| 2178 | Ga0587111_0006484 | |||
| 2179 | Ga0587111_0098376 | |||
| 2180 | Ga0501082_0265686 | |||
| 2181 | Ga0466962_0079520 | |||
| 2182 | 2588107945 | |||
| 2183 | 2643732585 | |||
| 2184 | 2643753710 | |||
| 2185 | 2643786349 | |||
| 2186 | 2643847782 | |||
| 2187 | 2643876451 | |||
| 2188 | 2643888094 | |||
| 2189 | 2643994809 | |||
| 2190 | 2644096404 | |||
| 2191 | 2644171385 | |||
| 2192 | 2644197847 | |||
| 2193 | 2644383506 | |||
| 2194 | 2644681049 | |||
| 2195 | 2730230518 | |||
| 2196 | 2747952119 | |||
| 2197 | 2758224805 | |||
| 2198 | 2774378929 | |||
| 2199 | 2774382016 | |||
| 2200 | 2774400775 | |||
| 2201 | 2808628777 | |||
| 2202 | 2808884762 | |||
| 2203 | 2809226244 | |||
| 2204 | 2812322081 | |||
| 2205 | 2821268993 | |||
| 2206 | 2833709883 | |||
| 2207 | 2844843373 | |||
| 2208 | 2844854313 | |||
| 2209 | 2852632503 | |||
| 2210 | 2852644345 | |||
| 2211 | 2852647587 | |||
| 2212 | 2852664079 | |||
| 2213 | 2852678573 | |||
| 2214 | 2857722758 | |||
| 2215 | 2857725837 | |||
| 2216 | 2857730665 | |||
| 2217 | 2857738242 | |||
| 2218 | 2870629388 | |||
| 2219 | 2884766400 | |||
| 2220 | 2895660626 | |||
| 2221 | 2904510391 | |||
| 2222 | 2906801159 | |||
| 2223 | 2908678391 | |||
| 2224 | 2919055351 | |||
| 2225 | 2919070715 | |||
| 2226 | 2919397184 | |||
| 2227 | 2919445545 | |||
| 2228 | 2928093822 | |||
| 2229 | 2928121471 | |||
| 2230 | 2928153510 | |||
| 2231 | 2945968754 | |||
| 2232 | 2946036572 | |||
| 2233 | 2946045195 | |||
| 2234 | 2946084038 | |||
| 2235 | 2966922546 | |||
| 2236 | 2966926522 | |||
| 2237 | 2974294875 | |||
| 2238 | 2974325325 | |||
| 2239 | 2977230287 | |||
| 2240 | 2977239091 | |||
| 2241 | 2977252177 | |||
| 2242 | 2977265505 | |||
| 2243 | 2984543124 | |||
| 2244 | 2984582491 | |||
| 2245 | 2995728353 | |||
| 2246 | 8004184518 | |||
| 2247 | 8004213324 | |||
| 2248 | 8016255130 | |||
| 2249 | 8045832185 | |||
| 2250 | 8055035302 | |||
| 2251 | 8055039009 | |||
| 2252 | 8057347402 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7nhm-assembly1.cif.gz_W | 70s ribosome from staphylococcus aureus | 0.9378 | 14 | 101 |
| 7nhn-assembly1.cif.gz_W | vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes | 0.9369 | 13 | 99 |
| 6ddg-assembly1.cif.gz_F | structure of the 50s ribosomal subunit from methicillin resistant staphylococcus aureus in complex with the oxazolidinone antibiotic lzd-6 | 0.9352 | 15 | 98 |
| 7m4z-assembly1.cif.gz_S | a. baumannii ribosome-eravacycline complex: hpf-bound 70s | 0.9319 | 14 | 98 |
| 8cgd-assembly1.cif.gz_s | clindamycin bound to the 50s subunit | 0.9299 | 13 | 94 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6hmaR00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.9424 | 14 | 101 | 3.30.70.330 |
| af_P61845_1_86_3.30.70.330 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.9346 | 16 | 98 | 3.30.70.330 |
| af_D3ZFK7_36_158_3.30.70.330 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.9254 | 11 | 93 | 3.30.70.330 |
| 6hmaR00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.9223 | 14 | 101 | 3.30.70.330 |
| 5x8tU01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.8976 | 17 | 94 | 3.30.70.330 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A3DJH4-F1-model_v4 | Large ribosomal subunit protein uL23 (50S ribosomal protein L23) | 0.9802 | 12 | 93 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-Q4L8B2-F1-model_v4 | Large ribosomal subunit protein uL23 (50S ribosomal protein L23) | 0.9773 | 12 | 102 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-Q5HDW0-F1-model_v4 | Large ribosomal subunit protein uL23 (50S ribosomal protein L23) | 0.9765 | 12 | 102 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-Q8CRG2-F1-model_v4 | Large ribosomal subunit protein uL23 (50S ribosomal protein L23) | 0.9765 | 12 | 102 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A0L6JNB5-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.9719 | 12 | 94 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |