F490478

General Info

Members Datasets Scaffolds Average Seq Length
1126 515 2252 100

Family's Representative Sequence

Representative Sequence 3300020078|Ga0206352_10173797|Ga0206352_101737971
Length 113
Sequence MSNIAVSTNRTSAATLQINKDPRDIILKPVVSEKSYSLIDEGKYTFLVDPRASKTEIKLAIEKIFGVKVAAVNTINRVGKARRTRFGTGKRKDTKRAIVTLKSGTIDIFTAVG

Samples

Sample ID Description Type Environment
1 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
9 3300003157 Avena fatua rhizosphere microbial communities - H3_Bulk_Litter_17 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003160 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_22 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
19 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
20 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
21 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
22 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
23 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
24 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
25 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
26 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
27 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
28 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
29 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
30 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
46 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
84 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
112 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300023309 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 Metatranscriptome Rhizosphere
119 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
120 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
121 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
122 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
124 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
125 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
126 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
171 3300029276 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.ctcc.R1 Metatranscriptome Rhizosphere
172 3300029277 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 Metatranscriptome Rhizosphere
173 3300029283 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctno.R1 Metatranscriptome Rhizosphere
174 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
175 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
176 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
177 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
178 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
179 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
180 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
181 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
182 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
183 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
184 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
185 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
186 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
187 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
188 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
189 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
190 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
191 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
192 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
193 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
194 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
195 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
196 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
197 3300041442 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaT Metatranscriptome Rhizoplane
198 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
199 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
200 3300041445 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaT Metatranscriptome Rhizoplane
201 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
202 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
203 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
204 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
205 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
206 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
207 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
208 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
209 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
210 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
211 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
212 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
213 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
214 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
215 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
216 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
217 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
218 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
219 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
220 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
221 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
222 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
223 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
224 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
225 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
226 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
227 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
228 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
229 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
230 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
231 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
232 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
233 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
234 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
235 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
236 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
237 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
238 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
239 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
240 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
241 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
242 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
243 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
244 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
245 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
246 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
247 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
248 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
249 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
250 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
251 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
252 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
253 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
254 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
255 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
256 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
257 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
258 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
259 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
260 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
261 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
262 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
263 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
264 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
265 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
266 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
267 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
268 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
269 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
270 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
271 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
272 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
273 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
274 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
275 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
276 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
277 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
278 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
279 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
280 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
281 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
282 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
283 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
284 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
285 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
286 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
287 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
288 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
289 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
290 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
291 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
292 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
293 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
294 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
295 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
296 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
297 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
298 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
299 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
300 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
301 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
302 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
303 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
304 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
305 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
306 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
307 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
325 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
327 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
329 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
330 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
331 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
332 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
337 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
350 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
351 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
352 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
353 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
354 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
355 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
356 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
357 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
358 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
359 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
360 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
361 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
364 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
365 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
366 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
367 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
368 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
369 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
370 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
371 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
372 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
373 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
374 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
375 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
376 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
377 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
378 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
379 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
380 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
381 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
382 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
383 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
384 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
385 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
386 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
387 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
388 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
389 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
390 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
391 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
392 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
393 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
394 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
396 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
398 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
399 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
400 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
402 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
404 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
405 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
406 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
407 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
408 3300059603 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 62R_AD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
409 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
410 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
411 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
412 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
413 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
414 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
415 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
416 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
417 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
418 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
419 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
420 3300059629 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
421 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
422 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
423 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
424 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
425 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
426 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
427 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
428 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
429 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
430 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
431 3300059650 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
432 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
433 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
434 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
435 3300059656 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 153R_AW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
436 3300059657 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
437 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
438 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
439 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
440 3300060247 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 61R_AD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
441 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
442 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
443 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
444 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
445 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
446 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
447 2643221546 Microbacterium sp. Root53 Isolate Unclassified
448 2643221553 Microbacterium sp. Root553 Isolate Unclassified
449 2643221566 Microbacterium sp. Root166 Isolate Unclassified
450 2643221572 Leifsonia sp. Root60 Isolate Unclassified
451 2643221575 Microbacterium sp. Root61 Isolate Unclassified
452 2643221597 Microbacterium sp. Root180 Isolate Unclassified
453 2643221616 Leifsonia sp. Root227 Isolate Unclassified
454 2643221630 Microbacterium sp. Root322 Isolate Unclassified
455 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
456 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
457 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
458 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
459 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
460 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
461 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
462 2773857759 Microbacterium sp. 1294 Isolate Unclassified
463 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
464 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
465 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
466 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
467 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
468 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
469 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
470 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
471 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
472 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
473 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
474 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
475 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
476 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
477 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
478 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
479 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
480 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
481 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
482 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
483 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
484 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
485 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
486 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
487 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
488 2919069694 Microbacterium sp. 1154 Isolate Unclassified
489 2919395869 Microbacterium resistens 2980 Isolate Unclassified
490 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
491 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
492 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
493 2928153084 Leifsonia sp. 563 Isolate Unclassified
494 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
495 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
496 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
497 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
498 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
499 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
500 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
501 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
502 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
503 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
504 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
505 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
506 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
507 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
508 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
509 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
510 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
511 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
512 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
513 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
514 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere
515 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 66.61
Metatranscriptomes 27.09
Isolates 6.31

Biome Distribution

Category Percentage (%)
Aerial Root 0.18
Bulb 0
Endosphere 7.9
Nodule 0
Rhizoplane 6.48
Rhizosphere 72.56
Stem 0
Stem Tuber 0.09
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0206352_10173797 3300020078 Bacteria 1900
2 JGI24740J21852_10000460 3300001979 Bacteria 17440
3 JGI24740J21852_10008552 3300001979 Bacteria 4069
4 JGI24740J21852_10012670 3300001979 Bacteria 3172
5 JGI24740J21852_10050801 3300001979 Bacteria 1190
6 JGI24739J22299_10005224 3300001989 Bacteria 4947
7 JGI24739J22299_10093748 3300001989 Bacteria 912
8 JGI24737J22298_10063151 3300001990 Bacteria 1112
9 JGI24735J21928_10042386 3300002067 Bacteria 1325
10 JGI24735J21928_10064972 3300002067 Bacteria 1047
11 JGI25162J39368_1008761 3300002737 Bacteria 1418
12 JGI25154J39366_1006883 3300002738 Bacteria 1612
13 JGI25164J39214_1000440 3300002772 Bacteria 22554
14 Ga0006774J45829_10761 3300003157 Bacteria 593
15 Ga0006779J45831_102222 3300003160 Bacteria 5110
16 Ga0006778J45830_1023361 3300003162 Bacteria 1084
17 Ga0006778J45830_1037863 3300003162 Bacteria 2270
18 Ga0006759J45824_1032491 3300003163 Bacteria 614
19 JGI25165J46597_1000061 3300003214 Bacteria 208362
20 Ga0006770J48903_1025413 3300003305 Bacteria 621
21 Ga0006777J48905_1024731 3300003308 Bacteria 1087
22 Ga0007417J51691_1036599 3300003544 Bacteria 937
23 Ga0007427J51700_102557 3300003559 Bacteria 6979
24 Ga0006781J51513_1004015 3300003568 Bacteria 4443
25 Ga0007410J51695_1022860 3300003574 Bacteria 1161
26 Ga0007409J51694_1032594 3300003575 Bacteria 689
27 Ga0007416J51690_1023401 3300003577 Bacteria 1339
28 Ga0006562J51391_1024272 3300003578 Bacteria 2938
29 Ga0006562J51391_1024273 3300003578 Bacteria 2580
30 Ga0007429J51699_1022931 3300003579 Bacteria 1165
31 Ga0032354_1037035 3300003693 Bacteria 547
32 Ga0032354_1078778 3300003693 Bacteria 522
33 Ga0006780_1005385 3300003735 Bacteria 6163
34 Ga0006780_1012984 3300003735 Bacteria 929
35 Ga0055542_1016158 3300003762 Bacteria 1182
36 Ga0058858_1046361 3300004785 Bacteria 647
37 Ga0058858_1420510 3300004785 Bacteria 669
38 Ga0058859_11827816 3300004798 Bacteria 513
39 Ga0058860_10000991 3300004801 Bacteria 645
40 Ga0058860_10026029 3300004801 Bacteria 699
41 Ga0058860_12222763 3300004801 Bacteria 535
42 Ga0065714_10155188 3300005288 Bacteria 1083
43 Ga0070658_10009122 3300005327 Bacteria 7974
44 Ga0070658_10220817 3300005327 Bacteria 1603
45 Ga0070658_10542007 3300005327 Bacteria 1007
46 Ga0070670_100851899 3300005331 Bacteria 825
47 Ga0070677_10424709 3300005333 Bacteria 706
48 Ga0068869_100209932 3300005334 Bacteria 1539
49 Ga0068869_100553472 3300005334 Bacteria 967
50 Ga0070682_100038470 3300005337 Bacteria 2934
51 Ga0070682_100116365 3300005337 Bacteria 1788
52 Ga0070682_100705191 3300005337 Bacteria 810
53 Ga0070682_101264025 3300005337 Bacteria 626
54 Ga0068868_100709387 3300005338 Bacteria 901
55 Ga0070660_100057825 3300005339 Bacteria 3005
56 Ga0070660_100400716 3300005339 Bacteria 1134
57 Ga0070661_100351559 3300005344 Bacteria 1156
58 Ga0070692_11119038 3300005345 Bacteria 557
59 Ga0070668_100317440 3300005347 Bacteria 1311
60 Ga0070671_100053010 3300005355 Bacteria 3372
61 Ga0070674_100045759 3300005356 Bacteria 2990
62 Ga0070659_100003025 3300005366 Bacteria 11966
63 Ga0070659_100021971 3300005366 Bacteria 4867
64 Ga0070667_100042795 3300005367 Bacteria 3800
65 Ga0070667_100151748 3300005367 Bacteria 2036
66 Ga0070667_100706796 3300005367 Bacteria 933
67 Ga0070667_101201259 3300005367 Bacteria 710
68 Ga0070714_100511690 3300005435 Bacteria 1146
69 Ga0070714_100600580 3300005435 Bacteria 1057
70 Ga0070714_100974345 3300005435 Bacteria 825
71 Ga0070710_10095608 3300005437 Bacteria 1760
72 Ga0070711_101031561 3300005439 Bacteria 707
73 Ga0070705_101430272 3300005440 Bacteria 577
74 Ga0070663_100016293 3300005455 Bacteria 4823
75 Ga0070663_100829139 3300005455 Bacteria 795
76 Ga0070663_100959306 3300005455 Bacteria 742
77 Ga0070663_101788530 3300005455 Bacteria 551
78 Ga0070663_101938008 3300005455 Bacteria 530
79 Ga0070678_100660439 3300005456 Bacteria 939
80 Ga0070678_102195584 3300005456 Bacteria 524
81 Ga0070685_11138554 3300005466 Bacteria 591
82 Ga0070685_11387074 3300005466 Bacteria 539
83 Ga0070679_100496419 3300005530 Bacteria 1164
84 Ga0070684_100631291 3300005535 Bacteria 997
85 Ga0068853_100068961 3300005539 Bacteria 3075
86 Ga0070672_100066968 3300005543 Bacteria 2844
87 Ga0070672_101003912 3300005543 Bacteria 740
88 Ga0070695_101035290 3300005545 Bacteria 669
89 Ga0070693_100850847 3300005547 Bacteria 680
90 Ga0070665_100083091 3300005548 Bacteria 3208
91 Ga0068855_100047986 3300005563 Bacteria 5042
92 Ga0068855_100261541 3300005563 Bacteria 1927
93 Ga0068855_100427578 3300005563 Bacteria 1448
94 Ga0068855_102444860 3300005563 Bacteria 521
95 Ga0068857_100999643 3300005577 Bacteria 805
96 Ga0070702_101236485 3300005615 Bacteria 604
97 Ga0068852_100120419 3300005616 Bacteria 2401
98 Ga0068852_100417091 3300005616 Bacteria 1323
99 Ga0068859_100456521 3300005617 Bacteria 1374
100 Ga0068864_100318828 3300005618 Bacteria 1459
101 Ga0068861_100790364 3300005719 Bacteria 890
102 Ga0068851_10000022 3300005834 Bacteria 129607
103 Ga0068863_100830072 3300005841 Bacteria 922
104 Ga0068858_100034623 3300005842 Bacteria 4685
105 Ga0068860_100224634 3300005843 Bacteria 1824
106 Ga0068862_101693087 3300005844 Bacteria 641
107 Ga0075365_10012248 3300006038 Bacteria 5084
108 Ga0075365_10020292 3300006038 Bacteria 4118
109 Ga0075365_10113563 3300006038 Bacteria 1863
110 Ga0075365_10207236 3300006038 Bacteria 1374
111 Ga0075365_10476055 3300006038 Bacteria 882
112 Ga0075365_11037567 3300006038 Bacteria 578
113 Ga0075365_11326162 3300006038 Bacteria 506
114 Ga0075368_10014257 3300006042 Bacteria 2933
115 Ga0075368_10110645 3300006042 Bacteria 1132
116 Ga0075363_100132063 3300006048 Bacteria 1401
117 Ga0075363_100994458 3300006048 Bacteria 517
118 Ga0075364_10084726 3300006051 Bacteria 2098
119 Ga0075364_10243007 3300006051 Bacteria 1223
120 Ga0075364_10260286 3300006051 Bacteria 1179
121 Ga0075364_10351716 3300006051 Bacteria 1004
122 Ga0075364_10544300 3300006051 Bacteria 794
123 Ga0075364_10819133 3300006051 Bacteria 634
124 Ga0075432_10179913 3300006058 Bacteria 827
125 Ga0070716_101339101 3300006173 Bacteria 580
126 Ga0075367_10020722 3300006178 Bacteria 3666
127 Ga0075367_10298664 3300006178 Bacteria 1013
128 Ga0075367_10306712 3300006178 Bacteria 1000
129 Ga0075369_10008212 3300006186 Bacteria 4009
130 Ga0075369_10047871 3300006186 Bacteria 1844
131 Ga0075369_10119131 3300006186 Bacteria 1194
132 Ga0075369_10437265 3300006186 Bacteria 619
133 Ga0097621_101150850 3300006237 Bacteria 730
134 Ga0097621_101562109 3300006237 Bacteria 627
135 Ga0075370_10043477 3300006353 Bacteria 2539
136 Ga0075370_10231423 3300006353 Bacteria 1094
137 Ga0068871_100843645 3300006358 Bacteria 847
138 Ga0097620_100456490 3300006931 Bacteria 1374
139 Ga0105251_10056462 3300009011 Bacteria 1858
140 Ga0105244_10004765 3300009036 Bacteria 9234
141 Ga0105244_10096109 3300009036 Bacteria 1453
142 Ga0105245_10212872 3300009098 Bacteria 1861
143 Ga0105245_13198088 3300009098 Bacteria 508
144 Ga0105247_10296667 3300009101 Bacteria 1120
145 Ga0105247_11114506 3300009101 Bacteria 623
146 Ga0105243_10671170 3300009148 Bacteria 1007
147 Ga0105243_12512123 3300009148 Bacteria 554
148 Ga0105243_13023197 3300009148 Bacteria 510
149 Ga0105242_12699972 3300009176 Bacteria 546
150 Ga0105248_10266117 3300009177 Bacteria 1930
151 Ga0105248_10780203 3300009177 Bacteria 1078
152 Ga0105237_10542431 3300009545 Bacteria 1170
153 Ga0105237_10717429 3300009545 Bacteria 1006
154 Ga0105237_10804485 3300009545 Bacteria 947
155 Ga0105237_11204814 3300009545 Bacteria 764
156 Ga0105238_10027288 3300009551 Bacteria 5817
157 Ga0105238_10214305 3300009551 Bacteria 1902
158 Ga0105238_10347193 3300009551 Bacteria 1473
159 Ga0105249_11467249 3300009553 Bacteria 754
160 Ga0105239_10378900 3300010375 Bacteria 1599
161 Ga0105239_10421283 3300010375 Bacteria 1512
162 Ga0105239_12866857 3300010375 Bacteria 563
163 Ga0105246_10750250 3300011119 Bacteria 861
164 Ga0105246_11019891 3300011119 Bacteria 750
165 Ga0105246_11449826 3300011119 Bacteria 643
166 Ga0157373_10522192 3300013100 Bacteria 859
167 Ga0157371_10013796 3300013102 Bacteria 6121
168 Ga0157371_10174660 3300013102 Bacteria 1536
169 Ga0157371_11065031 3300013102 Bacteria 619
170 Ga0157370_10010513 3300013104 Bacteria 9746
171 Ga0157370_10443917 3300013104 Bacteria 1193
172 Ga0157370_10765040 3300013104 Bacteria 880
173 Ga0157370_11133628 3300013104 Bacteria 706
174 Ga0157369_10041722 3300013105 Bacteria 5008
175 Ga0157369_10059481 3300013105 Bacteria 4120
176 Ga0157369_10465961 3300013105 Bacteria 1308
177 Ga0157369_10740957 3300013105 Bacteria 1011
178 Ga0157369_11196541 3300013105 Bacteria 776
179 Ga0171462_1001 3300013250 Bacteria 1135406
180 Ga0157374_10789598 3300013296 Bacteria 965
181 Ga0157374_10950176 3300013296 Bacteria 878
182 Ga0157374_11320556 3300013296 Bacteria 743
183 Ga0157374_11906802 3300013296 Bacteria 620
184 Ga0157374_12265189 3300013296 Bacteria 570
185 Ga0163162_10177320 3300013306 Bacteria 2257
186 Ga0163162_10303139 3300013306 Bacteria 1730
187 Ga0163162_10620717 3300013306 Bacteria 1206
188 Ga0163162_10668866 3300013306 Bacteria 1161
189 Ga0163162_11851247 3300013306 Bacteria 690
190 Ga0157372_10232148 3300013307 Bacteria 2139
191 Ga0157372_10438593 3300013307 Bacteria 1522
192 Ga0157372_10845425 3300013307 Bacteria 1062
193 Ga0157372_11689194 3300013307 Bacteria 729
194 Ga0157372_12253699 3300013307 Bacteria 626
195 Ga0157375_10596593 3300013308 Bacteria 1264
196 Ga0157375_10925170 3300013308 Bacteria 1015
197 Ga0157375_11150802 3300013308 Bacteria 909
198 Ga0163163_11577474 3300014325 Bacteria 717
199 Ga0157380_10453219 3300014326 Bacteria 1233
200 Ga0157380_11040347 3300014326 Bacteria 854
201 Ga0157379_10053997 3300014968 Bacteria 3590
202 Ga0157379_11354817 3300014968 Bacteria 688
203 Ga0157376_10560361 3300014969 Bacteria 1132
204 Ga0163161_10157815 3300017792 Bacteria 1728
205 Ga0197907_10361036 3300020069 Bacteria 706
206 Ga0197907_10498511 3300020069 Bacteria 1399
207 Ga0197907_11223662 3300020069 Bacteria 1196
208 Ga0197907_11245501 3300020069 Bacteria 1210
209 Ga0206349_1034221 3300020075 Bacteria 2022
210 Ga0206349_1250205 3300020075 Bacteria 1104
211 Ga0206349_1521915 3300020075 Bacteria 2815
212 Ga0206349_1604768 3300020075 Bacteria 966
213 Ga0206349_1707418 3300020075 Bacteria 844
214 Ga0206349_1849192 3300020075 Bacteria 734
215 Ga0206355_1041932 3300020076 Bacteria 1057
216 Ga0206355_1129944 3300020076 Bacteria 581
217 Ga0206355_1137396 3300020076 Bacteria 2655
218 Ga0206355_1277111 3300020076 Bacteria 651
219 Ga0206355_1324827 3300020076 Bacteria 920
220 Ga0206355_1605190 3300020076 Bacteria 995
221 Ga0206355_1669966 3300020076 Bacteria 918
222 Ga0206351_10185023 3300020077 Bacteria 1382
223 Ga0206351_10564340 3300020077 Bacteria 919
224 Ga0206351_10632664 3300020077 Bacteria 592
225 Ga0206351_10843496 3300020077 Bacteria 594
226 Ga0206352_10172050 3300020078 Bacteria 897
227 Ga0206352_10209131 3300020078 Bacteria 1340
228 Ga0206352_10305699 3300020078 Bacteria 4238
229 Ga0206352_10498154 3300020078 Bacteria 729
230 Ga0206352_11013222 3300020078 Bacteria 1084
231 Ga0206352_11153687 3300020078 Bacteria 1615
232 Ga0206350_11401627 3300020080 Bacteria 3011
233 Ga0206350_11436187 3300020080 Bacteria 649
234 Ga0206354_10084611 3300020081 Bacteria 1354
235 Ga0206354_11464084 3300020081 Bacteria 784
236 Ga0206354_11671741 3300020081 Bacteria 1532
237 Ga0206353_10160049 3300020082 Bacteria 596
238 Ga0206353_10463612 3300020082 Bacteria 694
239 Ga0206353_11638567 3300020082 Bacteria 659
240 Ga0154015_1476573 3300020610 Bacteria 1038
241 Ga0224712_10083078 3300022467 Bacteria 1326
242 Ga0224712_10153416 3300022467 Bacteria 1022
243 Ga0256744_142576 3300023309 Bacteria 948
244 Ga0207427_100042 3300025231 Bacteria 254170
245 Ga0209437_100510 3300025233 Bacteria 27572
246 Ga0209646_1000013 3300025246 Bacteria 565830
247 Ga0209646_1000014 3300025246 Bacteria 550484
248 Ga0209148_1002314 3300025254 Bacteria 6797
249 Ga0209129_1016695 3300025258 Bacteria 1464
250 Ga0209233_1000001 3300025261 Bacteria 2992747
251 Ga0209130_1039307 3300025284 Bacteria 922
252 Ga0209676_1023744 3300025292 Bacteria 2001
253 Ga0207656_10000005 3300025321 Bacteria 490514
254 Ga0207655_1000386 3300025728 Bacteria 61740
255 Ga0207655_1134228 3300025728 Bacteria 802
256 Ga0207682_10145213 3300025893 Bacteria 1067
257 Ga0207692_10352603 3300025898 Bacteria 907
258 Ga0207710_10758950 3300025900 Bacteria 510
259 Ga0207710_10775627 3300025900 Bacteria 504
260 Ga0207647_10035337 3300025904 Bacteria 3185
261 Ga0207647_10070828 3300025904 Bacteria 2105
262 Ga0207647_10115621 3300025904 Bacteria 1584
263 Ga0207685_10857587 3300025905 Bacteria 503
264 Ga0207643_10091417 3300025908 Bacteria 1775
265 Ga0207705_10000001 3300025909 Bacteria 2061880
266 Ga0207705_10192945 3300025909 Bacteria 1541
267 Ga0207705_10257753 3300025909 Bacteria 1331
268 Ga0207654_10000001 3300025911 Bacteria 1816198
269 Ga0207695_10277353 3300025913 Bacteria 1571
270 Ga0207671_10000016 3300025914 Bacteria 435413
271 Ga0207671_10082507 3300025914 Bacteria 2412
272 Ga0207671_10901436 3300025914 Bacteria 699
273 Ga0207671_11568720 3300025914 Bacteria 507
274 Ga0207657_10005997 3300025919 Bacteria 12644
275 Ga0207657_10372004 3300025919 Bacteria 1126
276 Ga0207649_10165081 3300025920 Bacteria 1537
277 Ga0207646_11316455 3300025922 Bacteria 630
278 Ga0207694_10000057 3300025924 Bacteria 146441
279 Ga0207650_10347892 3300025925 Bacteria 1219
280 Ga0207659_11124255 3300025926 Bacteria 676
281 Ga0207687_10091182 3300025927 Bacteria 2222
282 Ga0207664_10347094 3300025929 Bacteria 1313
283 Ga0207664_10844209 3300025929 Bacteria 823
284 Ga0207644_10132279 3300025931 Bacteria 1911
285 Ga0207690_10003803 3300025932 Bacteria 8937
286 Ga0207690_11430486 3300025932 Bacteria 578
287 Ga0207690_11861409 3300025932 Bacteria 502
288 Ga0207709_10233903 3300025935 Bacteria 1332
289 Ga0207709_10315467 3300025935 Bacteria 1168
290 Ga0207665_10571300 3300025939 Bacteria 880
291 Ga0207665_10584751 3300025939 Bacteria 870
292 Ga0207691_10126653 3300025940 Bacteria 2259
293 Ga0207711_10022131 3300025941 Bacteria 5314
294 Ga0207711_10469680 3300025941 Bacteria 1171
295 Ga0207689_10351692 3300025942 Bacteria 1225
296 Ga0207661_11318852 3300025944 Bacteria 663
297 Ga0207667_10021165 3300025949 Bacteria 7212
298 Ga0207667_10069574 3300025949 Bacteria 3663
299 Ga0207667_10303822 3300025949 Bacteria 1630
300 Ga0207667_11310732 3300025949 Bacteria 700
301 Ga0207667_11695718 3300025949 Bacteria 598
302 Ga0207667_11939989 3300025949 Bacteria 550
303 Ga0207712_11576636 3300025961 Bacteria 588
304 Ga0207668_10525059 3300025972 Bacteria 1022
305 Ga0207668_10584374 3300025972 Bacteria 971
306 Ga0207640_10304432 3300025981 Bacteria 1262
307 Ga0207658_10014016 3300025986 Bacteria 5487
308 Ga0207658_11137653 3300025986 Bacteria 713
309 Ga0207658_11424409 3300025986 Bacteria 634
310 Ga0207658_11592194 3300025986 Bacteria 597
311 Ga0207658_11943280 3300025986 Bacteria 536
312 Ga0207703_10001453 3300026035 Bacteria 21613
313 Ga0207639_10056116 3300026041 Bacteria 3018
314 Ga0207639_11316923 3300026041 Bacteria 678
315 Ga0207678_10027691 3300026067 Bacteria 4947
316 Ga0207678_10329291 3300026067 Bacteria 1315
317 Ga0207678_10387201 3300026067 Bacteria 1209
318 Ga0207708_10290684 3300026075 Bacteria 1327
319 Ga0207702_10029018 3300026078 Bacteria 4601
320 Ga0207702_10208314 3300026078 Bacteria 1816
321 Ga0207683_10168192 3300026121 Bacteria 1985
322 Ga0207698_10139001 3300026142 Bacteria 2089
323 Ga0207698_10304750 3300026142 Bacteria 1485
324 Ga0207698_10339745 3300026142 Bacteria 1414
325 Ga0209813_10207646 3300027866 Bacteria 728
326 Ga0209813_10301414 3300027866 Bacteria 622
327 Ga0268266_10393555 3300028379 Bacteria 1309
328 Ga0268265_10135334 3300028380 Bacteria 2055
329 Ga0307517_10268976 3300028786 Bacteria 982
330 Ga0311004_143717 3300029276 Bacteria 573
331 Ga0311001_1007990 3300029277 Bacteria 685
332 Ga0310982_140508 3300029283 Bacteria 538
333 Ga0310981_1006206 3300029285 Bacteria 664
334 Ga0307513_10282932 3300031456 Bacteria 1435
335 Ga0307513_10547263 3300031456 Bacteria 870
336 Ga0307408_100631993 3300031548 Bacteria 955
337 Ga0307408_100725948 3300031548 Bacteria 895
338 Ga0307408_101247540 3300031548 Bacteria 695
339 Ga0307514_10304681 3300031649 Bacteria 889
340 Ga0307405_10646754 3300031731 Bacteria 869
341 Ga0307405_10686116 3300031731 Bacteria 846
342 Ga0307405_10689973 3300031731 Bacteria 844
343 Ga0307405_10696163 3300031731 Bacteria 841
344 Ga0307405_11098457 3300031731 Bacteria 683
345 Ga0307413_10728988 3300031824 Bacteria 826
346 Ga0307413_11255066 3300031824 Bacteria 646
347 Ga0307413_11802838 3300031824 Bacteria 548
348 Ga0307410_10735200 3300031852 Bacteria 834
349 Ga0307406_10000938 3300031901 Bacteria 16294
350 Ga0307406_10074938 3300031901 Bacteria 2230
351 Ga0307406_10300233 3300031901 Bacteria 1233
352 Ga0307406_10444568 3300031901 Bacteria 1038
353 Ga0307406_10607517 3300031901 Bacteria 902
354 Ga0307406_10834118 3300031901 Bacteria 780
355 Ga0307406_11120531 3300031901 Bacteria 680
356 Ga0307407_10192660 3300031903 Bacteria 1360
357 Ga0307407_10362949 3300031903 Bacteria 1029
358 Ga0307407_10919056 3300031903 Bacteria 672
359 Ga0307412_10038041 3300031911 Bacteria 3095
360 Ga0307412_10708588 3300031911 Bacteria 865
361 Ga0307412_11305184 3300031911 Bacteria 653
362 Ga0307412_12078050 3300031911 Bacteria 527
363 Ga0307412_12177422 3300031911 Bacteria 516
364 Ga0307409_100257187 3300031995 Bacteria 1600
365 Ga0307409_100287294 3300031995 Bacteria 1523
366 Ga0307409_100447884 3300031995 Bacteria 1245
367 Ga0307409_100688508 3300031995 Bacteria 1020
368 Ga0307409_101079594 3300031995 Bacteria 823
369 Ga0307409_101112435 3300031995 Bacteria 811
370 Ga0307416_100528221 3300032002 Bacteria 1249
371 Ga0307416_101566001 3300032002 Bacteria 764
372 Ga0307416_101643799 3300032002 Bacteria 747
373 Ga0307416_102199011 3300032002 Bacteria 653
374 Ga0307416_102363314 3300032002 Bacteria 631
375 Ga0307414_10503976 3300032004 Bacteria 1071
376 Ga0307411_10299553 3300032005 Bacteria 1289
377 Ga0307411_11041070 3300032005 Bacteria 735
378 Ga0307415_100008614 3300032126 Bacteria 5665
379 Ga0307415_100925132 3300032126 Bacteria 805
380 Ga0307415_100939453 3300032126 Bacteria 800
381 Ga0307415_101697904 3300032126 Bacteria 609
382 Ga0395900_0642566 3300037418 Bacteria 998
383 Ga0395900_0700140 3300037418 Bacteria 947
384 Ga0395900_0829724 3300037418 Bacteria 851
385 Ga0395900_1792186 3300037418 Bacteria 524
386 Ga0395898_0019914 3300037466 Bacteria 6823
387 Ga0395898_0105586 3300037466 Bacteria 2701
388 Ga0395898_0167204 3300037466 Bacteria 2103
389 Ga0395901_0051416 3300038443 Bacteria 4284
390 Ga0395901_0141720 3300038443 Bacteria 2526
391 Ga0439436_0090588 3300041404 Bacteria 852
392 Ga0439439_0067856 3300041406 Bacteria 953
393 Ga0439466_0188528 3300041411 Bacteria 628
394 Ga0439465_0045859 3300041413 Bacteria 1422
395 Ga0439465_0117232 3300041413 Bacteria 931
396 Ga0439465_0136287 3300041413 Bacteria 869
397 Ga0451787_006059 3300041441 Bacteria 651
398 Ga0451787_198347 3300041441 Bacteria 740
399 Ga0451787_494371 3300041441 Bacteria 665
400 Ga0451787_698953 3300041441 Bacteria 555
401 Ga0451788_06186 3300041442 Bacteria 803
402 Ga0451789_1026005 3300041443 Bacteria 879
403 Ga0451790_16529 3300041444 Bacteria 1384
404 Ga0451792_08540 3300041445 Bacteria 541
405 Ga0451794_15320 3300041446 Bacteria 801
406 Ga0451794_50422 3300041446 Bacteria 1199
407 Ga0451791_0192690 3300041451 Bacteria 1357
408 Ga0451791_0375613 3300041451 Bacteria 709
409 Ga0451791_1451577 3300041451 Bacteria 1343
410 Ga0451793_1220708 3300041452 Bacteria 1350
411 Ga0451797_0304931 3300041453 Bacteria 546
412 Ga0451797_0960236 3300041453 Bacteria 828
413 Ga0451795_0615518 3300041456 Bacteria 732
414 Ga0451795_0717574 3300041456 Bacteria 602
415 Ga0451795_1155111 3300041456 Bacteria 539
416 Ga0451802_0607156 3300041460 Bacteria 889
417 Ga0451802_1045637 3300041460 Bacteria 567
418 Ga0451805_067564 3300041461 Bacteria 630
419 Ga0451805_083680 3300041461 Bacteria 577
420 Ga0451806_370333 3300041462 Bacteria 624
421 Ga0451804_0004070 3300041463 Bacteria 513
422 Ga0451807_0180144 3300041486 Bacteria 652
423 Ga0451807_1534873 3300041486 Bacteria 736
424 Ga0451807_1605592 3300041486 Bacteria 614
425 Ga0451835_0538675 3300041492 Bacteria 585
426 Ga0451837_0302867 3300041494 Bacteria 1459
427 Ga0451837_1713824 3300041494 Bacteria 609
428 Ga0451841_0622253 3300041498 Bacteria 757
429 Ga0451841_0717519 3300041498 Bacteria 984
430 Ga0451847_0492307 3300041503 Bacteria 716
431 Ga0451843_0686131 3300041509 Bacteria 1207
432 Ga0451853_0693091 3300041512 Bacteria 864
433 Ga0451853_2006119 3300041512 Bacteria 912
434 Ga0451853_3216936 3300041512 Bacteria 1047
435 Ga0439431_0106876 3300041997 Bacteria 773
436 Ga0439433_0036605 3300041999 Bacteria 1134
437 Ga0439449_0338324 3300042007 Bacteria 569
438 Ga0439462_0035379 3300042015 Bacteria 1328
439 Ga0450920_012421 3300042122 Bacteria 1598
440 Ga0450922_041426 3300042124 Bacteria 522
441 Ga0450923_096439 3300042125 Bacteria 679
442 Ga0450905_038500 3300042142 Bacteria 755
443 Ga0450906_047563 3300042145 Bacteria 757
444 Ga0450909_007757 3300042185 Bacteria 1555
445 Ga0439434_0172163 3300042435 Bacteria 723
446 Ga0439459_0192832 3300042438 Bacteria 553
447 Ga0466969_0049679 3300044656 Bacteria 2069
448 Ga0466969_0166999 3300044656 Bacteria 1010
449 Ga0466972_0028315 3300044658 Bacteria 2764
450 Ga0466972_0072420 3300044658 Bacteria 1643
451 Ga0466972_0221483 3300044658 Bacteria 885
452 Ga0466972_0375215 3300044658 Bacteria 666
453 Ga0466965_0000003 3300044683 Bacteria 265985
454 Ga0466965_0053028 3300044683 Bacteria 2015
455 Ga0466965_0072804 3300044683 Bacteria 1729
456 Ga0466965_0261460 3300044683 Bacteria 930
457 Ga0466965_0371437 3300044683 Bacteria 786
458 Ga0466966_0023287 3300044684 Bacteria 4056
459 Ga0466966_0251933 3300044684 Bacteria 1063
460 Ga0466966_0262503 3300044684 Bacteria 1040
461 Ga0466961_0005839 3300044693 Bacteria 7798
462 Ga0466961_0057729 3300044693 Bacteria 2470
463 Ga0466961_0103620 3300044693 Bacteria 1791
464 Ga0466961_0149441 3300044693 Bacteria 1459
465 Ga0466961_0239574 3300044693 Bacteria 1115
466 Ga0466961_0423278 3300044693 Bacteria 807
467 Ga0466963_0541606 3300044694 Bacteria 822
468 Ga0466963_0590903 3300044694 Bacteria 784
469 Ga0466964_0032622 3300044706 Bacteria 2070
470 Ga0466964_0531943 3300044706 Bacteria 636
471 Ga0466971_0033256 3300044719 Bacteria 2311
472 Ga0466971_0179354 3300044719 Bacteria 995
473 Ga0466971_0424543 3300044719 Bacteria 650
474 Ga0466968_0172687 3300044735 Bacteria 1002
475 Ga0466968_0210904 3300044735 Bacteria 912
476 Ga0466970_0000027 3300044765 Bacteria 56103
477 Ga0466970_0036988 3300044765 Bacteria 2586
478 Ga0466970_0113359 3300044765 Bacteria 1481
479 Ga0466970_0121472 3300044765 Bacteria 1431
480 Ga0466970_0234301 3300044765 Bacteria 1026
481 Ga0466970_0511148 3300044765 Bacteria 692
482 Ga0466970_0566948 3300044765 Bacteria 657
483 Ga0466957_0051721 3300044842 Bacteria 2500
484 Ga0466957_0654141 3300044842 Bacteria 739
485 Ga0466957_0851449 3300044842 Bacteria 650
486 Ga0466960_0019431 3300044901 Bacteria 2994
487 Ga0466960_0031018 3300044901 Bacteria 2463
488 Ga0466960_0223077 3300044901 Bacteria 1038
489 Ga0466960_0455257 3300044901 Bacteria 744
490 Ga0466959_0352321 3300045049 Bacteria 1003
491 Ga0466959_0712361 3300045049 Bacteria 672
492 Ga0466958_0023373 3300045836 Bacteria 3628
493 Ga0466958_0089102 3300045836 Bacteria 1907
494 Ga0466958_0328554 3300045836 Bacteria 983
495 Ga0466958_0621732 3300045836 Bacteria 703
496 Ga0466967_0202852 3300045976 Bacteria 1879
497 Ga0466967_0967154 3300045976 Bacteria 847
498 Ga0495627_001687 3300046453 Bacteria 12164
499 Ga0495592_0692055 3300046454 Bacteria 614
500 Ga0495590_0000902 3300046457 Bacteria 13285
501 Ga0495591_111967 3300046458 Bacteria 670
502 Ga0495639_0105309 3300046475 Bacteria 1335
503 Ga0495596_0098554 3300046500 Bacteria 1135
504 Ga0495583_0116370 3300046506 Bacteria 1129
505 Ga0495610_0152610 3300046512 Bacteria 984
506 Ga0495610_0373205 3300046512 Bacteria 532
507 Ga0495620_0046421 3300046515 Bacteria 1875
508 Ga0495620_0114915 3300046515 Bacteria 1064
509 Ga0495631_0015142 3300046518 Bacteria 3704
510 Ga0495632_0334238 3300046519 Bacteria 668
511 Ga0495632_0364624 3300046519 Bacteria 634
512 Ga0495643_0268651 3300046522 Bacteria 789
513 Ga0495663_0258418 3300046525 Bacteria 620
514 Ga0495654_0118549 3300046530 Bacteria 1200
515 Ga0495598_0088631 3300046537 Bacteria 1005
516 Ga0495609_0069765 3300046538 Bacteria 1545
517 Ga0495621_0124588 3300046539 Bacteria 998
518 Ga0495645_0076192 3300046543 Bacteria 2414
519 Ga0495633_0057220 3300046558 Bacteria 1832
520 Ga0495633_0271671 3300046558 Bacteria 772
521 Ga0495656_0029433 3300046615 Bacteria 2211
522 Ga0495656_0175132 3300046615 Bacteria 1051
523 Ga0495668_0793284 3300046616 Bacteria 524
524 Ga0495646_0293386 3300046680 Bacteria 862
525 Ga0495658_1021239 3300046683 Bacteria 528
526 Ga0495624_0799313 3300046690 Bacteria 558
527 Ga0495670_0631421 3300046691 Bacteria 584
528 Ga0495671_0086028 3300046692 Bacteria 1540
529 Ga0495649_0062055 3300046694 Bacteria 2009
530 Ga0495660_0176997 3300046810 Bacteria 1035
531 Ga0495636_0124496 3300047318 Bacteria 1143
532 Ga0495672_0011493 3300047320 Bacteria 6245
533 Ga0495672_0084128 3300047320 Bacteria 1765
534 Ga0495672_0105416 3300047320 Bacteria 1521
535 Ga0495676_0855972 3300047321 Bacteria 584
536 Ga0495673_0286143 3300047469 Bacteria 594
537 Ga0495673_0286889 3300047469 Bacteria 593
538 Ga0495681_0059308 3300047470 Bacteria 1770
539 Ga0495686_0028366 3300047472 Bacteria 3646
540 Ga0495686_0050944 3300047472 Bacteria 2600
541 Ga0495686_0386462 3300047472 Bacteria 754
542 Ga0495615_0036135 3300048090 Bacteria 1210
543 Ga0495615_0190979 3300048090 Bacteria 628
544 Ga0495615_0229528 3300048090 Bacteria 582
545 Ga0495626_0010797 3300048091 Bacteria 4853
546 Ga0496100_0011682 3300048903 Bacteria 5004
547 Ga0496100_0088880 3300048903 Bacteria 2103
548 Ga0496101_0002898 3300048904 Bacteria 10559
549 Ga0496101_0008133 3300048904 Bacteria 6844
550 Ga0496102_0089571 3300048905 Bacteria 2847
551 Ga0496102_0280181 3300048905 Bacteria 1572
552 Ga0496103_0010181 3300048906 Bacteria 5560
553 Ga0496103_0033058 3300048906 Bacteria 3159
554 Ga0496103_0794279 3300048906 Bacteria 597
555 Ga0496104_0003769 3300048907 Bacteria 13107
556 Ga0496104_0015491 3300048907 Bacteria 6903
557 Ga0496104_0052939 3300048907 Bacteria 3834
558 Ga0496104_0812440 3300048907 Bacteria 841
559 Ga0496105_0005038 3300048908 Bacteria 10001
560 Ga0496105_0009192 3300048908 Bacteria 7715
561 Ga0496105_0150981 3300048908 Bacteria 1909
562 Ga0496105_0224039 3300048908 Bacteria 1530
563 Ga0496105_0447361 3300048908 Bacteria 1020
564 Ga0496105_0994965 3300048908 Bacteria 627
565 Ga0496105_1405630 3300048908 Bacteria 505
566 Ga0496106_0530388 3300048909 Bacteria 945
567 Ga0496107_0001328 3300048910 Bacteria 15168
568 Ga0496107_0939130 3300048910 Bacteria 629
569 Ga0496108_0047565 3300048911 Bacteria 3586
570 Ga0496108_0052644 3300048911 Bacteria 3412
571 Ga0496109_0042506 3300048912 Bacteria 4117
572 Ga0496109_0080472 3300048912 Bacteria 3001
573 Ga0496110_0029641 3300048913 Bacteria 4712
574 Ga0496110_0950228 3300048913 Bacteria 766
575 Ga0496111_0012648 3300048914 Bacteria 5719
576 Ga0496111_0269126 3300048914 Bacteria 1264
577 Ga0496111_0543024 3300048914 Bacteria 854
578 Ga0496111_0716449 3300048914 Bacteria 727
579 Ga0496111_1181849 3300048914 Bacteria 543
580 Ga0496112_0231900 3300048915 Bacteria 1800
581 Ga0496112_1478820 3300048915 Bacteria 593
582 Ga0496113_0005620 3300048916 Bacteria 7845
583 Ga0496113_0323369 3300048916 Bacteria 1236
584 Ga0496113_0809195 3300048916 Bacteria 744
585 Ga0496114_0044687 3300048917 Bacteria 3676
586 Ga0496114_0085888 3300048917 Bacteria 2665
587 Ga0496114_0118841 3300048917 Bacteria 2271
588 Ga0496114_0396836 3300048917 Bacteria 1222
589 Ga0496115_0002702 3300048918 Bacteria 12733
590 Ga0496115_0058315 3300048918 Bacteria 3106
591 Ga0496116_0021611 3300048919 Bacteria 4845
592 Ga0496116_0095573 3300048919 Bacteria 1793
593 Ga0496116_0384463 3300048919 Bacteria 628
594 Ga0496117_0000362 3300048920 Bacteria 79224
595 Ga0496117_0004032 3300048920 Bacteria 16539
596 Ga0496117_0006530 3300048920 Bacteria 11750
597 Ga0496117_0008690 3300048920 Bacteria 9601
598 Ga0496117_0009885 3300048920 Bacteria 8783
599 Ga0496117_0010175 3300048920 Bacteria 8627
600 Ga0496117_0018116 3300048920 Bacteria 5854
601 Ga0496117_0111258 3300048920 Bacteria 1705
602 Ga0496118_0043816 3300048921 Bacteria 3512
603 Ga0496118_0049600 3300048921 Bacteria 3231
604 Ga0496118_0081814 3300048921 Bacteria 2265
605 Ga0496118_0103297 3300048921 Bacteria 1917
606 Ga0496118_0106746 3300048921 Bacteria 1872
607 Ga0496118_0195117 3300048921 Bacteria 1206
608 Ga0496118_0427522 3300048921 Bacteria 679
609 Ga0496119_0000720 3300048922 Bacteria 44520
610 Ga0496119_0006250 3300048922 Bacteria 11123
611 Ga0496119_0046717 3300048922 Bacteria 2700
612 Ga0496119_0061767 3300048922 Bacteria 2235
613 Ga0496119_0061774 3300048922 Bacteria 2235
614 Ga0496119_0096444 3300048922 Bacteria 1668
615 Ga0496119_0120060 3300048922 Bacteria 1446
616 Ga0496119_0207019 3300048922 Bacteria 1011
617 Ga0496119_0236420 3300048922 Bacteria 927
618 Ga0496119_0458713 3300048922 Bacteria 599
619 Ga0496119_0492731 3300048922 Bacteria 571
620 Ga0496120_0007276 3300048923 Bacteria 8270
621 Ga0496120_0013513 3300048923 Bacteria 5495
622 Ga0496120_0027437 3300048923 Bacteria 3502
623 Ga0496120_0038694 3300048923 Bacteria 2820
624 Ga0496120_0052424 3300048923 Bacteria 2324
625 Ga0496120_0130693 3300048923 Bacteria 1286
626 Ga0496120_0140755 3300048923 Bacteria 1225
627 Ga0496120_0174191 3300048923 Bacteria 1062
628 Ga0496120_0185392 3300048923 Bacteria 1018
629 Ga0496120_0342639 3300048923 Bacteria 673
630 Ga0496121_0278670 3300048924 Bacteria 1145
631 Ga0496122_0000022 3300048925 Bacteria 388704
632 Ga0496122_0000799 3300048925 Bacteria 60347
633 Ga0496122_0005147 3300048925 Bacteria 15769
634 Ga0496122_0010341 3300048925 Bacteria 9645
635 Ga0496122_0012595 3300048925 Bacteria 8394
636 Ga0496122_0026775 3300048925 Bacteria 4956
637 Ga0496122_0232491 3300048925 Bacteria 1047
638 Ga0496122_0398172 3300048925 Bacteria 700
639 Ga0496123_0000009 3300048926 Bacteria 509486
640 Ga0496123_0000016 3300048926 Bacteria 424330
641 Ga0496123_0019848 3300048926 Bacteria 5277
642 Ga0496123_0020865 3300048926 Bacteria 5109
643 Ga0496123_0068714 3300048926 Bacteria 2229
644 Ga0496123_0080336 3300048926 Bacteria 1988
645 Ga0496123_0084999 3300048926 Bacteria 1905
646 Ga0496123_0117289 3300048926 Bacteria 1506
647 Ga0496123_0120729 3300048926 Bacteria 1475
648 Ga0496123_0169347 3300048926 Bacteria 1154
649 Ga0496124_0002766 3300048927 Bacteria 22302
650 Ga0496124_0046380 3300048927 Bacteria 3721
651 Ga0496124_0059852 3300048927 Bacteria 3197
652 Ga0496124_0086176 3300048927 Bacteria 2571
653 Ga0496124_0206335 3300048927 Bacteria 1490
654 Ga0496125_0001491 3300048928 Bacteria 33565
655 Ga0496125_0002578 3300048928 Bacteria 23316
656 Ga0496125_0007012 3300048928 Bacteria 12054
657 Ga0496125_0016052 3300048928 Bacteria 7209
658 Ga0496125_0109413 3300048928 Bacteria 2006
659 Ga0496125_0133224 3300048928 Bacteria 1744
660 Ga0496125_0376185 3300048928 Bacteria 839
661 Ga0496125_0570307 3300048928 Bacteria 623
662 Ga0496126_0002077 3300048929 Bacteria 28059
663 Ga0496126_0002563 3300048929 Bacteria 24311
664 Ga0496126_0011686 3300048929 Bacteria 9055
665 Ga0496126_0019423 3300048929 Bacteria 6691
666 Ga0496126_0029883 3300048929 Bacteria 5173
667 Ga0496126_0052594 3300048929 Bacteria 3700
668 Ga0496126_0144413 3300048929 Bacteria 2045
669 Ga0496126_0175971 3300048929 Bacteria 1820
670 Ga0496126_0613962 3300048929 Bacteria 855
671 Ga0496126_1271306 3300048929 Bacteria 537
672 Ga0501306_000560 3300049127 Bacteria 2934
673 Ga0501306_001630 3300049127 Bacteria 2164
674 Ga0501306_009766 3300049127 Bacteria 1196
675 Ga0501306_012383 3300049127 Bacteria 1099
676 Ga0501306_021437 3300049127 Bacteria 905
677 Ga0501306_074369 3300049127 Bacteria 578
678 Ga0501306_078472 3300049127 Bacteria 566
679 Ga0501308_004880 3300049128 Bacteria 1313
680 Ga0501308_013611 3300049128 Bacteria 942
681 Ga0501308_066583 3300049128 Bacteria 553
682 Ga0501309_000718 3300049129 Bacteria 2872
683 Ga0501309_049635 3300049129 Bacteria 657
684 Ga0501310_004109 3300049130 Bacteria 1449
685 Ga0501310_006454 3300049130 Bacteria 1231
686 Ga0501310_028960 3300049130 Bacteria 728
687 Ga0501310_048299 3300049130 Bacteria 610
688 Ga0501341_01663 3300049131 Bacteria 1138
689 Ga0501304_002063 3300049160 Bacteria 1362
690 Ga0501304_002642 3300049160 Bacteria 1260
691 Ga0501304_010309 3300049160 Bacteria 815
692 Ga0501305_000734 3300049161 Bacteria 2858
693 Ga0501305_004421 3300049161 Bacteria 1653
694 Ga0501305_010239 3300049161 Bacteria 1249
695 Ga0501305_016506 3300049161 Bacteria 1054
696 Ga0501305_102569 3300049161 Bacteria 534
697 Ga0501305_112221 3300049161 Bacteria 517
698 Ga0501305_120657 3300049161 Bacteria 503
699 Ga0501307_000265 3300049162 Bacteria 3171
700 Ga0501307_005058 3300049162 Bacteria 1375
701 Ga0501307_024831 3300049162 Bacteria 801
702 Ga0501307_025153 3300049162 Bacteria 798
703 Ga0501307_025451 3300049162 Bacteria 795
704 Ga0501307_027312 3300049162 Bacteria 775
705 Ga0501311_000387 3300049527 Bacteria 2979
706 Ga0501311_008374 3300049527 Bacteria 1211
707 Ga0501311_019784 3300049527 Bacteria 905
708 Ga0501311_026229 3300049527 Bacteria 821
709 Ga0501311_084211 3300049527 Bacteria 545
710 Ga0501312_000232 3300049528 Bacteria 3979
711 Ga0501312_087617 3300049528 Bacteria 571
712 Ga0501313_004872 3300049529 Bacteria 1397
713 Ga0501313_010638 3300049529 Bacteria 1051
714 Ga0501314_002087 3300049530 Bacteria 1514
715 Ga0501314_003965 3300049530 Bacteria 1212
716 Ga0501315_005291 3300049531 Bacteria 1392
717 Ga0501315_028725 3300049531 Bacteria 791
718 Ga0501315_029278 3300049531 Bacteria 785
719 Ga0501315_096537 3300049531 Bacteria 518
720 Ga0501316_005648 3300049532 Bacteria 1305
721 Ga0501316_020268 3300049532 Bacteria 833
722 Ga0501317_000092 3300049533 Bacteria 4572
723 Ga0501317_002999 3300049533 Bacteria 1647
724 Ga0501317_004767 3300049533 Bacteria 1425
725 Ga0501317_012140 3300049533 Bacteria 1059
726 Ga0501317_015192 3300049533 Bacteria 985
727 Ga0501317_018134 3300049533 Bacteria 929
728 Ga0501317_073508 3300049533 Bacteria 581
729 Ga0501317_087720 3300049533 Bacteria 546
730 Ga0501317_103749 3300049533 Bacteria 516
731 Ga0501318_001483 3300049534 Bacteria 1858
732 Ga0501318_003859 3300049534 Bacteria 1404
733 Ga0501318_007672 3300049534 Bacteria 1135
734 Ga0501318_007736 3300049534 Bacteria 1132
735 Ga0501318_010758 3300049534 Bacteria 1022
736 Ga0501318_073420 3300049534 Bacteria 544
737 Ga0501319_007607 3300049535 Bacteria 822
738 Ga0501319_009009 3300049535 Bacteria 776
739 Ga0501319_026015 3300049535 Bacteria 546
740 Ga0501320_007464 3300049536 Bacteria 1053
741 Ga0501320_011242 3300049536 Bacteria 925
742 Ga0501320_014435 3300049536 Bacteria 854
743 Ga0501320_028182 3300049536 Bacteria 686
744 Ga0501321_000064 3300049537 Bacteria 4712
745 Ga0501321_002137 3300049537 Bacteria 1675
746 Ga0501321_006408 3300049537 Bacteria 1196
747 Ga0501321_006964 3300049537 Bacteria 1163
748 Ga0501321_008554 3300049537 Bacteria 1089
749 Ga0501321_009527 3300049537 Bacteria 1050
750 Ga0501321_028462 3300049537 Bacteria 735
751 Ga0501322_000562 3300049538 Bacteria 1799
752 Ga0501323_002343 3300049539 Bacteria 1825
753 Ga0501323_020355 3300049539 Bacteria 871
754 Ga0501323_031187 3300049539 Bacteria 749
755 Ga0501324_001672 3300049540 Bacteria 1514
756 Ga0501324_012702 3300049540 Bacteria 790
757 Ga0501324_025687 3300049540 Bacteria 622
758 Ga0501324_026773 3300049540 Bacteria 613
759 Ga0501325_004097 3300049541 Bacteria 1098
760 Ga0501325_004154 3300049541 Bacteria 1095
761 Ga0501325_006462 3300049541 Bacteria 965
762 Ga0501325_014393 3300049541 Bacteria 769
763 Ga0501325_016954 3300049541 Bacteria 733
764 Ga0501325_045302 3300049541 Bacteria 546
765 Ga0501330_001979 3300049546 Bacteria 1125
766 Ga0501330_003718 3300049546 Bacteria 922
767 Ga0501331_06050 3300049547 Bacteria 701
768 Ga0501332_08873 3300049548 Bacteria 657
769 Ga0501332_13759 3300049548 Bacteria 565
770 Ga0501333_006876 3300049549 Bacteria 763
771 Ga0501335_009693 3300049551 Bacteria 921
772 Ga0501336_008255 3300049552 Bacteria 803
773 Ga0501340_003715 3300049556 Bacteria 936
774 Ga0501031_0012276 3300049568 Bacteria 5584
775 Ga0501031_0026550 3300049568 Bacteria 3775
776 Ga0501031_0090099 3300049568 Bacteria 2000
777 Ga0501031_0186178 3300049568 Bacteria 1356
778 Ga0501032_0003386 3300049569 Bacteria 12226
779 Ga0501032_0011095 3300049569 Bacteria 6474
780 Ga0501032_0060246 3300049569 Bacteria 2545
781 Ga0501032_0063351 3300049569 Bacteria 2476
782 Ga0501032_0169713 3300049569 Bacteria 1431
783 Ga0501033_0002214 3300049570 Bacteria 16754
784 Ga0501033_0004032 3300049570 Bacteria 11861
785 Ga0501033_0004858 3300049570 Bacteria 10708
786 Ga0501033_0233744 3300049570 Bacteria 1305
787 Ga0501033_0284185 3300049570 Bacteria 1167
788 Ga0501034_0002490 3300049571 Bacteria 22119
789 Ga0501034_0008687 3300049571 Bacteria 10701
790 Ga0501034_0057847 3300049571 Bacteria 3897
791 Ga0501034_0201798 3300049571 Bacteria 1946
792 Ga0501034_0256960 3300049571 Bacteria 1690
793 Ga0501034_0279349 3300049571 Bacteria 1609
794 Ga0501034_0658423 3300049571 Bacteria 948
795 Ga0501036_0123303 3300049572 Bacteria 2188
796 Ga0501036_0267934 3300049572 Bacteria 1430
797 Ga0501036_0365972 3300049572 Bacteria 1203
798 Ga0501036_0656253 3300049572 Bacteria 868
799 Ga0501037_0001422 3300049573 Bacteria 17565
800 Ga0501037_0050605 3300049573 Bacteria 3040
801 Ga0501037_0084416 3300049573 Bacteria 2299
802 Ga0501037_0099456 3300049573 Bacteria 2100
803 Ga0501037_0347933 3300049573 Bacteria 1023
804 Ga0501038_0003511 3300049574 Bacteria 14597
805 Ga0501038_0021820 3300049574 Bacteria 5744
806 Ga0501038_0187593 3300049574 Bacteria 1665
807 Ga0501038_0188345 3300049574 Bacteria 1661
808 Ga0501038_0339541 3300049574 Bacteria 1171
809 Ga0501038_0655828 3300049574 Bacteria 790
810 Ga0501039_0064692 3300049575 Bacteria 2835
811 Ga0501039_0303888 3300049575 Bacteria 1254
812 Ga0501039_0725069 3300049575 Bacteria 777
813 Ga0501042_0009674 3300049578 Bacteria 6437
814 Ga0501042_0108198 3300049578 Bacteria 2001
815 Ga0501043_0035007 3300049579 Bacteria 3949
816 Ga0501043_0065288 3300049579 Bacteria 2858
817 Ga0501043_0112406 3300049579 Bacteria 2139
818 Ga0501043_0201043 3300049579 Bacteria 1546
819 Ga0501043_0289285 3300049579 Bacteria 1254
820 Ga0501046_0013742 3300049580 Bacteria 6845
821 Ga0501046_0014149 3300049580 Bacteria 6739
822 Ga0501046_0173226 3300049580 Bacteria 1618
823 Ga0501047_0001782 3300049581 Bacteria 20821
824 Ga0501047_0006944 3300049581 Bacteria 10634
825 Ga0501047_0090346 3300049581 Bacteria 2939
826 Ga0501047_0273903 3300049581 Bacteria 1533
827 Ga0501048_0013228 3300049582 Bacteria 6124
828 Ga0501048_0016304 3300049582 Bacteria 5476
829 Ga0501048_0022961 3300049582 Bacteria 4560
830 Ga0501067_0023885 3300049583 Bacteria 3390
831 Ga0501067_0113885 3300049583 Bacteria 1504
832 Ga0501068_0051682 3300049584 Bacteria 2486
833 Ga0501068_0290467 3300049584 Bacteria 1046
834 Ga0501068_0388140 3300049584 Bacteria 899
835 Ga0501068_0391015 3300049584 Bacteria 896
836 Ga0501070_0016910 3300049586 Bacteria 6121
837 Ga0501070_0018992 3300049586 Bacteria 5765
838 Ga0501070_0048708 3300049586 Bacteria 3519
839 Ga0501070_0122688 3300049586 Bacteria 2147
840 Ga0501070_0249362 3300049586 Bacteria 1452
841 Ga0501070_0259936 3300049586 Bacteria 1419
842 Ga0501070_0372507 3300049586 Bacteria 1157
843 Ga0501070_0372724 3300049586 Bacteria 1157
844 Ga0501071_0144813 3300049587 Bacteria 1771
845 Ga0501071_0292580 3300049587 Bacteria 1234
846 Ga0501071_1258995 3300049587 Bacteria 571
847 Ga0501073_0000030 3300049589 Bacteria 115949
848 Ga0501073_0041926 3300049589 Bacteria 3232
849 Ga0501073_0272971 3300049589 Bacteria 1167
850 Ga0501073_0381959 3300049589 Bacteria 973
851 Ga0501074_0028983 3300049590 Bacteria 4010
852 Ga0501075_1001107 3300049591 Bacteria 635
853 Ga0501259_141890 3300049688 Bacteria 589
854 Ga0501079_0758558 3300049741 Bacteria 764
855 Ga0501080_0124926 3300049742 Bacteria 2383
856 Ga0501080_0282609 3300049742 Bacteria 1508
857 Ga0501083_0015538 3300049744 Bacteria 5329
858 Ga0501083_0112793 3300049744 Bacteria 1786
859 Ga0501035_0013885 3300049822 Bacteria 7432
860 Ga0501035_0023629 3300049822 Bacteria 5640
861 Ga0501035_0216432 3300049822 Bacteria 1637
862 Ga0501035_0304302 3300049822 Bacteria 1342
863 Ga0501044_0001531 3300049823 Bacteria 27116
864 Ga0501044_0021477 3300049823 Bacteria 6884
865 Ga0501044_0128262 3300049823 Bacteria 2532
866 Ga0501044_0180571 3300049823 Bacteria 2077
867 Ga0501044_0249314 3300049823 Bacteria 1717
868 Ga0501044_0821298 3300049823 Bacteria 808
869 Ga0501044_1365634 3300049823 Bacteria 574
870 Ga0501045_0012578 3300049824 Bacteria 5959
871 Ga0501045_0245961 3300049824 Bacteria 1331
872 Ga0501045_0427464 3300049824 Bacteria 985
873 nmdc:mga03n38_769481_c1 3300050490 Bacteria 559
874 nmdc:mga03n38_99409_c1 3300050490 Bacteria 1401
875 nmdc:mga00v17_121287_c1 3300050491 Bacteria 1665
876 nmdc:mga00v17_312102_c1 3300050491 Bacteria 1022
877 nmdc:mga00v17_49308_c1 3300050491 Bacteria 2554
878 nmdc:mga00v17_577796_c1 3300050491 Bacteria 726
879 nmdc:mga00v17_6859_c1 3300050491 Bacteria 6054
880 nmdc:mga00v17_88029_c1 3300050491 Bacteria 1947
881 nmdc:mga0yw44_19106_c1 3300050492 Bacteria 3772
882 nmdc:mga0yw44_277_c1 3300050492 Bacteria 17596
883 nmdc:mga0yw44_662928_c1 3300050492 Bacteria 709
884 nmdc:mga0yw44_68280_c1 3300050492 Bacteria 2199
885 nmdc:mga0yw44_82709_c1 3300050492 Bacteria 2015
886 nmdc:mga06z11_23458_c1 3300050494 Bacteria 2899
887 nmdc:mga04h51_120153_c1 3300050495 Bacteria 978
888 nmdc:mga04h51_501755_c1 3300050495 Bacteria 518
889 nmdc:mga07m45_482854_c1 3300050496 Bacteria 718
890 nmdc:mga07m45_8187_c1 3300050496 Bacteria 5365
891 nmdc:mga07m45_873133_c1 3300050496 Bacteria 515
892 nmdc:mga0sz30_10621_c1 3300050516 Bacteria 3531
893 nmdc:mga0sz30_201779_c1 3300050516 Bacteria 883
894 nmdc:mga0sz30_45403_c1 3300050516 Bacteria 1853
895 nmdc:mga0sz30_84375_c1 3300050516 Bacteria 1377
896 Ga0495601_0433583 3300053077 Bacteria 851
897 Ga0500635_0044869 3300053080 Bacteria 1493
898 Ga0495619_0120641 3300053085 Bacteria 1798
899 Ga0500643_001952 3300053087 Bacteria 11184
900 Ga0500651_0004271 3300053093 Bacteria 7981
901 Ga0500556_0000020 3300053104 Bacteria 185929
902 Ga0500556_0000151 3300053104 Bacteria 57882
903 Ga0500562_027326 3300053108 Bacteria 1497
904 Ga0500593_000975 3300053117 Bacteria 10477
905 Ga0500593_041574 3300053117 Bacteria 2054
906 Ga0500608_344112 3300053122 Bacteria 531
907 Ga0500628_071200 3300053129 Bacteria 871
908 Ga0500628_190452 3300053129 Bacteria 588
909 Ga0500655_003771 3300053133 Bacteria 2731
910 Ga0500655_046492 3300053133 Bacteria 859
911 Ga0500559_0000050 3300053136 Bacteria 93262
912 Ga0500559_0052618 3300053136 Bacteria 1800
913 Ga0500559_0304464 3300053136 Bacteria 748
914 Ga0500559_0464170 3300053136 Bacteria 584
915 Ga0500568_0000038 3300053139 Bacteria 134267
916 Ga0500568_0000117 3300053139 Bacteria 71510
917 Ga0500568_0002756 3300053139 Bacteria 10167
918 Ga0500573_0379997 3300053140 Bacteria 675
919 Ga0500590_049090 3300053148 Bacteria 2148
920 Ga0500616_0000027 3300053153 Bacteria 441053
921 Ga0500616_0002723 3300053153 Bacteria 14334
922 Ga0500616_0205028 3300053153 Bacteria 871
923 Ga0500620_000519 3300053155 Bacteria 6752
924 Ga0500611_246722 3300053727 Bacteria 514
925 Ga0501084_0161687 3300054114 Bacteria 1889
926 Ga0501084_0738504 3300054114 Bacteria 830
927 Ga0590075_190435 3300059424 Bacteria 543
928 Ga0587084_000004 3300059477 Bacteria 10690
929 Ga0587084_005686 3300059477 Bacteria 1488
930 Ga0587084_022776 3300059477 Bacteria 951
931 Ga0587084_047149 3300059477 Bacteria 752
932 Ga0587093_058119 3300059478 Bacteria 626
933 Ga0587066_061185 3300059490 Bacteria 769
934 Ga0587066_152503 3300059490 Bacteria 574
935 Ga0587070_000571 3300059491 Bacteria 3169
936 Ga0587070_007980 3300059491 Bacteria 1486
937 Ga0587070_033861 3300059491 Bacteria 942
938 Ga0587070_056277 3300059491 Bacteria 800
939 Ga0587073_0070195 3300059492 Bacteria 844
940 Ga0587077_000501 3300059493 Bacteria 3391
941 Ga0587077_006148 3300059493 Bacteria 1684
942 Ga0587077_014309 3300059493 Bacteria 1304
943 Ga0587077_047866 3300059493 Bacteria 884
944 Ga0587077_065220 3300059493 Bacteria 800
945 Ga0587080_002778 3300059503 Bacteria 2106
946 Ga0587080_009509 3300059503 Bacteria 1416
947 Ga0587080_023505 3300059503 Bacteria 1029
948 Ga0587083_0008351 3300059505 Bacteria 1617
949 Ga0587083_0030595 3300059505 Bacteria 1069
950 Ga0587083_0051089 3300059505 Bacteria 901
951 Ga0587085_007645 3300059506 Bacteria 1355
952 Ga0587085_045682 3300059506 Bacteria 780
953 Ga0587086_009862 3300059507 Bacteria 1144
954 Ga0587086_021908 3300059507 Bacteria 879
955 Ga0587086_050370 3300059507 Bacteria 670
956 Ga0587086_079212 3300059507 Bacteria 577
957 Ga0587088_002140 3300059508 Bacteria 2192
958 Ga0587088_004735 3300059508 Bacteria 1745
959 Ga0587088_005922 3300059508 Bacteria 1628
960 Ga0587088_017488 3300059508 Bacteria 1155
961 Ga0587088_018983 3300059508 Bacteria 1126
962 Ga0587088_029751 3300059508 Bacteria 969
963 Ga0587088_125430 3300059508 Bacteria 599
964 Ga0587088_170796 3300059508 Bacteria 539
965 Ga0587089_004824 3300059509 Bacteria 1501
966 Ga0587089_060024 3300059509 Bacteria 627
967 Ga0587090_000311 3300059510 Bacteria 3800
968 Ga0587090_000846 3300059510 Bacteria 2830
969 Ga0587090_005328 3300059510 Bacteria 1607
970 Ga0587090_005979 3300059510 Bacteria 1548
971 Ga0587090_007195 3300059510 Bacteria 1455
972 Ga0587090_011080 3300059510 Bacteria 1262
973 Ga0587090_054823 3300059510 Bacteria 741
974 Ga0587091_000744 3300059511 Bacteria 3083
975 Ga0587092_001025 3300059512 Bacteria 2577
976 Ga0587092_118976 3300059512 Bacteria 562
977 Ga0587094_001057 3300059513 Bacteria 2469
978 Ga0587094_060111 3300059513 Bacteria 663
979 Ga0587094_095914 3300059513 Bacteria 567
980 Ga0587095_000418 3300059514 Bacteria 2151
981 Ga0587095_002414 3300059514 Bacteria 1254
982 Ga0587095_009270 3300059514 Bacteria 812
983 Ga0587095_018578 3300059514 Bacteria 652
984 Ga0587097_00051 3300059603 Bacteria 2238
985 Ga0587098_000388 3300059604 Bacteria 2571
986 Ga0587106_000996 3300059605 Bacteria 2340
987 Ga0587106_032224 3300059605 Bacteria 847
988 Ga0587106_128274 3300059605 Bacteria 545
989 Ga0587125_000024 3300059607 Bacteria 4952
990 Ga0587129_000773 3300059608 Bacteria 1556
991 Ga0587099_000526 3300059622 Bacteria 2252
992 Ga0587099_018533 3300059622 Bacteria 769
993 Ga0587101_000011 3300059623 Bacteria 8540
994 Ga0587101_003992 3300059623 Bacteria 1545
995 Ga0587101_005295 3300059623 Bacteria 1425
996 Ga0587101_031126 3300059623 Bacteria 833
997 Ga0587101_124407 3300059623 Bacteria 536
998 Ga0587109_036847 3300059624 Bacteria 954
999 Ga0587113_000345 3300059625 Bacteria 2337
1000 Ga0587113_006517 3300059625 Bacteria 994
1001 Ga0587115_000112 3300059626 Bacteria 4239
1002 Ga0587115_006179 3300059626 Bacteria 1373
1003 Ga0587117_001041 3300059627 Bacteria 2209
1004 Ga0587117_050704 3300059627 Bacteria 688
1005 Ga0587122_006132 3300059628 Bacteria 1028
1006 Ga0587127_001361 3300059629 Bacteria 1360
1007 Ga0587128_000332 3300059630 Bacteria 3269
1008 Ga0587128_001735 3300059630 Bacteria 2130
1009 Ga0587128_023345 3300059630 Bacteria 969
1010 Ga0587128_030255 3300059630 Bacteria 892
1011 Ga0587130_003592 3300059631 Bacteria 1319
1012 Ga0587068_010714 3300059641 Bacteria 1373
1013 Ga0587068_035242 3300059641 Bacteria 886
1014 Ga0587068_082069 3300059641 Bacteria 652
1015 Ga0587069_004707 3300059642 Bacteria 1552
1016 Ga0587069_008799 3300059642 Bacteria 1287
1017 Ga0587069_009068 3300059642 Bacteria 1275
1018 Ga0587069_116334 3300059642 Bacteria 562
1019 Ga0587072_020829 3300059643 Bacteria 1159
1020 Ga0587072_053680 3300059643 Bacteria 814
1021 Ga0587076_026060 3300059645 Bacteria 1004
1022 Ga0587076_040920 3300059645 Bacteria 866
1023 Ga0587076_059951 3300059645 Bacteria 765
1024 Ga0587078_047352 3300059646 Bacteria 622
1025 Ga0587078_068160 3300059646 Bacteria 551
1026 Ga0587079_034838 3300059647 Bacteria 987
1027 Ga0587079_044436 3300059647 Bacteria 910
1028 Ga0587079_063695 3300059647 Bacteria 805
1029 Ga0587100_000216 3300059648 Bacteria 2447
1030 Ga0587102_000354 3300059649 Bacteria 2488
1031 Ga0587102_006949 3300059649 Bacteria 1041
1032 Ga0587104_004547 3300059650 Bacteria 891
1033 Ga0587105_005336 3300059651 Bacteria 852
1034 Ga0587107_000716 3300059652 Bacteria 2359
1035 Ga0587107_028075 3300059652 Bacteria 838
1036 Ga0587114_111990 3300059655 Bacteria 544
1037 Ga0587116_20676 3300059656 Bacteria 504
1038 Ga0587118_01369 3300059657 Bacteria 1461
1039 Ga0587118_14663 3300059657 Bacteria 622
1040 Ga0587119_000543 3300059658 Bacteria 2554
1041 Ga0587119_018261 3300059658 Bacteria 874
1042 Ga0587119_072730 3300059658 Bacteria 548
1043 Ga0587120_000682 3300059659 Bacteria 1854
1044 Ga0587120_038302 3300059659 Bacteria 508
1045 Ga0587124_000015 3300059660 Bacteria 5332
1046 Ga0587096_00565 3300060247 Bacteria 1057
1047 Ga0587071_021408 3300060344 Bacteria 1186
1048 Ga0587071_041793 3300060344 Bacteria 921
1049 Ga0587071_052040 3300060344 Bacteria 849
1050 Ga0587071_109149 3300060344 Bacteria 649
1051 Ga0587111_0000485 3300060346 Bacteria 3808
1052 Ga0587111_0006484 3300060346 Bacteria 1859
1053 Ga0587111_0098376 3300060346 Bacteria 725
1054 Ga0501082_0265686 3300060353 Bacteria 1493
1055 Ga0466962_0079520 3300061719 Bacteria 1567
1056 2588107945 2585428157 Bacteria 3018951
1057 2643732585 2643221542 Bacteria 3563959
1058 2643753710 2643221546 Bacteria 2910897
1059 2643786349 2643221553 Bacteria 3544260
1060 2643847782 2643221566 Bacteria 3460379
1061 2643876451 2643221572 Bacteria 3614809
1062 2643888094 2643221575 Bacteria 4022601
1063 2643994809 2643221597 Bacteria 3347721
1064 2644096404 2643221616 Bacteria 4066575
1065 2644171385 2643221630 Bacteria 3601215
1066 2644197847 2643221635 Bacteria 2632343
1067 2644383506 2643221669 Bacteria 3611286
1068 2644681049 2643221724 Bacteria 3593515
1069 2730230518 2728369380 Bacteria 3620317
1070 2747952119 2747842429 Bacteria 3914386
1071 2758224805 2757320536 Bacteria 3629334
1072 2774378929 2773857758 Bacteria 3592392
1073 2774382016 2773857759 Bacteria 2963774
1074 2774400775 2773857763 Bacteria 4180068
1075 2808628777 2808606306 Bacteria 3608896
1076 2808884762 2808606368 Bacteria 3174172
1077 2809226244 2808606447 Bacteria 3572005
1078 2812322081 2811994872 Bacteria 4121241
1079 2821268993 2821268502 Bacteria 3750023
1080 2833709883 2833709550 Bacteria 4008291
1081 2844843373 2844841374 Bacteria 3917147
1082 2844854313 2844852863 Bacteria 3849151
1083 2852632503 2852632344 Bacteria 3463163
1084 2852644345 2852643534 Bacteria 3013378
1085 2852647587 2852646457 Bacteria 3408613
1086 2852664079 2852663356 Bacteria 4090475
1087 2852678573 2852677369 Bacteria 3768884
1088 2857722758 2857720070 Bacteria 3189373
1089 2857725837 2857723135 Bacteria 4217853
1090 2857730665 2857729791 Bacteria 4040535
1091 2857738242 2857737099 Bacteria 3104305
1092 2870629388 2870628048 Bacteria 3696012
1093 2884766400 2884763398 Bacteria 4091164
1094 2895660626 2895660088 Bacteria 3782833
1095 2904510391 2904509784 Bacteria 3520416
1096 2906801159 2906799679 Bacteria 4031749
1097 2908678391 2908678064 Bacteria 3482747
1098 2919055351 2919055335 Bacteria 3875751
1099 2919070715 2919069694 Bacteria 3622919
1100 2919397184 2919395869 Bacteria 3704152
1101 2919445545 2919443155 Bacteria 4072969
1102 2928093822 2928090899 Bacteria 3158267
1103 2928121471 2928121344 Bacteria 3972376
1104 2928153510 2928153084 Bacteria 4020257
1105 2945968754 2945968032 Bacteria 4111363
1106 2946036572 2946033335 Bacteria 3835514
1107 2946045195 2946041624 Bacteria 4191385
1108 2946084038 2946080515 Bacteria 4310960
1109 2966922546 2966921586 Bacteria 3092803
1110 2966926522 2966924647 Bacteria 3268643
1111 2974294875 2974294766 Bacteria 3767688
1112 2974325325 2974324384 Bacteria 3750535
1113 2977230287 2977228692 Bacteria 3450105
1114 2977239091 2977236895 Bacteria 3569373
1115 2977252177 2977251589 Bacteria 2952848
1116 2977265505 2977264416 Bacteria 3750737
1117 2984543124 2984542743 Bacteria 3569378
1118 2984582491 2984580707 Bacteria 3351387
1119 2995728353 2995726249 Bacteria 3470435
1120 8004184518 8004182704 Bacteria 3391155
1121 8004213324 8004212874 Bacteria 2861420
1122 8016255130 8016254467 Bacteria 3797036
1123 8045832185 8045830549 Bacteria 4444727
1124 8055035302 8055034563 Bacteria 3562128
1125 8055039009 8055037949 Bacteria 3337834
1126 8057347402 8057345674 Bacteria 4160394
1127 Ga0206352_10173797
1128 JGI24740J21852_10000460
1129 JGI24740J21852_10008552
1130 JGI24740J21852_10012670
1131 JGI24740J21852_10050801
1132 JGI24739J22299_10005224
1133 JGI24739J22299_10093748
1134 JGI24737J22298_10063151
1135 JGI24735J21928_10042386
1136 JGI24735J21928_10064972
1137 JGI25162J39368_1008761
1138 JGI25154J39366_1006883
1139 JGI25164J39214_1000440
1140 Ga0006774J45829_10761
1141 Ga0006779J45831_102222
1142 Ga0006778J45830_1023361
1143 Ga0006778J45830_1037863
1144 Ga0006759J45824_1032491
1145 JGI25165J46597_1000061
1146 Ga0006770J48903_1025413
1147 Ga0006777J48905_1024731
1148 Ga0007417J51691_1036599
1149 Ga0007427J51700_102557
1150 Ga0006781J51513_1004015
1151 Ga0007410J51695_1022860
1152 Ga0007409J51694_1032594
1153 Ga0007416J51690_1023401
1154 Ga0006562J51391_1024272
1155 Ga0006562J51391_1024273
1156 Ga0007429J51699_1022931
1157 Ga0032354_1037035
1158 Ga0032354_1078778
1159 Ga0006780_1005385
1160 Ga0006780_1012984
1161 Ga0055542_1016158
1162 Ga0058858_1046361
1163 Ga0058858_1420510
1164 Ga0058859_11827816
1165 Ga0058860_10000991
1166 Ga0058860_10026029
1167 Ga0058860_12222763
1168 Ga0065714_10155188
1169 Ga0070658_10009122
1170 Ga0070658_10220817
1171 Ga0070658_10542007
1172 Ga0070670_100851899
1173 Ga0070677_10424709
1174 Ga0068869_100209932
1175 Ga0068869_100553472
1176 Ga0070682_100038470
1177 Ga0070682_100116365
1178 Ga0070682_100705191
1179 Ga0070682_101264025
1180 Ga0068868_100709387
1181 Ga0070660_100057825
1182 Ga0070660_100400716
1183 Ga0070661_100351559
1184 Ga0070692_11119038
1185 Ga0070668_100317440
1186 Ga0070671_100053010
1187 Ga0070674_100045759
1188 Ga0070659_100003025
1189 Ga0070659_100021971
1190 Ga0070667_100042795
1191 Ga0070667_100151748
1192 Ga0070667_100706796
1193 Ga0070667_101201259
1194 Ga0070714_100511690
1195 Ga0070714_100600580
1196 Ga0070714_100974345
1197 Ga0070710_10095608
1198 Ga0070711_101031561
1199 Ga0070705_101430272
1200 Ga0070663_100016293
1201 Ga0070663_100829139
1202 Ga0070663_100959306
1203 Ga0070663_101788530
1204 Ga0070663_101938008
1205 Ga0070678_100660439
1206 Ga0070678_102195584
1207 Ga0070685_11138554
1208 Ga0070685_11387074
1209 Ga0070679_100496419
1210 Ga0070684_100631291
1211 Ga0068853_100068961
1212 Ga0070672_100066968
1213 Ga0070672_101003912
1214 Ga0070695_101035290
1215 Ga0070693_100850847
1216 Ga0070665_100083091
1217 Ga0068855_100047986
1218 Ga0068855_100261541
1219 Ga0068855_100427578
1220 Ga0068855_102444860
1221 Ga0068857_100999643
1222 Ga0070702_101236485
1223 Ga0068852_100120419
1224 Ga0068852_100417091
1225 Ga0068859_100456521
1226 Ga0068864_100318828
1227 Ga0068861_100790364
1228 Ga0068851_10000022
1229 Ga0068863_100830072
1230 Ga0068858_100034623
1231 Ga0068860_100224634
1232 Ga0068862_101693087
1233 Ga0075365_10012248
1234 Ga0075365_10020292
1235 Ga0075365_10113563
1236 Ga0075365_10207236
1237 Ga0075365_10476055
1238 Ga0075365_11037567
1239 Ga0075365_11326162
1240 Ga0075368_10014257
1241 Ga0075368_10110645
1242 Ga0075363_100132063
1243 Ga0075363_100994458
1244 Ga0075364_10084726
1245 Ga0075364_10243007
1246 Ga0075364_10260286
1247 Ga0075364_10351716
1248 Ga0075364_10544300
1249 Ga0075364_10819133
1250 Ga0075432_10179913
1251 Ga0070716_101339101
1252 Ga0075367_10020722
1253 Ga0075367_10298664
1254 Ga0075367_10306712
1255 Ga0075369_10008212
1256 Ga0075369_10047871
1257 Ga0075369_10119131
1258 Ga0075369_10437265
1259 Ga0097621_101150850
1260 Ga0097621_101562109
1261 Ga0075370_10043477
1262 Ga0075370_10231423
1263 Ga0068871_100843645
1264 Ga0097620_100456490
1265 Ga0105251_10056462
1266 Ga0105244_10004765
1267 Ga0105244_10096109
1268 Ga0105245_10212872
1269 Ga0105245_13198088
1270 Ga0105247_10296667
1271 Ga0105247_11114506
1272 Ga0105243_10671170
1273 Ga0105243_12512123
1274 Ga0105243_13023197
1275 Ga0105242_12699972
1276 Ga0105248_10266117
1277 Ga0105248_10780203
1278 Ga0105237_10542431
1279 Ga0105237_10717429
1280 Ga0105237_10804485
1281 Ga0105237_11204814
1282 Ga0105238_10027288
1283 Ga0105238_10214305
1284 Ga0105238_10347193
1285 Ga0105249_11467249
1286 Ga0105239_10378900
1287 Ga0105239_10421283
1288 Ga0105239_12866857
1289 Ga0105246_10750250
1290 Ga0105246_11019891
1291 Ga0105246_11449826
1292 Ga0157373_10522192
1293 Ga0157371_10013796
1294 Ga0157371_10174660
1295 Ga0157371_11065031
1296 Ga0157370_10010513
1297 Ga0157370_10443917
1298 Ga0157370_10765040
1299 Ga0157370_11133628
1300 Ga0157369_10041722
1301 Ga0157369_10059481
1302 Ga0157369_10465961
1303 Ga0157369_10740957
1304 Ga0157369_11196541
1305 Ga0171462_1001
1306 Ga0157374_10789598
1307 Ga0157374_10950176
1308 Ga0157374_11320556
1309 Ga0157374_11906802
1310 Ga0157374_12265189
1311 Ga0163162_10177320
1312 Ga0163162_10303139
1313 Ga0163162_10620717
1314 Ga0163162_10668866
1315 Ga0163162_11851247
1316 Ga0157372_10232148
1317 Ga0157372_10438593
1318 Ga0157372_10845425
1319 Ga0157372_11689194
1320 Ga0157372_12253699
1321 Ga0157375_10596593
1322 Ga0157375_10925170
1323 Ga0157375_11150802
1324 Ga0163163_11577474
1325 Ga0157380_10453219
1326 Ga0157380_11040347
1327 Ga0157379_10053997
1328 Ga0157379_11354817
1329 Ga0157376_10560361
1330 Ga0163161_10157815
1331 Ga0197907_10361036
1332 Ga0197907_10498511
1333 Ga0197907_11223662
1334 Ga0197907_11245501
1335 Ga0206349_1034221
1336 Ga0206349_1250205
1337 Ga0206349_1521915
1338 Ga0206349_1604768
1339 Ga0206349_1707418
1340 Ga0206349_1849192
1341 Ga0206355_1041932
1342 Ga0206355_1129944
1343 Ga0206355_1137396
1344 Ga0206355_1277111
1345 Ga0206355_1324827
1346 Ga0206355_1605190
1347 Ga0206355_1669966
1348 Ga0206351_10185023
1349 Ga0206351_10564340
1350 Ga0206351_10632664
1351 Ga0206351_10843496
1352 Ga0206352_10172050
1353 Ga0206352_10209131
1354 Ga0206352_10305699
1355 Ga0206352_10498154
1356 Ga0206352_11013222
1357 Ga0206352_11153687
1358 Ga0206350_11401627
1359 Ga0206350_11436187
1360 Ga0206354_10084611
1361 Ga0206354_11464084
1362 Ga0206354_11671741
1363 Ga0206353_10160049
1364 Ga0206353_10463612
1365 Ga0206353_11638567
1366 Ga0154015_1476573
1367 Ga0224712_10083078
1368 Ga0224712_10153416
1369 Ga0256744_142576
1370 Ga0207427_100042
1371 Ga0209437_100510
1372 Ga0209646_1000013
1373 Ga0209646_1000014
1374 Ga0209148_1002314
1375 Ga0209129_1016695
1376 Ga0209233_1000001
1377 Ga0209130_1039307
1378 Ga0209676_1023744
1379 Ga0207656_10000005
1380 Ga0207655_1000386
1381 Ga0207655_1134228
1382 Ga0207682_10145213
1383 Ga0207692_10352603
1384 Ga0207710_10758950
1385 Ga0207710_10775627
1386 Ga0207647_10035337
1387 Ga0207647_10070828
1388 Ga0207647_10115621
1389 Ga0207685_10857587
1390 Ga0207643_10091417
1391 Ga0207705_10000001
1392 Ga0207705_10192945
1393 Ga0207705_10257753
1394 Ga0207654_10000001
1395 Ga0207695_10277353
1396 Ga0207671_10000016
1397 Ga0207671_10082507
1398 Ga0207671_10901436
1399 Ga0207671_11568720
1400 Ga0207657_10005997
1401 Ga0207657_10372004
1402 Ga0207649_10165081
1403 Ga0207646_11316455
1404 Ga0207694_10000057
1405 Ga0207650_10347892
1406 Ga0207659_11124255
1407 Ga0207687_10091182
1408 Ga0207664_10347094
1409 Ga0207664_10844209
1410 Ga0207644_10132279
1411 Ga0207690_10003803
1412 Ga0207690_11430486
1413 Ga0207690_11861409
1414 Ga0207709_10233903
1415 Ga0207709_10315467
1416 Ga0207665_10571300
1417 Ga0207665_10584751
1418 Ga0207691_10126653
1419 Ga0207711_10022131
1420 Ga0207711_10469680
1421 Ga0207689_10351692
1422 Ga0207661_11318852
1423 Ga0207667_10021165
1424 Ga0207667_10069574
1425 Ga0207667_10303822
1426 Ga0207667_11310732
1427 Ga0207667_11695718
1428 Ga0207667_11939989
1429 Ga0207712_11576636
1430 Ga0207668_10525059
1431 Ga0207668_10584374
1432 Ga0207640_10304432
1433 Ga0207658_10014016
1434 Ga0207658_11137653
1435 Ga0207658_11424409
1436 Ga0207658_11592194
1437 Ga0207658_11943280
1438 Ga0207703_10001453
1439 Ga0207639_10056116
1440 Ga0207639_11316923
1441 Ga0207678_10027691
1442 Ga0207678_10329291
1443 Ga0207678_10387201
1444 Ga0207708_10290684
1445 Ga0207702_10029018
1446 Ga0207702_10208314
1447 Ga0207683_10168192
1448 Ga0207698_10139001
1449 Ga0207698_10304750
1450 Ga0207698_10339745
1451 Ga0209813_10207646
1452 Ga0209813_10301414
1453 Ga0268266_10393555
1454 Ga0268265_10135334
1455 Ga0307517_10268976
1456 Ga0311004_143717
1457 Ga0311001_1007990
1458 Ga0310982_140508
1459 Ga0310981_1006206
1460 Ga0307513_10282932
1461 Ga0307513_10547263
1462 Ga0307408_100631993
1463 Ga0307408_100725948
1464 Ga0307408_101247540
1465 Ga0307514_10304681
1466 Ga0307405_10646754
1467 Ga0307405_10686116
1468 Ga0307405_10689973
1469 Ga0307405_10696163
1470 Ga0307405_11098457
1471 Ga0307413_10728988
1472 Ga0307413_11255066
1473 Ga0307413_11802838
1474 Ga0307410_10735200
1475 Ga0307406_10000938
1476 Ga0307406_10074938
1477 Ga0307406_10300233
1478 Ga0307406_10444568
1479 Ga0307406_10607517
1480 Ga0307406_10834118
1481 Ga0307406_11120531
1482 Ga0307407_10192660
1483 Ga0307407_10362949
1484 Ga0307407_10919056
1485 Ga0307412_10038041
1486 Ga0307412_10708588
1487 Ga0307412_11305184
1488 Ga0307412_12078050
1489 Ga0307412_12177422
1490 Ga0307409_100257187
1491 Ga0307409_100287294
1492 Ga0307409_100447884
1493 Ga0307409_100688508
1494 Ga0307409_101079594
1495 Ga0307409_101112435
1496 Ga0307416_100528221
1497 Ga0307416_101566001
1498 Ga0307416_101643799
1499 Ga0307416_102199011
1500 Ga0307416_102363314
1501 Ga0307414_10503976
1502 Ga0307411_10299553
1503 Ga0307411_11041070
1504 Ga0307415_100008614
1505 Ga0307415_100925132
1506 Ga0307415_100939453
1507 Ga0307415_101697904
1508 Ga0395900_0642566
1509 Ga0395900_0700140
1510 Ga0395900_0829724
1511 Ga0395900_1792186
1512 Ga0395898_0019914
1513 Ga0395898_0105586
1514 Ga0395898_0167204
1515 Ga0395901_0051416
1516 Ga0395901_0141720
1517 Ga0439436_0090588
1518 Ga0439439_0067856
1519 Ga0439466_0188528
1520 Ga0439465_0045859
1521 Ga0439465_0117232
1522 Ga0439465_0136287
1523 Ga0451787_006059
1524 Ga0451787_198347
1525 Ga0451787_494371
1526 Ga0451787_698953
1527 Ga0451788_06186
1528 Ga0451789_1026005
1529 Ga0451790_16529
1530 Ga0451792_08540
1531 Ga0451794_15320
1532 Ga0451794_50422
1533 Ga0451791_0192690
1534 Ga0451791_0375613
1535 Ga0451791_1451577
1536 Ga0451793_1220708
1537 Ga0451797_0304931
1538 Ga0451797_0960236
1539 Ga0451795_0615518
1540 Ga0451795_0717574
1541 Ga0451795_1155111
1542 Ga0451802_0607156
1543 Ga0451802_1045637
1544 Ga0451805_067564
1545 Ga0451805_083680
1546 Ga0451806_370333
1547 Ga0451804_0004070
1548 Ga0451807_0180144
1549 Ga0451807_1534873
1550 Ga0451807_1605592
1551 Ga0451835_0538675
1552 Ga0451837_0302867
1553 Ga0451837_1713824
1554 Ga0451841_0622253
1555 Ga0451841_0717519
1556 Ga0451847_0492307
1557 Ga0451843_0686131
1558 Ga0451853_0693091
1559 Ga0451853_2006119
1560 Ga0451853_3216936
1561 Ga0439431_0106876
1562 Ga0439433_0036605
1563 Ga0439449_0338324
1564 Ga0439462_0035379
1565 Ga0450920_012421
1566 Ga0450922_041426
1567 Ga0450923_096439
1568 Ga0450905_038500
1569 Ga0450906_047563
1570 Ga0450909_007757
1571 Ga0439434_0172163
1572 Ga0439459_0192832
1573 Ga0466969_0049679
1574 Ga0466969_0166999
1575 Ga0466972_0028315
1576 Ga0466972_0072420
1577 Ga0466972_0221483
1578 Ga0466972_0375215
1579 Ga0466965_0000003
1580 Ga0466965_0053028
1581 Ga0466965_0072804
1582 Ga0466965_0261460
1583 Ga0466965_0371437
1584 Ga0466966_0023287
1585 Ga0466966_0251933
1586 Ga0466966_0262503
1587 Ga0466961_0005839
1588 Ga0466961_0057729
1589 Ga0466961_0103620
1590 Ga0466961_0149441
1591 Ga0466961_0239574
1592 Ga0466961_0423278
1593 Ga0466963_0541606
1594 Ga0466963_0590903
1595 Ga0466964_0032622
1596 Ga0466964_0531943
1597 Ga0466971_0033256
1598 Ga0466971_0179354
1599 Ga0466971_0424543
1600 Ga0466968_0172687
1601 Ga0466968_0210904
1602 Ga0466970_0000027
1603 Ga0466970_0036988
1604 Ga0466970_0113359
1605 Ga0466970_0121472
1606 Ga0466970_0234301
1607 Ga0466970_0511148
1608 Ga0466970_0566948
1609 Ga0466957_0051721
1610 Ga0466957_0654141
1611 Ga0466957_0851449
1612 Ga0466960_0019431
1613 Ga0466960_0031018
1614 Ga0466960_0223077
1615 Ga0466960_0455257
1616 Ga0466959_0352321
1617 Ga0466959_0712361
1618 Ga0466958_0023373
1619 Ga0466958_0089102
1620 Ga0466958_0328554
1621 Ga0466958_0621732
1622 Ga0466967_0202852
1623 Ga0466967_0967154
1624 Ga0495627_001687
1625 Ga0495592_0692055
1626 Ga0495590_0000902
1627 Ga0495591_111967
1628 Ga0495639_0105309
1629 Ga0495596_0098554
1630 Ga0495583_0116370
1631 Ga0495610_0152610
1632 Ga0495610_0373205
1633 Ga0495620_0046421
1634 Ga0495620_0114915
1635 Ga0495631_0015142
1636 Ga0495632_0334238
1637 Ga0495632_0364624
1638 Ga0495643_0268651
1639 Ga0495663_0258418
1640 Ga0495654_0118549
1641 Ga0495598_0088631
1642 Ga0495609_0069765
1643 Ga0495621_0124588
1644 Ga0495645_0076192
1645 Ga0495633_0057220
1646 Ga0495633_0271671
1647 Ga0495656_0029433
1648 Ga0495656_0175132
1649 Ga0495668_0793284
1650 Ga0495646_0293386
1651 Ga0495658_1021239
1652 Ga0495624_0799313
1653 Ga0495670_0631421
1654 Ga0495671_0086028
1655 Ga0495649_0062055
1656 Ga0495660_0176997
1657 Ga0495636_0124496
1658 Ga0495672_0011493
1659 Ga0495672_0084128
1660 Ga0495672_0105416
1661 Ga0495676_0855972
1662 Ga0495673_0286143
1663 Ga0495673_0286889
1664 Ga0495681_0059308
1665 Ga0495686_0028366
1666 Ga0495686_0050944
1667 Ga0495686_0386462
1668 Ga0495615_0036135
1669 Ga0495615_0190979
1670 Ga0495615_0229528
1671 Ga0495626_0010797
1672 Ga0496100_0011682
1673 Ga0496100_0088880
1674 Ga0496101_0002898
1675 Ga0496101_0008133
1676 Ga0496102_0089571
1677 Ga0496102_0280181
1678 Ga0496103_0010181
1679 Ga0496103_0033058
1680 Ga0496103_0794279
1681 Ga0496104_0003769
1682 Ga0496104_0015491
1683 Ga0496104_0052939
1684 Ga0496104_0812440
1685 Ga0496105_0005038
1686 Ga0496105_0009192
1687 Ga0496105_0150981
1688 Ga0496105_0224039
1689 Ga0496105_0447361
1690 Ga0496105_0994965
1691 Ga0496105_1405630
1692 Ga0496106_0530388
1693 Ga0496107_0001328
1694 Ga0496107_0939130
1695 Ga0496108_0047565
1696 Ga0496108_0052644
1697 Ga0496109_0042506
1698 Ga0496109_0080472
1699 Ga0496110_0029641
1700 Ga0496110_0950228
1701 Ga0496111_0012648
1702 Ga0496111_0269126
1703 Ga0496111_0543024
1704 Ga0496111_0716449
1705 Ga0496111_1181849
1706 Ga0496112_0231900
1707 Ga0496112_1478820
1708 Ga0496113_0005620
1709 Ga0496113_0323369
1710 Ga0496113_0809195
1711 Ga0496114_0044687
1712 Ga0496114_0085888
1713 Ga0496114_0118841
1714 Ga0496114_0396836
1715 Ga0496115_0002702
1716 Ga0496115_0058315
1717 Ga0496116_0021611
1718 Ga0496116_0095573
1719 Ga0496116_0384463
1720 Ga0496117_0000362
1721 Ga0496117_0004032
1722 Ga0496117_0006530
1723 Ga0496117_0008690
1724 Ga0496117_0009885
1725 Ga0496117_0010175
1726 Ga0496117_0018116
1727 Ga0496117_0111258
1728 Ga0496118_0043816
1729 Ga0496118_0049600
1730 Ga0496118_0081814
1731 Ga0496118_0103297
1732 Ga0496118_0106746
1733 Ga0496118_0195117
1734 Ga0496118_0427522
1735 Ga0496119_0000720
1736 Ga0496119_0006250
1737 Ga0496119_0046717
1738 Ga0496119_0061767
1739 Ga0496119_0061774
1740 Ga0496119_0096444
1741 Ga0496119_0120060
1742 Ga0496119_0207019
1743 Ga0496119_0236420
1744 Ga0496119_0458713
1745 Ga0496119_0492731
1746 Ga0496120_0007276
1747 Ga0496120_0013513
1748 Ga0496120_0027437
1749 Ga0496120_0038694
1750 Ga0496120_0052424
1751 Ga0496120_0130693
1752 Ga0496120_0140755
1753 Ga0496120_0174191
1754 Ga0496120_0185392
1755 Ga0496120_0342639
1756 Ga0496121_0278670
1757 Ga0496122_0000022
1758 Ga0496122_0000799
1759 Ga0496122_0005147
1760 Ga0496122_0010341
1761 Ga0496122_0012595
1762 Ga0496122_0026775
1763 Ga0496122_0232491
1764 Ga0496122_0398172
1765 Ga0496123_0000009
1766 Ga0496123_0000016
1767 Ga0496123_0019848
1768 Ga0496123_0020865
1769 Ga0496123_0068714
1770 Ga0496123_0080336
1771 Ga0496123_0084999
1772 Ga0496123_0117289
1773 Ga0496123_0120729
1774 Ga0496123_0169347
1775 Ga0496124_0002766
1776 Ga0496124_0046380
1777 Ga0496124_0059852
1778 Ga0496124_0086176
1779 Ga0496124_0206335
1780 Ga0496125_0001491
1781 Ga0496125_0002578
1782 Ga0496125_0007012
1783 Ga0496125_0016052
1784 Ga0496125_0109413
1785 Ga0496125_0133224
1786 Ga0496125_0376185
1787 Ga0496125_0570307
1788 Ga0496126_0002077
1789 Ga0496126_0002563
1790 Ga0496126_0011686
1791 Ga0496126_0019423
1792 Ga0496126_0029883
1793 Ga0496126_0052594
1794 Ga0496126_0144413
1795 Ga0496126_0175971
1796 Ga0496126_0613962
1797 Ga0496126_1271306
1798 Ga0501306_000560
1799 Ga0501306_001630
1800 Ga0501306_009766
1801 Ga0501306_012383
1802 Ga0501306_021437
1803 Ga0501306_074369
1804 Ga0501306_078472
1805 Ga0501308_004880
1806 Ga0501308_013611
1807 Ga0501308_066583
1808 Ga0501309_000718
1809 Ga0501309_049635
1810 Ga0501310_004109
1811 Ga0501310_006454
1812 Ga0501310_028960
1813 Ga0501310_048299
1814 Ga0501341_01663
1815 Ga0501304_002063
1816 Ga0501304_002642
1817 Ga0501304_010309
1818 Ga0501305_000734
1819 Ga0501305_004421
1820 Ga0501305_010239
1821 Ga0501305_016506
1822 Ga0501305_102569
1823 Ga0501305_112221
1824 Ga0501305_120657
1825 Ga0501307_000265
1826 Ga0501307_005058
1827 Ga0501307_024831
1828 Ga0501307_025153
1829 Ga0501307_025451
1830 Ga0501307_027312
1831 Ga0501311_000387
1832 Ga0501311_008374
1833 Ga0501311_019784
1834 Ga0501311_026229
1835 Ga0501311_084211
1836 Ga0501312_000232
1837 Ga0501312_087617
1838 Ga0501313_004872
1839 Ga0501313_010638
1840 Ga0501314_002087
1841 Ga0501314_003965
1842 Ga0501315_005291
1843 Ga0501315_028725
1844 Ga0501315_029278
1845 Ga0501315_096537
1846 Ga0501316_005648
1847 Ga0501316_020268
1848 Ga0501317_000092
1849 Ga0501317_002999
1850 Ga0501317_004767
1851 Ga0501317_012140
1852 Ga0501317_015192
1853 Ga0501317_018134
1854 Ga0501317_073508
1855 Ga0501317_087720
1856 Ga0501317_103749
1857 Ga0501318_001483
1858 Ga0501318_003859
1859 Ga0501318_007672
1860 Ga0501318_007736
1861 Ga0501318_010758
1862 Ga0501318_073420
1863 Ga0501319_007607
1864 Ga0501319_009009
1865 Ga0501319_026015
1866 Ga0501320_007464
1867 Ga0501320_011242
1868 Ga0501320_014435
1869 Ga0501320_028182
1870 Ga0501321_000064
1871 Ga0501321_002137
1872 Ga0501321_006408
1873 Ga0501321_006964
1874 Ga0501321_008554
1875 Ga0501321_009527
1876 Ga0501321_028462
1877 Ga0501322_000562
1878 Ga0501323_002343
1879 Ga0501323_020355
1880 Ga0501323_031187
1881 Ga0501324_001672
1882 Ga0501324_012702
1883 Ga0501324_025687
1884 Ga0501324_026773
1885 Ga0501325_004097
1886 Ga0501325_004154
1887 Ga0501325_006462
1888 Ga0501325_014393
1889 Ga0501325_016954
1890 Ga0501325_045302
1891 Ga0501330_001979
1892 Ga0501330_003718
1893 Ga0501331_06050
1894 Ga0501332_08873
1895 Ga0501332_13759
1896 Ga0501333_006876
1897 Ga0501335_009693
1898 Ga0501336_008255
1899 Ga0501340_003715
1900 Ga0501031_0012276
1901 Ga0501031_0026550
1902 Ga0501031_0090099
1903 Ga0501031_0186178
1904 Ga0501032_0003386
1905 Ga0501032_0011095
1906 Ga0501032_0060246
1907 Ga0501032_0063351
1908 Ga0501032_0169713
1909 Ga0501033_0002214
1910 Ga0501033_0004032
1911 Ga0501033_0004858
1912 Ga0501033_0233744
1913 Ga0501033_0284185
1914 Ga0501034_0002490
1915 Ga0501034_0008687
1916 Ga0501034_0057847
1917 Ga0501034_0201798
1918 Ga0501034_0256960
1919 Ga0501034_0279349
1920 Ga0501034_0658423
1921 Ga0501036_0123303
1922 Ga0501036_0267934
1923 Ga0501036_0365972
1924 Ga0501036_0656253
1925 Ga0501037_0001422
1926 Ga0501037_0050605
1927 Ga0501037_0084416
1928 Ga0501037_0099456
1929 Ga0501037_0347933
1930 Ga0501038_0003511
1931 Ga0501038_0021820
1932 Ga0501038_0187593
1933 Ga0501038_0188345
1934 Ga0501038_0339541
1935 Ga0501038_0655828
1936 Ga0501039_0064692
1937 Ga0501039_0303888
1938 Ga0501039_0725069
1939 Ga0501042_0009674
1940 Ga0501042_0108198
1941 Ga0501043_0035007
1942 Ga0501043_0065288
1943 Ga0501043_0112406
1944 Ga0501043_0201043
1945 Ga0501043_0289285
1946 Ga0501046_0013742
1947 Ga0501046_0014149
1948 Ga0501046_0173226
1949 Ga0501047_0001782
1950 Ga0501047_0006944
1951 Ga0501047_0090346
1952 Ga0501047_0273903
1953 Ga0501048_0013228
1954 Ga0501048_0016304
1955 Ga0501048_0022961
1956 Ga0501067_0023885
1957 Ga0501067_0113885
1958 Ga0501068_0051682
1959 Ga0501068_0290467
1960 Ga0501068_0388140
1961 Ga0501068_0391015
1962 Ga0501070_0016910
1963 Ga0501070_0018992
1964 Ga0501070_0048708
1965 Ga0501070_0122688
1966 Ga0501070_0249362
1967 Ga0501070_0259936
1968 Ga0501070_0372507
1969 Ga0501070_0372724
1970 Ga0501071_0144813
1971 Ga0501071_0292580
1972 Ga0501071_1258995
1973 Ga0501073_0000030
1974 Ga0501073_0041926
1975 Ga0501073_0272971
1976 Ga0501073_0381959
1977 Ga0501074_0028983
1978 Ga0501075_1001107
1979 Ga0501259_141890
1980 Ga0501079_0758558
1981 Ga0501080_0124926
1982 Ga0501080_0282609
1983 Ga0501083_0015538
1984 Ga0501083_0112793
1985 Ga0501035_0013885
1986 Ga0501035_0023629
1987 Ga0501035_0216432
1988 Ga0501035_0304302
1989 Ga0501044_0001531
1990 Ga0501044_0021477
1991 Ga0501044_0128262
1992 Ga0501044_0180571
1993 Ga0501044_0249314
1994 Ga0501044_0821298
1995 Ga0501044_1365634
1996 Ga0501045_0012578
1997 Ga0501045_0245961
1998 Ga0501045_0427464
1999 nmdc:mga03n38_769481_c1
2000 nmdc:mga03n38_99409_c1
2001 nmdc:mga00v17_121287_c1
2002 nmdc:mga00v17_312102_c1
2003 nmdc:mga00v17_49308_c1
2004 nmdc:mga00v17_577796_c1
2005 nmdc:mga00v17_6859_c1
2006 nmdc:mga00v17_88029_c1
2007 nmdc:mga0yw44_19106_c1
2008 nmdc:mga0yw44_277_c1
2009 nmdc:mga0yw44_662928_c1
2010 nmdc:mga0yw44_68280_c1
2011 nmdc:mga0yw44_82709_c1
2012 nmdc:mga06z11_23458_c1
2013 nmdc:mga04h51_120153_c1
2014 nmdc:mga04h51_501755_c1
2015 nmdc:mga07m45_482854_c1
2016 nmdc:mga07m45_8187_c1
2017 nmdc:mga07m45_873133_c1
2018 nmdc:mga0sz30_10621_c1
2019 nmdc:mga0sz30_201779_c1
2020 nmdc:mga0sz30_45403_c1
2021 nmdc:mga0sz30_84375_c1
2022 Ga0495601_0433583
2023 Ga0500635_0044869
2024 Ga0495619_0120641
2025 Ga0500643_001952
2026 Ga0500651_0004271
2027 Ga0500556_0000020
2028 Ga0500556_0000151
2029 Ga0500562_027326
2030 Ga0500593_000975
2031 Ga0500593_041574
2032 Ga0500608_344112
2033 Ga0500628_071200
2034 Ga0500628_190452
2035 Ga0500655_003771
2036 Ga0500655_046492
2037 Ga0500559_0000050
2038 Ga0500559_0052618
2039 Ga0500559_0304464
2040 Ga0500559_0464170
2041 Ga0500568_0000038
2042 Ga0500568_0000117
2043 Ga0500568_0002756
2044 Ga0500573_0379997
2045 Ga0500590_049090
2046 Ga0500616_0000027
2047 Ga0500616_0002723
2048 Ga0500616_0205028
2049 Ga0500620_000519
2050 Ga0500611_246722
2051 Ga0501084_0161687
2052 Ga0501084_0738504
2053 Ga0590075_190435
2054 Ga0587084_000004
2055 Ga0587084_005686
2056 Ga0587084_022776
2057 Ga0587084_047149
2058 Ga0587093_058119
2059 Ga0587066_061185
2060 Ga0587066_152503
2061 Ga0587070_000571
2062 Ga0587070_007980
2063 Ga0587070_033861
2064 Ga0587070_056277
2065 Ga0587073_0070195
2066 Ga0587077_000501
2067 Ga0587077_006148
2068 Ga0587077_014309
2069 Ga0587077_047866
2070 Ga0587077_065220
2071 Ga0587080_002778
2072 Ga0587080_009509
2073 Ga0587080_023505
2074 Ga0587083_0008351
2075 Ga0587083_0030595
2076 Ga0587083_0051089
2077 Ga0587085_007645
2078 Ga0587085_045682
2079 Ga0587086_009862
2080 Ga0587086_021908
2081 Ga0587086_050370
2082 Ga0587086_079212
2083 Ga0587088_002140
2084 Ga0587088_004735
2085 Ga0587088_005922
2086 Ga0587088_017488
2087 Ga0587088_018983
2088 Ga0587088_029751
2089 Ga0587088_125430
2090 Ga0587088_170796
2091 Ga0587089_004824
2092 Ga0587089_060024
2093 Ga0587090_000311
2094 Ga0587090_000846
2095 Ga0587090_005328
2096 Ga0587090_005979
2097 Ga0587090_007195
2098 Ga0587090_011080
2099 Ga0587090_054823
2100 Ga0587091_000744
2101 Ga0587092_001025
2102 Ga0587092_118976
2103 Ga0587094_001057
2104 Ga0587094_060111
2105 Ga0587094_095914
2106 Ga0587095_000418
2107 Ga0587095_002414
2108 Ga0587095_009270
2109 Ga0587095_018578
2110 Ga0587097_00051
2111 Ga0587098_000388
2112 Ga0587106_000996
2113 Ga0587106_032224
2114 Ga0587106_128274
2115 Ga0587125_000024
2116 Ga0587129_000773
2117 Ga0587099_000526
2118 Ga0587099_018533
2119 Ga0587101_000011
2120 Ga0587101_003992
2121 Ga0587101_005295
2122 Ga0587101_031126
2123 Ga0587101_124407
2124 Ga0587109_036847
2125 Ga0587113_000345
2126 Ga0587113_006517
2127 Ga0587115_000112
2128 Ga0587115_006179
2129 Ga0587117_001041
2130 Ga0587117_050704
2131 Ga0587122_006132
2132 Ga0587127_001361
2133 Ga0587128_000332
2134 Ga0587128_001735
2135 Ga0587128_023345
2136 Ga0587128_030255
2137 Ga0587130_003592
2138 Ga0587068_010714
2139 Ga0587068_035242
2140 Ga0587068_082069
2141 Ga0587069_004707
2142 Ga0587069_008799
2143 Ga0587069_009068
2144 Ga0587069_116334
2145 Ga0587072_020829
2146 Ga0587072_053680
2147 Ga0587076_026060
2148 Ga0587076_040920
2149 Ga0587076_059951
2150 Ga0587078_047352
2151 Ga0587078_068160
2152 Ga0587079_034838
2153 Ga0587079_044436
2154 Ga0587079_063695
2155 Ga0587100_000216
2156 Ga0587102_000354
2157 Ga0587102_006949
2158 Ga0587104_004547
2159 Ga0587105_005336
2160 Ga0587107_000716
2161 Ga0587107_028075
2162 Ga0587114_111990
2163 Ga0587116_20676
2164 Ga0587118_01369
2165 Ga0587118_14663
2166 Ga0587119_000543
2167 Ga0587119_018261
2168 Ga0587119_072730
2169 Ga0587120_000682
2170 Ga0587120_038302
2171 Ga0587124_000015
2172 Ga0587096_00565
2173 Ga0587071_021408
2174 Ga0587071_041793
2175 Ga0587071_052040
2176 Ga0587071_109149
2177 Ga0587111_0000485
2178 Ga0587111_0006484
2179 Ga0587111_0098376
2180 Ga0501082_0265686
2181 Ga0466962_0079520
2182 2588107945
2183 2643732585
2184 2643753710
2185 2643786349
2186 2643847782
2187 2643876451
2188 2643888094
2189 2643994809
2190 2644096404
2191 2644171385
2192 2644197847
2193 2644383506
2194 2644681049
2195 2730230518
2196 2747952119
2197 2758224805
2198 2774378929
2199 2774382016
2200 2774400775
2201 2808628777
2202 2808884762
2203 2809226244
2204 2812322081
2205 2821268993
2206 2833709883
2207 2844843373
2208 2844854313
2209 2852632503
2210 2852644345
2211 2852647587
2212 2852664079
2213 2852678573
2214 2857722758
2215 2857725837
2216 2857730665
2217 2857738242
2218 2870629388
2219 2884766400
2220 2895660626
2221 2904510391
2222 2906801159
2223 2908678391
2224 2919055351
2225 2919070715
2226 2919397184
2227 2919445545
2228 2928093822
2229 2928121471
2230 2928153510
2231 2945968754
2232 2946036572
2233 2946045195
2234 2946084038
2235 2966922546
2236 2966926522
2237 2974294875
2238 2974325325
2239 2977230287
2240 2977239091
2241 2977252177
2242 2977265505
2243 2984543124
2244 2984582491
2245 2995728353
2246 8004184518
2247 8004213324
2248 8016255130
2249 8045832185
2250 8055035302
2251 8055039009
2252 8057347402

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00276

Ribosomal_L23

Ribosomal protein L23

24

108

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7nhm-assembly1.cif.gz_W 70s ribosome from staphylococcus aureus 0.9378 14 101
7nhn-assembly1.cif.gz_W vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9369 13 99
6ddg-assembly1.cif.gz_F structure of the 50s ribosomal subunit from methicillin resistant staphylococcus aureus in complex with the oxazolidinone antibiotic lzd-6 0.9352 15 98
7m4z-assembly1.cif.gz_S a. baumannii ribosome-eravacycline complex: hpf-bound 70s 0.9319 14 98
8cgd-assembly1.cif.gz_s clindamycin bound to the 50s subunit 0.9299 13 94
ID Description Score Start End Superfamily
6hmaR00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9424 14 101 3.30.70.330
af_P61845_1_86_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9346 16 98 3.30.70.330
af_D3ZFK7_36_158_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9254 11 93 3.30.70.330
6hmaR00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9223 14 101 3.30.70.330
5x8tU01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8976 17 94 3.30.70.330
ID Description Score Start End GO Terms
AF-A3DJH4-F1-model_v4 Large ribosomal subunit protein uL23 (50S ribosomal protein L23) 0.9802 12 93 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-Q4L8B2-F1-model_v4 Large ribosomal subunit protein uL23 (50S ribosomal protein L23) 0.9773 12 102 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-Q5HDW0-F1-model_v4 Large ribosomal subunit protein uL23 (50S ribosomal protein L23) 0.9765 12 102 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-Q8CRG2-F1-model_v4 Large ribosomal subunit protein uL23 (50S ribosomal protein L23) 0.9765 12 102 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A0L6JNB5-F1-model_v4 Large ribosomal subunit protein uL23 0.9719 12 94 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Map