F490482
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1126 | 384 | 2252 | 252 |
Family's Representative Sequence
| Representative Sequence | 3300031995|Ga0307409_100042126|Ga0307409_1000421263 |
| Length | 281 |
| Sequence | VSVEVIRAGCLQGVTHGFLGRRGGVSTGEMAGLNVGTGSSDDREAIAENRRRAVAAVLPGAELATVHQVHSAVAVAVEKPWPHEQRPHADALVTDRPGLLLGVLTADCAPVLLAXAEAGWRGAIGGVTDAAIAEMERLGARRERIAAAVGPCIAQASYEVDEGFRERFIAEDAANARFFAEGPRFDLEGYVASRLAAAGIDRVEPLSLDTYADPERFFSYRRATHRGEADYGRQIALIGLSACRPRGRACGVAWRRSSRCWRFQRPRACRRRRGRPARSSC |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 4 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 7 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 8 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 9 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 10 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 11 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 12 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 13 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 14 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 15 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 16 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 17 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 25 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 27 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 34 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 38 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 59 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 69 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 71 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 72 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 73 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 74 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 75 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 76 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 77 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 78 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 79 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 80 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 81 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 82 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 83 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 84 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 86 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 87 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 89 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 90 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 91 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 93 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 94 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 95 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 96 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 98 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 125 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 202 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 204 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 208 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 209 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 210 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 211 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 212 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 213 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 214 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 215 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 216 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 217 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 218 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 219 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 220 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 221 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 222 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 223 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 224 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 225 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 226 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 227 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 228 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 229 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 230 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 231 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 232 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 233 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 236 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 237 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 238 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 239 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 240 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 241 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 242 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 243 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 244 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 245 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 246 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 247 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 248 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 249 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 250 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 251 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 252 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 253 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 254 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 255 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 256 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 257 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 258 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 259 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 260 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 261 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 262 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 263 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 264 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 304 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 305 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 306 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 307 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 308 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 309 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 310 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 311 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 312 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 313 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 314 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 315 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 316 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 317 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 318 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 319 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 320 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 321 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 322 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 323 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 324 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 325 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 326 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 327 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 338 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 339 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 342 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 343 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 344 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 345 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 350 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 351 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 352 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 353 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 354 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 355 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 356 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 357 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 358 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 359 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 360 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 361 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 362 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 363 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 364 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 365 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 366 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 367 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 368 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 369 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 370 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 371 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 372 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 373 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 374 | 2643221588 | Altererythrobacter sp. Root672 | Isolate | Unclassified |
| 375 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 376 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 377 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 378 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 379 | 2896429255 | Sphingomonas rhizophila KACC 19189 | Isolate | Rhizosphere |
| 380 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 381 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 382 | 3000865235 | Altericroceibacterium indicum DSM 18604 | Isolate | Rhizosphere |
| 383 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
| 384 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.76 |
| Metatranscriptomes | 0.09 |
| Isolates | 1.15 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.61 |
| Nodule | 0.18 |
| Rhizoplane | 2.31 |
| Rhizosphere | 83.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0307409_100042126 | 3300031995 | Bacteria | 3417 |
| 2 | SwRhRL2b_contig_1105262 | 2162886007 | Bacteria | 7671 |
| 3 | SwRhRL2b_contig_3318283 | 2162886007 | Bacteria | 39515 |
| 4 | JGI24736J21556_1003886 | 3300001904 | Bacteria | 2573 |
| 5 | JGI24741J21665_1000617 | 3300001915 | Bacteria | 10730 |
| 6 | JGI24741J21665_1002803 | 3300001915 | Bacteria | 4394 |
| 7 | JGI24740J21852_10000474 | 3300001979 | Bacteria | 17287 |
| 8 | JGI24740J21852_10003183 | 3300001979 | Bacteria | 7247 |
| 9 | JGI24740J21852_10004741 | 3300001979 | Bacteria | 5812 |
| 10 | JGI24740J21852_10010219 | 3300001979 | Bacteria | 3627 |
| 11 | JGI24740J21852_10024992 | 3300001979 | Bacteria | 2019 |
| 12 | JGI24740J21852_10026015 | 3300001979 | Bacteria | 1965 |
| 13 | JGI24739J22299_10000035 | 3300001989 | Bacteria | 37844 |
| 14 | JGI24739J22299_10001730 | 3300001989 | Bacteria | 8302 |
| 15 | JGI24739J22299_10002626 | 3300001989 | Bacteria | 6925 |
| 16 | JGI24739J22299_10002884 | 3300001989 | Bacteria | 6601 |
| 17 | JGI24739J22299_10040361 | 3300001989 | Bacteria | 1558 |
| 18 | JGI24737J22298_10000020 | 3300001990 | Bacteria | 46324 |
| 19 | JGI24737J22298_10000167 | 3300001990 | Bacteria | 21119 |
| 20 | JGI24737J22298_10002252 | 3300001990 | Bacteria | 6874 |
| 21 | JGI24737J22298_10030293 | 3300001990 | Bacteria | 1693 |
| 22 | JGI24743J22301_10021275 | 3300001991 | Bacteria | 1238 |
| 23 | JGI24735J21928_10017959 | 3300002067 | Bacteria | 2185 |
| 24 | JGI24735J21928_10054526 | 3300002067 | Bacteria | 1152 |
| 25 | JGI24735J21928_10060453 | 3300002067 | Bacteria | 1089 |
| 26 | JGI24738J21930_10000050 | 3300002075 | Bacteria | 24055 |
| 27 | JGI24738J21930_10004991 | 3300002075 | Bacteria | 3210 |
| 28 | JGI24742J22300_10007668 | 3300002244 | Bacteria | 1782 |
| 29 | JGI25150J39212_1000658 | 3300002774 | Bacteria | 12817 |
| 30 | JGI25165J46597_1000071 | 3300003214 | Bacteria | 193222 |
| 31 | JGI25153J46596_10000008 | 3300003215 | Bacteria | 376808 |
| 32 | JGI25153J46596_10000183 | 3300003215 | Bacteria | 61802 |
| 33 | rootL2_10167713 | 3300003322 | Bacteria | 1909 |
| 34 | rootL2_10211840 | 3300003322 | Bacteria | 2618 |
| 35 | rootH1_10310960 | 3300003323 | Bacteria | 1190 |
| 36 | Ga0055542_1000038 | 3300003762 | Bacteria | 224625 |
| 37 | Ga0055529_1000002 | 3300003763 | Bacteria | 537914 |
| 38 | Ga0055529_1000021 | 3300003763 | Bacteria | 321484 |
| 39 | Ga0055526_1007617 | 3300003771 | Bacteria | 5587 |
| 40 | Ga0055537_1003499 | 3300003773 | Bacteria | 4811 |
| 41 | Ga0055530_10034994 | 3300003791 | Bacteria | 1278 |
| 42 | Ga0055530_10037292 | 3300003791 | Bacteria | 1217 |
| 43 | Ga0055530_10043565 | 3300003791 | Bacteria | 1081 |
| 44 | Ga0055540_1006104 | 3300003792 | Bacteria | 4858 |
| 45 | Ga0055531_10043203 | 3300003794 | Bacteria | 1278 |
| 46 | Ga0055531_10045520 | 3300003794 | Bacteria | 1217 |
| 47 | Ga0065165_1004893 | 3300005262 | Bacteria | 7917 |
| 48 | Ga0065704_10006528 | 3300005289 | Bacteria | 4147 |
| 49 | Ga0065704_10070200 | 3300005289 | Bacteria | 89591 |
| 50 | Ga0065712_10131800 | 3300005290 | Bacteria | 1541 |
| 51 | Ga0070658_10000246 | 3300005327 | Bacteria | 48141 |
| 52 | Ga0070658_10001377 | 3300005327 | Bacteria | 20794 |
| 53 | Ga0070658_10003252 | 3300005327 | Bacteria | 13413 |
| 54 | Ga0070658_10009024 | 3300005327 | Bacteria | 8020 |
| 55 | Ga0070658_10038444 | 3300005327 | Bacteria | 3859 |
| 56 | Ga0070658_10142169 | 3300005327 | Bacteria | 2005 |
| 57 | Ga0070658_10186874 | 3300005327 | Bacteria | 1745 |
| 58 | Ga0070658_10345275 | 3300005327 | Bacteria | 1273 |
| 59 | Ga0070676_10003530 | 3300005328 | Bacteria | 8176 |
| 60 | Ga0070676_10025705 | 3300005328 | Bacteria | 3329 |
| 61 | Ga0070676_10034049 | 3300005328 | Bacteria | 2923 |
| 62 | Ga0070683_100020418 | 3300005329 | Bacteria | 5895 |
| 63 | Ga0070683_100079286 | 3300005329 | Bacteria | 3073 |
| 64 | Ga0070683_100492938 | 3300005329 | Bacteria | 1170 |
| 65 | Ga0070690_100156555 | 3300005330 | Bacteria | 1558 |
| 66 | Ga0070670_100007537 | 3300005331 | Bacteria | 9237 |
| 67 | Ga0070670_100014177 | 3300005331 | Bacteria | 6839 |
| 68 | Ga0070670_100016985 | 3300005331 | Bacteria | 6248 |
| 69 | Ga0070670_100105231 | 3300005331 | Bacteria | 2431 |
| 70 | Ga0070670_100160248 | 3300005331 | Bacteria | 1950 |
| 71 | Ga0070670_100272071 | 3300005331 | Bacteria | 1478 |
| 72 | Ga0070670_100526559 | 3300005331 | Bacteria | 1053 |
| 73 | Ga0070677_10012331 | 3300005333 | Bacteria | 2968 |
| 74 | Ga0070677_10021855 | 3300005333 | Bacteria | 2351 |
| 75 | Ga0068869_100000043 | 3300005334 | Bacteria | 52392 |
| 76 | Ga0070666_10000090 | 3300005335 | Bacteria | 64025 |
| 77 | Ga0070666_10102257 | 3300005335 | Bacteria | 1976 |
| 78 | Ga0070680_100001376 | 3300005336 | Bacteria | 17581 |
| 79 | Ga0070680_100260340 | 3300005336 | Bacteria | 1467 |
| 80 | Ga0070682_100079366 | 3300005337 | Bacteria | 2119 |
| 81 | Ga0070682_100183702 | 3300005337 | Bacteria | 1463 |
| 82 | Ga0068868_100000019 | 3300005338 | Bacteria | 92673 |
| 83 | Ga0068868_100001402 | 3300005338 | Bacteria | 16620 |
| 84 | Ga0068868_100096446 | 3300005338 | Bacteria | 2389 |
| 85 | Ga0070660_100000415 | 3300005339 | Bacteria | 28402 |
| 86 | Ga0070660_100014625 | 3300005339 | Bacteria | 5661 |
| 87 | Ga0070660_100057475 | 3300005339 | Bacteria | 3013 |
| 88 | Ga0070660_100061033 | 3300005339 | Bacteria | 2927 |
| 89 | Ga0070660_100064868 | 3300005339 | Bacteria | 2842 |
| 90 | Ga0070660_100092138 | 3300005339 | Bacteria | 2392 |
| 91 | Ga0070660_100133185 | 3300005339 | Bacteria | 1990 |
| 92 | Ga0070660_100154406 | 3300005339 | Bacteria | 1847 |
| 93 | Ga0070687_100451623 | 3300005343 | Bacteria | 855 |
| 94 | Ga0070661_100020380 | 3300005344 | Bacteria | 4727 |
| 95 | Ga0070661_100159766 | 3300005344 | Bacteria | 1706 |
| 96 | Ga0070661_100183768 | 3300005344 | Bacteria | 1592 |
| 97 | Ga0070661_100350579 | 3300005344 | Bacteria | 1158 |
| 98 | Ga0070692_10036243 | 3300005345 | Bacteria | 2502 |
| 99 | Ga0070692_10115747 | 3300005345 | Bacteria | 1489 |
| 100 | Ga0070668_100000062 | 3300005347 | Bacteria | 66612 |
| 101 | Ga0070668_100050214 | 3300005347 | Bacteria | 3211 |
| 102 | Ga0070668_100075301 | 3300005347 | Bacteria | 2635 |
| 103 | Ga0070668_100183067 | 3300005347 | Bacteria | 1712 |
| 104 | Ga0070669_100000024 | 3300005353 | Bacteria | 173107 |
| 105 | Ga0070669_100000209 | 3300005353 | Bacteria | 48982 |
| 106 | Ga0070669_100015859 | 3300005353 | Bacteria | 5375 |
| 107 | Ga0070669_100017883 | 3300005353 | Bacteria | 5061 |
| 108 | Ga0070669_100185643 | 3300005353 | Bacteria | 1629 |
| 109 | Ga0070675_100016633 | 3300005354 | Bacteria | 5840 |
| 110 | Ga0070675_100053030 | 3300005354 | Bacteria | 3335 |
| 111 | Ga0070675_100184593 | 3300005354 | Bacteria | 1805 |
| 112 | Ga0070675_100201011 | 3300005354 | Bacteria | 1729 |
| 113 | Ga0070671_100000006 | 3300005355 | Bacteria | 250635 |
| 114 | Ga0070671_100000174 | 3300005355 | Bacteria | 42612 |
| 115 | Ga0070671_100005122 | 3300005355 | Bacteria | 10439 |
| 116 | Ga0070671_100016942 | 3300005355 | Bacteria | 5894 |
| 117 | Ga0070671_100023916 | 3300005355 | Bacteria | 4999 |
| 118 | Ga0070671_100077682 | 3300005355 | Bacteria | 2775 |
| 119 | Ga0070671_100167379 | 3300005355 | Bacteria | 1859 |
| 120 | Ga0070671_100178291 | 3300005355 | Bacteria | 1798 |
| 121 | Ga0070671_100305719 | 3300005355 | Bacteria | 1354 |
| 122 | Ga0070671_100314227 | 3300005355 | Bacteria | 1335 |
| 123 | Ga0070674_100000168 | 3300005356 | Bacteria | 30513 |
| 124 | Ga0070674_100214774 | 3300005356 | Bacteria | 1493 |
| 125 | Ga0070673_100000440 | 3300005364 | Bacteria | 21943 |
| 126 | Ga0070673_100032130 | 3300005364 | Bacteria | 3947 |
| 127 | Ga0070673_100161375 | 3300005364 | Bacteria | 1907 |
| 128 | Ga0070673_100634640 | 3300005364 | Bacteria | 976 |
| 129 | Ga0070659_100000009 | 3300005366 | Bacteria | 203891 |
| 130 | Ga0070659_100000903 | 3300005366 | Bacteria | 21708 |
| 131 | Ga0070659_100010016 | 3300005366 | Bacteria | 6976 |
| 132 | Ga0070659_100038415 | 3300005366 | Bacteria | 3734 |
| 133 | Ga0070659_100054821 | 3300005366 | Bacteria | 3141 |
| 134 | Ga0070659_100070355 | 3300005366 | Bacteria | 2779 |
| 135 | Ga0070659_100098436 | 3300005366 | Bacteria | 2352 |
| 136 | Ga0070659_100117957 | 3300005366 | Bacteria | 2146 |
| 137 | Ga0070659_100165523 | 3300005366 | Bacteria | 1809 |
| 138 | Ga0070659_100197877 | 3300005366 | Bacteria | 1653 |
| 139 | Ga0070667_100000160 | 3300005367 | Bacteria | 83754 |
| 140 | Ga0070667_100002316 | 3300005367 | Bacteria | 16687 |
| 141 | Ga0070667_100020111 | 3300005367 | Bacteria | 5542 |
| 142 | Ga0070667_100235550 | 3300005367 | Bacteria | 1633 |
| 143 | Ga0070667_100235951 | 3300005367 | Bacteria | 1632 |
| 144 | Ga0070667_100239281 | 3300005367 | Bacteria | 1620 |
| 145 | Ga0070667_100256563 | 3300005367 | Bacteria | 1564 |
| 146 | Ga0070667_100484995 | 3300005367 | Bacteria | 1132 |
| 147 | Ga0070667_100609669 | 3300005367 | Bacteria | 1006 |
| 148 | Ga0070709_10070530 | 3300005434 | Bacteria | 2253 |
| 149 | Ga0070714_100022690 | 3300005435 | Bacteria | 5148 |
| 150 | Ga0070705_100257571 | 3300005440 | Bacteria | 1228 |
| 151 | Ga0070708_100414317 | 3300005445 | Bacteria | 1271 |
| 152 | Ga0070663_100084211 | 3300005455 | Bacteria | 2343 |
| 153 | Ga0070663_100239551 | 3300005455 | Bacteria | 1431 |
| 154 | Ga0070663_100382572 | 3300005455 | Bacteria | 1146 |
| 155 | Ga0070678_100000122 | 3300005456 | Bacteria | 30750 |
| 156 | Ga0070678_100120811 | 3300005456 | Bacteria | 2066 |
| 157 | Ga0070662_100000324 | 3300005457 | Bacteria | 28542 |
| 158 | Ga0070662_100004883 | 3300005457 | Bacteria | 8508 |
| 159 | Ga0070662_100027482 | 3300005457 | Bacteria | 3950 |
| 160 | Ga0070662_100032561 | 3300005457 | Bacteria | 3664 |
| 161 | Ga0070662_100086703 | 3300005457 | Bacteria | 2342 |
| 162 | Ga0070662_100088478 | 3300005457 | Bacteria | 2321 |
| 163 | Ga0070662_100115832 | 3300005457 | Bacteria | 2047 |
| 164 | Ga0070662_100249997 | 3300005457 | Bacteria | 1425 |
| 165 | Ga0070681_10063149 | 3300005458 | Bacteria | 3676 |
| 166 | Ga0070681_10090131 | 3300005458 | Bacteria | 3017 |
| 167 | Ga0070681_10124657 | 3300005458 | Bacteria | 2509 |
| 168 | Ga0070681_10433898 | 3300005458 | Bacteria | 1226 |
| 169 | Ga0070681_10521002 | 3300005458 | Bacteria | 1102 |
| 170 | Ga0070681_10599998 | 3300005458 | Bacteria | 1015 |
| 171 | Ga0068867_100001209 | 3300005459 | Bacteria | 17732 |
| 172 | Ga0068867_100012453 | 3300005459 | Bacteria | 6018 |
| 173 | Ga0070698_100313275 | 3300005471 | Bacteria | 1500 |
| 174 | Ga0070679_100000008 | 3300005530 | Bacteria | 194672 |
| 175 | Ga0070679_100014028 | 3300005530 | Bacteria | 7682 |
| 176 | Ga0070679_100038477 | 3300005530 | Bacteria | 4755 |
| 177 | Ga0070679_100040229 | 3300005530 | Bacteria | 4651 |
| 178 | Ga0070679_100304841 | 3300005530 | Bacteria | 1543 |
| 179 | Ga0070679_100646299 | 3300005530 | Bacteria | 1000 |
| 180 | Ga0070684_100033668 | 3300005535 | Bacteria | 4376 |
| 181 | Ga0070684_100173397 | 3300005535 | Bacteria | 1959 |
| 182 | Ga0070684_100257650 | 3300005535 | Bacteria | 1595 |
| 183 | Ga0070684_100390431 | 3300005535 | Bacteria | 1282 |
| 184 | Ga0068853_100004143 | 3300005539 | Bacteria | 11177 |
| 185 | Ga0068853_100007960 | 3300005539 | Bacteria | 8500 |
| 186 | Ga0068853_100008144 | 3300005539 | Bacteria | 8413 |
| 187 | Ga0068853_100056439 | 3300005539 | Bacteria | 3386 |
| 188 | Ga0068853_100078085 | 3300005539 | Bacteria | 2893 |
| 189 | Ga0068853_100090181 | 3300005539 | Bacteria | 2694 |
| 190 | Ga0068853_100102660 | 3300005539 | Bacteria | 2530 |
| 191 | Ga0068853_100105004 | 3300005539 | Bacteria | 2502 |
| 192 | Ga0068853_100108310 | 3300005539 | Bacteria | 2465 |
| 193 | Ga0068853_100116760 | 3300005539 | Bacteria | 2376 |
| 194 | Ga0068853_100136179 | 3300005539 | Bacteria | 2202 |
| 195 | Ga0068853_100290209 | 3300005539 | Bacteria | 1510 |
| 196 | Ga0068853_100510370 | 3300005539 | Bacteria | 1136 |
| 197 | Ga0070672_100011310 | 3300005543 | Bacteria | 6225 |
| 198 | Ga0070672_100275293 | 3300005543 | Bacteria | 1422 |
| 199 | Ga0070672_100352458 | 3300005543 | Bacteria | 1255 |
| 200 | Ga0070672_100359658 | 3300005543 | Bacteria | 1242 |
| 201 | Ga0070672_100617201 | 3300005543 | Bacteria | 945 |
| 202 | Ga0070686_100000059 | 3300005544 | Bacteria | 84781 |
| 203 | Ga0070696_100006276 | 3300005546 | Bacteria | 7960 |
| 204 | Ga0070696_100011558 | 3300005546 | Bacteria | 5915 |
| 205 | Ga0070693_100093519 | 3300005547 | Bacteria | 1817 |
| 206 | Ga0070693_100178794 | 3300005547 | Bacteria | 1364 |
| 207 | Ga0070665_100000024 | 3300005548 | Bacteria | 374559 |
| 208 | Ga0070665_100000049 | 3300005548 | Bacteria | 261123 |
| 209 | Ga0070665_100000541 | 3300005548 | Bacteria | 53057 |
| 210 | Ga0070665_100049678 | 3300005548 | Bacteria | 4208 |
| 211 | Ga0070665_100053287 | 3300005548 | Bacteria | 4057 |
| 212 | Ga0070665_100057319 | 3300005548 | Bacteria | 3906 |
| 213 | Ga0070665_100557937 | 3300005548 | Bacteria | 1158 |
| 214 | Ga0068855_100000780 | 3300005563 | Bacteria | 39315 |
| 215 | Ga0068855_100002861 | 3300005563 | Bacteria | 21208 |
| 216 | Ga0068855_100032263 | 3300005563 | Bacteria | 6254 |
| 217 | Ga0068855_100064616 | 3300005563 | Bacteria | 4268 |
| 218 | Ga0068855_100076235 | 3300005563 | Bacteria | 3892 |
| 219 | Ga0068855_100104230 | 3300005563 | Bacteria | 3263 |
| 220 | Ga0068855_100238315 | 3300005563 | Bacteria | 2034 |
| 221 | Ga0070664_100000738 | 3300005564 | Bacteria | 25207 |
| 222 | Ga0070664_100010085 | 3300005564 | Bacteria | 7658 |
| 223 | Ga0070664_100139198 | 3300005564 | Bacteria | 2136 |
| 224 | Ga0070664_100169999 | 3300005564 | Bacteria | 1933 |
| 225 | Ga0070664_100242350 | 3300005564 | Bacteria | 1619 |
| 226 | Ga0070664_100421340 | 3300005564 | Bacteria | 1223 |
| 227 | Ga0070664_100447181 | 3300005564 | Bacteria | 1186 |
| 228 | Ga0070664_100550870 | 3300005564 | Bacteria | 1066 |
| 229 | Ga0068857_100001963 | 3300005577 | Bacteria | 16623 |
| 230 | Ga0068857_100016345 | 3300005577 | Bacteria | 6501 |
| 231 | Ga0068857_100019067 | 3300005577 | Bacteria | 6020 |
| 232 | Ga0068857_100482959 | 3300005577 | Bacteria | 1161 |
| 233 | Ga0068854_100004099 | 3300005578 | Bacteria | 9155 |
| 234 | Ga0068854_100025243 | 3300005578 | Bacteria | 4077 |
| 235 | Ga0068854_100072441 | 3300005578 | Bacteria | 2523 |
| 236 | Ga0068854_100075843 | 3300005578 | Bacteria | 2470 |
| 237 | Ga0068854_100325360 | 3300005578 | Bacteria | 1251 |
| 238 | Ga0068856_100034050 | 3300005614 | Bacteria | 4989 |
| 239 | Ga0068856_100085893 | 3300005614 | Bacteria | 3126 |
| 240 | Ga0068852_100000562 | 3300005616 | Bacteria | 24464 |
| 241 | Ga0068852_100022610 | 3300005616 | Bacteria | 5045 |
| 242 | Ga0068852_100081967 | 3300005616 | Bacteria | 2865 |
| 243 | Ga0068852_100186517 | 3300005616 | Bacteria | 1954 |
| 244 | Ga0068852_100589012 | 3300005616 | Bacteria | 1116 |
| 245 | Ga0068852_100628212 | 3300005616 | Bacteria | 1080 |
| 246 | Ga0068852_100774218 | 3300005616 | Bacteria | 973 |
| 247 | Ga0068859_100000934 | 3300005617 | Bacteria | 29961 |
| 248 | Ga0068859_100003670 | 3300005617 | Bacteria | 15635 |
| 249 | Ga0068859_100005706 | 3300005617 | Bacteria | 12662 |
| 250 | Ga0068859_100006035 | 3300005617 | Bacteria | 12305 |
| 251 | Ga0068859_100011213 | 3300005617 | Bacteria | 9013 |
| 252 | Ga0068864_100000181 | 3300005618 | Bacteria | 58221 |
| 253 | Ga0068864_100000560 | 3300005618 | Bacteria | 31787 |
| 254 | Ga0068864_100000652 | 3300005618 | Bacteria | 28966 |
| 255 | Ga0068864_100010323 | 3300005618 | Bacteria | 7713 |
| 256 | Ga0068864_100020751 | 3300005618 | Bacteria | 5498 |
| 257 | Ga0068864_100048137 | 3300005618 | Bacteria | 3664 |
| 258 | Ga0068861_100000414 | 3300005719 | Bacteria | 24709 |
| 259 | Ga0068861_100052916 | 3300005719 | Bacteria | 3087 |
| 260 | Ga0068861_100536875 | 3300005719 | Bacteria | 1063 |
| 261 | Ga0068851_10144683 | 3300005834 | Bacteria | 1295 |
| 262 | Ga0068863_100000011 | 3300005841 | Bacteria | 232287 |
| 263 | Ga0068863_100003320 | 3300005841 | Bacteria | 15888 |
| 264 | Ga0068863_100015750 | 3300005841 | Bacteria | 7260 |
| 265 | Ga0068863_100020361 | 3300005841 | Bacteria | 6343 |
| 266 | Ga0068863_100028370 | 3300005841 | Bacteria | 5344 |
| 267 | Ga0068863_100062424 | 3300005841 | Bacteria | 3524 |
| 268 | Ga0068863_100078666 | 3300005841 | Bacteria | 3123 |
| 269 | Ga0068863_100471478 | 3300005841 | Bacteria | 1234 |
| 270 | Ga0068858_100000338 | 3300005842 | Bacteria | 49699 |
| 271 | Ga0068858_100000986 | 3300005842 | Bacteria | 29374 |
| 272 | Ga0068858_100002349 | 3300005842 | Bacteria | 19115 |
| 273 | Ga0068858_100004683 | 3300005842 | Bacteria | 13409 |
| 274 | Ga0068858_100188402 | 3300005842 | Bacteria | 1949 |
| 275 | Ga0068860_100010006 | 3300005843 | Bacteria | 9401 |
| 276 | Ga0068860_100014755 | 3300005843 | Bacteria | 7641 |
| 277 | Ga0068860_100017212 | 3300005843 | Bacteria | 7046 |
| 278 | Ga0068860_100028785 | 3300005843 | Bacteria | 5346 |
| 279 | Ga0068860_100034629 | 3300005843 | Bacteria | 4845 |
| 280 | Ga0068860_100036466 | 3300005843 | Bacteria | 4711 |
| 281 | Ga0068860_100258680 | 3300005843 | Bacteria | 1696 |
| 282 | Ga0068860_100483411 | 3300005843 | Unclassified | 1234 |
| 283 | Ga0068862_100000307 | 3300005844 | Bacteria | 53788 |
| 284 | Ga0068862_100003180 | 3300005844 | Bacteria | 14239 |
| 285 | Ga0068862_100049721 | 3300005844 | Bacteria | 3581 |
| 286 | Ga0068862_100130515 | 3300005844 | Bacteria | 2222 |
| 287 | Ga0068862_100178377 | 3300005844 | Bacteria | 1905 |
| 288 | Ga0081455_10000964 | 3300005937 | Bacteria | 36801 |
| 289 | Ga0081455_10212806 | 3300005937 | Bacteria | 1439 |
| 290 | Ga0081540_1065923 | 3300005983 | Bacteria | 1700 |
| 291 | Ga0070717_10208178 | 3300006028 | Bacteria | 1716 |
| 292 | Ga0075364_10170292 | 3300006051 | Bacteria | 1472 |
| 293 | Ga0075432_10000082 | 3300006058 | Bacteria | 19252 |
| 294 | Ga0070712_100203270 | 3300006175 | Bacteria | 1557 |
| 295 | Ga0075362_10034249 | 3300006177 | Bacteria | 2213 |
| 296 | Ga0075362_10141469 | 3300006177 | Bacteria | 1150 |
| 297 | Ga0075369_10013769 | 3300006186 | Bacteria | 3218 |
| 298 | Ga0075366_10101406 | 3300006195 | Bacteria | 1727 |
| 299 | Ga0097621_100027264 | 3300006237 | Bacteria | 4491 |
| 300 | Ga0097621_100074960 | 3300006237 | Bacteria | 2803 |
| 301 | Ga0097621_100304594 | 3300006237 | Bacteria | 1408 |
| 302 | Ga0075370_10002507 | 3300006353 | Bacteria | 8524 |
| 303 | Ga0075370_10237265 | 3300006353 | Bacteria | 1079 |
| 304 | Ga0075370_10260992 | 3300006353 | Bacteria | 1027 |
| 305 | Ga0075430_100033702 | 3300006846 | Bacteria | 4346 |
| 306 | Ga0075434_100301885 | 3300006871 | Bacteria | 1622 |
| 307 | Ga0068865_100000775 | 3300006881 | Bacteria | 17940 |
| 308 | Ga0097620_100000934 | 3300006931 | Bacteria | 29961 |
| 309 | Ga0097620_100003670 | 3300006931 | Bacteria | 15635 |
| 310 | Ga0097620_100005706 | 3300006931 | Bacteria | 12662 |
| 311 | Ga0097620_100006035 | 3300006931 | Bacteria | 12305 |
| 312 | Ga0097620_100011215 | 3300006931 | Bacteria | 9013 |
| 313 | Ga0079104_1013431 | 3300006946 | Bacteria | 2522 |
| 314 | Ga0105251_10019640 | 3300009011 | Bacteria | 3564 |
| 315 | Ga0105240_10035590 | 3300009093 | Bacteria | 6415 |
| 316 | Ga0105240_10074553 | 3300009093 | Bacteria | 4188 |
| 317 | Ga0105240_10348809 | 3300009093 | Bacteria | 1680 |
| 318 | Ga0111539_10043818 | 3300009094 | Bacteria | 5363 |
| 319 | Ga0111539_10133704 | 3300009094 | Bacteria | 2904 |
| 320 | Ga0111539_10260122 | 3300009094 | Bacteria | 2020 |
| 321 | Ga0105245_10000120 | 3300009098 | Bacteria | 75923 |
| 322 | Ga0105245_10001533 | 3300009098 | Bacteria | 20938 |
| 323 | Ga0105245_10078423 | 3300009098 | Bacteria | 3014 |
| 324 | Ga0105245_10235701 | 3300009098 | Bacteria | 1772 |
| 325 | Ga0105245_10934896 | 3300009098 | Bacteria | 910 |
| 326 | Ga0105247_10004401 | 3300009101 | Bacteria | 8986 |
| 327 | Ga0105247_10137751 | 3300009101 | Unclassified | 1596 |
| 328 | Ga0114129_10116412 | 3300009147 | Bacteria | 3684 |
| 329 | Ga0114129_10293032 | 3300009147 | Bacteria | 2171 |
| 330 | Ga0114129_10751408 | 3300009147 | Bacteria | 1248 |
| 331 | Ga0105243_10000113 | 3300009148 | Bacteria | 93087 |
| 332 | Ga0105243_10019774 | 3300009148 | Bacteria | 5105 |
| 333 | Ga0105243_10082629 | 3300009148 | Bacteria | 2626 |
| 334 | Ga0105241_10025707 | 3300009174 | Bacteria | 4377 |
| 335 | Ga0105241_10120633 | 3300009174 | Bacteria | 2111 |
| 336 | Ga0105242_10814588 | 3300009176 | Bacteria | 925 |
| 337 | Ga0105248_10000256 | 3300009177 | Bacteria | 62138 |
| 338 | Ga0105248_10000400 | 3300009177 | Bacteria | 50262 |
| 339 | Ga0105248_10017191 | 3300009177 | Bacteria | 7969 |
| 340 | Ga0105248_10019300 | 3300009177 | Bacteria | 7543 |
| 341 | Ga0105248_10049925 | 3300009177 | Bacteria | 4691 |
| 342 | Ga0105248_10146066 | 3300009177 | Bacteria | 2669 |
| 343 | Ga0105248_10164291 | 3300009177 | Bacteria | 2503 |
| 344 | Ga0105248_10168191 | 3300009177 | Bacteria | 2471 |
| 345 | Ga0105237_10002575 | 3300009545 | Bacteria | 22351 |
| 346 | Ga0105238_10058377 | 3300009551 | Bacteria | 3868 |
| 347 | Ga0105249_10009644 | 3300009553 | Bacteria | 8462 |
| 348 | Ga0105249_10011174 | 3300009553 | Bacteria | 7888 |
| 349 | Ga0105249_10021020 | 3300009553 | Bacteria | 5841 |
| 350 | Ga0105249_10190214 | 3300009553 | Bacteria | 2003 |
| 351 | Ga0105249_10441162 | 3300009553 | Bacteria | 1339 |
| 352 | Ga0105249_10730645 | 3300009553 | Bacteria | 1051 |
| 353 | Ga0105239_10075291 | 3300010375 | Bacteria | 3711 |
| 354 | Ga0105239_10622658 | 3300010375 | Bacteria | 1232 |
| 355 | Ga0105246_10000160 | 3300011119 | Bacteria | 32154 |
| 356 | Ga0105246_10001420 | 3300011119 | Bacteria | 14190 |
| 357 | Ga0105246_10486402 | 3300011119 | Bacteria | 1045 |
| 358 | Ga0157373_10002630 | 3300013100 | Bacteria | 13620 |
| 359 | Ga0157373_10023182 | 3300013100 | Bacteria | 4502 |
| 360 | Ga0157373_10038833 | 3300013100 | Bacteria | 3411 |
| 361 | Ga0157373_10049331 | 3300013100 | Bacteria | 3000 |
| 362 | Ga0157373_10128340 | 3300013100 | Bacteria | 1783 |
| 363 | Ga0157373_10327634 | 3300013100 | Bacteria | 1090 |
| 364 | Ga0157371_10000114 | 3300013102 | Bacteria | 122406 |
| 365 | Ga0157371_10002108 | 3300013102 | Bacteria | 19391 |
| 366 | Ga0157371_10013797 | 3300013102 | Bacteria | 6121 |
| 367 | Ga0157371_10036127 | 3300013102 | Bacteria | 3538 |
| 368 | Ga0157371_10061311 | 3300013102 | Bacteria | 2667 |
| 369 | Ga0157371_10126617 | 3300013102 | Bacteria | 1817 |
| 370 | Ga0157371_10373290 | 3300013102 | Bacteria | 1041 |
| 371 | Ga0157370_10114356 | 3300013104 | Bacteria | 2521 |
| 372 | Ga0157369_10032870 | 3300013105 | Bacteria | 5702 |
| 373 | Ga0157369_10039817 | 3300013105 | Bacteria | 5135 |
| 374 | Ga0157369_10060405 | 3300013105 | Bacteria | 4088 |
| 375 | Ga0157369_10138316 | 3300013105 | Bacteria | 2578 |
| 376 | Ga0157369_10453915 | 3300013105 | Bacteria | 1327 |
| 377 | Ga0157374_10090243 | 3300013296 | Bacteria | 2921 |
| 378 | Ga0157374_10225674 | 3300013296 | Bacteria | 1839 |
| 379 | Ga0157378_10044452 | 3300013297 | Bacteria | 3945 |
| 380 | Ga0157378_10203789 | 3300013297 | Bacteria | 1872 |
| 381 | Ga0163162_10020908 | 3300013306 | Bacteria | 6437 |
| 382 | Ga0163162_10102278 | 3300013306 | Bacteria | 2958 |
| 383 | Ga0163162_10220426 | 3300013306 | Bacteria | 2027 |
| 384 | Ga0157372_10028966 | 3300013307 | Bacteria | 6042 |
| 385 | Ga0157375_10160157 | 3300013308 | Bacteria | 2392 |
| 386 | Ga0157375_10198094 | 3300013308 | Bacteria | 2164 |
| 387 | Ga0157375_10447835 | 3300013308 | Bacteria | 1457 |
| 388 | Ga0157375_10501238 | 3300013308 | Bacteria | 1378 |
| 389 | Ga0157375_10598194 | 3300013308 | Bacteria | 1262 |
| 390 | Ga0157375_10712577 | 3300013308 | Unclassified | 1157 |
| 391 | Ga0163163_10023225 | 3300014325 | Bacteria | 5883 |
| 392 | Ga0163163_10111881 | 3300014325 | Bacteria | 2759 |
| 393 | Ga0157380_10033099 | 3300014326 | Bacteria | 3979 |
| 394 | Ga0157380_10507749 | 3300014326 | Bacteria | 1173 |
| 395 | Ga0182008_10173442 | 3300014497 | Bacteria | 1089 |
| 396 | Ga0157377_10181641 | 3300014745 | Bacteria | 1323 |
| 397 | Ga0157377_10340657 | 3300014745 | Bacteria | 1003 |
| 398 | Ga0157379_10002639 | 3300014968 | Bacteria | 15087 |
| 399 | Ga0157379_10375636 | 3300014968 | Bacteria | 1304 |
| 400 | Ga0157379_10520736 | 3300014968 | Bacteria | 1104 |
| 401 | Ga0163161_10012240 | 3300017792 | Bacteria | 5952 |
| 402 | Ga0163161_10088745 | 3300017792 | Bacteria | 2286 |
| 403 | Ga0163161_10119588 | 3300017792 | Bacteria | 1978 |
| 404 | Ga0163161_10282621 | 3300017792 | Bacteria | 1302 |
| 405 | Ga0206356_11779621 | 3300020070 | Bacteria | 2004 |
| 406 | Ga0209563_100081 | 3300025230 | Bacteria | 199455 |
| 407 | Ga0209437_104409 | 3300025233 | Bacteria | 2483 |
| 408 | Ga0207425_1000005 | 3300025245 | Bacteria | 900502 |
| 409 | Ga0209148_1000008 | 3300025254 | Bacteria | 1504371 |
| 410 | Ga0209129_1000526 | 3300025258 | Bacteria | 26748 |
| 411 | Ga0209233_1000140 | 3300025261 | Bacteria | 193274 |
| 412 | Ga0209233_1006894 | 3300025261 | Bacteria | 3634 |
| 413 | Ga0209565_1000044 | 3300025263 | Bacteria | 229969 |
| 414 | Ga0209455_1000002 | 3300025272 | Bacteria | 1505459 |
| 415 | Ga0209673_1022156 | 3300025273 | Bacteria | 2200 |
| 416 | Ga0209676_1006640 | 3300025292 | Bacteria | 5649 |
| 417 | Ga0209676_1015467 | 3300025292 | Bacteria | 2807 |
| 418 | Ga0209025_1000128 | 3300025294 | Bacteria | 198859 |
| 419 | Ga0209564_1001630 | 3300025295 | Bacteria | 21749 |
| 420 | Ga0209564_1004768 | 3300025295 | Bacteria | 8099 |
| 421 | Ga0209758_1000002 | 3300025297 | Bacteria | 1400310 |
| 422 | Ga0209758_1000017 | 3300025297 | Bacteria | 754393 |
| 423 | Ga0209758_1037345 | 3300025297 | Bacteria | 1879 |
| 424 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 425 | Ga0209050_1000140 | 3300025298 | Bacteria | 173241 |
| 426 | Ga0209050_1011915 | 3300025298 | Bacteria | 4055 |
| 427 | Ga0209050_1034182 | 3300025298 | Bacteria | 1527 |
| 428 | Ga0207426_1013899 | 3300025302 | Bacteria | 2967 |
| 429 | Ga0209051_1000797 | 3300025303 | Bacteria | 33107 |
| 430 | Ga0209257_1002519 | 3300025304 | Bacteria | 18001 |
| 431 | Ga0209257_1002670 | 3300025304 | Bacteria | 17111 |
| 432 | Ga0209257_1010120 | 3300025304 | Bacteria | 4863 |
| 433 | Ga0207697_10000244 | 3300025315 | Bacteria | 29795 |
| 434 | Ga0207697_10000260 | 3300025315 | Bacteria | 29097 |
| 435 | Ga0207697_10009084 | 3300025315 | Bacteria | 4306 |
| 436 | Ga0207656_10161624 | 3300025321 | Bacteria | 1066 |
| 437 | Ga0207682_10000110 | 3300025893 | Bacteria | 37556 |
| 438 | Ga0207682_10037745 | 3300025893 | Bacteria | 1958 |
| 439 | Ga0207682_10062222 | 3300025893 | Bacteria | 1564 |
| 440 | Ga0207682_10171435 | 3300025893 | Bacteria | 987 |
| 441 | Ga0207710_10011691 | 3300025900 | Bacteria | 3692 |
| 442 | Ga0207688_10000225 | 3300025901 | Bacteria | 25468 |
| 443 | Ga0207688_10068543 | 3300025901 | Bacteria | 2009 |
| 444 | Ga0207688_10087540 | 3300025901 | Bacteria | 1786 |
| 445 | Ga0207688_10135512 | 3300025901 | Bacteria | 1446 |
| 446 | Ga0207680_10000439 | 3300025903 | Bacteria | 19657 |
| 447 | Ga0207647_10000052 | 3300025904 | Bacteria | 87651 |
| 448 | Ga0207647_10004308 | 3300025904 | Bacteria | 10553 |
| 449 | Ga0207647_10048616 | 3300025904 | Bacteria | 2634 |
| 450 | Ga0207647_10058442 | 3300025904 | Bacteria | 2362 |
| 451 | Ga0207645_10011101 | 3300025907 | Bacteria | 6162 |
| 452 | Ga0207645_10014890 | 3300025907 | Bacteria | 5187 |
| 453 | Ga0207645_10081385 | 3300025907 | Bacteria | 2076 |
| 454 | Ga0207705_10000658 | 3300025909 | Bacteria | 28794 |
| 455 | Ga0207705_10002088 | 3300025909 | Bacteria | 15529 |
| 456 | Ga0207705_10002734 | 3300025909 | Bacteria | 13521 |
| 457 | Ga0207705_10003400 | 3300025909 | Bacteria | 12098 |
| 458 | Ga0207705_10004744 | 3300025909 | Bacteria | 10238 |
| 459 | Ga0207705_10019495 | 3300025909 | Bacteria | 4850 |
| 460 | Ga0207705_10021171 | 3300025909 | Bacteria | 4638 |
| 461 | Ga0207705_10158196 | 3300025909 | Bacteria | 1701 |
| 462 | Ga0207705_10221527 | 3300025909 | Bacteria | 1437 |
| 463 | Ga0207705_10260726 | 3300025909 | Bacteria | 1323 |
| 464 | Ga0207705_10366033 | 3300025909 | Bacteria | 1112 |
| 465 | Ga0207705_10410980 | 3300025909 | Bacteria | 1047 |
| 466 | Ga0207654_10014233 | 3300025911 | Bacteria | 4108 |
| 467 | Ga0207654_10276736 | 3300025911 | Bacteria | 1134 |
| 468 | Ga0207654_10648483 | 3300025911 | Bacteria | 756 |
| 469 | Ga0207707_10007643 | 3300025912 | Bacteria | 9417 |
| 470 | Ga0207707_10011692 | 3300025912 | Bacteria | 7640 |
| 471 | Ga0207707_10186703 | 3300025912 | Bacteria | 1809 |
| 472 | Ga0207695_10031036 | 3300025913 | Bacteria | 5872 |
| 473 | Ga0207695_10355166 | 3300025913 | Bacteria | 1352 |
| 474 | Ga0207671_10001065 | 3300025914 | Bacteria | 33324 |
| 475 | Ga0207671_10017233 | 3300025914 | Bacteria | 5580 |
| 476 | Ga0207693_10026672 | 3300025915 | Bacteria | 4571 |
| 477 | Ga0207660_10003179 | 3300025917 | Bacteria | 10739 |
| 478 | Ga0207660_10008606 | 3300025917 | Bacteria | 6600 |
| 479 | Ga0207660_10073175 | 3300025917 | Bacteria | 2498 |
| 480 | Ga0207660_10570949 | 3300025917 | Bacteria | 920 |
| 481 | Ga0207657_10002591 | 3300025919 | Bacteria | 19567 |
| 482 | Ga0207657_10002788 | 3300025919 | Bacteria | 18798 |
| 483 | Ga0207657_10004362 | 3300025919 | Bacteria | 14986 |
| 484 | Ga0207657_10006324 | 3300025919 | Bacteria | 12306 |
| 485 | Ga0207657_10014781 | 3300025919 | Bacteria | 7600 |
| 486 | Ga0207657_10022552 | 3300025919 | Bacteria | 5886 |
| 487 | Ga0207657_10023328 | 3300025919 | Bacteria | 5763 |
| 488 | Ga0207657_10056280 | 3300025919 | Bacteria | 3394 |
| 489 | Ga0207657_10173661 | 3300025919 | Bacteria | 1745 |
| 490 | Ga0207657_10189914 | 3300025919 | Bacteria | 1658 |
| 491 | Ga0207649_10000104 | 3300025920 | Bacteria | 69778 |
| 492 | Ga0207649_10037876 | 3300025920 | Bacteria | 2916 |
| 493 | Ga0207649_10055556 | 3300025920 | Bacteria | 2469 |
| 494 | Ga0207649_10080584 | 3300025920 | Bacteria | 2106 |
| 495 | Ga0207649_10318133 | 3300025920 | Bacteria | 1142 |
| 496 | Ga0207649_10405868 | 3300025920 | Bacteria | 1020 |
| 497 | Ga0207652_10000008 | 3300025921 | Bacteria | 286698 |
| 498 | Ga0207652_10003272 | 3300025921 | Bacteria | 13421 |
| 499 | Ga0207652_10011805 | 3300025921 | Bacteria | 7049 |
| 500 | Ga0207652_10085290 | 3300025921 | Bacteria | 2768 |
| 501 | Ga0207652_10087574 | 3300025921 | Bacteria | 2731 |
| 502 | Ga0207652_10343906 | 3300025921 | Bacteria | 1346 |
| 503 | Ga0207652_10505052 | 3300025921 | Bacteria | 1088 |
| 504 | Ga0207681_10000004 | 3300025923 | Bacteria | 559005 |
| 505 | Ga0207681_10002587 | 3300025923 | Bacteria | 11459 |
| 506 | Ga0207681_10016147 | 3300025923 | Bacteria | 4665 |
| 507 | Ga0207681_10025190 | 3300025923 | Bacteria | 3824 |
| 508 | Ga0207681_10048992 | 3300025923 | Bacteria | 2854 |
| 509 | Ga0207681_10110407 | 3300025923 | Bacteria | 1999 |
| 510 | Ga0207694_10007740 | 3300025924 | Bacteria | 8135 |
| 511 | Ga0207694_10093691 | 3300025924 | Bacteria | 2373 |
| 512 | Ga0207694_10422429 | 3300025924 | Bacteria | 1111 |
| 513 | Ga0207650_10004421 | 3300025925 | Bacteria | 9604 |
| 514 | Ga0207650_10006658 | 3300025925 | Bacteria | 7881 |
| 515 | Ga0207650_10058187 | 3300025925 | Bacteria | 2877 |
| 516 | Ga0207650_10143679 | 3300025925 | Bacteria | 1878 |
| 517 | Ga0207650_10187840 | 3300025925 | Bacteria | 1650 |
| 518 | Ga0207650_10212543 | 3300025925 | Bacteria | 1554 |
| 519 | Ga0207659_10233763 | 3300025926 | Bacteria | 1484 |
| 520 | Ga0207659_10307988 | 3300025926 | Bacteria | 1303 |
| 521 | Ga0207659_10416938 | 3300025926 | Bacteria | 1125 |
| 522 | Ga0207659_10662489 | 3300025926 | Bacteria | 892 |
| 523 | Ga0207687_10006406 | 3300025927 | Bacteria | 7776 |
| 524 | Ga0207687_10334769 | 3300025927 | Bacteria | 1229 |
| 525 | Ga0207687_10584201 | 3300025927 | Bacteria | 940 |
| 526 | Ga0207700_10539880 | 3300025928 | Bacteria | 1034 |
| 527 | Ga0207664_10280228 | 3300025929 | Bacteria | 1463 |
| 528 | Ga0207644_10000009 | 3300025931 | Bacteria | 251643 |
| 529 | Ga0207644_10000021 | 3300025931 | Bacteria | 165175 |
| 530 | Ga0207644_10010959 | 3300025931 | Bacteria | 5989 |
| 531 | Ga0207644_10081673 | 3300025931 | Bacteria | 2389 |
| 532 | Ga0207644_10101729 | 3300025931 | Bacteria | 2160 |
| 533 | Ga0207644_10118428 | 3300025931 | Bacteria | 2012 |
| 534 | Ga0207644_10127541 | 3300025931 | Bacteria | 1944 |
| 535 | Ga0207690_10000022 | 3300025932 | Bacteria | 215772 |
| 536 | Ga0207690_10000463 | 3300025932 | Bacteria | 26092 |
| 537 | Ga0207690_10002801 | 3300025932 | Bacteria | 10522 |
| 538 | Ga0207690_10012242 | 3300025932 | Bacteria | 5133 |
| 539 | Ga0207690_10017740 | 3300025932 | Bacteria | 4353 |
| 540 | Ga0207690_10023696 | 3300025932 | Bacteria | 3835 |
| 541 | Ga0207690_10058479 | 3300025932 | Bacteria | 2607 |
| 542 | Ga0207690_10160746 | 3300025932 | Bacteria | 1674 |
| 543 | Ga0207690_10215159 | 3300025932 | Bacteria | 1467 |
| 544 | Ga0207690_10232839 | 3300025932 | Bacteria | 1415 |
| 545 | Ga0207706_10001178 | 3300025933 | Bacteria | 26405 |
| 546 | Ga0207706_10009206 | 3300025933 | Bacteria | 9073 |
| 547 | Ga0207706_10010997 | 3300025933 | Bacteria | 8251 |
| 548 | Ga0207706_10036973 | 3300025933 | Bacteria | 4336 |
| 549 | Ga0207706_10044088 | 3300025933 | Bacteria | 3953 |
| 550 | Ga0207706_10236690 | 3300025933 | Bacteria | 1596 |
| 551 | Ga0207706_10523470 | 3300025933 | Bacteria | 1022 |
| 552 | Ga0207709_10000116 | 3300025935 | Bacteria | 123061 |
| 553 | Ga0207709_10017683 | 3300025935 | Bacteria | 3982 |
| 554 | Ga0207709_10252183 | 3300025935 | Bacteria | 1289 |
| 555 | Ga0207669_10001099 | 3300025937 | Bacteria | 11547 |
| 556 | Ga0207669_10001331 | 3300025937 | Bacteria | 10512 |
| 557 | Ga0207669_10180270 | 3300025937 | Bacteria | 1513 |
| 558 | Ga0207669_10220293 | 3300025937 | Bacteria | 1392 |
| 559 | Ga0207704_10015412 | 3300025938 | Bacteria | 3894 |
| 560 | Ga0207691_10042920 | 3300025940 | Bacteria | 4168 |
| 561 | Ga0207691_10049967 | 3300025940 | Bacteria | 3830 |
| 562 | Ga0207691_10144798 | 3300025940 | Bacteria | 2092 |
| 563 | Ga0207691_10210733 | 3300025940 | Bacteria | 1688 |
| 564 | Ga0207691_10320826 | 3300025940 | Bacteria | 1328 |
| 565 | Ga0207691_10328355 | 3300025940 | Bacteria | 1311 |
| 566 | Ga0207711_10002898 | 3300025941 | Bacteria | 15027 |
| 567 | Ga0207711_10003023 | 3300025941 | Bacteria | 14703 |
| 568 | Ga0207711_10004639 | 3300025941 | Bacteria | 11676 |
| 569 | Ga0207711_10015981 | 3300025941 | Bacteria | 6227 |
| 570 | Ga0207711_10061948 | 3300025941 | Bacteria | 3226 |
| 571 | Ga0207711_10103189 | 3300025941 | Bacteria | 2525 |
| 572 | Ga0207711_10106342 | 3300025941 | Bacteria | 2490 |
| 573 | Ga0207689_10000014 | 3300025942 | Bacteria | 122534 |
| 574 | Ga0207689_10053101 | 3300025942 | Bacteria | 3339 |
| 575 | Ga0207661_10037845 | 3300025944 | Bacteria | 3776 |
| 576 | Ga0207661_10146074 | 3300025944 | Bacteria | 2040 |
| 577 | Ga0207661_10163548 | 3300025944 | Bacteria | 1932 |
| 578 | Ga0207661_10221025 | 3300025944 | Bacteria | 1674 |
| 579 | Ga0207679_10000677 | 3300025945 | Bacteria | 22872 |
| 580 | Ga0207679_10019370 | 3300025945 | Bacteria | 4569 |
| 581 | Ga0207679_10020644 | 3300025945 | Bacteria | 4448 |
| 582 | Ga0207679_10035886 | 3300025945 | Bacteria | 3512 |
| 583 | Ga0207679_10098482 | 3300025945 | Bacteria | 2280 |
| 584 | Ga0207679_10138734 | 3300025945 | Bacteria | 1962 |
| 585 | Ga0207679_10346518 | 3300025945 | Bacteria | 1293 |
| 586 | Ga0207667_10000001 | 3300025949 | Bacteria | 1178522 |
| 587 | Ga0207667_10001580 | 3300025949 | Bacteria | 28640 |
| 588 | Ga0207667_10002922 | 3300025949 | Bacteria | 21209 |
| 589 | Ga0207667_10077441 | 3300025949 | Bacteria | 3449 |
| 590 | Ga0207667_10110426 | 3300025949 | Bacteria | 2836 |
| 591 | Ga0207651_10000310 | 3300025960 | Bacteria | 20959 |
| 592 | Ga0207651_10182429 | 3300025960 | Bacteria | 1666 |
| 593 | Ga0207651_10188407 | 3300025960 | Bacteria | 1643 |
| 594 | Ga0207651_10221217 | 3300025960 | Bacteria | 1531 |
| 595 | Ga0207712_10008477 | 3300025961 | Bacteria | 6499 |
| 596 | Ga0207712_10087965 | 3300025961 | Bacteria | 2280 |
| 597 | Ga0207712_10151782 | 3300025961 | Bacteria | 1790 |
| 598 | Ga0207712_10284324 | 3300025961 | Bacteria | 1351 |
| 599 | Ga0207668_10000083 | 3300025972 | Bacteria | 71561 |
| 600 | Ga0207668_10004935 | 3300025972 | Bacteria | 7846 |
| 601 | Ga0207668_10025939 | 3300025972 | Bacteria | 3800 |
| 602 | Ga0207668_10032953 | 3300025972 | Bacteria | 3430 |
| 603 | Ga0207668_10034311 | 3300025972 | Bacteria | 3368 |
| 604 | Ga0207668_10188344 | 3300025972 | Bacteria | 1633 |
| 605 | Ga0207668_10348194 | 3300025972 | Bacteria | 1238 |
| 606 | Ga0207668_10776347 | 3300025972 | Bacteria | 847 |
| 607 | Ga0207640_10001199 | 3300025981 | Bacteria | 14165 |
| 608 | Ga0207640_10065064 | 3300025981 | Bacteria | 2431 |
| 609 | Ga0207640_10121377 | 3300025981 | Bacteria | 1873 |
| 610 | Ga0207640_10271989 | 3300025981 | Bacteria | 1326 |
| 611 | Ga0207658_10000710 | 3300025986 | Bacteria | 28839 |
| 612 | Ga0207658_10005707 | 3300025986 | Bacteria | 8511 |
| 613 | Ga0207658_10009884 | 3300025986 | Bacteria | 6482 |
| 614 | Ga0207658_10100030 | 3300025986 | Bacteria | 2269 |
| 615 | Ga0207658_10155085 | 3300025986 | Bacteria | 1870 |
| 616 | Ga0207658_10168933 | 3300025986 | Bacteria | 1800 |
| 617 | Ga0207658_10444397 | 3300025986 | Bacteria | 1147 |
| 618 | Ga0207677_10000124 | 3300026023 | Bacteria | 63564 |
| 619 | Ga0207677_10000776 | 3300026023 | Bacteria | 18351 |
| 620 | Ga0207677_10024018 | 3300026023 | Bacteria | 3778 |
| 621 | Ga0207703_10000167 | 3300026035 | Bacteria | 76517 |
| 622 | Ga0207703_10001172 | 3300026035 | Bacteria | 24751 |
| 623 | Ga0207703_10014614 | 3300026035 | Bacteria | 6124 |
| 624 | Ga0207703_10031140 | 3300026035 | Bacteria | 4216 |
| 625 | Ga0207703_10313481 | 3300026035 | Unclassified | 1434 |
| 626 | Ga0207639_10004768 | 3300026041 | Bacteria | 9139 |
| 627 | Ga0207639_10011215 | 3300026041 | Bacteria | 6217 |
| 628 | Ga0207639_10027474 | 3300026041 | Bacteria | 4147 |
| 629 | Ga0207639_10029025 | 3300026041 | Bacteria | 4046 |
| 630 | Ga0207639_10043252 | 3300026041 | Bacteria | 3381 |
| 631 | Ga0207639_10048108 | 3300026041 | Bacteria | 3226 |
| 632 | Ga0207639_10062397 | 3300026041 | Bacteria | 2882 |
| 633 | Ga0207639_10076856 | 3300026041 | Bacteria | 2630 |
| 634 | Ga0207639_10092778 | 3300026041 | Bacteria | 2420 |
| 635 | Ga0207639_10170958 | 3300026041 | Bacteria | 1840 |
| 636 | Ga0207639_10240828 | 3300026041 | Bacteria | 1573 |
| 637 | Ga0207639_10247332 | 3300026041 | Bacteria | 1554 |
| 638 | Ga0207639_10346209 | 3300026041 | Bacteria | 1326 |
| 639 | Ga0207639_10461578 | 3300026041 | Bacteria | 1155 |
| 640 | Ga0207639_10465081 | 3300026041 | Bacteria | 1150 |
| 641 | Ga0207678_10000681 | 3300026067 | Bacteria | 31104 |
| 642 | Ga0207678_10004862 | 3300026067 | Bacteria | 12067 |
| 643 | Ga0207678_10013560 | 3300026067 | Bacteria | 7156 |
| 644 | Ga0207678_10017394 | 3300026067 | Bacteria | 6313 |
| 645 | Ga0207678_10078097 | 3300026067 | Bacteria | 2835 |
| 646 | Ga0207678_10082279 | 3300026067 | Bacteria | 2755 |
| 647 | Ga0207678_10122757 | 3300026067 | Bacteria | 2216 |
| 648 | Ga0207678_10196956 | 3300026067 | Bacteria | 1722 |
| 649 | Ga0207708_10087041 | 3300026075 | Bacteria | 2405 |
| 650 | Ga0207702_10001591 | 3300026078 | Bacteria | 22471 |
| 651 | Ga0207702_10015308 | 3300026078 | Bacteria | 6358 |
| 652 | Ga0207702_10343992 | 3300026078 | Unclassified | 1425 |
| 653 | Ga0207641_10000028 | 3300026088 | Bacteria | 232451 |
| 654 | Ga0207641_10007019 | 3300026088 | Bacteria | 9415 |
| 655 | Ga0207641_10019628 | 3300026088 | Bacteria | 5549 |
| 656 | Ga0207641_10025186 | 3300026088 | Bacteria | 4906 |
| 657 | Ga0207641_10028710 | 3300026088 | Bacteria | 4598 |
| 658 | Ga0207641_10031560 | 3300026088 | Bacteria | 4394 |
| 659 | Ga0207641_10048852 | 3300026088 | Bacteria | 3573 |
| 660 | Ga0207648_10001420 | 3300026089 | Bacteria | 26422 |
| 661 | Ga0207648_10054701 | 3300026089 | Bacteria | 3485 |
| 662 | Ga0207648_10360189 | 3300026089 | Bacteria | 1312 |
| 663 | Ga0207676_10000527 | 3300026095 | Bacteria | 32092 |
| 664 | Ga0207676_10000666 | 3300026095 | Bacteria | 27542 |
| 665 | Ga0207676_10005078 | 3300026095 | Bacteria | 9310 |
| 666 | Ga0207676_10033569 | 3300026095 | Bacteria | 3878 |
| 667 | Ga0207676_10069931 | 3300026095 | Bacteria | 2813 |
| 668 | Ga0207676_10078796 | 3300026095 | Bacteria | 2669 |
| 669 | Ga0207674_10000244 | 3300026116 | Bacteria | 67590 |
| 670 | Ga0207674_10004090 | 3300026116 | Bacteria | 17674 |
| 671 | Ga0207674_10016651 | 3300026116 | Bacteria | 8038 |
| 672 | Ga0207674_10042600 | 3300026116 | Bacteria | 4687 |
| 673 | Ga0207674_10277481 | 3300026116 | Bacteria | 1624 |
| 674 | Ga0207674_10305124 | 3300026116 | Bacteria | 1541 |
| 675 | Ga0207675_100000199 | 3300026118 | Bacteria | 55487 |
| 676 | Ga0207675_100000666 | 3300026118 | Bacteria | 33780 |
| 677 | Ga0207675_100134453 | 3300026118 | Bacteria | 2345 |
| 678 | Ga0207675_100590307 | 3300026118 | Bacteria | 1113 |
| 679 | Ga0207683_10001771 | 3300026121 | Bacteria | 19121 |
| 680 | Ga0207683_10278529 | 3300026121 | Bacteria | 1528 |
| 681 | Ga0207683_10288989 | 3300026121 | Bacteria | 1499 |
| 682 | Ga0207698_10005956 | 3300026142 | Bacteria | 7577 |
| 683 | Ga0207698_10013116 | 3300026142 | Bacteria | 5456 |
| 684 | Ga0207698_10021079 | 3300026142 | Bacteria | 4499 |
| 685 | Ga0207698_10021164 | 3300026142 | Bacteria | 4493 |
| 686 | Ga0207698_10064282 | 3300026142 | Bacteria | 2875 |
| 687 | Ga0207698_10277326 | 3300026142 | Bacteria | 1549 |
| 688 | Ga0207698_10506930 | 3300026142 | Bacteria | 1175 |
| 689 | Ga0207698_10711417 | 3300026142 | Bacteria | 1000 |
| 690 | Ga0209281_1005897 | 3300027111 | Bacteria | 3288 |
| 691 | Ga0209983_1010919 | 3300027665 | Bacteria | 1856 |
| 692 | Ga0207428_10015734 | 3300027907 | Bacteria | 6533 |
| 693 | Ga0268266_10000019 | 3300028379 | Bacteria | 556465 |
| 694 | Ga0268266_10000036 | 3300028379 | Bacteria | 348910 |
| 695 | Ga0268266_10001687 | 3300028379 | Bacteria | 25379 |
| 696 | Ga0268266_10028584 | 3300028379 | Bacteria | 4738 |
| 697 | Ga0268266_10109769 | 3300028379 | Bacteria | 2443 |
| 698 | Ga0268265_10000109 | 3300028380 | Bacteria | 104063 |
| 699 | Ga0268265_10004482 | 3300028380 | Bacteria | 9678 |
| 700 | Ga0268264_10000069 | 3300028381 | Bacteria | 270492 |
| 701 | Ga0268264_10004358 | 3300028381 | Bacteria | 12081 |
| 702 | Ga0268264_10004801 | 3300028381 | Bacteria | 11462 |
| 703 | Ga0268264_10009152 | 3300028381 | Bacteria | 8209 |
| 704 | Ga0268264_10039114 | 3300028381 | Bacteria | 3918 |
| 705 | Ga0268264_10149990 | 3300028381 | Unclassified | 2089 |
| 706 | Ga0268264_10197259 | 3300028381 | Bacteria | 1839 |
| 707 | Ga0265318_10000046 | 3300028577 | Bacteria | 126568 |
| 708 | Ga0307517_10007943 | 3300028786 | Bacteria | 15328 |
| 709 | Ga0265338_10047479 | 3300028800 | Bacteria | 3920 |
| 710 | Ga0316177_1101382 | 3300030731 | Bacteria | 1408 |
| 711 | Ga0265327_10020375 | 3300031251 | Bacteria | 4044 |
| 712 | Ga0307513_10043999 | 3300031456 | Bacteria | 4896 |
| 713 | Ga0307513_10212571 | 3300031456 | Bacteria | 1764 |
| 714 | Ga0307513_10339208 | 3300031456 | Bacteria | 1254 |
| 715 | Ga0307408_100020364 | 3300031548 | Bacteria | 4476 |
| 716 | Ga0307408_100047753 | 3300031548 | Bacteria | 3067 |
| 717 | Ga0307408_100059639 | 3300031548 | Bacteria | 2778 |
| 718 | Ga0307408_100187168 | 3300031548 | Bacteria | 1665 |
| 719 | Ga0307408_100496120 | 3300031548 | Bacteria | 1068 |
| 720 | Ga0307408_100831392 | 3300031548 | Bacteria | 840 |
| 721 | Ga0307508_10001242 | 3300031616 | Bacteria | 29119 |
| 722 | Ga0265314_10089683 | 3300031711 | Bacteria | 2005 |
| 723 | Ga0307405_10001143 | 3300031731 | Bacteria | 10886 |
| 724 | Ga0307405_10001791 | 3300031731 | Bacteria | 9189 |
| 725 | Ga0307405_10029574 | 3300031731 | Bacteria | 3203 |
| 726 | Ga0307405_10056225 | 3300031731 | Bacteria | 2467 |
| 727 | Ga0307405_10185068 | 3300031731 | Bacteria | 1499 |
| 728 | Ga0307405_10494911 | 3300031731 | Bacteria | 979 |
| 729 | Ga0307413_10001436 | 3300031824 | Bacteria | 9023 |
| 730 | Ga0307413_10003418 | 3300031824 | Bacteria | 6678 |
| 731 | Ga0307413_10026883 | 3300031824 | Bacteria | 3179 |
| 732 | Ga0307413_10034901 | 3300031824 | Bacteria | 2879 |
| 733 | Ga0307413_10043222 | 3300031824 | Bacteria | 2654 |
| 734 | Ga0307413_10113559 | 3300031824 | Bacteria | 1819 |
| 735 | Ga0307413_10166587 | 3300031824 | Bacteria | 1555 |
| 736 | Ga0307413_10888331 | 3300031824 | Bacteria | 756 |
| 737 | Ga0307410_10006204 | 3300031852 | Bacteria | 6426 |
| 738 | Ga0307410_10008488 | 3300031852 | Bacteria | 5698 |
| 739 | Ga0307410_10012577 | 3300031852 | Bacteria | 4900 |
| 740 | Ga0307410_10063489 | 3300031852 | Bacteria | 2534 |
| 741 | Ga0307410_10120250 | 3300031852 | Bacteria | 1914 |
| 742 | Ga0307410_10135805 | 3300031852 | Bacteria | 1813 |
| 743 | Ga0307410_10211319 | 3300031852 | Bacteria | 1487 |
| 744 | Ga0307410_10221435 | 3300031852 | Bacteria | 1456 |
| 745 | Ga0307410_10326154 | 3300031852 | Bacteria | 1220 |
| 746 | Ga0307410_10549189 | 3300031852 | Bacteria | 957 |
| 747 | Ga0307406_10004895 | 3300031901 | Bacteria | 7294 |
| 748 | Ga0307406_10014574 | 3300031901 | Bacteria | 4526 |
| 749 | Ga0307406_10034013 | 3300031901 | Bacteria | 3124 |
| 750 | Ga0307406_10063684 | 3300031901 | Bacteria | 2390 |
| 751 | Ga0307407_10002091 | 3300031903 | Bacteria | 7655 |
| 752 | Ga0307407_10002700 | 3300031903 | Bacteria | 7039 |
| 753 | Ga0307407_10005183 | 3300031903 | Bacteria | 5626 |
| 754 | Ga0307407_10270209 | 3300031903 | Bacteria | 1173 |
| 755 | Ga0307412_10004442 | 3300031911 | Bacteria | 7812 |
| 756 | Ga0307412_10018121 | 3300031911 | Bacteria | 4229 |
| 757 | Ga0307412_10031357 | 3300031911 | Bacteria | 3356 |
| 758 | Ga0307412_10073649 | 3300031911 | Bacteria | 2337 |
| 759 | Ga0307412_10077414 | 3300031911 | Bacteria | 2288 |
| 760 | Ga0307412_10138016 | 3300031911 | Bacteria | 1782 |
| 761 | Ga0307412_10234555 | 3300031911 | Bacteria | 1415 |
| 762 | Ga0307412_10502205 | 3300031911 | Bacteria | 1010 |
| 763 | Ga0307409_100002533 | 3300031995 | Bacteria | 9581 |
| 764 | Ga0307409_100007426 | 3300031995 | Bacteria | 6554 |
| 765 | Ga0307409_100022011 | 3300031995 | Bacteria | 4385 |
| 766 | Ga0307409_100063032 | 3300031995 | Bacteria | 2905 |
| 767 | Ga0307409_100137150 | 3300031995 | Bacteria | 2101 |
| 768 | Ga0307409_100153145 | 3300031995 | Bacteria | 2005 |
| 769 | Ga0307409_100234250 | 3300031995 | Bacteria | 1667 |
| 770 | Ga0307409_100325951 | 3300031995 | Bacteria | 1439 |
| 771 | Ga0307416_100008545 | 3300032002 | Bacteria | 6616 |
| 772 | Ga0307416_100047316 | 3300032002 | Bacteria | 3403 |
| 773 | Ga0307416_100219558 | 3300032002 | Bacteria | 1821 |
| 774 | Ga0307416_100408484 | 3300032002 | Bacteria | 1398 |
| 775 | Ga0307416_100793181 | 3300032002 | Bacteria | 1042 |
| 776 | Ga0307414_10003894 | 3300032004 | Bacteria | 8038 |
| 777 | Ga0307414_10010707 | 3300032004 | Bacteria | 5339 |
| 778 | Ga0307414_10032504 | 3300032004 | Bacteria | 3436 |
| 779 | Ga0307414_10039799 | 3300032004 | Bacteria | 3169 |
| 780 | Ga0307414_10046248 | 3300032004 | Bacteria | 2986 |
| 781 | Ga0307414_10144556 | 3300032004 | Bacteria | 1867 |
| 782 | Ga0307414_10277319 | 3300032004 | Bacteria | 1407 |
| 783 | Ga0307414_10475657 | 3300032004 | Bacteria | 1101 |
| 784 | Ga0307414_10479712 | 3300032004 | Bacteria | 1096 |
| 785 | Ga0307411_10001555 | 3300032005 | Bacteria | 9488 |
| 786 | Ga0307411_10024979 | 3300032005 | Bacteria | 3571 |
| 787 | Ga0307411_10076290 | 3300032005 | Bacteria | 2291 |
| 788 | Ga0307411_10078928 | 3300032005 | Bacteria | 2258 |
| 789 | Ga0307411_10208932 | 3300032005 | Bacteria | 1506 |
| 790 | Ga0307411_10327119 | 3300032005 | Bacteria | 1240 |
| 791 | Ga0307411_10500354 | 3300032005 | Bacteria | 1027 |
| 792 | Ga0307411_10577536 | 3300032005 | Unclassified | 963 |
| 793 | Ga0307411_10725215 | 3300032005 | Bacteria | 868 |
| 794 | Ga0307415_100000632 | 3300032126 | Bacteria | 15442 |
| 795 | Ga0307415_100002383 | 3300032126 | Bacteria | 9366 |
| 796 | Ga0307415_100041995 | 3300032126 | Bacteria | 3040 |
| 797 | Ga0307415_100086361 | 3300032126 | Bacteria | 2257 |
| 798 | Ga0307415_100142512 | 3300032126 | Bacteria | 1833 |
| 799 | Ga0307510_10103418 | 3300033180 | Bacteria | 2626 |
| 800 | Ga0373923_0062819 | 3300035111 | Bacteria | 1581 |
| 801 | Ga0373923_0065455 | 3300035111 | Bacteria | 1551 |
| 802 | Ga0373953_0023016 | 3300035117 | Bacteria | 2356 |
| 803 | Ga0373943_0006039 | 3300035170 | Bacteria | 5437 |
| 804 | Ga0373955_0000936 | 3300035172 | Bacteria | 12491 |
| 805 | Ga0373931_0002063 | 3300035691 | Bacteria | 8836 |
| 806 | Ga0373935_0308362 | 3300035692 | Bacteria | 1120 |
| 807 | Ga0373937_0004532 | 3300036401 | Bacteria | 11800 |
| 808 | Ga0373925_0011013 | 3300037068 | Bacteria | 6567 |
| 809 | Ga0395899_0006947 | 3300037312 | Bacteria | 8767 |
| 810 | Ga0395899_0074811 | 3300037312 | Bacteria | 2474 |
| 811 | Ga0395899_0140577 | 3300037312 | Bacteria | 1718 |
| 812 | Ga0395899_0155446 | 3300037312 | Bacteria | 1618 |
| 813 | Ga0395899_0166709 | 3300037312 | Unclassified | 1553 |
| 814 | Ga0395900_0000336 | 3300037418 | Bacteria | 69212 |
| 815 | Ga0395900_0005712 | 3300037418 | Bacteria | 13000 |
| 816 | Ga0395900_0050979 | 3300037418 | Bacteria | 4263 |
| 817 | Ga0395900_0078289 | 3300037418 | Bacteria | 3397 |
| 818 | Ga0395900_0083504 | 3300037418 | Bacteria | 3281 |
| 819 | Ga0395900_0104552 | 3300037418 | Bacteria | 2909 |
| 820 | Ga0395900_0145175 | 3300037418 | Bacteria | 2426 |
| 821 | Ga0395900_0167501 | 3300037418 | Bacteria | 2238 |
| 822 | Ga0395898_0016208 | 3300037466 | Bacteria | 7631 |
| 823 | Ga0395898_0022790 | 3300037466 | Bacteria | 6337 |
| 824 | Ga0395898_0294833 | 3300037466 | Bacteria | 1547 |
| 825 | Ga0395898_0423500 | 3300037466 | Bacteria | 1268 |
| 826 | Ga0395898_0858978 | 3300037466 | Bacteria | 846 |
| 827 | Ga0395905_0029283 | 3300037471 | Bacteria | 5189 |
| 828 | Ga0395905_0054283 | 3300037471 | Bacteria | 3750 |
| 829 | Ga0395905_0084437 | 3300037471 | Bacteria | 2975 |
| 830 | Ga0395905_0090504 | 3300037471 | Bacteria | 2868 |
| 831 | Ga0395905_0110002 | 3300037471 | Bacteria | 2587 |
| 832 | Ga0395905_0117033 | 3300037471 | Bacteria | 2504 |
| 833 | Ga0395905_0319064 | 3300037471 | Bacteria | 1443 |
| 834 | Ga0395901_0000398 | 3300038443 | Bacteria | 51885 |
| 835 | Ga0395901_0002173 | 3300038443 | Bacteria | 20032 |
| 836 | Ga0395901_0124817 | 3300038443 | Bacteria | 2705 |
| 837 | Ga0395901_0139053 | 3300038443 | Bacteria | 2552 |
| 838 | Ga0395901_0222418 | 3300038443 | Bacteria | 1973 |
| 839 | Ga0395901_0278471 | 3300038443 | Bacteria | 1738 |
| 840 | Ga0237819_00292 | 3300038705 | Bacteria | 18420 |
| 841 | Ga0436365_1902390 | 3300039437 | Bacteria | 4486 |
| 842 | Ga0436363_0606517 | 3300039450 | Bacteria | 819 |
| 843 | Ga0436363_1122466 | 3300039450 | Bacteria | 1052 |
| 844 | Ga0439465_0081722 | 3300041413 | Bacteria | 1096 |
| 845 | Ga0439431_0001810 | 3300041997 | Bacteria | 4729 |
| 846 | Ga0439432_000391 | 3300042006 | Bacteria | 16191 |
| 847 | Ga0439462_0004540 | 3300042015 | Bacteria | 3397 |
| 848 | Ga0450912_000302 | 3300042116 | Bacteria | 2250 |
| 849 | Ga0450917_003634 | 3300042120 | Bacteria | 1118 |
| 850 | Ga0450923_038696 | 3300042125 | Unclassified | 996 |
| 851 | Ga0450905_004102 | 3300042142 | Bacteria | 1922 |
| 852 | Ga0450889_000006 | 3300042144 | Bacteria | 19255 |
| 853 | Ga0439434_0002010 | 3300042435 | Bacteria | 5882 |
| 854 | Ga0439464_0008848 | 3300042439 | Bacteria | 2639 |
| 855 | Ga0450893_0003067 | 3300042532 | Bacteria | 2627 |
| 856 | Ga0466966_0000301 | 3300044684 | Bacteria | 32475 |
| 857 | Ga0466966_0074595 | 3300044684 | Bacteria | 2120 |
| 858 | Ga0466966_0115417 | 3300044684 | Bacteria | 1653 |
| 859 | Ga0466966_0135612 | 3300044684 | Bacteria | 1505 |
| 860 | Ga0466961_0020790 | 3300044693 | Bacteria | 4225 |
| 861 | Ga0466963_0223929 | 3300044694 | Bacteria | 1318 |
| 862 | Ga0466963_0345078 | 3300044694 | Bacteria | 1048 |
| 863 | Ga0466971_0059943 | 3300044719 | Unclassified | 1720 |
| 864 | Ga0466971_0102069 | 3300044719 | Bacteria | 1319 |
| 865 | Ga0466957_0097773 | 3300044842 | Bacteria | 1846 |
| 866 | Ga0466959_0086297 | 3300045049 | Bacteria | 2258 |
| 867 | Ga0451576_0574629 | 3300045051 | Bacteria | 1184 |
| 868 | Ga0466958_0262411 | 3300045836 | Unclassified | 1106 |
| 869 | Ga0466958_0411452 | 3300045836 | Bacteria | 874 |
| 870 | Ga0466967_0001182 | 3300045976 | Bacteria | 14643 |
| 871 | Ga0466967_0138252 | 3300045976 | Bacteria | 2267 |
| 872 | Ga0466967_0280572 | 3300045976 | Bacteria | 1598 |
| 873 | Ga0466967_0450672 | 3300045976 | Unclassified | 1257 |
| 874 | Ga0495638_0000029 | 3300046460 | Bacteria | 330201 |
| 875 | Ga0495638_0001480 | 3300046460 | Bacteria | 21212 |
| 876 | Ga0495638_0021189 | 3300046460 | Bacteria | 4287 |
| 877 | Ga0495638_0074540 | 3300046460 | Bacteria | 2070 |
| 878 | Ga0495650_0000290 | 3300046471 | Bacteria | 93004 |
| 879 | Ga0495650_0012351 | 3300046471 | Bacteria | 4600 |
| 880 | Ga0495584_0004125 | 3300046491 | Bacteria | 7842 |
| 881 | Ga0495585_0001024 | 3300046492 | Bacteria | 23262 |
| 882 | Ga0495585_0087436 | 3300046492 | Bacteria | 1682 |
| 883 | Ga0495596_0000091 | 3300046500 | Bacteria | 63577 |
| 884 | Ga0495596_0008830 | 3300046500 | Bacteria | 4460 |
| 885 | Ga0495607_0005251 | 3300046501 | Bacteria | 9319 |
| 886 | Ga0495583_0000147 | 3300046506 | Bacteria | 119035 |
| 887 | Ga0495583_0002617 | 3300046506 | Bacteria | 15046 |
| 888 | Ga0495583_0019485 | 3300046506 | Bacteria | 3540 |
| 889 | Ga0495583_0034629 | 3300046506 | Bacteria | 2417 |
| 890 | Ga0495583_0067410 | 3300046506 | Bacteria | 1581 |
| 891 | Ga0495606_0000178 | 3300046507 | Bacteria | 112329 |
| 892 | Ga0495606_0053017 | 3300046507 | Bacteria | 2634 |
| 893 | Ga0495606_0054178 | 3300046507 | Bacteria | 2598 |
| 894 | Ga0495606_0115164 | 3300046507 | Bacteria | 1616 |
| 895 | Ga0495606_0345361 | 3300046507 | Bacteria | 791 |
| 896 | Ga0495610_0000220 | 3300046512 | Bacteria | 61190 |
| 897 | Ga0495610_0000352 | 3300046512 | Bacteria | 48332 |
| 898 | Ga0495610_0001714 | 3300046512 | Bacteria | 19218 |
| 899 | Ga0495616_0000009 | 3300046513 | Bacteria | 225502 |
| 900 | Ga0495620_0003485 | 3300046515 | Bacteria | 9003 |
| 901 | Ga0495620_0075294 | 3300046515 | Bacteria | 1374 |
| 902 | Ga0495632_0000047 | 3300046519 | Bacteria | 138951 |
| 903 | Ga0495632_0000565 | 3300046519 | Bacteria | 34434 |
| 904 | Ga0495632_0001651 | 3300046519 | Bacteria | 18277 |
| 905 | Ga0495632_0071777 | 3300046519 | Bacteria | 1662 |
| 906 | Ga0495632_0076201 | 3300046519 | Bacteria | 1604 |
| 907 | Ga0495632_0140863 | 3300046519 | Bacteria | 1119 |
| 908 | Ga0495643_0000036 | 3300046522 | Bacteria | 238374 |
| 909 | Ga0495643_0000166 | 3300046522 | Bacteria | 104972 |
| 910 | Ga0495643_0001718 | 3300046522 | Bacteria | 18979 |
| 911 | Ga0495643_0007008 | 3300046522 | Bacteria | 7324 |
| 912 | Ga0495643_0013682 | 3300046522 | Bacteria | 4848 |
| 913 | Ga0495643_0081907 | 3300046522 | Bacteria | 1677 |
| 914 | Ga0495648_0000020 | 3300046524 | Bacteria | 254330 |
| 915 | Ga0495648_0002711 | 3300046524 | Bacteria | 16000 |
| 916 | Ga0495648_0009822 | 3300046524 | Bacteria | 7358 |
| 917 | Ga0495648_0011578 | 3300046524 | Bacteria | 6634 |
| 918 | Ga0495663_0000017 | 3300046525 | Bacteria | 138955 |
| 919 | Ga0495663_0000533 | 3300046525 | Bacteria | 13597 |
| 920 | Ga0495642_0003717 | 3300046528 | Bacteria | 5985 |
| 921 | Ga0495654_0028751 | 3300046530 | Bacteria | 2840 |
| 922 | Ga0495598_0018214 | 3300046537 | Bacteria | 1822 |
| 923 | Ga0495609_0004809 | 3300046538 | Bacteria | 7286 |
| 924 | Ga0495597_0004964 | 3300046542 | Bacteria | 7144 |
| 925 | Ga0495622_0128231 | 3300046557 | Bacteria | 1156 |
| 926 | Ga0495633_0000496 | 3300046558 | Bacteria | 39673 |
| 927 | Ga0495633_0000685 | 3300046558 | Bacteria | 31174 |
| 928 | Ga0495633_0000737 | 3300046558 | Bacteria | 29667 |
| 929 | Ga0495633_0009060 | 3300046558 | Bacteria | 5535 |
| 930 | Ga0495633_0019259 | 3300046558 | Bacteria | 3452 |
| 931 | Ga0495668_0000013 | 3300046616 | Bacteria | 452938 |
| 932 | Ga0495668_0007020 | 3300046616 | Bacteria | 7270 |
| 933 | Ga0495668_0076747 | 3300046616 | Bacteria | 1834 |
| 934 | Ga0495668_0104330 | 3300046616 | Bacteria | 1551 |
| 935 | Ga0495668_0198996 | 3300046616 | Bacteria | 1097 |
| 936 | Ga0495668_0222100 | 3300046616 | Bacteria | 1034 |
| 937 | Ga0495611_0003692 | 3300046648 | Bacteria | 6699 |
| 938 | Ga0495611_0037085 | 3300046648 | Bacteria | 2166 |
| 939 | Ga0495625_0000400 | 3300046660 | Bacteria | 66228 |
| 940 | Ga0495625_0000599 | 3300046660 | Bacteria | 52442 |
| 941 | Ga0495625_0012837 | 3300046660 | Bacteria | 6771 |
| 942 | Ga0495625_0020250 | 3300046660 | Bacteria | 5140 |
| 943 | Ga0495625_0023541 | 3300046660 | Bacteria | 4703 |
| 944 | Ga0495669_0093406 | 3300046684 | Bacteria | 1391 |
| 945 | Ga0495669_0109928 | 3300046684 | Bacteria | 1286 |
| 946 | Ga0495669_0203340 | 3300046684 | Bacteria | 947 |
| 947 | Ga0495670_0014132 | 3300046691 | Bacteria | 3928 |
| 948 | Ga0495670_0062004 | 3300046691 | Bacteria | 1880 |
| 949 | Ga0495671_0000022 | 3300046692 | Bacteria | 255591 |
| 950 | Ga0495600_0047932 | 3300046809 | Bacteria | 2787 |
| 951 | Ga0495683_0001221 | 3300047323 | Bacteria | 17505 |
| 952 | Ga0495687_000384 | 3300047443 | Bacteria | 54885 |
| 953 | Ga0495677_0002225 | 3300047445 | Bacteria | 7673 |
| 954 | Ga0495677_0002456 | 3300047445 | Bacteria | 7282 |
| 955 | Ga0495673_0000051 | 3300047469 | Bacteria | 255511 |
| 956 | Ga0495673_0046497 | 3300047469 | Bacteria | 1923 |
| 957 | Ga0495681_0046345 | 3300047470 | Bacteria | 2073 |
| 958 | Ga0495681_0084971 | 3300047470 | Bacteria | 1406 |
| 959 | Ga0495686_0046805 | 3300047472 | Bacteria | 2733 |
| 960 | Ga0495602_0038123 | 3300048088 | Bacteria | 4450 |
| 961 | Ga0495615_0000009 | 3300048090 | Bacteria | 76727 |
| 962 | Ga0495615_0003485 | 3300048090 | Bacteria | 2641 |
| 963 | Ga0495626_0000517 | 3300048091 | Bacteria | 38618 |
| 964 | Ga0496101_0088988 | 3300048904 | Bacteria | 2294 |
| 965 | Ga0496102_0000066 | 3300048905 | Bacteria | 159020 |
| 966 | Ga0496102_0009317 | 3300048905 | Bacteria | 8431 |
| 967 | Ga0496103_0000248 | 3300048906 | Bacteria | 52332 |
| 968 | Ga0496103_0019178 | 3300048906 | Bacteria | 4107 |
| 969 | Ga0496104_0052149 | 3300048907 | Bacteria | 3863 |
| 970 | Ga0496105_0000199 | 3300048908 | Bacteria | 40100 |
| 971 | Ga0496107_0029046 | 3300048910 | Bacteria | 3932 |
| 972 | Ga0496108_0005656 | 3300048911 | Bacteria | 10119 |
| 973 | Ga0496108_0172143 | 3300048911 | Bacteria | 1874 |
| 974 | Ga0496108_0299899 | 3300048911 | Bacteria | 1400 |
| 975 | Ga0496109_0091111 | 3300048912 | Bacteria | 2819 |
| 976 | Ga0496110_0015870 | 3300048913 | Bacteria | 6280 |
| 977 | Ga0496110_0023976 | 3300048913 | Bacteria | 5197 |
| 978 | Ga0496110_0278115 | 3300048913 | Bacteria | 1524 |
| 979 | Ga0496110_0303493 | 3300048913 | Bacteria | 1454 |
| 980 | Ga0496110_0587925 | 3300048913 | Bacteria | 1010 |
| 981 | Ga0496111_0087964 | 3300048914 | Bacteria | 2274 |
| 982 | Ga0496111_0173569 | 3300048914 | Bacteria | 1602 |
| 983 | Ga0496112_0009138 | 3300048915 | Bacteria | 8905 |
| 984 | Ga0496113_0009937 | 3300048916 | Bacteria | 6269 |
| 985 | Ga0496113_0029922 | 3300048916 | Bacteria | 3937 |
| 986 | Ga0496114_0014088 | 3300048917 | Bacteria | 6411 |
| 987 | Ga0496115_0000216 | 3300048918 | Bacteria | 53242 |
| 988 | Ga0496115_0000732 | 3300048918 | Bacteria | 24253 |
| 989 | Ga0496116_0000279 | 3300048919 | Bacteria | 88014 |
| 990 | Ga0496116_0002551 | 3300048919 | Bacteria | 19034 |
| 991 | Ga0496117_0000717 | 3300048920 | Bacteria | 52330 |
| 992 | Ga0496118_0000754 | 3300048921 | Bacteria | 52330 |
| 993 | Ga0496119_0003364 | 3300048922 | Bacteria | 16654 |
| 994 | Ga0496120_0043993 | 3300048923 | Bacteria | 2597 |
| 995 | Ga0496121_0000954 | 3300048924 | Bacteria | 52302 |
| 996 | Ga0496121_0002098 | 3300048924 | Bacteria | 31368 |
| 997 | Ga0496121_0009641 | 3300048924 | Bacteria | 11060 |
| 998 | Ga0496121_0024707 | 3300048924 | Bacteria | 5734 |
| 999 | Ga0496121_0038601 | 3300048924 | Bacteria | 4223 |
| 1000 | Ga0496121_0088189 | 3300048924 | Bacteria | 2433 |
| 1001 | Ga0496121_0119116 | 3300048924 | Bacteria | 1997 |
| 1002 | Ga0496122_0000385 | 3300048925 | Bacteria | 94046 |
| 1003 | Ga0496122_0003528 | 3300048925 | Bacteria | 20474 |
| 1004 | Ga0496122_0008856 | 3300048925 | Bacteria | 10738 |
| 1005 | Ga0496122_0011771 | 3300048925 | Bacteria | 8812 |
| 1006 | Ga0496122_0013679 | 3300048925 | Bacteria | 7920 |
| 1007 | Ga0496122_0015070 | 3300048925 | Bacteria | 7418 |
| 1008 | Ga0496123_0000220 | 3300048926 | Bacteria | 115824 |
| 1009 | Ga0496123_0000300 | 3300048926 | Bacteria | 96475 |
| 1010 | Ga0496123_0000684 | 3300048926 | Bacteria | 55863 |
| 1011 | Ga0496123_0008437 | 3300048926 | Bacteria | 9466 |
| 1012 | Ga0496123_0056302 | 3300048926 | Bacteria | 2571 |
| 1013 | Ga0496123_0262501 | 3300048926 | Bacteria | 845 |
| 1014 | Ga0496124_0000767 | 3300048927 | Bacteria | 52350 |
| 1015 | Ga0496124_0001301 | 3300048927 | Bacteria | 37771 |
| 1016 | Ga0496124_0040271 | 3300048927 | Bacteria | 4044 |
| 1017 | Ga0496124_0092017 | 3300048927 | Bacteria | 2470 |
| 1018 | Ga0496125_0000229 | 3300048928 | Bacteria | 114537 |
| 1019 | Ga0496125_0002679 | 3300048928 | Bacteria | 22728 |
| 1020 | Ga0496125_0017789 | 3300048928 | Bacteria | 6764 |
| 1021 | Ga0496125_0025306 | 3300048928 | Bacteria | 5438 |
| 1022 | Ga0496125_0032271 | 3300048928 | Bacteria | 4654 |
| 1023 | Ga0496126_0000891 | 3300048929 | Bacteria | 52294 |
| 1024 | Ga0496126_0007119 | 3300048929 | Bacteria | 12321 |
| 1025 | Ga0496126_0008301 | 3300048929 | Bacteria | 11215 |
| 1026 | Ga0496126_0245081 | 3300048929 | Bacteria | 1495 |
| 1027 | Ga0496126_0346070 | 3300048929 | Bacteria | 1217 |
| 1028 | Ga0496126_0385991 | 3300048929 | Bacteria | 1139 |
| 1029 | Ga0501032_0078028 | 3300049569 | Bacteria | 2205 |
| 1030 | Ga0501033_0007416 | 3300049570 | Bacteria | 8543 |
| 1031 | Ga0501033_0097399 | 3300049570 | Bacteria | 2149 |
| 1032 | Ga0501033_0190395 | 3300049570 | Bacteria | 1468 |
| 1033 | Ga0501036_0410571 | 3300049572 | Bacteria | 1129 |
| 1034 | Ga0501037_0041873 | 3300049573 | Bacteria | 3367 |
| 1035 | Ga0501038_0019972 | 3300049574 | Bacteria | 6031 |
| 1036 | Ga0501038_0167917 | 3300049574 | Bacteria | 1779 |
| 1037 | Ga0501047_0029038 | 3300049581 | Bacteria | 5334 |
| 1038 | Ga0501047_0064618 | 3300049581 | Bacteria | 3529 |
| 1039 | Ga0501047_0073563 | 3300049581 | Bacteria | 3290 |
| 1040 | Ga0501047_0440467 | 3300049581 | Bacteria | 1133 |
| 1041 | Ga0501067_0016612 | 3300049583 | Bacteria | 4067 |
| 1042 | Ga0501067_0242614 | 3300049583 | Bacteria | 1003 |
| 1043 | Ga0501070_0522088 | 3300049586 | Bacteria | 953 |
| 1044 | Ga0501080_0065115 | 3300049742 | Bacteria | 3391 |
| 1045 | Ga0501080_0707770 | 3300049742 | Bacteria | 888 |
| 1046 | Ga0501083_0214106 | 3300049744 | Bacteria | 1256 |
| 1047 | Ga0501241_005531 | 3300049758 | Bacteria | 2354 |
| 1048 | Ga0501241_013910 | 3300049758 | Bacteria | 1462 |
| 1049 | Ga0501270_001791 | 3300049767 | Bacteria | 2124 |
| 1050 | Ga0501035_0069158 | 3300049822 | Bacteria | 3130 |
| 1051 | Ga0501035_0560386 | 3300049822 | Bacteria | 935 |
| 1052 | Ga0501044_0004024 | 3300049823 | Bacteria | 16477 |
| 1053 | Ga0501044_0005674 | 3300049823 | Bacteria | 13835 |
| 1054 | Ga0501044_0146616 | 3300049823 | Bacteria | 2345 |
| 1055 | Ga0501044_0172839 | 3300049823 | Bacteria | 2131 |
| 1056 | Ga0501044_0228335 | 3300049823 | Bacteria | 1810 |
| 1057 | Ga0501044_0410150 | 3300049823 | Bacteria | 1266 |
| 1058 | Ga0501044_0506546 | 3300049823 | Bacteria | 1108 |
| 1059 | nmdc:mga03683_33738_c2 | 3300050489 | Bacteria | 1189 |
| 1060 | nmdc:mga03683_9114_c1 | 3300050489 | Bacteria | 3515 |
| 1061 | nmdc:mga00v17_1450_c1 | 3300050491 | Bacteria | 12406 |
| 1062 | nmdc:mga0k408_12448_c1 | 3300050493 | Bacteria | 4650 |
| 1063 | nmdc:mga07m45_1_c1 | 3300050496 | Bacteria | 485809 |
| 1064 | nmdc:mga07m45_2592_c1 | 3300050496 | Bacteria | 8519 |
| 1065 | nmdc:mga07m45_5623_c1 | 3300050496 | Bacteria | 6260 |
| 1066 | nmdc:mga05p37_123477_c1 | 3300050507 | Bacteria | 3180 |
| 1067 | nmdc:mga05p37_342720_c1 | 3300050507 | Bacteria | 1762 |
| 1068 | nmdc:mga05p37_9157_c1 | 3300050507 | Bacteria | 11705 |
| 1069 | nmdc:mga0qj67_27138_c1 | 3300050509 | Bacteria | 4436 |
| 1070 | nmdc:mga08y16_209291_c1 | 3300050511 | Bacteria | 2020 |
| 1071 | nmdc:mga08y16_381262_c1 | 3300050511 | Bacteria | 1445 |
| 1072 | nmdc:mga0n895_444082_c1 | 3300050512 | Bacteria | 1310 |
| 1073 | Ga0500610_0002615 | 3300053079 | Bacteria | 6687 |
| 1074 | Ga0500643_008453 | 3300053087 | Bacteria | 4041 |
| 1075 | Ga0500643_018922 | 3300053087 | Bacteria | 2276 |
| 1076 | Ga0500641_0039472 | 3300053096 | Bacteria | 1902 |
| 1077 | Ga0500556_0000217 | 3300053104 | Bacteria | 46762 |
| 1078 | Ga0500557_079179 | 3300053105 | Bacteria | 1084 |
| 1079 | Ga0500595_002981 | 3300053119 | Bacteria | 8054 |
| 1080 | Ga0500595_005185 | 3300053119 | Bacteria | 5716 |
| 1081 | Ga0500607_000070 | 3300053121 | Bacteria | 73162 |
| 1082 | Ga0500607_000102 | 3300053121 | Bacteria | 65607 |
| 1083 | Ga0500608_127336 | 3300053122 | Bacteria | 1146 |
| 1084 | Ga0500642_0000001 | 3300053130 | Bacteria | 1468402 |
| 1085 | Ga0500642_0000543 | 3300053130 | Bacteria | 11428 |
| 1086 | Ga0500658_0000049 | 3300053134 | Bacteria | 65535 |
| 1087 | Ga0500658_0002034 | 3300053134 | Bacteria | 7893 |
| 1088 | Ga0500559_0002376 | 3300053136 | Bacteria | 9811 |
| 1089 | Ga0500559_0009272 | 3300053136 | Bacteria | 4269 |
| 1090 | Ga0500559_0012440 | 3300053136 | Bacteria | 3617 |
| 1091 | Ga0500559_0012634 | 3300053136 | Bacteria | 3585 |
| 1092 | Ga0500559_0014432 | 3300053136 | Bacteria | 3339 |
| 1093 | Ga0500568_0013440 | 3300053139 | Bacteria | 3731 |
| 1094 | Ga0500568_0021149 | 3300053139 | Bacteria | 2803 |
| 1095 | Ga0500568_0037492 | 3300053139 | Bacteria | 1966 |
| 1096 | Ga0500577_0203930 | 3300053142 | Bacteria | 854 |
| 1097 | Ga0500588_0028133 | 3300053146 | Bacteria | 1591 |
| 1098 | Ga0500590_008590 | 3300053148 | Bacteria | 5103 |
| 1099 | Ga0500604_0000007 | 3300053151 | Bacteria | 115773 |
| 1100 | Ga0500604_0003053 | 3300053151 | Bacteria | 4499 |
| 1101 | Ga0500604_0017140 | 3300053151 | Bacteria | 2001 |
| 1102 | Ga0500616_0000080 | 3300053153 | Bacteria | 200381 |
| 1103 | Ga0500616_0025469 | 3300053153 | Bacteria | 3281 |
| 1104 | Ga0500616_0033403 | 3300053153 | Bacteria | 2808 |
| 1105 | Ga0500622_0003841 | 3300053156 | Bacteria | 9776 |
| 1106 | Ga0500636_0008384 | 3300053177 | Bacteria | 5994 |
| 1107 | Ga0500625_096024 | 3300053729 | Bacteria | 1255 |
| 1108 | Ga0500645_000148 | 3300053730 | Bacteria | 54683 |
| 1109 | Ga0500645_003044 | 3300053730 | Bacteria | 7055 |
| 1110 | Ga0500645_006610 | 3300053730 | Bacteria | 4114 |
| 1111 | Ga0500596_000119 | 3300053735 | Bacteria | 11234 |
| 1112 | Ga0466962_0098253 | 3300061719 | Bacteria | 1405 |
| 1113 | Ga0466962_0102452 | 3300061719 | Bacteria | 1375 |
| 1114 | 2511127776 | 2510917021 | Bacteria | 5705459 |
| 1115 | 2600203172 | 2599185354 | Bacteria | 4398675 |
| 1116 | 2643950995 | 2643221588 | Bacteria | 3692460 |
| 1117 | 2753766691 | 2751185897 | Bacteria | 5322941 |
| 1118 | 2819554899 | 2818991438 | Bacteria | 5793701 |
| 1119 | 2882809389 | 2882806704 | Bacteria | 3007728 |
| 1120 | 2885432604 | 2885429604 | Bacteria | 3642894 |
| 1121 | 2896431432 | 2896429255 | Bacteria | 2557483 |
| 1122 | 2919143570 | 2919138771 | Bacteria | 5281312 |
| 1123 | 2919712652 | 2919709256 | Bacteria | 4318106 |
| 1124 | 3000868158 | 3000865235 | Bacteria | 3106258 |
| 1125 | 8054306421 | 8054302542 | Bacteria | 5698134 |
| 1126 | 8057101539 | 8057101203 | Bacteria | 5034064 |
| 1127 | Ga0307409_100042126 | |||
| 1128 | SwRhRL2b_contig_1105262 | |||
| 1129 | SwRhRL2b_contig_3318283 | |||
| 1130 | JGI24736J21556_1003886 | |||
| 1131 | JGI24741J21665_1000617 | |||
| 1132 | JGI24741J21665_1002803 | |||
| 1133 | JGI24740J21852_10000474 | |||
| 1134 | JGI24740J21852_10003183 | |||
| 1135 | JGI24740J21852_10004741 | |||
| 1136 | JGI24740J21852_10010219 | |||
| 1137 | JGI24740J21852_10024992 | |||
| 1138 | JGI24740J21852_10026015 | |||
| 1139 | JGI24739J22299_10000035 | |||
| 1140 | JGI24739J22299_10001730 | |||
| 1141 | JGI24739J22299_10002626 | |||
| 1142 | JGI24739J22299_10002884 | |||
| 1143 | JGI24739J22299_10040361 | |||
| 1144 | JGI24737J22298_10000020 | |||
| 1145 | JGI24737J22298_10000167 | |||
| 1146 | JGI24737J22298_10002252 | |||
| 1147 | JGI24737J22298_10030293 | |||
| 1148 | JGI24743J22301_10021275 | |||
| 1149 | JGI24735J21928_10017959 | |||
| 1150 | JGI24735J21928_10054526 | |||
| 1151 | JGI24735J21928_10060453 | |||
| 1152 | JGI24738J21930_10000050 | |||
| 1153 | JGI24738J21930_10004991 | |||
| 1154 | JGI24742J22300_10007668 | |||
| 1155 | JGI25150J39212_1000658 | |||
| 1156 | JGI25165J46597_1000071 | |||
| 1157 | JGI25153J46596_10000008 | |||
| 1158 | JGI25153J46596_10000183 | |||
| 1159 | rootL2_10167713 | |||
| 1160 | rootL2_10211840 | |||
| 1161 | rootH1_10310960 | |||
| 1162 | Ga0055542_1000038 | |||
| 1163 | Ga0055529_1000002 | |||
| 1164 | Ga0055529_1000021 | |||
| 1165 | Ga0055526_1007617 | |||
| 1166 | Ga0055537_1003499 | |||
| 1167 | Ga0055530_10034994 | |||
| 1168 | Ga0055530_10037292 | |||
| 1169 | Ga0055530_10043565 | |||
| 1170 | Ga0055540_1006104 | |||
| 1171 | Ga0055531_10043203 | |||
| 1172 | Ga0055531_10045520 | |||
| 1173 | Ga0065165_1004893 | |||
| 1174 | Ga0065704_10006528 | |||
| 1175 | Ga0065704_10070200 | |||
| 1176 | Ga0065712_10131800 | |||
| 1177 | Ga0070658_10000246 | |||
| 1178 | Ga0070658_10001377 | |||
| 1179 | Ga0070658_10003252 | |||
| 1180 | Ga0070658_10009024 | |||
| 1181 | Ga0070658_10038444 | |||
| 1182 | Ga0070658_10142169 | |||
| 1183 | Ga0070658_10186874 | |||
| 1184 | Ga0070658_10345275 | |||
| 1185 | Ga0070676_10003530 | |||
| 1186 | Ga0070676_10025705 | |||
| 1187 | Ga0070676_10034049 | |||
| 1188 | Ga0070683_100020418 | |||
| 1189 | Ga0070683_100079286 | |||
| 1190 | Ga0070683_100492938 | |||
| 1191 | Ga0070690_100156555 | |||
| 1192 | Ga0070670_100007537 | |||
| 1193 | Ga0070670_100014177 | |||
| 1194 | Ga0070670_100016985 | |||
| 1195 | Ga0070670_100105231 | |||
| 1196 | Ga0070670_100160248 | |||
| 1197 | Ga0070670_100272071 | |||
| 1198 | Ga0070670_100526559 | |||
| 1199 | Ga0070677_10012331 | |||
| 1200 | Ga0070677_10021855 | |||
| 1201 | Ga0068869_100000043 | |||
| 1202 | Ga0070666_10000090 | |||
| 1203 | Ga0070666_10102257 | |||
| 1204 | Ga0070680_100001376 | |||
| 1205 | Ga0070680_100260340 | |||
| 1206 | Ga0070682_100079366 | |||
| 1207 | Ga0070682_100183702 | |||
| 1208 | Ga0068868_100000019 | |||
| 1209 | Ga0068868_100001402 | |||
| 1210 | Ga0068868_100096446 | |||
| 1211 | Ga0070660_100000415 | |||
| 1212 | Ga0070660_100014625 | |||
| 1213 | Ga0070660_100057475 | |||
| 1214 | Ga0070660_100061033 | |||
| 1215 | Ga0070660_100064868 | |||
| 1216 | Ga0070660_100092138 | |||
| 1217 | Ga0070660_100133185 | |||
| 1218 | Ga0070660_100154406 | |||
| 1219 | Ga0070687_100451623 | |||
| 1220 | Ga0070661_100020380 | |||
| 1221 | Ga0070661_100159766 | |||
| 1222 | Ga0070661_100183768 | |||
| 1223 | Ga0070661_100350579 | |||
| 1224 | Ga0070692_10036243 | |||
| 1225 | Ga0070692_10115747 | |||
| 1226 | Ga0070668_100000062 | |||
| 1227 | Ga0070668_100050214 | |||
| 1228 | Ga0070668_100075301 | |||
| 1229 | Ga0070668_100183067 | |||
| 1230 | Ga0070669_100000024 | |||
| 1231 | Ga0070669_100000209 | |||
| 1232 | Ga0070669_100015859 | |||
| 1233 | Ga0070669_100017883 | |||
| 1234 | Ga0070669_100185643 | |||
| 1235 | Ga0070675_100016633 | |||
| 1236 | Ga0070675_100053030 | |||
| 1237 | Ga0070675_100184593 | |||
| 1238 | Ga0070675_100201011 | |||
| 1239 | Ga0070671_100000006 | |||
| 1240 | Ga0070671_100000174 | |||
| 1241 | Ga0070671_100005122 | |||
| 1242 | Ga0070671_100016942 | |||
| 1243 | Ga0070671_100023916 | |||
| 1244 | Ga0070671_100077682 | |||
| 1245 | Ga0070671_100167379 | |||
| 1246 | Ga0070671_100178291 | |||
| 1247 | Ga0070671_100305719 | |||
| 1248 | Ga0070671_100314227 | |||
| 1249 | Ga0070674_100000168 | |||
| 1250 | Ga0070674_100214774 | |||
| 1251 | Ga0070673_100000440 | |||
| 1252 | Ga0070673_100032130 | |||
| 1253 | Ga0070673_100161375 | |||
| 1254 | Ga0070673_100634640 | |||
| 1255 | Ga0070659_100000009 | |||
| 1256 | Ga0070659_100000903 | |||
| 1257 | Ga0070659_100010016 | |||
| 1258 | Ga0070659_100038415 | |||
| 1259 | Ga0070659_100054821 | |||
| 1260 | Ga0070659_100070355 | |||
| 1261 | Ga0070659_100098436 | |||
| 1262 | Ga0070659_100117957 | |||
| 1263 | Ga0070659_100165523 | |||
| 1264 | Ga0070659_100197877 | |||
| 1265 | Ga0070667_100000160 | |||
| 1266 | Ga0070667_100002316 | |||
| 1267 | Ga0070667_100020111 | |||
| 1268 | Ga0070667_100235550 | |||
| 1269 | Ga0070667_100235951 | |||
| 1270 | Ga0070667_100239281 | |||
| 1271 | Ga0070667_100256563 | |||
| 1272 | Ga0070667_100484995 | |||
| 1273 | Ga0070667_100609669 | |||
| 1274 | Ga0070709_10070530 | |||
| 1275 | Ga0070714_100022690 | |||
| 1276 | Ga0070705_100257571 | |||
| 1277 | Ga0070708_100414317 | |||
| 1278 | Ga0070663_100084211 | |||
| 1279 | Ga0070663_100239551 | |||
| 1280 | Ga0070663_100382572 | |||
| 1281 | Ga0070678_100000122 | |||
| 1282 | Ga0070678_100120811 | |||
| 1283 | Ga0070662_100000324 | |||
| 1284 | Ga0070662_100004883 | |||
| 1285 | Ga0070662_100027482 | |||
| 1286 | Ga0070662_100032561 | |||
| 1287 | Ga0070662_100086703 | |||
| 1288 | Ga0070662_100088478 | |||
| 1289 | Ga0070662_100115832 | |||
| 1290 | Ga0070662_100249997 | |||
| 1291 | Ga0070681_10063149 | |||
| 1292 | Ga0070681_10090131 | |||
| 1293 | Ga0070681_10124657 | |||
| 1294 | Ga0070681_10433898 | |||
| 1295 | Ga0070681_10521002 | |||
| 1296 | Ga0070681_10599998 | |||
| 1297 | Ga0068867_100001209 | |||
| 1298 | Ga0068867_100012453 | |||
| 1299 | Ga0070698_100313275 | |||
| 1300 | Ga0070679_100000008 | |||
| 1301 | Ga0070679_100014028 | |||
| 1302 | Ga0070679_100038477 | |||
| 1303 | Ga0070679_100040229 | |||
| 1304 | Ga0070679_100304841 | |||
| 1305 | Ga0070679_100646299 | |||
| 1306 | Ga0070684_100033668 | |||
| 1307 | Ga0070684_100173397 | |||
| 1308 | Ga0070684_100257650 | |||
| 1309 | Ga0070684_100390431 | |||
| 1310 | Ga0068853_100004143 | |||
| 1311 | Ga0068853_100007960 | |||
| 1312 | Ga0068853_100008144 | |||
| 1313 | Ga0068853_100056439 | |||
| 1314 | Ga0068853_100078085 | |||
| 1315 | Ga0068853_100090181 | |||
| 1316 | Ga0068853_100102660 | |||
| 1317 | Ga0068853_100105004 | |||
| 1318 | Ga0068853_100108310 | |||
| 1319 | Ga0068853_100116760 | |||
| 1320 | Ga0068853_100136179 | |||
| 1321 | Ga0068853_100290209 | |||
| 1322 | Ga0068853_100510370 | |||
| 1323 | Ga0070672_100011310 | |||
| 1324 | Ga0070672_100275293 | |||
| 1325 | Ga0070672_100352458 | |||
| 1326 | Ga0070672_100359658 | |||
| 1327 | Ga0070672_100617201 | |||
| 1328 | Ga0070686_100000059 | |||
| 1329 | Ga0070696_100006276 | |||
| 1330 | Ga0070696_100011558 | |||
| 1331 | Ga0070693_100093519 | |||
| 1332 | Ga0070693_100178794 | |||
| 1333 | Ga0070665_100000024 | |||
| 1334 | Ga0070665_100000049 | |||
| 1335 | Ga0070665_100000541 | |||
| 1336 | Ga0070665_100049678 | |||
| 1337 | Ga0070665_100053287 | |||
| 1338 | Ga0070665_100057319 | |||
| 1339 | Ga0070665_100557937 | |||
| 1340 | Ga0068855_100000780 | |||
| 1341 | Ga0068855_100002861 | |||
| 1342 | Ga0068855_100032263 | |||
| 1343 | Ga0068855_100064616 | |||
| 1344 | Ga0068855_100076235 | |||
| 1345 | Ga0068855_100104230 | |||
| 1346 | Ga0068855_100238315 | |||
| 1347 | Ga0070664_100000738 | |||
| 1348 | Ga0070664_100010085 | |||
| 1349 | Ga0070664_100139198 | |||
| 1350 | Ga0070664_100169999 | |||
| 1351 | Ga0070664_100242350 | |||
| 1352 | Ga0070664_100421340 | |||
| 1353 | Ga0070664_100447181 | |||
| 1354 | Ga0070664_100550870 | |||
| 1355 | Ga0068857_100001963 | |||
| 1356 | Ga0068857_100016345 | |||
| 1357 | Ga0068857_100019067 | |||
| 1358 | Ga0068857_100482959 | |||
| 1359 | Ga0068854_100004099 | |||
| 1360 | Ga0068854_100025243 | |||
| 1361 | Ga0068854_100072441 | |||
| 1362 | Ga0068854_100075843 | |||
| 1363 | Ga0068854_100325360 | |||
| 1364 | Ga0068856_100034050 | |||
| 1365 | Ga0068856_100085893 | |||
| 1366 | Ga0068852_100000562 | |||
| 1367 | Ga0068852_100022610 | |||
| 1368 | Ga0068852_100081967 | |||
| 1369 | Ga0068852_100186517 | |||
| 1370 | Ga0068852_100589012 | |||
| 1371 | Ga0068852_100628212 | |||
| 1372 | Ga0068852_100774218 | |||
| 1373 | Ga0068859_100000934 | |||
| 1374 | Ga0068859_100003670 | |||
| 1375 | Ga0068859_100005706 | |||
| 1376 | Ga0068859_100006035 | |||
| 1377 | Ga0068859_100011213 | |||
| 1378 | Ga0068864_100000181 | |||
| 1379 | Ga0068864_100000560 | |||
| 1380 | Ga0068864_100000652 | |||
| 1381 | Ga0068864_100010323 | |||
| 1382 | Ga0068864_100020751 | |||
| 1383 | Ga0068864_100048137 | |||
| 1384 | Ga0068861_100000414 | |||
| 1385 | Ga0068861_100052916 | |||
| 1386 | Ga0068861_100536875 | |||
| 1387 | Ga0068851_10144683 | |||
| 1388 | Ga0068863_100000011 | |||
| 1389 | Ga0068863_100003320 | |||
| 1390 | Ga0068863_100015750 | |||
| 1391 | Ga0068863_100020361 | |||
| 1392 | Ga0068863_100028370 | |||
| 1393 | Ga0068863_100062424 | |||
| 1394 | Ga0068863_100078666 | |||
| 1395 | Ga0068863_100471478 | |||
| 1396 | Ga0068858_100000338 | |||
| 1397 | Ga0068858_100000986 | |||
| 1398 | Ga0068858_100002349 | |||
| 1399 | Ga0068858_100004683 | |||
| 1400 | Ga0068858_100188402 | |||
| 1401 | Ga0068860_100010006 | |||
| 1402 | Ga0068860_100014755 | |||
| 1403 | Ga0068860_100017212 | |||
| 1404 | Ga0068860_100028785 | |||
| 1405 | Ga0068860_100034629 | |||
| 1406 | Ga0068860_100036466 | |||
| 1407 | Ga0068860_100258680 | |||
| 1408 | Ga0068860_100483411 | |||
| 1409 | Ga0068862_100000307 | |||
| 1410 | Ga0068862_100003180 | |||
| 1411 | Ga0068862_100049721 | |||
| 1412 | Ga0068862_100130515 | |||
| 1413 | Ga0068862_100178377 | |||
| 1414 | Ga0081455_10000964 | |||
| 1415 | Ga0081455_10212806 | |||
| 1416 | Ga0081540_1065923 | |||
| 1417 | Ga0070717_10208178 | |||
| 1418 | Ga0075364_10170292 | |||
| 1419 | Ga0075432_10000082 | |||
| 1420 | Ga0070712_100203270 | |||
| 1421 | Ga0075362_10034249 | |||
| 1422 | Ga0075362_10141469 | |||
| 1423 | Ga0075369_10013769 | |||
| 1424 | Ga0075366_10101406 | |||
| 1425 | Ga0097621_100027264 | |||
| 1426 | Ga0097621_100074960 | |||
| 1427 | Ga0097621_100304594 | |||
| 1428 | Ga0075370_10002507 | |||
| 1429 | Ga0075370_10237265 | |||
| 1430 | Ga0075370_10260992 | |||
| 1431 | Ga0075430_100033702 | |||
| 1432 | Ga0075434_100301885 | |||
| 1433 | Ga0068865_100000775 | |||
| 1434 | Ga0097620_100000934 | |||
| 1435 | Ga0097620_100003670 | |||
| 1436 | Ga0097620_100005706 | |||
| 1437 | Ga0097620_100006035 | |||
| 1438 | Ga0097620_100011215 | |||
| 1439 | Ga0079104_1013431 | |||
| 1440 | Ga0105251_10019640 | |||
| 1441 | Ga0105240_10035590 | |||
| 1442 | Ga0105240_10074553 | |||
| 1443 | Ga0105240_10348809 | |||
| 1444 | Ga0111539_10043818 | |||
| 1445 | Ga0111539_10133704 | |||
| 1446 | Ga0111539_10260122 | |||
| 1447 | Ga0105245_10000120 | |||
| 1448 | Ga0105245_10001533 | |||
| 1449 | Ga0105245_10078423 | |||
| 1450 | Ga0105245_10235701 | |||
| 1451 | Ga0105245_10934896 | |||
| 1452 | Ga0105247_10004401 | |||
| 1453 | Ga0105247_10137751 | |||
| 1454 | Ga0114129_10116412 | |||
| 1455 | Ga0114129_10293032 | |||
| 1456 | Ga0114129_10751408 | |||
| 1457 | Ga0105243_10000113 | |||
| 1458 | Ga0105243_10019774 | |||
| 1459 | Ga0105243_10082629 | |||
| 1460 | Ga0105241_10025707 | |||
| 1461 | Ga0105241_10120633 | |||
| 1462 | Ga0105242_10814588 | |||
| 1463 | Ga0105248_10000256 | |||
| 1464 | Ga0105248_10000400 | |||
| 1465 | Ga0105248_10017191 | |||
| 1466 | Ga0105248_10019300 | |||
| 1467 | Ga0105248_10049925 | |||
| 1468 | Ga0105248_10146066 | |||
| 1469 | Ga0105248_10164291 | |||
| 1470 | Ga0105248_10168191 | |||
| 1471 | Ga0105237_10002575 | |||
| 1472 | Ga0105238_10058377 | |||
| 1473 | Ga0105249_10009644 | |||
| 1474 | Ga0105249_10011174 | |||
| 1475 | Ga0105249_10021020 | |||
| 1476 | Ga0105249_10190214 | |||
| 1477 | Ga0105249_10441162 | |||
| 1478 | Ga0105249_10730645 | |||
| 1479 | Ga0105239_10075291 | |||
| 1480 | Ga0105239_10622658 | |||
| 1481 | Ga0105246_10000160 | |||
| 1482 | Ga0105246_10001420 | |||
| 1483 | Ga0105246_10486402 | |||
| 1484 | Ga0157373_10002630 | |||
| 1485 | Ga0157373_10023182 | |||
| 1486 | Ga0157373_10038833 | |||
| 1487 | Ga0157373_10049331 | |||
| 1488 | Ga0157373_10128340 | |||
| 1489 | Ga0157373_10327634 | |||
| 1490 | Ga0157371_10000114 | |||
| 1491 | Ga0157371_10002108 | |||
| 1492 | Ga0157371_10013797 | |||
| 1493 | Ga0157371_10036127 | |||
| 1494 | Ga0157371_10061311 | |||
| 1495 | Ga0157371_10126617 | |||
| 1496 | Ga0157371_10373290 | |||
| 1497 | Ga0157370_10114356 | |||
| 1498 | Ga0157369_10032870 | |||
| 1499 | Ga0157369_10039817 | |||
| 1500 | Ga0157369_10060405 | |||
| 1501 | Ga0157369_10138316 | |||
| 1502 | Ga0157369_10453915 | |||
| 1503 | Ga0157374_10090243 | |||
| 1504 | Ga0157374_10225674 | |||
| 1505 | Ga0157378_10044452 | |||
| 1506 | Ga0157378_10203789 | |||
| 1507 | Ga0163162_10020908 | |||
| 1508 | Ga0163162_10102278 | |||
| 1509 | Ga0163162_10220426 | |||
| 1510 | Ga0157372_10028966 | |||
| 1511 | Ga0157375_10160157 | |||
| 1512 | Ga0157375_10198094 | |||
| 1513 | Ga0157375_10447835 | |||
| 1514 | Ga0157375_10501238 | |||
| 1515 | Ga0157375_10598194 | |||
| 1516 | Ga0157375_10712577 | |||
| 1517 | Ga0163163_10023225 | |||
| 1518 | Ga0163163_10111881 | |||
| 1519 | Ga0157380_10033099 | |||
| 1520 | Ga0157380_10507749 | |||
| 1521 | Ga0182008_10173442 | |||
| 1522 | Ga0157377_10181641 | |||
| 1523 | Ga0157377_10340657 | |||
| 1524 | Ga0157379_10002639 | |||
| 1525 | Ga0157379_10375636 | |||
| 1526 | Ga0157379_10520736 | |||
| 1527 | Ga0163161_10012240 | |||
| 1528 | Ga0163161_10088745 | |||
| 1529 | Ga0163161_10119588 | |||
| 1530 | Ga0163161_10282621 | |||
| 1531 | Ga0206356_11779621 | |||
| 1532 | Ga0209563_100081 | |||
| 1533 | Ga0209437_104409 | |||
| 1534 | Ga0207425_1000005 | |||
| 1535 | Ga0209148_1000008 | |||
| 1536 | Ga0209129_1000526 | |||
| 1537 | Ga0209233_1000140 | |||
| 1538 | Ga0209233_1006894 | |||
| 1539 | Ga0209565_1000044 | |||
| 1540 | Ga0209455_1000002 | |||
| 1541 | Ga0209673_1022156 | |||
| 1542 | Ga0209676_1006640 | |||
| 1543 | Ga0209676_1015467 | |||
| 1544 | Ga0209025_1000128 | |||
| 1545 | Ga0209564_1001630 | |||
| 1546 | Ga0209564_1004768 | |||
| 1547 | Ga0209758_1000002 | |||
| 1548 | Ga0209758_1000017 | |||
| 1549 | Ga0209758_1037345 | |||
| 1550 | Ga0209050_1000001 | |||
| 1551 | Ga0209050_1000140 | |||
| 1552 | Ga0209050_1011915 | |||
| 1553 | Ga0209050_1034182 | |||
| 1554 | Ga0207426_1013899 | |||
| 1555 | Ga0209051_1000797 | |||
| 1556 | Ga0209257_1002519 | |||
| 1557 | Ga0209257_1002670 | |||
| 1558 | Ga0209257_1010120 | |||
| 1559 | Ga0207697_10000244 | |||
| 1560 | Ga0207697_10000260 | |||
| 1561 | Ga0207697_10009084 | |||
| 1562 | Ga0207656_10161624 | |||
| 1563 | Ga0207682_10000110 | |||
| 1564 | Ga0207682_10037745 | |||
| 1565 | Ga0207682_10062222 | |||
| 1566 | Ga0207682_10171435 | |||
| 1567 | Ga0207710_10011691 | |||
| 1568 | Ga0207688_10000225 | |||
| 1569 | Ga0207688_10068543 | |||
| 1570 | Ga0207688_10087540 | |||
| 1571 | Ga0207688_10135512 | |||
| 1572 | Ga0207680_10000439 | |||
| 1573 | Ga0207647_10000052 | |||
| 1574 | Ga0207647_10004308 | |||
| 1575 | Ga0207647_10048616 | |||
| 1576 | Ga0207647_10058442 | |||
| 1577 | Ga0207645_10011101 | |||
| 1578 | Ga0207645_10014890 | |||
| 1579 | Ga0207645_10081385 | |||
| 1580 | Ga0207705_10000658 | |||
| 1581 | Ga0207705_10002088 | |||
| 1582 | Ga0207705_10002734 | |||
| 1583 | Ga0207705_10003400 | |||
| 1584 | Ga0207705_10004744 | |||
| 1585 | Ga0207705_10019495 | |||
| 1586 | Ga0207705_10021171 | |||
| 1587 | Ga0207705_10158196 | |||
| 1588 | Ga0207705_10221527 | |||
| 1589 | Ga0207705_10260726 | |||
| 1590 | Ga0207705_10366033 | |||
| 1591 | Ga0207705_10410980 | |||
| 1592 | Ga0207654_10014233 | |||
| 1593 | Ga0207654_10276736 | |||
| 1594 | Ga0207654_10648483 | |||
| 1595 | Ga0207707_10007643 | |||
| 1596 | Ga0207707_10011692 | |||
| 1597 | Ga0207707_10186703 | |||
| 1598 | Ga0207695_10031036 | |||
| 1599 | Ga0207695_10355166 | |||
| 1600 | Ga0207671_10001065 | |||
| 1601 | Ga0207671_10017233 | |||
| 1602 | Ga0207693_10026672 | |||
| 1603 | Ga0207660_10003179 | |||
| 1604 | Ga0207660_10008606 | |||
| 1605 | Ga0207660_10073175 | |||
| 1606 | Ga0207660_10570949 | |||
| 1607 | Ga0207657_10002591 | |||
| 1608 | Ga0207657_10002788 | |||
| 1609 | Ga0207657_10004362 | |||
| 1610 | Ga0207657_10006324 | |||
| 1611 | Ga0207657_10014781 | |||
| 1612 | Ga0207657_10022552 | |||
| 1613 | Ga0207657_10023328 | |||
| 1614 | Ga0207657_10056280 | |||
| 1615 | Ga0207657_10173661 | |||
| 1616 | Ga0207657_10189914 | |||
| 1617 | Ga0207649_10000104 | |||
| 1618 | Ga0207649_10037876 | |||
| 1619 | Ga0207649_10055556 | |||
| 1620 | Ga0207649_10080584 | |||
| 1621 | Ga0207649_10318133 | |||
| 1622 | Ga0207649_10405868 | |||
| 1623 | Ga0207652_10000008 | |||
| 1624 | Ga0207652_10003272 | |||
| 1625 | Ga0207652_10011805 | |||
| 1626 | Ga0207652_10085290 | |||
| 1627 | Ga0207652_10087574 | |||
| 1628 | Ga0207652_10343906 | |||
| 1629 | Ga0207652_10505052 | |||
| 1630 | Ga0207681_10000004 | |||
| 1631 | Ga0207681_10002587 | |||
| 1632 | Ga0207681_10016147 | |||
| 1633 | Ga0207681_10025190 | |||
| 1634 | Ga0207681_10048992 | |||
| 1635 | Ga0207681_10110407 | |||
| 1636 | Ga0207694_10007740 | |||
| 1637 | Ga0207694_10093691 | |||
| 1638 | Ga0207694_10422429 | |||
| 1639 | Ga0207650_10004421 | |||
| 1640 | Ga0207650_10006658 | |||
| 1641 | Ga0207650_10058187 | |||
| 1642 | Ga0207650_10143679 | |||
| 1643 | Ga0207650_10187840 | |||
| 1644 | Ga0207650_10212543 | |||
| 1645 | Ga0207659_10233763 | |||
| 1646 | Ga0207659_10307988 | |||
| 1647 | Ga0207659_10416938 | |||
| 1648 | Ga0207659_10662489 | |||
| 1649 | Ga0207687_10006406 | |||
| 1650 | Ga0207687_10334769 | |||
| 1651 | Ga0207687_10584201 | |||
| 1652 | Ga0207700_10539880 | |||
| 1653 | Ga0207664_10280228 | |||
| 1654 | Ga0207644_10000009 | |||
| 1655 | Ga0207644_10000021 | |||
| 1656 | Ga0207644_10010959 | |||
| 1657 | Ga0207644_10081673 | |||
| 1658 | Ga0207644_10101729 | |||
| 1659 | Ga0207644_10118428 | |||
| 1660 | Ga0207644_10127541 | |||
| 1661 | Ga0207690_10000022 | |||
| 1662 | Ga0207690_10000463 | |||
| 1663 | Ga0207690_10002801 | |||
| 1664 | Ga0207690_10012242 | |||
| 1665 | Ga0207690_10017740 | |||
| 1666 | Ga0207690_10023696 | |||
| 1667 | Ga0207690_10058479 | |||
| 1668 | Ga0207690_10160746 | |||
| 1669 | Ga0207690_10215159 | |||
| 1670 | Ga0207690_10232839 | |||
| 1671 | Ga0207706_10001178 | |||
| 1672 | Ga0207706_10009206 | |||
| 1673 | Ga0207706_10010997 | |||
| 1674 | Ga0207706_10036973 | |||
| 1675 | Ga0207706_10044088 | |||
| 1676 | Ga0207706_10236690 | |||
| 1677 | Ga0207706_10523470 | |||
| 1678 | Ga0207709_10000116 | |||
| 1679 | Ga0207709_10017683 | |||
| 1680 | Ga0207709_10252183 | |||
| 1681 | Ga0207669_10001099 | |||
| 1682 | Ga0207669_10001331 | |||
| 1683 | Ga0207669_10180270 | |||
| 1684 | Ga0207669_10220293 | |||
| 1685 | Ga0207704_10015412 | |||
| 1686 | Ga0207691_10042920 | |||
| 1687 | Ga0207691_10049967 | |||
| 1688 | Ga0207691_10144798 | |||
| 1689 | Ga0207691_10210733 | |||
| 1690 | Ga0207691_10320826 | |||
| 1691 | Ga0207691_10328355 | |||
| 1692 | Ga0207711_10002898 | |||
| 1693 | Ga0207711_10003023 | |||
| 1694 | Ga0207711_10004639 | |||
| 1695 | Ga0207711_10015981 | |||
| 1696 | Ga0207711_10061948 | |||
| 1697 | Ga0207711_10103189 | |||
| 1698 | Ga0207711_10106342 | |||
| 1699 | Ga0207689_10000014 | |||
| 1700 | Ga0207689_10053101 | |||
| 1701 | Ga0207661_10037845 | |||
| 1702 | Ga0207661_10146074 | |||
| 1703 | Ga0207661_10163548 | |||
| 1704 | Ga0207661_10221025 | |||
| 1705 | Ga0207679_10000677 | |||
| 1706 | Ga0207679_10019370 | |||
| 1707 | Ga0207679_10020644 | |||
| 1708 | Ga0207679_10035886 | |||
| 1709 | Ga0207679_10098482 | |||
| 1710 | Ga0207679_10138734 | |||
| 1711 | Ga0207679_10346518 | |||
| 1712 | Ga0207667_10000001 | |||
| 1713 | Ga0207667_10001580 | |||
| 1714 | Ga0207667_10002922 | |||
| 1715 | Ga0207667_10077441 | |||
| 1716 | Ga0207667_10110426 | |||
| 1717 | Ga0207651_10000310 | |||
| 1718 | Ga0207651_10182429 | |||
| 1719 | Ga0207651_10188407 | |||
| 1720 | Ga0207651_10221217 | |||
| 1721 | Ga0207712_10008477 | |||
| 1722 | Ga0207712_10087965 | |||
| 1723 | Ga0207712_10151782 | |||
| 1724 | Ga0207712_10284324 | |||
| 1725 | Ga0207668_10000083 | |||
| 1726 | Ga0207668_10004935 | |||
| 1727 | Ga0207668_10025939 | |||
| 1728 | Ga0207668_10032953 | |||
| 1729 | Ga0207668_10034311 | |||
| 1730 | Ga0207668_10188344 | |||
| 1731 | Ga0207668_10348194 | |||
| 1732 | Ga0207668_10776347 | |||
| 1733 | Ga0207640_10001199 | |||
| 1734 | Ga0207640_10065064 | |||
| 1735 | Ga0207640_10121377 | |||
| 1736 | Ga0207640_10271989 | |||
| 1737 | Ga0207658_10000710 | |||
| 1738 | Ga0207658_10005707 | |||
| 1739 | Ga0207658_10009884 | |||
| 1740 | Ga0207658_10100030 | |||
| 1741 | Ga0207658_10155085 | |||
| 1742 | Ga0207658_10168933 | |||
| 1743 | Ga0207658_10444397 | |||
| 1744 | Ga0207677_10000124 | |||
| 1745 | Ga0207677_10000776 | |||
| 1746 | Ga0207677_10024018 | |||
| 1747 | Ga0207703_10000167 | |||
| 1748 | Ga0207703_10001172 | |||
| 1749 | Ga0207703_10014614 | |||
| 1750 | Ga0207703_10031140 | |||
| 1751 | Ga0207703_10313481 | |||
| 1752 | Ga0207639_10004768 | |||
| 1753 | Ga0207639_10011215 | |||
| 1754 | Ga0207639_10027474 | |||
| 1755 | Ga0207639_10029025 | |||
| 1756 | Ga0207639_10043252 | |||
| 1757 | Ga0207639_10048108 | |||
| 1758 | Ga0207639_10062397 | |||
| 1759 | Ga0207639_10076856 | |||
| 1760 | Ga0207639_10092778 | |||
| 1761 | Ga0207639_10170958 | |||
| 1762 | Ga0207639_10240828 | |||
| 1763 | Ga0207639_10247332 | |||
| 1764 | Ga0207639_10346209 | |||
| 1765 | Ga0207639_10461578 | |||
| 1766 | Ga0207639_10465081 | |||
| 1767 | Ga0207678_10000681 | |||
| 1768 | Ga0207678_10004862 | |||
| 1769 | Ga0207678_10013560 | |||
| 1770 | Ga0207678_10017394 | |||
| 1771 | Ga0207678_10078097 | |||
| 1772 | Ga0207678_10082279 | |||
| 1773 | Ga0207678_10122757 | |||
| 1774 | Ga0207678_10196956 | |||
| 1775 | Ga0207708_10087041 | |||
| 1776 | Ga0207702_10001591 | |||
| 1777 | Ga0207702_10015308 | |||
| 1778 | Ga0207702_10343992 | |||
| 1779 | Ga0207641_10000028 | |||
| 1780 | Ga0207641_10007019 | |||
| 1781 | Ga0207641_10019628 | |||
| 1782 | Ga0207641_10025186 | |||
| 1783 | Ga0207641_10028710 | |||
| 1784 | Ga0207641_10031560 | |||
| 1785 | Ga0207641_10048852 | |||
| 1786 | Ga0207648_10001420 | |||
| 1787 | Ga0207648_10054701 | |||
| 1788 | Ga0207648_10360189 | |||
| 1789 | Ga0207676_10000527 | |||
| 1790 | Ga0207676_10000666 | |||
| 1791 | Ga0207676_10005078 | |||
| 1792 | Ga0207676_10033569 | |||
| 1793 | Ga0207676_10069931 | |||
| 1794 | Ga0207676_10078796 | |||
| 1795 | Ga0207674_10000244 | |||
| 1796 | Ga0207674_10004090 | |||
| 1797 | Ga0207674_10016651 | |||
| 1798 | Ga0207674_10042600 | |||
| 1799 | Ga0207674_10277481 | |||
| 1800 | Ga0207674_10305124 | |||
| 1801 | Ga0207675_100000199 | |||
| 1802 | Ga0207675_100000666 | |||
| 1803 | Ga0207675_100134453 | |||
| 1804 | Ga0207675_100590307 | |||
| 1805 | Ga0207683_10001771 | |||
| 1806 | Ga0207683_10278529 | |||
| 1807 | Ga0207683_10288989 | |||
| 1808 | Ga0207698_10005956 | |||
| 1809 | Ga0207698_10013116 | |||
| 1810 | Ga0207698_10021079 | |||
| 1811 | Ga0207698_10021164 | |||
| 1812 | Ga0207698_10064282 | |||
| 1813 | Ga0207698_10277326 | |||
| 1814 | Ga0207698_10506930 | |||
| 1815 | Ga0207698_10711417 | |||
| 1816 | Ga0209281_1005897 | |||
| 1817 | Ga0209983_1010919 | |||
| 1818 | Ga0207428_10015734 | |||
| 1819 | Ga0268266_10000019 | |||
| 1820 | Ga0268266_10000036 | |||
| 1821 | Ga0268266_10001687 | |||
| 1822 | Ga0268266_10028584 | |||
| 1823 | Ga0268266_10109769 | |||
| 1824 | Ga0268265_10000109 | |||
| 1825 | Ga0268265_10004482 | |||
| 1826 | Ga0268264_10000069 | |||
| 1827 | Ga0268264_10004358 | |||
| 1828 | Ga0268264_10004801 | |||
| 1829 | Ga0268264_10009152 | |||
| 1830 | Ga0268264_10039114 | |||
| 1831 | Ga0268264_10149990 | |||
| 1832 | Ga0268264_10197259 | |||
| 1833 | Ga0265318_10000046 | |||
| 1834 | Ga0307517_10007943 | |||
| 1835 | Ga0265338_10047479 | |||
| 1836 | Ga0316177_1101382 | |||
| 1837 | Ga0265327_10020375 | |||
| 1838 | Ga0307513_10043999 | |||
| 1839 | Ga0307513_10212571 | |||
| 1840 | Ga0307513_10339208 | |||
| 1841 | Ga0307408_100020364 | |||
| 1842 | Ga0307408_100047753 | |||
| 1843 | Ga0307408_100059639 | |||
| 1844 | Ga0307408_100187168 | |||
| 1845 | Ga0307408_100496120 | |||
| 1846 | Ga0307408_100831392 | |||
| 1847 | Ga0307508_10001242 | |||
| 1848 | Ga0265314_10089683 | |||
| 1849 | Ga0307405_10001143 | |||
| 1850 | Ga0307405_10001791 | |||
| 1851 | Ga0307405_10029574 | |||
| 1852 | Ga0307405_10056225 | |||
| 1853 | Ga0307405_10185068 | |||
| 1854 | Ga0307405_10494911 | |||
| 1855 | Ga0307413_10001436 | |||
| 1856 | Ga0307413_10003418 | |||
| 1857 | Ga0307413_10026883 | |||
| 1858 | Ga0307413_10034901 | |||
| 1859 | Ga0307413_10043222 | |||
| 1860 | Ga0307413_10113559 | |||
| 1861 | Ga0307413_10166587 | |||
| 1862 | Ga0307413_10888331 | |||
| 1863 | Ga0307410_10006204 | |||
| 1864 | Ga0307410_10008488 | |||
| 1865 | Ga0307410_10012577 | |||
| 1866 | Ga0307410_10063489 | |||
| 1867 | Ga0307410_10120250 | |||
| 1868 | Ga0307410_10135805 | |||
| 1869 | Ga0307410_10211319 | |||
| 1870 | Ga0307410_10221435 | |||
| 1871 | Ga0307410_10326154 | |||
| 1872 | Ga0307410_10549189 | |||
| 1873 | Ga0307406_10004895 | |||
| 1874 | Ga0307406_10014574 | |||
| 1875 | Ga0307406_10034013 | |||
| 1876 | Ga0307406_10063684 | |||
| 1877 | Ga0307407_10002091 | |||
| 1878 | Ga0307407_10002700 | |||
| 1879 | Ga0307407_10005183 | |||
| 1880 | Ga0307407_10270209 | |||
| 1881 | Ga0307412_10004442 | |||
| 1882 | Ga0307412_10018121 | |||
| 1883 | Ga0307412_10031357 | |||
| 1884 | Ga0307412_10073649 | |||
| 1885 | Ga0307412_10077414 | |||
| 1886 | Ga0307412_10138016 | |||
| 1887 | Ga0307412_10234555 | |||
| 1888 | Ga0307412_10502205 | |||
| 1889 | Ga0307409_100002533 | |||
| 1890 | Ga0307409_100007426 | |||
| 1891 | Ga0307409_100022011 | |||
| 1892 | Ga0307409_100063032 | |||
| 1893 | Ga0307409_100137150 | |||
| 1894 | Ga0307409_100153145 | |||
| 1895 | Ga0307409_100234250 | |||
| 1896 | Ga0307409_100325951 | |||
| 1897 | Ga0307416_100008545 | |||
| 1898 | Ga0307416_100047316 | |||
| 1899 | Ga0307416_100219558 | |||
| 1900 | Ga0307416_100408484 | |||
| 1901 | Ga0307416_100793181 | |||
| 1902 | Ga0307414_10003894 | |||
| 1903 | Ga0307414_10010707 | |||
| 1904 | Ga0307414_10032504 | |||
| 1905 | Ga0307414_10039799 | |||
| 1906 | Ga0307414_10046248 | |||
| 1907 | Ga0307414_10144556 | |||
| 1908 | Ga0307414_10277319 | |||
| 1909 | Ga0307414_10475657 | |||
| 1910 | Ga0307414_10479712 | |||
| 1911 | Ga0307411_10001555 | |||
| 1912 | Ga0307411_10024979 | |||
| 1913 | Ga0307411_10076290 | |||
| 1914 | Ga0307411_10078928 | |||
| 1915 | Ga0307411_10208932 | |||
| 1916 | Ga0307411_10327119 | |||
| 1917 | Ga0307411_10500354 | |||
| 1918 | Ga0307411_10577536 | |||
| 1919 | Ga0307411_10725215 | |||
| 1920 | Ga0307415_100000632 | |||
| 1921 | Ga0307415_100002383 | |||
| 1922 | Ga0307415_100041995 | |||
| 1923 | Ga0307415_100086361 | |||
| 1924 | Ga0307415_100142512 | |||
| 1925 | Ga0307510_10103418 | |||
| 1926 | Ga0373923_0062819 | |||
| 1927 | Ga0373923_0065455 | |||
| 1928 | Ga0373953_0023016 | |||
| 1929 | Ga0373943_0006039 | |||
| 1930 | Ga0373955_0000936 | |||
| 1931 | Ga0373931_0002063 | |||
| 1932 | Ga0373935_0308362 | |||
| 1933 | Ga0373937_0004532 | |||
| 1934 | Ga0373925_0011013 | |||
| 1935 | Ga0395899_0006947 | |||
| 1936 | Ga0395899_0074811 | |||
| 1937 | Ga0395899_0140577 | |||
| 1938 | Ga0395899_0155446 | |||
| 1939 | Ga0395899_0166709 | |||
| 1940 | Ga0395900_0000336 | |||
| 1941 | Ga0395900_0005712 | |||
| 1942 | Ga0395900_0050979 | |||
| 1943 | Ga0395900_0078289 | |||
| 1944 | Ga0395900_0083504 | |||
| 1945 | Ga0395900_0104552 | |||
| 1946 | Ga0395900_0145175 | |||
| 1947 | Ga0395900_0167501 | |||
| 1948 | Ga0395898_0016208 | |||
| 1949 | Ga0395898_0022790 | |||
| 1950 | Ga0395898_0294833 | |||
| 1951 | Ga0395898_0423500 | |||
| 1952 | Ga0395898_0858978 | |||
| 1953 | Ga0395905_0029283 | |||
| 1954 | Ga0395905_0054283 | |||
| 1955 | Ga0395905_0084437 | |||
| 1956 | Ga0395905_0090504 | |||
| 1957 | Ga0395905_0110002 | |||
| 1958 | Ga0395905_0117033 | |||
| 1959 | Ga0395905_0319064 | |||
| 1960 | Ga0395901_0000398 | |||
| 1961 | Ga0395901_0002173 | |||
| 1962 | Ga0395901_0124817 | |||
| 1963 | Ga0395901_0139053 | |||
| 1964 | Ga0395901_0222418 | |||
| 1965 | Ga0395901_0278471 | |||
| 1966 | Ga0237819_00292 | |||
| 1967 | Ga0436365_1902390 | |||
| 1968 | Ga0436363_0606517 | |||
| 1969 | Ga0436363_1122466 | |||
| 1970 | Ga0439465_0081722 | |||
| 1971 | Ga0439431_0001810 | |||
| 1972 | Ga0439432_000391 | |||
| 1973 | Ga0439462_0004540 | |||
| 1974 | Ga0450912_000302 | |||
| 1975 | Ga0450917_003634 | |||
| 1976 | Ga0450923_038696 | |||
| 1977 | Ga0450905_004102 | |||
| 1978 | Ga0450889_000006 | |||
| 1979 | Ga0439434_0002010 | |||
| 1980 | Ga0439464_0008848 | |||
| 1981 | Ga0450893_0003067 | |||
| 1982 | Ga0466966_0000301 | |||
| 1983 | Ga0466966_0074595 | |||
| 1984 | Ga0466966_0115417 | |||
| 1985 | Ga0466966_0135612 | |||
| 1986 | Ga0466961_0020790 | |||
| 1987 | Ga0466963_0223929 | |||
| 1988 | Ga0466963_0345078 | |||
| 1989 | Ga0466971_0059943 | |||
| 1990 | Ga0466971_0102069 | |||
| 1991 | Ga0466957_0097773 | |||
| 1992 | Ga0466959_0086297 | |||
| 1993 | Ga0451576_0574629 | |||
| 1994 | Ga0466958_0262411 | |||
| 1995 | Ga0466958_0411452 | |||
| 1996 | Ga0466967_0001182 | |||
| 1997 | Ga0466967_0138252 | |||
| 1998 | Ga0466967_0280572 | |||
| 1999 | Ga0466967_0450672 | |||
| 2000 | Ga0495638_0000029 | |||
| 2001 | Ga0495638_0001480 | |||
| 2002 | Ga0495638_0021189 | |||
| 2003 | Ga0495638_0074540 | |||
| 2004 | Ga0495650_0000290 | |||
| 2005 | Ga0495650_0012351 | |||
| 2006 | Ga0495584_0004125 | |||
| 2007 | Ga0495585_0001024 | |||
| 2008 | Ga0495585_0087436 | |||
| 2009 | Ga0495596_0000091 | |||
| 2010 | Ga0495596_0008830 | |||
| 2011 | Ga0495607_0005251 | |||
| 2012 | Ga0495583_0000147 | |||
| 2013 | Ga0495583_0002617 | |||
| 2014 | Ga0495583_0019485 | |||
| 2015 | Ga0495583_0034629 | |||
| 2016 | Ga0495583_0067410 | |||
| 2017 | Ga0495606_0000178 | |||
| 2018 | Ga0495606_0053017 | |||
| 2019 | Ga0495606_0054178 | |||
| 2020 | Ga0495606_0115164 | |||
| 2021 | Ga0495606_0345361 | |||
| 2022 | Ga0495610_0000220 | |||
| 2023 | Ga0495610_0000352 | |||
| 2024 | Ga0495610_0001714 | |||
| 2025 | Ga0495616_0000009 | |||
| 2026 | Ga0495620_0003485 | |||
| 2027 | Ga0495620_0075294 | |||
| 2028 | Ga0495632_0000047 | |||
| 2029 | Ga0495632_0000565 | |||
| 2030 | Ga0495632_0001651 | |||
| 2031 | Ga0495632_0071777 | |||
| 2032 | Ga0495632_0076201 | |||
| 2033 | Ga0495632_0140863 | |||
| 2034 | Ga0495643_0000036 | |||
| 2035 | Ga0495643_0000166 | |||
| 2036 | Ga0495643_0001718 | |||
| 2037 | Ga0495643_0007008 | |||
| 2038 | Ga0495643_0013682 | |||
| 2039 | Ga0495643_0081907 | |||
| 2040 | Ga0495648_0000020 | |||
| 2041 | Ga0495648_0002711 | |||
| 2042 | Ga0495648_0009822 | |||
| 2043 | Ga0495648_0011578 | |||
| 2044 | Ga0495663_0000017 | |||
| 2045 | Ga0495663_0000533 | |||
| 2046 | Ga0495642_0003717 | |||
| 2047 | Ga0495654_0028751 | |||
| 2048 | Ga0495598_0018214 | |||
| 2049 | Ga0495609_0004809 | |||
| 2050 | Ga0495597_0004964 | |||
| 2051 | Ga0495622_0128231 | |||
| 2052 | Ga0495633_0000496 | |||
| 2053 | Ga0495633_0000685 | |||
| 2054 | Ga0495633_0000737 | |||
| 2055 | Ga0495633_0009060 | |||
| 2056 | Ga0495633_0019259 | |||
| 2057 | Ga0495668_0000013 | |||
| 2058 | Ga0495668_0007020 | |||
| 2059 | Ga0495668_0076747 | |||
| 2060 | Ga0495668_0104330 | |||
| 2061 | Ga0495668_0198996 | |||
| 2062 | Ga0495668_0222100 | |||
| 2063 | Ga0495611_0003692 | |||
| 2064 | Ga0495611_0037085 | |||
| 2065 | Ga0495625_0000400 | |||
| 2066 | Ga0495625_0000599 | |||
| 2067 | Ga0495625_0012837 | |||
| 2068 | Ga0495625_0020250 | |||
| 2069 | Ga0495625_0023541 | |||
| 2070 | Ga0495669_0093406 | |||
| 2071 | Ga0495669_0109928 | |||
| 2072 | Ga0495669_0203340 | |||
| 2073 | Ga0495670_0014132 | |||
| 2074 | Ga0495670_0062004 | |||
| 2075 | Ga0495671_0000022 | |||
| 2076 | Ga0495600_0047932 | |||
| 2077 | Ga0495683_0001221 | |||
| 2078 | Ga0495687_000384 | |||
| 2079 | Ga0495677_0002225 | |||
| 2080 | Ga0495677_0002456 | |||
| 2081 | Ga0495673_0000051 | |||
| 2082 | Ga0495673_0046497 | |||
| 2083 | Ga0495681_0046345 | |||
| 2084 | Ga0495681_0084971 | |||
| 2085 | Ga0495686_0046805 | |||
| 2086 | Ga0495602_0038123 | |||
| 2087 | Ga0495615_0000009 | |||
| 2088 | Ga0495615_0003485 | |||
| 2089 | Ga0495626_0000517 | |||
| 2090 | Ga0496101_0088988 | |||
| 2091 | Ga0496102_0000066 | |||
| 2092 | Ga0496102_0009317 | |||
| 2093 | Ga0496103_0000248 | |||
| 2094 | Ga0496103_0019178 | |||
| 2095 | Ga0496104_0052149 | |||
| 2096 | Ga0496105_0000199 | |||
| 2097 | Ga0496107_0029046 | |||
| 2098 | Ga0496108_0005656 | |||
| 2099 | Ga0496108_0172143 | |||
| 2100 | Ga0496108_0299899 | |||
| 2101 | Ga0496109_0091111 | |||
| 2102 | Ga0496110_0015870 | |||
| 2103 | Ga0496110_0023976 | |||
| 2104 | Ga0496110_0278115 | |||
| 2105 | Ga0496110_0303493 | |||
| 2106 | Ga0496110_0587925 | |||
| 2107 | Ga0496111_0087964 | |||
| 2108 | Ga0496111_0173569 | |||
| 2109 | Ga0496112_0009138 | |||
| 2110 | Ga0496113_0009937 | |||
| 2111 | Ga0496113_0029922 | |||
| 2112 | Ga0496114_0014088 | |||
| 2113 | Ga0496115_0000216 | |||
| 2114 | Ga0496115_0000732 | |||
| 2115 | Ga0496116_0000279 | |||
| 2116 | Ga0496116_0002551 | |||
| 2117 | Ga0496117_0000717 | |||
| 2118 | Ga0496118_0000754 | |||
| 2119 | Ga0496119_0003364 | |||
| 2120 | Ga0496120_0043993 | |||
| 2121 | Ga0496121_0000954 | |||
| 2122 | Ga0496121_0002098 | |||
| 2123 | Ga0496121_0009641 | |||
| 2124 | Ga0496121_0024707 | |||
| 2125 | Ga0496121_0038601 | |||
| 2126 | Ga0496121_0088189 | |||
| 2127 | Ga0496121_0119116 | |||
| 2128 | Ga0496122_0000385 | |||
| 2129 | Ga0496122_0003528 | |||
| 2130 | Ga0496122_0008856 | |||
| 2131 | Ga0496122_0011771 | |||
| 2132 | Ga0496122_0013679 | |||
| 2133 | Ga0496122_0015070 | |||
| 2134 | Ga0496123_0000220 | |||
| 2135 | Ga0496123_0000300 | |||
| 2136 | Ga0496123_0000684 | |||
| 2137 | Ga0496123_0008437 | |||
| 2138 | Ga0496123_0056302 | |||
| 2139 | Ga0496123_0262501 | |||
| 2140 | Ga0496124_0000767 | |||
| 2141 | Ga0496124_0001301 | |||
| 2142 | Ga0496124_0040271 | |||
| 2143 | Ga0496124_0092017 | |||
| 2144 | Ga0496125_0000229 | |||
| 2145 | Ga0496125_0002679 | |||
| 2146 | Ga0496125_0017789 | |||
| 2147 | Ga0496125_0025306 | |||
| 2148 | Ga0496125_0032271 | |||
| 2149 | Ga0496126_0000891 | |||
| 2150 | Ga0496126_0007119 | |||
| 2151 | Ga0496126_0008301 | |||
| 2152 | Ga0496126_0245081 | |||
| 2153 | Ga0496126_0346070 | |||
| 2154 | Ga0496126_0385991 | |||
| 2155 | Ga0501032_0078028 | |||
| 2156 | Ga0501033_0007416 | |||
| 2157 | Ga0501033_0097399 | |||
| 2158 | Ga0501033_0190395 | |||
| 2159 | Ga0501036_0410571 | |||
| 2160 | Ga0501037_0041873 | |||
| 2161 | Ga0501038_0019972 | |||
| 2162 | Ga0501038_0167917 | |||
| 2163 | Ga0501047_0029038 | |||
| 2164 | Ga0501047_0064618 | |||
| 2165 | Ga0501047_0073563 | |||
| 2166 | Ga0501047_0440467 | |||
| 2167 | Ga0501067_0016612 | |||
| 2168 | Ga0501067_0242614 | |||
| 2169 | Ga0501070_0522088 | |||
| 2170 | Ga0501080_0065115 | |||
| 2171 | Ga0501080_0707770 | |||
| 2172 | Ga0501083_0214106 | |||
| 2173 | Ga0501241_005531 | |||
| 2174 | Ga0501241_013910 | |||
| 2175 | Ga0501270_001791 | |||
| 2176 | Ga0501035_0069158 | |||
| 2177 | Ga0501035_0560386 | |||
| 2178 | Ga0501044_0004024 | |||
| 2179 | Ga0501044_0005674 | |||
| 2180 | Ga0501044_0146616 | |||
| 2181 | Ga0501044_0172839 | |||
| 2182 | Ga0501044_0228335 | |||
| 2183 | Ga0501044_0410150 | |||
| 2184 | Ga0501044_0506546 | |||
| 2185 | nmdc:mga03683_33738_c2 | |||
| 2186 | nmdc:mga03683_9114_c1 | |||
| 2187 | nmdc:mga00v17_1450_c1 | |||
| 2188 | nmdc:mga0k408_12448_c1 | |||
| 2189 | nmdc:mga07m45_1_c1 | |||
| 2190 | nmdc:mga07m45_2592_c1 | |||
| 2191 | nmdc:mga07m45_5623_c1 | |||
| 2192 | nmdc:mga05p37_123477_c1 | |||
| 2193 | nmdc:mga05p37_342720_c1 | |||
| 2194 | nmdc:mga05p37_9157_c1 | |||
| 2195 | nmdc:mga0qj67_27138_c1 | |||
| 2196 | nmdc:mga08y16_209291_c1 | |||
| 2197 | nmdc:mga08y16_381262_c1 | |||
| 2198 | nmdc:mga0n895_444082_c1 | |||
| 2199 | Ga0500610_0002615 | |||
| 2200 | Ga0500643_008453 | |||
| 2201 | Ga0500643_018922 | |||
| 2202 | Ga0500641_0039472 | |||
| 2203 | Ga0500556_0000217 | |||
| 2204 | Ga0500557_079179 | |||
| 2205 | Ga0500595_002981 | |||
| 2206 | Ga0500595_005185 | |||
| 2207 | Ga0500607_000070 | |||
| 2208 | Ga0500607_000102 | |||
| 2209 | Ga0500608_127336 | |||
| 2210 | Ga0500642_0000001 | |||
| 2211 | Ga0500642_0000543 | |||
| 2212 | Ga0500658_0000049 | |||
| 2213 | Ga0500658_0002034 | |||
| 2214 | Ga0500559_0002376 | |||
| 2215 | Ga0500559_0009272 | |||
| 2216 | Ga0500559_0012440 | |||
| 2217 | Ga0500559_0012634 | |||
| 2218 | Ga0500559_0014432 | |||
| 2219 | Ga0500568_0013440 | |||
| 2220 | Ga0500568_0021149 | |||
| 2221 | Ga0500568_0037492 | |||
| 2222 | Ga0500577_0203930 | |||
| 2223 | Ga0500588_0028133 | |||
| 2224 | Ga0500590_008590 | |||
| 2225 | Ga0500604_0000007 | |||
| 2226 | Ga0500604_0003053 | |||
| 2227 | Ga0500604_0017140 | |||
| 2228 | Ga0500616_0000080 | |||
| 2229 | Ga0500616_0025469 | |||
| 2230 | Ga0500616_0033403 | |||
| 2231 | Ga0500622_0003841 | |||
| 2232 | Ga0500636_0008384 | |||
| 2233 | Ga0500625_096024 | |||
| 2234 | Ga0500645_000148 | |||
| 2235 | Ga0500645_003044 | |||
| 2236 | Ga0500645_006610 | |||
| 2237 | Ga0500596_000119 | |||
| 2238 | Ga0466962_0098253 | |||
| 2239 | Ga0466962_0102452 | |||
| 2240 | 2511127776 | |||
| 2241 | 2600203172 | |||
| 2242 | 2643950995 | |||
| 2243 | 2753766691 | |||
| 2244 | 2819554899 | |||
| 2245 | 2882809389 | |||
| 2246 | 2885432604 | |||
| 2247 | 2896431432 | |||
| 2248 | 2919143570 | |||
| 2249 | 2919712652 | |||
| 2250 | 3000868158 | |||
| 2251 | 8054306421 | |||
| 2252 | 8057101539 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1xfj-assembly1.cif.gz_A | crystal structure of protein cc_0490 from caulobacter crescentus, pfam duf152 | 0.9554 | 23 | 257 |
| 1rw0-assembly1.cif.gz_B | crystal structure of protein yfih from salmonella enterica serovar typhi, pfam duf152 | 0.93 | 47 | 257 |
| 1xaf-assembly1.cif.gz_B | crystal structure of protein of unknown function yfih from shigella flexneri 2a str. 2457t | 0.9279 | 47 | 257 |
| 1rv9-assembly1.cif.gz_A | crystal structure of neisseria meningitidis protein nmb0706, pfam duf152 | 0.8785 | 23 | 259 |
| 6dzd-assembly2.cif.gz_B | crystal structure of bacillus licheniformis hypothetical protein yfih | 0.8764 | 36 | 256 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1xfjA00 | Alpha Beta;4-Layer Sandwich;CNF1/YfiH-like putative cysteine hydrolases;CNF1/YfiH-like putative cysteine hydrolases | 0.9447 | 23 | 257 | 3.60.140.10 |
| 1rv9A00 | Alpha Beta;4-Layer Sandwich;CNF1/YfiH-like putative cysteine hydrolases;CNF1/YfiH-like putative cysteine hydrolases | 0.8785 | 23 | 259 | 3.60.140.10 |
| 1xfjA00 | Alpha Beta;4-Layer Sandwich;CNF1/YfiH-like putative cysteine hydrolases;CNF1/YfiH-like putative cysteine hydrolases | 0.8723 | 23 | 257 | 3.60.140.10 |
| 1rv9A00 | Alpha Beta;4-Layer Sandwich;CNF1/YfiH-like putative cysteine hydrolases;CNF1/YfiH-like putative cysteine hydrolases | 0.8578 | 23 | 259 | 3.60.140.10 |
| 1t8hA00 | Alpha Beta;4-Layer Sandwich;CNF1/YfiH-like putative cysteine hydrolases;CNF1/YfiH-like putative cysteine hydrolases | 0.8558 | 28 | 259 | 3.60.140.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0R2TTJ3-F1-model_v4 | Purine nucleoside phosphorylase | 0.9862 | 71 | 256 |
GO:0004000
GO:0005507 GO:0017061 GO:0046936 |
| AF-A0A3C0BS80-F1-model_v4 | Purine nucleoside phosphorylase | 0.9822 | 79 | 237 |
GO:0004000
GO:0005507 GO:0017061 GO:0046936 |
| AF-A0A1Y2K4K2-F1-model_v4 | Purine nucleoside phosphorylase | 0.9778 | 110 | 249 |
GO:0004000
GO:0005507 GO:0017061 GO:0046936 |
| AF-A0A530BMG2-F1-model_v4 | Polyphenol oxidase | 0.9715 | 135 | 251 |
GO:0004000
GO:0005507 GO:0017061 GO:0046936 |
| AF-A0A502FUC6-F1-model_v4 | Purine nucleoside phosphorylase | 0.9712 | 23 | 256 |
GO:0004000
GO:0005507 GO:0017061 GO:0046936 |