F490490

General Info

Members Datasets Scaffolds Average Seq Length
1127 774 2254 297

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_100088896|Ga0070669_1000888962
Length 306
Sequence VSVANDLTMTRAATIDGKAFAEGLRARVADKAAAFEAIAGRKAGLAVVLVGEDPASQVYVRNKGRQTVACGMESFEHKLPAEVPEADLLRLVGELNADPAVDGILVQLPLPAQIDEQKVIAAISPDKDVDGFHVINAGRLAVGQEGFVPCTPLGCLMLLKDRLGSLSGLEAVVIGRSNIVGKPMAQLLLGESCTVTVAHSRTHDLPAVVRRADIVVAAVGRAEMVKADWIKPGATVIDVGINRVPAAEAGKTRLVGDVDFDGVAEVAGAITPVPGGVGPMTIAVLLRNTLVAAHRNAGIALDPSGL

Samples

Sample ID Description Type Environment
1 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
9 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
10 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
11 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
12 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
13 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
14 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
17 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
22 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
23 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
74 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
87 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
88 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
99 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
100 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
101 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
102 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
103 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
104 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
105 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
106 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
107 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
109 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
111 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
113 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
116 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
150 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
155 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
156 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
157 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
158 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
159 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
160 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
161 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
162 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
163 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
164 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
165 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
166 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
167 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
168 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
169 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
170 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
173 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
174 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
175 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
176 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
177 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
179 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
180 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
181 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
182 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
183 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
184 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
185 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
186 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
187 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
188 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
189 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
190 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
191 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
192 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
193 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
194 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
195 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
196 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
197 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
198 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
199 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
200 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
201 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
202 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
203 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
204 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
205 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
206 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
207 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
208 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
209 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
210 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
211 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
212 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
213 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
214 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
215 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
216 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
217 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
218 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
219 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
220 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
221 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
222 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
223 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
224 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
225 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
226 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
227 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
228 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
229 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
230 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
231 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
232 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
233 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
234 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
235 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
236 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
237 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
238 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
239 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
240 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
241 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
242 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
243 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
244 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
245 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
246 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
247 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
248 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
249 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
250 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
251 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
252 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
253 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
254 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
255 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
256 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
257 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
258 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
259 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
260 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
261 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
262 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
263 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
264 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
265 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
266 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
267 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
268 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
269 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
270 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
280 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
281 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
282 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
283 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
284 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
285 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
286 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
287 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
288 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
289 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
291 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
292 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
293 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
294 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
295 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
296 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
297 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
298 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
299 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
300 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
301 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
302 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
303 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
304 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
305 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
306 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
307 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
308 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
309 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
310 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
311 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
312 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
313 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
314 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
315 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
316 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
317 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
318 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
319 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
320 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
321 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
322 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
323 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
324 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
325 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
326 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
327 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
328 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
329 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
330 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
331 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
332 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
333 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
334 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
335 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
336 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
337 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
338 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
339 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
340 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
341 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
342 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
343 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
344 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
345 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
346 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
347 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
348 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
349 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
350 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
351 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
352 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
353 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
354 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
355 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
356 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
357 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
358 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
359 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
360 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
361 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
362 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
363 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
364 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
365 2519899620 Rhizobium sp. Pop5 Isolate Nodule
366 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
367 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
368 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
369 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
370 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
371 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
372 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
373 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
374 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
375 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
376 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
377 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
378 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
379 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
380 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
381 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
382 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
383 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
384 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
385 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
386 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
387 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
388 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
389 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
390 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
391 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
392 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
393 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
394 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
395 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
396 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
397 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
398 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
399 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
400 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
401 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
402 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
403 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
404 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
405 2643221599 Rhizobium sp. Root708 Isolate Unclassified
406 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
407 2643221618 Ensifer sp. Root231 Isolate Unclassified
408 2643221626 Ensifer sp. Root31 Isolate Unclassified
409 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
410 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
411 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
412 2643221655 Ensifer sp. Root1252 Isolate Unclassified
413 2643221659 Ensifer sp. Root127 Isolate Unclassified
414 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
415 2643221688 Rhizobium sp. Root482 Isolate Unclassified
416 2643221698 Ensifer sp. Root142 Isolate Unclassified
417 2643221712 Ensifer sp. Root258 Isolate Unclassified
418 2643221718 Rhizobium sp. Root268 Isolate Unclassified
419 2643221719 Rhizobium sp. Root274 Isolate Unclassified
420 2718217882 Rhizobium sp. N741 Isolate Nodule
421 2718217927 Rhizobium sp. N324 Isolate Nodule
422 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
423 2718218009 Rhizobium sp. N561 Isolate Nodule
424 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
425 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
426 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
427 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
428 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
429 2718218363 Rhizobium sp. N113 Isolate Nodule
430 2718218365 Rhizobium sp. N731 Isolate Nodule
431 2718218366 Rhizobium sp. N621 Isolate Nodule
432 2718218423 Rhizobium sp. N941 Isolate Nodule
433 2721755514 Rhizobium sp. N6212 Isolate Nodule
434 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
435 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
436 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
437 2721755809 Rhizobium sp. N541 Isolate Nodule
438 2721755810 Rhizobium sp. N871 Isolate Nodule
439 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
440 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
441 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
442 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
443 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
444 2728369365 Rhizobium sp. N1341 Isolate Nodule
445 2728369397 Rhizobium sp. N1314 Isolate Nodule
446 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
447 2738541293 Rhizobium sp. GV031 Isolate Unclassified
448 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
449 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
450 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
451 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
452 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
453 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
454 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
455 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
456 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
457 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
458 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
459 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
460 2791355256 Rhizobium sp. M10 Isolate Nodule
461 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
462 2791355260 Rhizobium sp. L9 Isolate Nodule
463 2791355261 Rhizobium sp. J15 Isolate Nodule
464 2791355262 Rhizobium sp. M1 Isolate Nodule
465 2791355263 Rhizobium chutanense C5 Isolate Nodule
466 2791355264 Rhizobium sp. S9 Isolate Nodule
467 2791355266 Rhizobium sp. L43 Isolate Nodule
468 2791355267 Rhizobium sp. L18 Isolate Nodule
469 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
470 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
471 2802429633 Rhizobium anhuiense J3 Isolate Nodule
472 2802429634 Rhizobium anhuiense S10 Isolate Nodule
473 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
474 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
475 2802429637 Rhizobium anhuiense C15 Isolate Nodule
476 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
477 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
478 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
479 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
480 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
481 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
482 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
483 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
484 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
485 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
486 2838048938 Rhizobium pisi 27/80 Isolate Nodule
487 2838061910 Rhizobium phaseoli L15 Isolate Nodule
488 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
489 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
490 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
491 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
492 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
493 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
494 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
495 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
496 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
497 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
498 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
499 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
500 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
501 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
502 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
503 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
504 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
505 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
506 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
507 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
508 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
509 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
510 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
511 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
512 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
513 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
514 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
515 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
516 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
517 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
518 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
519 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
520 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
521 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
522 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
523 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
524 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
525 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
526 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
527 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
528 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
529 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
530 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
531 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
532 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
533 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
534 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
535 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
536 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
537 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
538 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
539 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
540 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
541 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
542 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
543 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
544 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
545 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
546 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
547 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
548 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
549 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
550 2844163670 Ensifer sp. 1H6 Isolate Unclassified
551 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
552 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
553 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
554 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
555 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
556 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
557 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
558 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
559 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
560 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
561 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
562 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
563 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
564 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
565 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
566 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
567 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
568 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
569 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
570 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
571 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
572 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
573 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
574 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
575 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
576 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
577 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
578 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
579 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
580 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
581 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
582 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
583 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
584 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
585 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
586 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
587 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
588 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
589 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
590 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
591 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
592 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
593 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
594 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
595 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
596 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
597 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
598 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
599 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
600 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
601 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
602 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
603 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
604 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
605 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
606 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
607 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
608 2933599457 Rhizobium phaseoli M3 Isolate Nodule
609 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
610 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
611 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
612 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
613 2936381700 Rhizobium chutanense C16 Isolate Unclassified
614 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
615 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
616 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
617 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
618 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
619 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
620 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
621 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
622 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
623 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
624 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
625 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
626 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
627 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
628 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
629 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
630 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
631 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
632 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
633 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
634 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
635 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
636 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
637 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
638 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
639 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
640 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
641 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
642 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
643 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
644 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
645 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
646 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
647 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
648 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
649 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
650 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
651 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
652 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
653 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
654 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
655 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
656 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
657 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
658 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
659 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
660 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
661 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
662 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
663 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
664 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
665 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
666 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
667 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
668 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
669 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
670 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
671 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
672 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
673 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
674 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
675 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
676 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
677 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
678 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
679 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
680 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
681 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
682 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
683 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
684 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
685 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
686 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
687 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
688 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
689 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
690 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
691 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
692 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
693 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
694 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
695 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
696 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
697 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
698 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
699 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
700 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
701 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
702 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
703 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
704 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
705 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
706 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
707 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
708 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
709 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
710 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
711 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
712 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
713 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
714 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
715 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
716 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
717 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
718 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
719 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
720 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
721 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
722 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
723 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
724 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
725 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
726 2996887358 Rhizobium sp. R711 Isolate Nodule
727 2996893221 Rhizobium sp. R635 Isolate Nodule
728 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
729 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
730 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
731 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
732 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
733 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
734 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
735 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
736 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
737 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
738 8005258706 Rhizobium sp. R693 Isolate Nodule
739 8005275841 Rhizobium sp. N4311 Isolate Nodule
740 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
741 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
742 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
743 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
744 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
745 8005321885 Rhizobium sp. R72 Isolate Nodule
746 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
747 8005382845 Rhizobium sp. R634 Isolate Nodule
748 8005395548 Rhizobium sp. R339 Isolate Nodule
749 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
750 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
751 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
752 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
753 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
754 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
755 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
756 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
757 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
758 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
759 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
760 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
761 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
762 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
763 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
764 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
765 8018176218 Rhizobium sp. N122 Isolate Nodule
766 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
767 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
768 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
769 8024501048 Rhizobium sp. H4 Isolate Nodule
770 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
771 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
772 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
773 8056382006 Rhizobium croatiense 13T Isolate Nodule
774 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 56.79
Metatranscriptomes 0
Isolates 43.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.88
Nodule 33.81
Rhizoplane 3.46
Rhizosphere 31.77
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070669_100088896 3300005353 Bacteria 2313
2 JGI24740J21852_10005355 3300001979 Bacteria 5439
3 JGI24739J22299_10008673 3300001989 Bacteria 3792
4 JGI24737J22298_10001181 3300001990 Bacteria 9201
5 JGI24735J21928_10005736 3300002067 Bacteria 4105
6 JGI25155J39150_1000023 3300002704 Bacteria 136961
7 JGI25156J39149_1000029 3300002705 Bacteria 126505
8 JGI25154J39366_1000067 3300002738 Bacteria 100452
9 JGI25158J39367_1000337 3300002739 Bacteria 10344
10 JGI25157J39369_1000043 3300002741 Bacteria 122537
11 JGI25152J39213_1000622 3300002773 Bacteria 18865
12 JGI25152J39213_1001653 3300002773 Bacteria 9283
13 JGI25150J39212_1000012 3300002774 Bacteria 182468
14 JGI25159J45721_1000016 3300002987 Bacteria 139656
15 JGI25159J45721_1000234 3300002987 Bacteria 26222
16 JGI25151J46595_10000025 3300003187 Bacteria 213302
17 JGI25151J46595_10000346 3300003187 Bacteria 49745
18 JGI25151J46595_10004241 3300003187 Bacteria 7629
19 JGI25151J46595_10027315 3300003187 Bacteria 2290
20 JGI25153J46596_10005707 3300003215 Bacteria 6490
21 JGI25153J46596_10045475 3300003215 Bacteria 1310
22 JGI25160J50197_1000002 3300003354 Bacteria 561707
23 JGI25160J50197_1000500 3300003354 Bacteria 23279
24 JGI25160J50197_1007740 3300003354 Bacteria 4171
25 JGI25161J50226_1000323 3300003374 Bacteria 26158
26 JGI25161J50226_1000382 3300003374 Bacteria 22288
27 JGI25161J50226_1003889 3300003374 Bacteria 3258
28 Ga0055526_1000624 3300003771 Bacteria 27522
29 Ga0055526_1006023 3300003771 Bacteria 6729
30 Ga0055526_1011604 3300003771 Bacteria 3948
31 Ga0055526_1014014 3300003771 Bacteria 3336
32 Ga0055526_1015721 3300003771 Bacteria 3018
33 Ga0055524_1001892 3300003775 Bacteria 11358
34 Ga0055524_1004600 3300003775 Bacteria 6341
35 Ga0055524_1013212 3300003775 Bacteria 3125
36 Ga0055524_1020811 3300003775 Bacteria 2197
37 Ga0055536_1002390 3300003781 Bacteria 10579
38 Ga0055528_1000137 3300003790 Bacteria 58854
39 Ga0055528_1000303 3300003790 Bacteria 41794
40 Ga0055528_1001607 3300003790 Bacteria 13359
41 Ga0055528_1012661 3300003790 Bacteria 3256
42 Ga0055528_1025258 3300003790 Bacteria 1751
43 Ga0055530_10015082 3300003791 Bacteria 2544
44 Ga0055540_1001855 3300003792 Bacteria 11904
45 Ga0055540_1002138 3300003792 Bacteria 10768
46 Ga0055540_1002362 3300003792 Bacteria 10085
47 Ga0055531_10001338 3300003794 Bacteria 18408
48 Ga0055531_10003792 3300003794 Bacteria 9487
49 Ga0055543_1000008 3300004625 Bacteria 202062
50 Ga0055543_1000022 3300004625 Bacteria 140745
51 Ga0055543_1000046 3300004625 Bacteria 113628
52 Ga0055543_1000141 3300004625 Bacteria 60055
53 Ga0055543_1002287 3300004625 Bacteria 6467
54 Ga0065165_1000031 3300005262 Bacteria 216330
55 Ga0065165_1000058 3300005262 Bacteria 184784
56 Ga0065165_1000175 3300005262 Bacteria 113628
57 Ga0065165_1004542 3300005262 Bacteria 8484
58 Ga0065165_1008189 3300005262 Bacteria 4960
59 Ga0065165_1029847 3300005262 Bacteria 1741
60 Ga0065704_10004143 3300005289 Bacteria 3553
61 Ga0070658_10000022 3300005327 Bacteria 186706
62 Ga0070658_10000304 3300005327 Bacteria 42569
63 Ga0070658_10333942 3300005327 Bacteria 1296
64 Ga0070670_100129173 3300005331 Bacteria 2181
65 Ga0070670_100257930 3300005331 Bacteria 1519
66 Ga0070666_10014916 3300005335 Bacteria 4950
67 Ga0070666_10127988 3300005335 Bacteria 1763
68 Ga0070666_10374711 3300005335 Bacteria 1021
69 Ga0070660_100009089 3300005339 Bacteria 6976
70 Ga0070660_100059159 3300005339 Bacteria 2971
71 Ga0070689_100117682 3300005340 Bacteria 2120
72 Ga0070661_100280743 3300005344 Bacteria 1292
73 Ga0070668_100018871 3300005347 Bacteria 5181
74 Ga0070668_100078075 3300005347 Bacteria 2589
75 Ga0070669_100000470 3300005353 Bacteria 30618
76 Ga0070669_100001664 3300005353 Bacteria 16087
77 Ga0070671_100000480 3300005355 Bacteria 27781
78 Ga0070671_100000845 3300005355 Bacteria 22289
79 Ga0070667_100003664 3300005367 Bacteria 13079
80 Ga0070667_100038587 3300005367 Bacteria 4004
81 Ga0070711_100047092 3300005439 Bacteria 2942
82 Ga0070705_100093227 3300005440 Bacteria 1882
83 Ga0070708_100533892 3300005445 Bacteria 1107
84 Ga0070663_100010764 3300005455 Bacteria 5711
85 Ga0070663_100121808 3300005455 Bacteria 1971
86 Ga0070678_100074328 3300005456 Bacteria 2554
87 Ga0070698_100562578 3300005471 Bacteria 1080
88 Ga0068853_100142436 3300005539 Bacteria 2153
89 Ga0068853_100283786 3300005539 Bacteria 1527
90 Ga0070686_100057706 3300005544 Bacteria 2495
91 Ga0070665_100000079 3300005548 Bacteria 186925
92 Ga0070665_100007174 3300005548 Bacteria 11332
93 Ga0070665_100069335 3300005548 Bacteria 3534
94 Ga0070665_100244589 3300005548 Bacteria 1794
95 Ga0070665_100708593 3300005548 Bacteria 1020
96 Ga0070704_100184020 3300005549 Bacteria 1673
97 Ga0068855_100001164 3300005563 Bacteria 32603
98 Ga0068855_100012273 3300005563 Bacteria 10353
99 Ga0068857_100045267 3300005577 Bacteria 3903
100 Ga0068854_100001776 3300005578 Bacteria 13129
101 Ga0068854_100047329 3300005578 Bacteria 3065
102 Ga0068854_100090117 3300005578 Bacteria 2280
103 Ga0068856_100088241 3300005614 Bacteria 3084
104 Ga0068852_100000357 3300005616 Bacteria 30774
105 Ga0068852_100122683 3300005616 Bacteria 2382
106 Ga0068859_100012881 3300005617 Bacteria 8400
107 Ga0068859_100031806 3300005617 Bacteria 5300
108 Ga0068864_100008530 3300005618 Bacteria 8456
109 Ga0068863_100000103 3300005841 Bacteria 91380
110 Ga0068858_100001349 3300005842 Bacteria 25309
111 Ga0068858_100016792 3300005842 Bacteria 6874
112 Ga0068858_100023512 3300005842 Bacteria 5740
113 Ga0068858_100040602 3300005842 Bacteria 4315
114 Ga0068860_100000093 3300005843 Bacteria 150034
115 Ga0068862_100024495 3300005844 Bacteria 5064
116 Ga0068862_100408680 3300005844 Bacteria 1271
117 Ga0081455_10042227 3300005937 Bacteria 4003
118 Ga0081455_10063732 3300005937 Bacteria 3091
119 Ga0081538_10001207 3300005981 Bacteria 27113
120 Ga0081538_10089373 3300005981 Bacteria 1599
121 Ga0075365_10004118 3300006038 Bacteria 7645
122 Ga0075365_10007525 3300006038 Bacteria 6110
123 Ga0075365_10054188 3300006038 Bacteria 2659
124 Ga0075365_10063111 3300006038 Bacteria 2480
125 Ga0075365_10105120 3300006038 Bacteria 1936
126 Ga0075363_100060745 3300006048 Bacteria 2035
127 Ga0070716_100132228 3300006173 Bacteria 1579
128 Ga0070712_100003467 3300006175 Bacteria 9712
129 Ga0075362_10000728 3300006177 Bacteria 9734
130 Ga0075362_10009130 3300006177 Bacteria 3819
131 Ga0075367_10061193 3300006178 Bacteria 2246
132 Ga0075367_10142283 3300006178 Bacteria 1486
133 Ga0075369_10008880 3300006186 Bacteria 3886
134 Ga0075369_10029915 3300006186 Bacteria 2291
135 Ga0075369_10035252 3300006186 Bacteria 2126
136 Ga0075366_10000192 3300006195 Bacteria 26957
137 Ga0097621_100112786 3300006237 Bacteria 2299
138 Ga0075370_10000015 3300006353 Bacteria 62164
139 Ga0075433_10063700 3300006852 Bacteria 3231
140 Ga0075434_100021327 3300006871 Bacteria 6297
141 Ga0097620_100012881 3300006931 Bacteria 8400
142 Ga0097620_100031806 3300006931 Bacteria 5300
143 Ga0099822_1047390 3300006943 Bacteria 1958
144 Ga0079104_1000069 3300006946 Bacteria 153993
145 Ga0075435_100070211 3300007076 Bacteria 2859
146 Ga0105251_10000232 3300009011 Bacteria 56006
147 Ga0105251_10033414 3300009011 Bacteria 2554
148 Ga0105240_10035774 3300009093 Bacteria 6395
149 Ga0105240_10108042 3300009093 Bacteria 3371
150 Ga0105245_10096781 3300009098 Bacteria 2724
151 Ga0105247_10053619 3300009101 Bacteria 2488
152 Ga0114129_10668261 3300009147 Bacteria 1339
153 Ga0105243_10570893 3300009148 Bacteria 1084
154 Ga0105242_10326049 3300009176 Bacteria 1410
155 Ga0105248_10024368 3300009177 Bacteria 6730
156 Ga0105248_10091196 3300009177 Bacteria 3432
157 Ga0105237_10005695 3300009545 Bacteria 14014
158 Ga0105249_10302920 3300009553 Bacteria 1604
159 Ga0105249_10553474 3300009553 Bacteria 1201
160 Ga0123340_1032850 3300009763 Bacteria 2973
161 Ga0123341_1000192 3300009765 Bacteria 31290
162 Ga0123341_1068856 3300009765 Bacteria 1577
163 Ga0123342_1011318 3300009766 Bacteria 9808
164 Ga0123342_1017436 3300009766 Bacteria 5965
165 Ga0105239_10000271 3300010375 Bacteria 76812
166 Ga0105239_10147014 3300010375 Bacteria 2629
167 Ga0105246_10156264 3300011119 Bacteria 1732
168 Ga0157369_10276980 3300013105 Bacteria 1747
169 Ga0163162_10009970 3300013306 Bacteria 9240
170 Ga0163162_10088278 3300013306 Bacteria 3180
171 Ga0163162_10183231 3300013306 Bacteria 2220
172 Ga0163162_10578988 3300013306 Bacteria 1250
173 Ga0157372_10093707 3300013307 Bacteria 3418
174 Ga0157375_10642267 3300013308 Bacteria 1218
175 Ga0163163_10153611 3300014325 Bacteria 2345
176 Ga0157379_10152633 3300014968 Bacteria 2084
177 Ga0163161_10095125 3300017792 Bacteria 2209
178 Ga0214542_1001787 3300021321 Bacteria 44536
179 Ga0214543_1001073 3300021327 Bacteria 51004
180 Ga0209435_100011 3300025206 Bacteria 413027
181 Ga0209436_100051 3300025208 Bacteria 64359
182 Ga0209436_100142 3300025208 Bacteria 34468
183 Ga0207425_1000012 3300025245 Bacteria 528324
184 Ga0207425_1003170 3300025245 Bacteria 5378
185 Ga0207425_1010785 3300025245 Bacteria 2209
186 Ga0209646_1000024 3300025246 Bacteria 413027
187 Ga0209026_1000030 3300025250 Bacteria 329811
188 Ga0209759_1000011 3300025256 Bacteria 413027
189 Ga0209129_1000081 3300025258 Bacteria 183694
190 Ga0209129_1000123 3300025258 Bacteria 133661
191 Ga0209129_1000545 3300025258 Bacteria 26086
192 Ga0209129_1001854 3300025258 Bacteria 11184
193 Ga0209129_1009580 3300025258 Bacteria 2529
194 Ga0209673_1000015 3300025273 Bacteria 530618
195 Ga0209673_1000023 3300025273 Bacteria 411385
196 Ga0209673_1000704 3300025273 Bacteria 47438
197 Ga0209673_1000999 3300025273 Bacteria 34430
198 Ga0209673_1001868 3300025273 Bacteria 17068
199 Ga0209673_1009131 3300025273 Bacteria 4328
200 Ga0209673_1015055 3300025273 Bacteria 2958
201 Ga0209673_1017660 3300025273 Bacteria 2624
202 Ga0209673_1021915 3300025273 Bacteria 2220
203 Ga0209130_1000002 3300025284 Bacteria 722648
204 Ga0209130_1000008 3300025284 Bacteria 581232
205 Ga0209130_1000088 3300025284 Bacteria 152927
206 Ga0209130_1000144 3300025284 Bacteria 114000
207 Ga0209130_1025027 3300025284 Bacteria 1297
208 Ga0209676_1023383 3300025292 Bacteria 2024
209 Ga0209025_1000024 3300025294 Bacteria 528324
210 Ga0209025_1000528 3300025294 Bacteria 72802
211 Ga0209025_1000631 3300025294 Bacteria 62429
212 Ga0209025_1000970 3300025294 Bacteria 43006
213 Ga0209025_1001290 3300025294 Bacteria 34276
214 Ga0209025_1004062 3300025294 Bacteria 13089
215 Ga0209025_1008764 3300025294 Bacteria 7200
216 Ga0209025_1008774 3300025294 Bacteria 7195
217 Ga0209025_1020194 3300025294 Bacteria 3657
218 Ga0209564_1000091 3300025295 Bacteria 249103
219 Ga0209564_1000100 3300025295 Bacteria 224016
220 Ga0209564_1000382 3300025295 Bacteria 81070
221 Ga0209564_1000811 3300025295 Bacteria 42680
222 Ga0209564_1001938 3300025295 Bacteria 18408
223 Ga0209564_1021333 3300025295 Bacteria 2333
224 Ga0209758_1000046 3300025297 Bacteria 364931
225 Ga0209758_1000349 3300025297 Bacteria 84164
226 Ga0209758_1001043 3300025297 Bacteria 36278
227 Ga0209758_1001705 3300025297 Bacteria 24677
228 Ga0209758_1003657 3300025297 Bacteria 13703
229 Ga0209758_1005259 3300025297 Bacteria 10125
230 Ga0209758_1007186 3300025297 Bacteria 7677
231 Ga0209758_1032753 3300025297 Bacteria 2103
232 Ga0209758_1045420 3300025297 Bacteria 1595
233 Ga0209758_1053437 3300025297 Bacteria 1388
234 Ga0209050_1008783 3300025298 Bacteria 5309
235 Ga0209050_1020591 3300025298 Bacteria 2447
236 Ga0209256_1000541 3300025299 Bacteria 54431
237 Ga0209256_1000991 3300025299 Bacteria 33849
238 Ga0209256_1002790 3300025299 Bacteria 13386
239 Ga0209256_1003225 3300025299 Bacteria 11770
240 Ga0209256_1005515 3300025299 Bacteria 7239
241 Ga0209256_1006225 3300025299 Bacteria 6429
242 Ga0209256_1008520 3300025299 Bacteria 4734
243 Ga0207426_1000012 3300025302 Bacteria 730942
244 Ga0207426_1000013 3300025302 Bacteria 721897
245 Ga0207426_1000016 3300025302 Bacteria 581232
246 Ga0207426_1000063 3300025302 Bacteria 358920
247 Ga0207426_1000126 3300025302 Bacteria 213341
248 Ga0207426_1000172 3300025302 Bacteria 163690
249 Ga0207426_1002543 3300025302 Bacteria 11441
250 Ga0209051_1000084 3300025303 Bacteria 190324
251 Ga0209051_1001361 3300025303 Bacteria 21200
252 Ga0209051_1002292 3300025303 Bacteria 13969
253 Ga0209051_1007069 3300025303 Bacteria 6209
254 Ga0209051_1011219 3300025303 Bacteria 4446
255 Ga0209051_1018218 3300025303 Bacteria 3112
256 Ga0209257_1003522 3300025304 Bacteria 13313
257 Ga0209257_1004519 3300025304 Bacteria 10694
258 Ga0209257_1015578 3300025304 Bacteria 3152
259 Ga0209257_1021288 3300025304 Bacteria 2361
260 Ga0207697_10023646 3300025315 Bacteria 2515
261 Ga0207713_1001012 3300025735 Bacteria 24466
262 Ga0207688_10027263 3300025901 Bacteria 3142
263 Ga0207647_10005017 3300025904 Bacteria 9754
264 Ga0207647_10014570 3300025904 Bacteria 5418
265 Ga0207705_10000007 3300025909 Bacteria 597387
266 Ga0207705_10000236 3300025909 Bacteria 54788
267 Ga0207695_10005291 3300025913 Bacteria 17200
268 Ga0207695_10111878 3300025913 Bacteria 2709
269 Ga0207671_10000955 3300025914 Bacteria 35890
270 Ga0207693_10009711 3300025915 Bacteria 7834
271 Ga0207657_10000837 3300025919 Bacteria 32516
272 Ga0207657_10083525 3300025919 Bacteria 2679
273 Ga0207650_10070488 3300025925 Bacteria 2628
274 Ga0207650_10139049 3300025925 Bacteria 1908
275 Ga0207687_10028182 3300025927 Bacteria 3773
276 Ga0207687_10233758 3300025927 Bacteria 1453
277 Ga0207644_10000022 3300025931 Bacteria 160689
278 Ga0207644_10002151 3300025931 Bacteria 12784
279 Ga0207644_10018833 3300025931 Bacteria 4677
280 Ga0207644_10074822 3300025931 Bacteria 2487
281 Ga0207644_10164890 3300025931 Bacteria 1725
282 Ga0207670_10090668 3300025936 Bacteria 2160
283 Ga0207670_10115361 3300025936 Bacteria 1943
284 Ga0207665_10139529 3300025939 Bacteria 1727
285 Ga0207691_10130402 3300025940 Bacteria 2221
286 Ga0207711_10017979 3300025941 Bacteria 5875
287 Ga0207711_10033443 3300025941 Bacteria 4350
288 Ga0207711_10090747 3300025941 Bacteria 2686
289 Ga0207667_10000017 3300025949 Bacteria 390654
290 Ga0207667_10009368 3300025949 Bacteria 11544
291 Ga0207712_10078256 3300025961 Bacteria 2399
292 Ga0207712_10094210 3300025961 Bacteria 2211
293 Ga0207712_10402570 3300025961 Bacteria 1151
294 Ga0207668_10024423 3300025972 Bacteria 3900
295 Ga0207640_10000279 3300025981 Bacteria 34340
296 Ga0207640_10043181 3300025981 Bacteria 2880
297 Ga0207640_10554721 3300025981 Bacteria 966
298 Ga0207658_10003195 3300025986 Bacteria 11669
299 Ga0207658_10004374 3300025986 Bacteria 9823
300 Ga0207703_10010077 3300026035 Bacteria 7407
301 Ga0207703_10014134 3300026035 Bacteria 6223
302 Ga0207639_10108095 3300026041 Bacteria 2261
303 Ga0207639_10113332 3300026041 Bacteria 2214
304 Ga0207639_10386986 3300026041 Bacteria 1257
305 Ga0207678_10020241 3300026067 Bacteria 5841
306 Ga0207678_10144888 3300026067 Bacteria 2028
307 Ga0207702_10037255 3300026078 Bacteria 4070
308 Ga0207702_10049092 3300026078 Bacteria 3560
309 Ga0207641_10000113 3300026088 Bacteria 119188
310 Ga0207641_10001790 3300026088 Bacteria 20701
311 Ga0207641_10094941 3300026088 Bacteria 2616
312 Ga0207648_10057138 3300026089 Bacteria 3404
313 Ga0207676_10007157 3300026095 Bacteria 7901
314 Ga0207674_10048088 3300026116 Bacteria 4368
315 Ga0207674_10056363 3300026116 Bacteria 3992
316 Ga0207683_10029461 3300026121 Bacteria 4753
317 Ga0207698_10000919 3300026142 Bacteria 17125
318 Ga0207698_10149172 3300026142 Bacteria 2027
319 Ga0209281_1000192 3300027111 Bacteria 140252
320 Ga0209589_1000008 3300027357 Bacteria 259970
321 Ga0268266_10000175 3300028379 Bacteria 115897
322 Ga0268266_10002389 3300028379 Bacteria 20264
323 Ga0268266_10063619 3300028379 Bacteria 3185
324 Ga0268266_10596049 3300028379 Bacteria 1061
325 Ga0268265_10003957 3300028380 Bacteria 10437
326 Ga0268265_10014248 3300028380 Bacteria 5416
327 Ga0268264_10000067 3300028381 Bacteria 284445
328 Ga0268264_10004814 3300028381 Bacteria 11451
329 Ga0268264_10319169 3300028381 Bacteria 1468
330 Ga0307515_10000023 3300028794 Bacteria 400846
331 Ga0307515_10002402 3300028794 Bacteria 40839
332 Ga0307515_10011571 3300028794 Bacteria 16734
333 Ga0307515_10080271 3300028794 Bacteria 4257
334 Ga0307515_10083547 3300028794 Bacteria 4114
335 Ga0265338_10012159 3300028800 Bacteria 9836
336 Ga0307512_10023098 3300030522 Bacteria 5563
337 Ga0307512_10204955 3300030522 Bacteria 1060
338 Ga0265340_10092350 3300031247 Bacteria 1413
339 Ga0265339_10052139 3300031249 Bacteria 2229
340 Ga0265331_10025309 3300031250 Bacteria 2997
341 Ga0307513_10001791 3300031456 Bacteria 30530
342 Ga0307513_10007352 3300031456 Bacteria 14292
343 Ga0307513_10135595 3300031456 Bacteria 2398
344 Ga0307513_10252732 3300031456 Bacteria 1558
345 Ga0307509_10213405 3300031507 Bacteria 1752
346 Ga0307508_10000061 3300031616 Bacteria 124749
347 Ga0307514_10006588 3300031649 Bacteria 10081
348 Ga0265342_10042786 3300031712 Bacteria 2735
349 Ga0307405_10004962 3300031731 Bacteria 6356
350 Ga0316577_10225929 3300031733 Bacteria 1059
351 Ga0307413_10012418 3300031824 Bacteria 4240
352 Ga0307410_10136980 3300031852 Bacteria 1806
353 Ga0307412_10001302 3300031911 Bacteria 13994
354 Ga0307412_10019347 3300031911 Bacteria 4121
355 Ga0307409_100027369 3300031995 Bacteria 4039
356 Ga0307416_100914279 3300032002 Bacteria 978
357 Ga0307411_10105799 3300032005 Bacteria 2001
358 Ga0307411_10226110 3300032005 Bacteria 1455
359 Ga0307415_100445395 3300032126 Bacteria 1118
360 Ga0307507_10017050 3300033179 Bacteria 8381
361 Ga0307510_10045809 3300033180 Bacteria 4713
362 Ga0316584_0139219 3300036712 Bacteria 1811
363 Ga0373925_0003273 3300037068 Bacteria 12613
364 Ga0395899_0126918 3300037312 Bacteria 1824
365 Ga0395900_0003414 3300037418 Bacteria 17170
366 Ga0395898_0003860 3300037466 Bacteria 16582
367 Ga0395898_0276351 3300037466 Bacteria 1602
368 Ga0395905_0003148 3300037471 Bacteria 17774
369 Ga0395905_0138386 3300037471 Bacteria 2291
370 Ga0395905_0173165 3300037471 Bacteria 2027
371 Ga0395905_0381806 3300037471 Bacteria 1303
372 Ga0395901_0007994 3300038443 Bacteria 10676
373 Ga0395901_0054859 3300038443 Bacteria 4143
374 Ga0395901_0592089 3300038443 Bacteria 1119
375 Ga0439436_0000251 3300041404 Bacteria 12861
376 Ga0439439_0006792 3300041406 Bacteria 2654
377 Ga0439465_0005175 3300041413 Bacteria 4185
378 Ga0439465_0010138 3300041413 Bacteria 2962
379 Ga0439465_0037163 3300041413 Bacteria 1565
380 Ga0451833_0527268 3300041491 Bacteria 1942
381 Ga0451833_1293815 3300041491 Bacteria 1526
382 Ga0451835_0106000 3300041492 Bacteria 1820
383 Ga0451837_0282246 3300041494 Bacteria 2722
384 Ga0451837_1449378 3300041494 Bacteria 1096
385 Ga0451839_0592019 3300041496 Bacteria 2152
386 Ga0451839_0649873 3300041496 Bacteria 3395
387 Ga0451841_0195940 3300041498 Bacteria 2418
388 Ga0451845_0049602 3300041501 Bacteria 1231
389 Ga0451847_0597278 3300041503 Bacteria 1024
390 Ga0451849_0316661 3300041505 Bacteria 1892
391 Ga0451849_0889549 3300041505 Bacteria 2431
392 Ga0451851_0538219 3300041507 Bacteria 4548
393 Ga0451853_2795663 3300041512 Bacteria 1910
394 Ga0451853_3659835 3300041512 Bacteria 1693
395 Ga0439431_0015409 3300041997 Bacteria 1780
396 Ga0439449_0002233 3300042007 Bacteria 7624
397 Ga0450907_008476 3300042146 Bacteria 1707
398 Ga0450918_000904 3300042531 Bacteria 6226
399 Ga0466970_0001455 3300044765 Bacteria 11448
400 Ga0466957_0036844 3300044842 Bacteria 2942
401 Ga0466960_0177554 3300044901 Bacteria 1153
402 Ga0451576_0000017 3300045051 Bacteria 558261
403 Ga0466958_0002666 3300045836 Bacteria 9031
404 Ga0495590_0040444 3300046457 Bacteria 1626
405 Ga0495629_0013845 3300046459 Bacteria 5819
406 Ga0495638_0002127 3300046460 Bacteria 16661
407 Ga0495638_0042581 3300046460 Bacteria 2867
408 Ga0495641_0041407 3300046461 Bacteria 2140
409 Ga0495650_0022100 3300046471 Bacteria 3058
410 Ga0495650_0086174 3300046471 Bacteria 1203
411 Ga0495605_0004255 3300046474 Bacteria 8434
412 Ga0495585_0003512 3300046492 Bacteria 10572
413 Ga0495585_0107138 3300046492 Bacteria 1489
414 Ga0495607_0026276 3300046501 Bacteria 3613
415 Ga0495607_0058173 3300046501 Bacteria 2212
416 Ga0495583_0000729 3300046506 Bacteria 41893
417 Ga0495583_0038500 3300046506 Bacteria 2259
418 Ga0495606_0028304 3300046507 Bacteria 3957
419 Ga0495606_0028981 3300046507 Bacteria 3894
420 Ga0495610_0003654 3300046512 Bacteria 11836
421 Ga0495620_0012660 3300046515 Bacteria 4345
422 Ga0495620_0031491 3300046515 Bacteria 2430
423 Ga0495620_0034435 3300046515 Bacteria 2288
424 Ga0495632_0004427 3300046519 Bacteria 9548
425 Ga0495632_0008553 3300046519 Bacteria 6262
426 Ga0495632_0038504 3300046519 Bacteria 2421
427 Ga0495632_0054546 3300046519 Bacteria 1959
428 Ga0495643_0020335 3300046522 Bacteria 3828
429 Ga0495643_0022058 3300046522 Bacteria 3640
430 Ga0495643_0076124 3300046522 Bacteria 1755
431 Ga0495644_0065939 3300046523 Bacteria 1360
432 Ga0495648_0012880 3300046524 Bacteria 6212
433 Ga0495648_0026511 3300046524 Bacteria 3899
434 Ga0495648_0131990 3300046524 Bacteria 1327
435 Ga0495663_0037469 3300046525 Bacteria 1463
436 Ga0495654_0065288 3300046530 Bacteria 1738
437 Ga0495597_0103518 3300046542 Bacteria 1198
438 Ga0495622_0054191 3300046557 Bacteria 1861
439 Ga0495633_0048852 3300046558 Bacteria 1997
440 Ga0495668_0033389 3300046616 Bacteria 2891
441 Ga0495668_0062119 3300046616 Bacteria 2059
442 Ga0495611_0004276 3300046648 Bacteria 6208
443 Ga0495625_0001549 3300046660 Bacteria 27422
444 Ga0495625_0008316 3300046660 Bacteria 8864
445 Ga0495625_0124392 3300046660 Bacteria 1752
446 Ga0495625_0198134 3300046660 Bacteria 1327
447 Ga0495625_0290172 3300046660 Bacteria 1050
448 Ga0495647_0066809 3300046681 Bacteria 1431
449 Ga0495670_0088217 3300046691 Bacteria 1585
450 Ga0495671_0005841 3300046692 Bacteria 7166
451 Ga0495671_0072259 3300046692 Bacteria 1694
452 Ga0495649_0047777 3300046694 Bacteria 2327
453 Ga0495589_0053124 3300046794 Bacteria 2000
454 Ga0495660_0033432 3300046810 Bacteria 2883
455 Ga0495581_0053660 3300047315 Bacteria 2328
456 Ga0495636_0032581 3300047318 Bacteria 2138
457 Ga0495672_0040288 3300047320 Bacteria 2834
458 Ga0495676_0014794 3300047321 Bacteria 6967
459 Ga0495683_0116123 3300047323 Bacteria 1274
460 Ga0495687_020132 3300047443 Bacteria 3258
461 Ga0495687_056893 3300047443 Bacteria 1629
462 Ga0495687_062756 3300047443 Bacteria 1524
463 Ga0495673_0064543 3300047469 Bacteria 1557
464 Ga0495673_0084977 3300047469 Bacteria 1303
465 Ga0495686_0007642 3300047472 Bacteria 8070
466 Ga0496100_0098884 3300048903 Bacteria 2006
467 Ga0496101_0001718 3300048904 Bacteria 13120
468 Ga0496101_0137123 3300048904 Bacteria 1863
469 Ga0496101_0173358 3300048904 Bacteria 1658
470 Ga0496102_0018972 3300048905 Bacteria 6050
471 Ga0496102_0041249 3300048905 Bacteria 4178
472 Ga0496102_0062080 3300048905 Bacteria 3421
473 Ga0496102_0062589 3300048905 Bacteria 3407
474 Ga0496102_0161723 3300048905 Bacteria 2106
475 Ga0496102_0254200 3300048905 Bacteria 1657
476 Ga0496103_0026313 3300048906 Bacteria 3522
477 Ga0496104_0025236 3300048907 Bacteria 5478
478 Ga0496104_0036153 3300048907 Bacteria 4615
479 Ga0496105_0000224 3300048908 Bacteria 38048
480 Ga0496105_0016215 3300048908 Bacteria 5944
481 Ga0496106_0006361 3300048909 Bacteria 8744
482 Ga0496106_0047264 3300048909 Bacteria 3238
483 Ga0496106_0138906 3300048909 Bacteria 1910
484 Ga0496106_0210824 3300048909 Bacteria 1547
485 Ga0496107_0002345 3300048910 Bacteria 12230
486 Ga0496107_0005917 3300048910 Bacteria 8381
487 Ga0496107_0064381 3300048910 Bacteria 2658
488 Ga0496108_0021911 3300048911 Bacteria 5252
489 Ga0496108_0030237 3300048911 Bacteria 4489
490 Ga0496109_0205114 3300048912 Bacteria 1854
491 Ga0496110_0016139 3300048913 Bacteria 6227
492 Ga0496110_0044333 3300048913 Bacteria 3884
493 Ga0496110_0053787 3300048913 Bacteria 3540
494 Ga0496111_0023729 3300048914 Bacteria 4308
495 Ga0496111_0030124 3300048914 Bacteria 3858
496 Ga0496111_0319858 3300048914 Bacteria 1149
497 Ga0496113_0125018 3300048916 Bacteria 2013
498 Ga0496114_0003970 3300048917 Bacteria 11423
499 Ga0496114_0133321 3300048917 Bacteria 2147
500 Ga0496115_0021954 3300048918 Bacteria 4936
501 Ga0496116_0012667 3300048919 Bacteria 6864
502 Ga0496116_0014264 3300048919 Bacteria 6355
503 Ga0496116_0015539 3300048919 Bacteria 6013
504 Ga0496116_0149291 3300048919 Bacteria 1301
505 Ga0496117_0004882 3300048920 Bacteria 14459
506 Ga0496117_0006044 3300048920 Bacteria 12434
507 Ga0496117_0019305 3300048920 Bacteria 5605
508 Ga0496117_0035745 3300048920 Bacteria 3725
509 Ga0496117_0102571 3300048920 Bacteria 1805
510 Ga0496118_0020924 3300048921 Bacteria 5783
511 Ga0496118_0034239 3300048921 Bacteria 4149
512 Ga0496118_0045801 3300048921 Bacteria 3409
513 Ga0496118_0050460 3300048921 Bacteria 3192
514 Ga0496118_0051624 3300048921 Bacteria 3144
515 Ga0496118_0128450 3300048921 Bacteria 1633
516 Ga0496119_0019149 3300048922 Bacteria 5057
517 Ga0496119_0052448 3300048922 Bacteria 2498
518 Ga0496119_0132140 3300048922 Bacteria 1359
519 Ga0496120_0070466 3300048923 Bacteria 1923
520 Ga0496121_0000274 3300048924 Bacteria 107140
521 Ga0496121_0001339 3300048924 Bacteria 42173
522 Ga0496121_0003000 3300048924 Bacteria 24522
523 Ga0496121_0007348 3300048924 Bacteria 13323
524 Ga0496121_0013331 3300048924 Bacteria 8844
525 Ga0496121_0022925 3300048924 Bacteria 6033
526 Ga0496121_0031341 3300048924 Bacteria 4859
527 Ga0496121_0176750 3300048924 Bacteria 1545
528 Ga0496121_0302587 3300048924 Bacteria 1084
529 Ga0496121_0380691 3300048924 Bacteria 930
530 Ga0496122_0000147 3300048925 Bacteria 165589
531 Ga0496122_0002476 3300048925 Bacteria 26097
532 Ga0496122_0018439 3300048925 Bacteria 6447
533 Ga0496122_0019098 3300048925 Bacteria 6284
534 Ga0496122_0029419 3300048925 Bacteria 4634
535 Ga0496122_0068652 3300048925 Bacteria 2543
536 Ga0496123_0000020 3300048926 Bacteria 388748
537 Ga0496123_0000158 3300048926 Bacteria 136078
538 Ga0496123_0004863 3300048926 Bacteria 13829
539 Ga0496123_0023631 3300048926 Bacteria 4699
540 Ga0496123_0025896 3300048926 Bacteria 4408
541 Ga0496123_0029027 3300048926 Bacteria 4083
542 Ga0496123_0067858 3300048926 Bacteria 2250
543 Ga0496124_0013299 3300048927 Bacteria 8042
544 Ga0496124_0023052 3300048927 Bacteria 5694
545 Ga0496124_0045132 3300048927 Bacteria 3779
546 Ga0496124_0055657 3300048927 Bacteria 3341
547 Ga0496124_0056012 3300048927 Bacteria 3328
548 Ga0496124_0090155 3300048927 Bacteria 2502
549 Ga0496124_0142682 3300048927 Bacteria 1888
550 Ga0496124_0344217 3300048927 Bacteria 1057
551 Ga0496125_0000695 3300048928 Bacteria 55563
552 Ga0496125_0006025 3300048928 Bacteria 13262
553 Ga0496125_0031254 3300048928 Bacteria 4747
554 Ga0496125_0038164 3300048928 Bacteria 4163
555 Ga0496125_0183467 3300048928 Bacteria 1391
556 Ga0496126_0000195 3300048929 Bacteria 135582
557 Ga0496126_0004852 3300048929 Bacteria 15748
558 Ga0496126_0050974 3300048929 Bacteria 3771
559 Ga0496126_0080772 3300048929 Bacteria 2876
560 Ga0496126_0113074 3300048929 Bacteria 2364
561 Ga0496126_0222638 3300048929 Bacteria 1584
562 Ga0496126_0351490 3300048929 Bacteria 1205
563 Ga0495678_039325 3300049459 Bacteria 1908
564 Ga0501032_0150012 3300049569 Bacteria 1533
565 Ga0501033_0065217 3300049570 Bacteria 2679
566 Ga0501033_0210520 3300049570 Bacteria 1386
567 Ga0501033_0250294 3300049570 Bacteria 1256
568 Ga0501034_0068978 3300049571 Bacteria 3546
569 Ga0501034_0144497 3300049571 Bacteria 2356
570 Ga0501034_0459545 3300049571 Bacteria 1190
571 Ga0501036_0379565 3300049572 Bacteria 1180
572 Ga0501036_0621555 3300049572 Bacteria 895
573 Ga0501037_0113439 3300049573 Bacteria 1951
574 Ga0501037_0273231 3300049573 Bacteria 1179
575 Ga0501040_0112463 3300049576 Bacteria 1905
576 Ga0501041_0069308 3300049577 Bacteria 2163
577 Ga0501041_0257298 3300049577 Bacteria 1098
578 Ga0501043_0011321 3300049579 Bacteria 6982
579 Ga0501043_0085023 3300049579 Bacteria 2486
580 Ga0501047_0156176 3300049581 Bacteria 2155
581 Ga0501069_0230600 3300049585 Bacteria 1078
582 Ga0501071_0015300 3300049587 Bacteria 5266
583 Ga0501072_0178326 3300049588 Bacteria 1695
584 Ga0501073_0099551 3300049589 Bacteria 2018
585 Ga0501075_0068180 3300049591 Bacteria 2687
586 Ga0501076_0105684 3300049592 Bacteria 2272
587 Ga0501076_0190817 3300049592 Bacteria 1672
588 Ga0501238_001781 3300049671 Bacteria 2514
589 Ga0501079_0009362 3300049741 Bacteria 7422
590 Ga0501080_0201868 3300049742 Bacteria 1825
591 Ga0501083_0086168 3300049744 Bacteria 2077
592 Ga0501044_0035147 3300049823 Bacteria 5250
593 Ga0501045_0317051 3300049824 Bacteria 1160
594 nmdc:mga03683_223_c1 3300050489 Bacteria 18101
595 nmdc:mga00v17_48066_c1 3300050491 Bacteria 2585
596 nmdc:mga0yw44_10889_c1 3300050492 Bacteria 4663
597 nmdc:mga0yw44_25643_c1 3300050492 Bacteria 3356
598 nmdc:mga0yw44_30853_c1 3300050492 Bacteria 3112
599 nmdc:mga0k408_9_c2 3300050493 Bacteria 64937
600 nmdc:mga07m45_13_c1 3300050496 Bacteria 65600
601 nmdc:mga07m45_7936_c1 3300050496 Bacteria 5436
602 nmdc:mga06r32_402360_c1 3300050510 Bacteria 1351
603 nmdc:mga08y16_190503_c1 3300050511 Bacteria 1508
604 nmdc:mga0n895_90481_c1 3300050512 Bacteria 3062
605 nmdc:mga0rr50_91238_c1 3300050513 Bacteria 2372
606 nmdc:mga0a205_120962_c1 3300050515 Bacteria 2517
607 nmdc:mga0sz30_2726_c1 3300050516 Bacteria 6304
608 Ga0495619_0093078 3300053085 Bacteria 2043
609 Ga0500578_0074949 3300053086 Bacteria 2155
610 Ga0500644_0027737 3300053088 Bacteria 1764
611 Ga0500557_002864 3300053105 Bacteria 3281
612 Ga0500569_059377 3300053109 Bacteria 1176
613 Ga0500593_000262 3300053117 Bacteria 21599
614 Ga0500607_003925 3300053121 Bacteria 10528
615 Ga0500608_001223 3300053122 Bacteria 9169
616 Ga0500608_005520 3300053122 Bacteria 5039
617 Ga0500618_000380 3300053125 Bacteria 30639
618 Ga0500618_020466 3300053125 Bacteria 1620
619 Ga0500658_0000858 3300053134 Bacteria 12470
620 Ga0500658_0015158 3300053134 Bacteria 2858
621 Ga0500559_0012724 3300053136 Bacteria 3572
622 Ga0500559_0014208 3300053136 Bacteria 3364
623 Ga0500568_0042779 3300053139 Bacteria 1813
624 Ga0500573_0000065 3300053140 Bacteria 64628
625 Ga0500573_0000308 3300053140 Bacteria 20963
626 Ga0500590_004524 3300053148 Bacteria 6573
627 Ga0500604_0023632 3300053151 Bacteria 1754
628 Ga0500616_0000817 3300053153 Bacteria 35314
629 Ga0500616_0032869 3300053153 Bacteria 2834
630 Ga0500619_000115 3300053154 Bacteria 21281
631 Ga0500622_0000391 3300053156 Bacteria 42302
632 Ga0500622_0065397 3300053156 Bacteria 1847
633 Ga0500627_0123668 3300053158 Bacteria 1167
634 Ga0500637_0013439 3300053178 Bacteria 4294
635 Ga0500567_002040 3300053723 Bacteria 8449
636 Ga0500625_000026 3300053729 Bacteria 60801
637 Ga0500645_005655 3300053730 Bacteria 4566
638 Ga0501084_0074481 3300054114 Bacteria 2843
639 Ga0501082_0101087 3300060353 Bacteria 2494
640 Ga0530510_0027672 3300061734 Bacteria 4062
641 2509107018 2508501122 Bacteria 6292184
642 2509112576 2508501122 Bacteria 6292184
643 2509385695 2509276021 Bacteria 7634384
644 2509388464 2509276021 Bacteria 7634384
645 2509444012 2509276033 Bacteria 7180565
646 2510131389 2510065019 Bacteria 6903379
647 2510308366 2510065057 Bacteria 6649661
648 2510897743 2510461076 Bacteria 8618824
649 2511135422 2510917022 Bacteria 6504556
650 2511136303 2510917022 Bacteria 6504556
651 2511170135 2510917026 Bacteria 7046020
652 2511184763 2510917028 Bacteria 6185411
653 2511196842 2510917030 Bacteria 7460662
654 2511199480 2510917030 Bacteria 7460662
655 2511498680 2511231052 Bacteria 6974333
656 2512531963 2512047086 Bacteria 6850303
657 2513570608 2513237084 Bacteria 7231967
658 2513580239 2513237085 Bacteria 7695351
659 2513587943 2513237086 Bacteria 7265287
660 2513596710 2513237088 Bacteria 6927906
661 2513620725 2513237091 Bacteria 6900273
662 2513634226 2513237093 Bacteria 7545552
663 2513713215 2513237103 Bacteria 7647401
664 2513864875 2513237138 Bacteria 7368160
665 2513886896 2513237140 Bacteria 7076289
666 2513907047 2513237143 Bacteria 6664116
667 2513910330 2513237144 Bacteria 7530820
668 2513928278 2513237146 Bacteria 7166346
669 2513987666 2513237156 Bacteria 6402557
670 2513996743 2513237159 Bacteria 6810126
671 2514000731 2513237159 Bacteria 6810126
672 2514020271 2513237162 Bacteria 7468464
673 2515110342 2515075009 Bacteria 7288508
674 2515634550 2515154113 Bacteria 7807172
675 2515643775 2515154114 Bacteria 7848616
676 2515657173 2515154116 Bacteria 7552979
677 2515743326 2515154134 Bacteria 7220242
678 2516894957 2516653046 Bacteria 6989037
679 2517039027 2516653077 Bacteria 7555578
680 2517079293 2516653085 Bacteria 7346596
681 2517093222 2517093000 Bacteria 7412387
682 2517409491 2517287029 Bacteria 6905599
683 2520377550 2519899620 Bacteria 6499161
684 2524454370 2524023207 Bacteria 6813453
685 2524458338 2524023209 Bacteria 6679728
686 2530644751 2529292951 Bacteria 6916614
687 2530647846 2529292951 Bacteria 6916614
688 2535515072 2534681796 Bacteria 7146037
689 2551679083 2551306084 Bacteria 8942552
690 2551685277 2551306085 Bacteria 7347181
691 2551693482 2551306086 Bacteria 6843938
692 2551703160 2551306087 Bacteria 7351905
693 2551715246 2551306089 Bacteria 7162724
694 2551716910 2551306090 Bacteria 7953713
695 2551718718 2551306090 Bacteria 7953713
696 2551727897 2551306091 Bacteria 7086830
697 2551731765 2551306092 Bacteria 6992595
698 2551739574 2551306093 Bacteria 7064773
699 2585203648 2582581294 Bacteria 6626667
700 2585222285 2582581298 Bacteria 7315509
701 2585227051 2582581298 Bacteria 7315509
702 2585255939 2582581304 Bacteria 5831370
703 2585275466 2582581307 Bacteria 6597605
704 2585275467 2582581307 Bacteria 6597605
705 2585276408 2582581307 Bacteria 6597605
706 2585330173 2582581316 Bacteria 7774528
707 2585335347 2582581316 Bacteria 7774528
708 2585385512 2582581865 Bacteria 6644329
709 2585391929 2582581866 Bacteria 6859583
710 2585398575 2582581867 Bacteria 7184437
711 2585529290 2585427526 Bacteria 7258840
712 2585539658 2585427528 Bacteria 6842387
713 2585544762 2585427529 Bacteria 7395659
714 2585550524 2585427529 Bacteria 7395659
715 2585560091 2585427531 Bacteria 6992870
716 2585819275 2585427590 Bacteria 6824633
717 2585837615 2585427593 Bacteria 7141551
718 2585905728 2585427609 Bacteria 6667127
719 2587755786 2585428062 Bacteria 6842168
720 2587979156 2585428125 Bacteria 6662905
721 2588294193 2588253510 Bacteria 6901809
722 2599332986 2599185156 Bacteria 5403036
723 2599419212 2599185170 Bacteria 7295545
724 2599719571 2599185236 Bacteria 6875203
725 2600374682 2600254933 Bacteria 4750527
726 2616297092 2615840624 Bacteria 6557588
727 2616553150 2615840698 Bacteria 7319877
728 2616553382 2615840698 Bacteria 7319877
729 2616557217 2615840698 Bacteria 7319877
730 2616557371 2615840698 Bacteria 7319877
731 2617383764 2617270742 Bacteria 6808054
732 2643730796 2643221541 Bacteria 5498788
733 2644007294 2643221599 Bacteria 6292121
734 2644044551 2643221606 Bacteria 5588032
735 2644103265 2643221618 Bacteria 7717186
736 2644151863 2643221626 Bacteria 8069654
737 2644190562 2643221634 Bacteria 6705461
738 2644206728 2643221637 Bacteria 5345260
739 2644241572 2643221643 Bacteria 5749658
740 2644306193 2643221655 Bacteria 7722067
741 2644330443 2643221659 Bacteria 7890716
742 2644391524 2643221671 Bacteria 5496681
743 2644492272 2643221688 Bacteria 5260751
744 2644542811 2643221698 Bacteria 7756764
745 2644618857 2643221712 Bacteria 7729434
746 2644650375 2643221718 Bacteria 5345506
747 2644655917 2643221719 Bacteria 4568197
748 2719179544 2718217882 Bacteria 6556348
749 2719384098 2718217927 Bacteria 6972593
750 2719663889 2718217997 Bacteria 6740740
751 2719730214 2718218009 Bacteria 6478651
752 2720490308 2718218199 Bacteria 6740745
753 2720611685 2718218232 Bacteria 6720332
754 2720618534 2718218233 Bacteria 6662049
755 2720629942 2718218235 Bacteria 6630699
756 2720773637 2718218269 Bacteria 6906114
757 2721145637 2718218363 Bacteria 6524337
758 2721157154 2718218365 Bacteria 6274507
759 2721162516 2718218366 Bacteria 6425255
760 2721397868 2718218423 Bacteria 6438183
761 2722838686 2721755514 Bacteria 6424414
762 2723025308 2721755556 Bacteria 6745503
763 2723558893 2721755684 Bacteria 6859907
764 2723565463 2721755685 Bacteria 6704835
765 2724036678 2721755809 Bacteria 6438790
766 2724042970 2721755810 Bacteria 6479005
767 2724088244 2721755819 Bacteria 6906405
768 2724102728 2721755822 Bacteria 6726041
769 2724108624 2721755823 Bacteria 6752556
770 2725948968 2724679232 Bacteria 7646494
771 2730106244 2728369352 Bacteria 6745171
772 2730162781 2728369365 Bacteria 6555560
773 2730296786 2728369397 Bacteria 6274511
774 2738710399 2738541275 Bacteria 4830863
775 2738801266 2738541293 Bacteria 7065685
776 2738848824 2738541301 Bacteria 4834102
777 2738864553 2738541304 Bacteria 4833665
778 2739037048 2738541333 Bacteria 7106503
779 2739297071 2738543022 Bacteria 4835059
780 2739358749 2738543033 Bacteria 4833336
781 2739651111 2739367664 Bacteria 4114334
782 2740029584 2739367865 Bacteria 4114482
783 2766066592 2765235942 Bacteria 7445910
784 2770199497 2767802442 Bacteria 5747986
785 2776267965 2775506902 Bacteria 6208009
786 2776268167 2775506902 Bacteria 6208009
787 2776281939 2775506904 Bacteria 5954060
788 2776283992 2775506904 Bacteria 5954060
789 2792580500 2791355082 Bacteria 5973319
790 2793295235 2791355256 Bacteria 6798008
791 2793316355 2791355259 Bacteria 7254731
792 2793323413 2791355260 Bacteria 6598818
793 2793324779 2791355260 Bacteria 6598818
794 2793326193 2791355261 Bacteria 6661293
795 2793334253 2791355262 Bacteria 6774204
796 2793341831 2791355263 Bacteria 6872478
797 2793348168 2791355264 Bacteria 6429314
798 2793361537 2791355266 Bacteria 7116587
799 2793364649 2791355267 Bacteria 7222458
800 2805929344 2802429605 Bacteria 6875453
801 2805932397 2802429606 Bacteria 6346811
802 2806047570 2802429633 Bacteria 7341974
803 2806054989 2802429634 Bacteria 7083200
804 2806062109 2802429635 Bacteria 7650140
805 2806067165 2802429636 Bacteria 7597525
806 2806076486 2802429637 Bacteria 7067217
807 2808990109 2808606387 Bacteria 5697198
808 2819245294 2818991272 Bacteria 4622173
809 2819608434 2818991448 Bacteria 6772224
810 2819612398 2818991448 Bacteria 6772224
811 2821123617 2821123053 Bacteria 7836056
812 2821446575 2821443989 Bacteria 7658172
813 2838020257 2838016132 Bacteria 6577831
814 2838025776 2838022645 Bacteria 6494267
815 2838031872 2838029111 Bacteria 6603031
816 2838037104 2838035591 Bacteria 7166484
817 2838044454 2838042994 Bacteria 6046894
818 2838051527 2838048938 Bacteria 6044578
819 2838064002 2838061910 Bacteria 6794874
820 2838071083 2838068647 Bacteria 6208656
821 2838663720 2838661181 Bacteria 7385261
822 2838672422 2838668709 Bacteria 6671819
823 2838680557 2838680041 Bacteria 6545511
824 2838691610 2838686498 Bacteria 7807632
825 2838695410 2838694306 Bacteria 6853137
826 2838703836 2838701080 Bacteria 6669771
827 2838708787 2838707686 Bacteria 6619912
828 2838733906 2838729681 Bacteria 7400765
829 2838739349 2838736955 Bacteria 5760694
830 2838747030 2838742623 Bacteria 7396178
831 2841843247 2841840854 Bacteria 5761912
832 2841856171 2841851746 Bacteria 7532261
833 2841866840 2841864319 Bacteria 6742987
834 2842079978 2842077413 Bacteria 6508645
835 2842112182 2842110456 Bacteria 7656360
836 2842120597 2842118031 Bacteria 7033875
837 2842143029 2842140634 Bacteria 5759631
838 2842148372 2842146304 Bacteria 5957337
839 2842161959 2842156927 Bacteria 6894975
840 2842169665 2842163707 Bacteria 6916235
841 2842185801 2842180545 Bacteria 6888678
842 2842192858 2842192696 Bacteria 6147454
843 2842202927 2842198810 Bacteria 6608673
844 2842206979 2842205361 Bacteria 6340321
845 2842218822 2842217011 Bacteria 7497767
846 2842235329 2842229732 Bacteria 7475766
847 2842238198 2842237096 Bacteria 6620661
848 2842248216 2842243621 Bacteria 7421798
849 2842253438 2842250916 Bacteria 6579627
850 2842262190 2842257432 Bacteria 7401195
851 2842268789 2842264693 Bacteria 6472963
852 2842276583 2842271015 Bacteria 7807131
853 2842280328 2842278818 Bacteria 6340002
854 2842286810 2842285085 Bacteria 6011953
855 2842293639 2842291075 Bacteria 7076806
856 2842306529 2842304105 Bacteria 7023636
857 2842312649 2842311132 Bacteria 6616990
858 2842322486 2842317721 Bacteria 6793725
859 2842343102 2842341865 Bacteria 7003929
860 2842367173 2842363717 Bacteria 6844742
861 2842371020 2842370503 Bacteria 7038661
862 2842380036 2842377471 Bacteria 7140707
863 2842387107 2842384541 Bacteria 7057858
864 2842399220 2842395702 Bacteria 6780583
865 2842403637 2842402390 Bacteria 6681310
866 2842410661 2842409023 Bacteria 6687331
867 2842417307 2842415677 Bacteria 6596907
868 2842424699 2842422224 Bacteria 6239196
869 2842433011 2842428310 Bacteria 6767288
870 2842439316 2842434925 Bacteria 6502746
871 2842445945 2842441272 Bacteria 6769273
872 2842451874 2842447887 Bacteria 6754142
873 2842467131 2842462802 Bacteria 6588055
874 2842473841 2842469257 Bacteria 6752936
875 2842476252 2842475841 Bacteria 6603183
876 2842478604 2842475841 Bacteria 6603183
877 2842492488 2842489311 Bacteria 6620893
878 2842500068 2842495871 Bacteria 6820686
879 2842502846 2842502639 Bacteria 6604161
880 2842505451 2842502639 Bacteria 6604161
881 2842509179 2842509118 Bacteria 6850950
882 2842513658 2842509118 Bacteria 6850950
883 2842521674 2842521101 Bacteria 6569494
884 2842526600 2842521101 Bacteria 6569494
885 2842923294 2842922631 Bacteria 5824079
886 2844170779 2844163670 Bacteria 7266046
887 2844456019 2844454524 Bacteria 7952546
888 2844536556 2844533157 Bacteria 7517899
889 2852388454 2852387548 Bacteria 8025568
890 2852392779 2852387548 Bacteria 8025568
891 2852393100 2852387548 Bacteria 8025568
892 2855827592 2855825444 Bacteria 6785811
893 2855842967 2855839649 Bacteria 7135830
894 2857523467 2857516855 Bacteria 7787325
895 2857531181 2857531043 Bacteria 6754041
896 2858801923 2858800743 Bacteria 6603254
897 2888349715 2888343758 Bacteria 6611049
898 2891374960 2891373044 Bacteria 5202277
899 2896385701 2896384573 Bacteria 7700774
900 2899805294 2899803654 Bacteria 5577784
901 2915992355 2915986958 Bacteria 6739310
902 2915994404 2915993759 Bacteria 7016183
903 2916002857 2916000859 Bacteria 6865702
904 2916011265 2916007675 Bacteria 6898660
905 2916018715 2916014648 Bacteria 6946486
906 2916025375 2916021584 Bacteria 6854472
907 2916035040 2916028427 Bacteria 6748433
908 2916038082 2916035215 Bacteria 6755766
909 2916048139 2916041962 Bacteria 6820487
910 2916054299 2916048683 Bacteria 6543552
911 2916061042 2916055098 Bacteria 6758838
912 2916071658 2916068649 Bacteria 6943657
913 2916082703 2916076590 Bacteria 6596108
914 2919101376 2919100787 Bacteria 7710546
915 2919102851 2919100787 Bacteria 7710546
916 2919172113 2919171160 Bacteria 6499771
917 2919408773 2919408235 Bacteria 6149349
918 2920762042 2920760137 Bacteria 7427611
919 2921208448 2921201388 Bacteria 6926299
920 2921211276 2921208531 Bacteria 6745326
921 2921241176 2921237296 Bacteria 6876710
922 2921250311 2921244191 Bacteria 6568419
923 2921258656 2921257292 Bacteria 6808382
924 2921263399 2921257292 Bacteria 6808382
925 2921270148 2921263974 Bacteria 6864552
926 2921285296 2921282425 Bacteria 6826397
927 2921293386 2921289301 Bacteria 7316391
928 2921302760 2921296804 Bacteria 7176999
929 2923557118 2923556063 Bacteria 6793593
930 2924147878 2924144063 Bacteria 6883928
931 2924151340 2924150972 Bacteria 7169444
932 2924164793 2924158325 Bacteria 7188855
933 2924166444 2924165586 Bacteria 7260590
934 2924179218 2924172951 Bacteria 6749356
935 2924180520 2924179722 Bacteria 6843264
936 2924193296 2924186466 Bacteria 6876637
937 2924196320 2924193448 Bacteria 6955718
938 2924203964 2924200457 Bacteria 6757188
939 2924210630 2924207177 Bacteria 6917007
940 2924215933 2924214083 Bacteria 7080103
941 2924225582 2924221636 Bacteria 7113495
942 2924232360 2924228884 Bacteria 6633132
943 2928100497 2928100450 Bacteria 4837635
944 2928960561 2928959182 Bacteria 4725774
945 2933020918 2933016740 Bacteria 6355406
946 2933573598 2933570622 Bacteria 7023390
947 2933587511 2933586486 Bacteria 7667493
948 2933601882 2933599457 Bacteria 5858799
949 2935895934 2935894831 Bacteria 6620579
950 2935907192 2935901341 Bacteria 7341747
951 2936368956 2936367885 Bacteria 7324495
952 2936378428 2936375103 Bacteria 6652732
953 2936383716 2936381700 Bacteria 7006523
954 2936998887 2936996657 Bacteria 6298727
955 2937007097 2937002841 Bacteria 6934057
956 2937013230 2937009748 Bacteria 6746052
957 2937019920 2937016420 Bacteria 6782579
958 2937028310 2937023124 Bacteria 6815156
959 2937028777 2937023124 Bacteria 6815156
960 2937049438 2937042894 Bacteria 6741576
961 2937053124 2937049772 Bacteria 6757901
962 2937063767 2937056579 Bacteria 7107896
963 2937065674 2937063883 Bacteria 7199456
964 2937075721 2937071275 Bacteria 6984483
965 2937092482 2937091812 Bacteria 6979387
966 2937099302 2937098957 Bacteria 7249374
967 2937111164 2937106411 Bacteria 6947143
968 2937115911 2937113482 Bacteria 6505872
969 2937123545 2937119839 Bacteria 6597547
970 2937129132 2937126314 Bacteria 6771275
971 2941500736 2941499720 Bacteria 7599444
972 2957386294 2957382221 Bacteria 6737050
973 2957392645 2957388812 Bacteria 6778072
974 2957396118 2957395598 Bacteria 6822399
975 2957402081 2957395598 Bacteria 6822399
976 2957404929 2957402308 Bacteria 6741770
977 2957411970 2957408893 Bacteria 6558585
978 2957417108 2957415311 Bacteria 6991633
979 2957427954 2957422303 Bacteria 7172205
980 2957433036 2957430029 Bacteria 7022557
981 2957457560 2957450854 Bacteria 6765715
982 2957461170 2957457609 Bacteria 6967680
983 2957467654 2957464669 Bacteria 6568877
984 2957477414 2957471148 Bacteria 6797643
985 2957483923 2957478035 Bacteria 6756658
986 2957486947 2957484790 Bacteria 6703082
987 2957493817 2957491536 Bacteria 6695180
988 2957502297 2957498199 Bacteria 7126688
989 2957511610 2957505466 Bacteria 7253085
990 2960587168 2960584000 Bacteria 6864594
991 2960602448 2960597568 Bacteria 6550735
992 2960608135 2960603979 Bacteria 6898737
993 2960616625 2960610863 Bacteria 6691244
994 2960630701 2960624210 Bacteria 6875384
995 2960638695 2960637947 Bacteria 7296468
996 2960652661 2960645483 Bacteria 7211087
997 2960653766 2960652885 Bacteria 7083688
998 2960671357 2960667422 Bacteria 6763020
999 2960678067 2960674078 Bacteria 6609048
1000 2960693414 2960687367 Bacteria 6535474
1001 2964615271 2964607997 Bacteria 7101408
1002 2964616713 2964615318 Bacteria 6809089
1003 2964621128 2964615318 Bacteria 6809089
1004 2964625382 2964621998 Bacteria 6834995
1005 2964632016 2964628898 Bacteria 7083044
1006 2964642799 2964636051 Bacteria 7091832
1007 2964647337 2964643177 Bacteria 6820887
1008 2964653711 2964649959 Bacteria 6675118
1009 2964658038 2964656573 Bacteria 7100150
1010 2964667397 2964663802 Bacteria 7019362
1011 2964677761 2964670856 Bacteria 6851364
1012 2964678353 2964678106 Bacteria 6792020
1013 2964687788 2964685014 Bacteria 6839111
1014 2964695753 2964691889 Bacteria 6802758
1015 2964705024 2964698721 Bacteria 6765331
1016 2964708113 2964705432 Bacteria 7114648
1017 2964718922 2964712639 Bacteria 6695970
1018 2964722549 2964719344 Bacteria 7286602
1019 2967666019 2967664464 Bacteria 6948836
1020 2967675259 2967671571 Bacteria 7021409
1021 2967679211 2967678726 Bacteria 7264382
1022 2967695789 2967693043 Bacteria 6804451
1023 2967700250 2967699805 Bacteria 6854538
1024 2967707303 2967706974 Bacteria 7186053
1025 2967720700 2967714385 Bacteria 7000047
1026 2967721821 2967721400 Bacteria 7073753
1027 2967738550 2967735183 Bacteria 6827012
1028 2967748509 2967742019 Bacteria 6794534
1029 2967752921 2967748971 Bacteria 6733771
1030 2967756959 2967755722 Bacteria 6814706
1031 2967761975 2967755722 Bacteria 6814706
1032 2967765298 2967762386 Bacteria 6923502
1033 2967772998 2967769361 Bacteria 6587838
1034 2967782695 2967775926 Bacteria 6738189
1035 2970020194 2970019648 Bacteria 7072033
1036 2970038065 2970033650 Bacteria 7118744
1037 2970044412 2970040964 Bacteria 6731123
1038 2970054319 2970047711 Bacteria 7088379
1039 2970059098 2970054988 Bacteria 6611507
1040 2970068076 2970061556 Bacteria 7099761
1041 2970074293 2970068827 Bacteria 7123112
1042 2970082013 2970076120 Bacteria 6697332
1043 2970087675 2970082768 Bacteria 6183754
1044 2970092099 2970088815 Bacteria 6933825
1045 2970097822 2970095765 Bacteria 6936963
1046 2970103293 2970102677 Bacteria 6812532
1047 2970107799 2970102677 Bacteria 6812532
1048 2970111829 2970109326 Bacteria 6863976
1049 2970116912 2970116247 Bacteria 6501857
1050 2970132235 2970129317 Bacteria 6806560
1051 2970137710 2970136068 Bacteria 7207982
1052 2970153729 2970149975 Bacteria 6779706
1053 2970163492 2970156795 Bacteria 7168044
1054 2970168556 2970164137 Bacteria 6861252
1055 2970177655 2970170962 Bacteria 6876229
1056 2970184409 2970177841 Bacteria 6768001
1057 2970185326 2970184632 Bacteria 7054431
1058 2970195910 2970191845 Bacteria 7032787
1059 2977523502 2977516862 Bacteria 6940108
1060 2977525717 2977523885 Bacteria 6960446
1061 2977540657 2977537788 Bacteria 6929320
1062 2977558259 2977551784 Bacteria 7125765
1063 2977562111 2977558990 Bacteria 6863948
1064 2977568720 2977565890 Bacteria 6901543
1065 2977576750 2977572785 Bacteria 6763888
1066 2977582526 2977579622 Bacteria 6772100
1067 2987652774 2987652177 Bacteria 6969023
1068 2989351435 2989349275 Bacteria 6349068
1069 2989772765 2989771324 Bacteria 5605128
1070 2989777394 2989776772 Bacteria 4843317
1071 2996888487 2996887358 Bacteria 5795980
1072 2996893406 2996893221 Bacteria 5823108
1073 3000867205 3000865235 Bacteria 3106258
1074 3003931927 3003930520 Bacteria 5667563
1075 3005411205 3005409236 Bacteria 7188837
1076 3005418205 3005416602 Bacteria 7064308
1077 3005422834 3005416602 Bacteria 7064308
1078 3005446156 3005445848 Bacteria 6906074
1079 3005451879 3005445848 Bacteria 6906074
1080 3005452815 3005452660 Bacteria 5889319
1081 3005457188 3005452660 Bacteria 5889319
1082 639646621 639633055 Bacteria 7751309
1083 648740415 648276728 Bacteria 6968865
1084 8003995547 8003992118 Bacteria 7266902
1085 8005247418 8005246636 Bacteria 4933972
1086 8005263451 8005258706 Bacteria 6184835
1087 8005278809 8005275841 Bacteria 6929066
1088 8005289037 8005282627 Bacteria 6675747
1089 8005289383 8005289223 Bacteria 6634003
1090 8005291111 8005289223 Bacteria 6634003
1091 8005301522 8005301065 Bacteria 6614431
1092 8005305284 8005301065 Bacteria 6614431
1093 8005309222 8005307578 Bacteria 7395396
1094 8005316155 8005314921 Bacteria 7072929
1095 8005321630 8005314921 Bacteria 7072929
1096 8005323014 8005321885 Bacteria 5795980
1097 8005377462 8005376324 Bacteria 6590079
1098 8005387325 8005382845 Bacteria 6732062
1099 8005400098 8005395548 Bacteria 6806915
1100 8005432903 8005430974 Bacteria 6689030
1101 8005460981 8005460587 Bacteria 7157962
1102 8005484922 8005484373 Bacteria 6297373
1103 8005488171 8005484373 Bacteria 6297373
1104 8005498633 8005497431 Bacteria 6477605
1105 8005543743 8005542996 Bacteria 7077758
1106 8005560594 8005556819 Bacteria 6908598
1107 8005563947 8005563573 Bacteria 7153261
1108 8005576893 8005570704 Bacteria 6957481
1109 8005619825 8005619151 Bacteria 7030230
1110 8005628397 8005626139 Bacteria 6534237
1111 8005650119 8005645114 Bacteria 6950293
1112 8005670044 8005668836 Bacteria 6953162
1113 8005689306 8005688590 Bacteria 6610080
1114 8005690238 8005688590 Bacteria 6610080
1115 8005699282 8005695170 Bacteria 6912330
1116 8018133096 8018127388 Bacteria 7351159
1117 8018168996 8018163183 Bacteria 7277977
1118 8018179485 8018176218 Bacteria 6896178
1119 8023684269 8023680758 Bacteria 7729763
1120 8024480248 8024479707 Bacteria 6954785
1121 8024491439 8024486573 Bacteria 6540512
1122 8024501631 8024501048 Bacteria 6427847
1123 8049297407 8049293176 Bacteria 6128433
1124 8055436167 8055431914 Bacteria 4551896
1125 8056375606 8056375014 Bacteria 7006639
1126 8056385920 8056382006 Bacteria 6408074
1127 8057876020 8057874678 Bacteria 7494653
1128 Ga0070669_100088896
1129 JGI24740J21852_10005355
1130 JGI24739J22299_10008673
1131 JGI24737J22298_10001181
1132 JGI24735J21928_10005736
1133 JGI25155J39150_1000023
1134 JGI25156J39149_1000029
1135 JGI25154J39366_1000067
1136 JGI25158J39367_1000337
1137 JGI25157J39369_1000043
1138 JGI25152J39213_1000622
1139 JGI25152J39213_1001653
1140 JGI25150J39212_1000012
1141 JGI25159J45721_1000016
1142 JGI25159J45721_1000234
1143 JGI25151J46595_10000025
1144 JGI25151J46595_10000346
1145 JGI25151J46595_10004241
1146 JGI25151J46595_10027315
1147 JGI25153J46596_10005707
1148 JGI25153J46596_10045475
1149 JGI25160J50197_1000002
1150 JGI25160J50197_1000500
1151 JGI25160J50197_1007740
1152 JGI25161J50226_1000323
1153 JGI25161J50226_1000382
1154 JGI25161J50226_1003889
1155 Ga0055526_1000624
1156 Ga0055526_1006023
1157 Ga0055526_1011604
1158 Ga0055526_1014014
1159 Ga0055526_1015721
1160 Ga0055524_1001892
1161 Ga0055524_1004600
1162 Ga0055524_1013212
1163 Ga0055524_1020811
1164 Ga0055536_1002390
1165 Ga0055528_1000137
1166 Ga0055528_1000303
1167 Ga0055528_1001607
1168 Ga0055528_1012661
1169 Ga0055528_1025258
1170 Ga0055530_10015082
1171 Ga0055540_1001855
1172 Ga0055540_1002138
1173 Ga0055540_1002362
1174 Ga0055531_10001338
1175 Ga0055531_10003792
1176 Ga0055543_1000008
1177 Ga0055543_1000022
1178 Ga0055543_1000046
1179 Ga0055543_1000141
1180 Ga0055543_1002287
1181 Ga0065165_1000031
1182 Ga0065165_1000058
1183 Ga0065165_1000175
1184 Ga0065165_1004542
1185 Ga0065165_1008189
1186 Ga0065165_1029847
1187 Ga0065704_10004143
1188 Ga0070658_10000022
1189 Ga0070658_10000304
1190 Ga0070658_10333942
1191 Ga0070670_100129173
1192 Ga0070670_100257930
1193 Ga0070666_10014916
1194 Ga0070666_10127988
1195 Ga0070666_10374711
1196 Ga0070660_100009089
1197 Ga0070660_100059159
1198 Ga0070689_100117682
1199 Ga0070661_100280743
1200 Ga0070668_100018871
1201 Ga0070668_100078075
1202 Ga0070669_100000470
1203 Ga0070669_100001664
1204 Ga0070671_100000480
1205 Ga0070671_100000845
1206 Ga0070667_100003664
1207 Ga0070667_100038587
1208 Ga0070711_100047092
1209 Ga0070705_100093227
1210 Ga0070708_100533892
1211 Ga0070663_100010764
1212 Ga0070663_100121808
1213 Ga0070678_100074328
1214 Ga0070698_100562578
1215 Ga0068853_100142436
1216 Ga0068853_100283786
1217 Ga0070686_100057706
1218 Ga0070665_100000079
1219 Ga0070665_100007174
1220 Ga0070665_100069335
1221 Ga0070665_100244589
1222 Ga0070665_100708593
1223 Ga0070704_100184020
1224 Ga0068855_100001164
1225 Ga0068855_100012273
1226 Ga0068857_100045267
1227 Ga0068854_100001776
1228 Ga0068854_100047329
1229 Ga0068854_100090117
1230 Ga0068856_100088241
1231 Ga0068852_100000357
1232 Ga0068852_100122683
1233 Ga0068859_100012881
1234 Ga0068859_100031806
1235 Ga0068864_100008530
1236 Ga0068863_100000103
1237 Ga0068858_100001349
1238 Ga0068858_100016792
1239 Ga0068858_100023512
1240 Ga0068858_100040602
1241 Ga0068860_100000093
1242 Ga0068862_100024495
1243 Ga0068862_100408680
1244 Ga0081455_10042227
1245 Ga0081455_10063732
1246 Ga0081538_10001207
1247 Ga0081538_10089373
1248 Ga0075365_10004118
1249 Ga0075365_10007525
1250 Ga0075365_10054188
1251 Ga0075365_10063111
1252 Ga0075365_10105120
1253 Ga0075363_100060745
1254 Ga0070716_100132228
1255 Ga0070712_100003467
1256 Ga0075362_10000728
1257 Ga0075362_10009130
1258 Ga0075367_10061193
1259 Ga0075367_10142283
1260 Ga0075369_10008880
1261 Ga0075369_10029915
1262 Ga0075369_10035252
1263 Ga0075366_10000192
1264 Ga0097621_100112786
1265 Ga0075370_10000015
1266 Ga0075433_10063700
1267 Ga0075434_100021327
1268 Ga0097620_100012881
1269 Ga0097620_100031806
1270 Ga0099822_1047390
1271 Ga0079104_1000069
1272 Ga0075435_100070211
1273 Ga0105251_10000232
1274 Ga0105251_10033414
1275 Ga0105240_10035774
1276 Ga0105240_10108042
1277 Ga0105245_10096781
1278 Ga0105247_10053619
1279 Ga0114129_10668261
1280 Ga0105243_10570893
1281 Ga0105242_10326049
1282 Ga0105248_10024368
1283 Ga0105248_10091196
1284 Ga0105237_10005695
1285 Ga0105249_10302920
1286 Ga0105249_10553474
1287 Ga0123340_1032850
1288 Ga0123341_1000192
1289 Ga0123341_1068856
1290 Ga0123342_1011318
1291 Ga0123342_1017436
1292 Ga0105239_10000271
1293 Ga0105239_10147014
1294 Ga0105246_10156264
1295 Ga0157369_10276980
1296 Ga0163162_10009970
1297 Ga0163162_10088278
1298 Ga0163162_10183231
1299 Ga0163162_10578988
1300 Ga0157372_10093707
1301 Ga0157375_10642267
1302 Ga0163163_10153611
1303 Ga0157379_10152633
1304 Ga0163161_10095125
1305 Ga0214542_1001787
1306 Ga0214543_1001073
1307 Ga0209435_100011
1308 Ga0209436_100051
1309 Ga0209436_100142
1310 Ga0207425_1000012
1311 Ga0207425_1003170
1312 Ga0207425_1010785
1313 Ga0209646_1000024
1314 Ga0209026_1000030
1315 Ga0209759_1000011
1316 Ga0209129_1000081
1317 Ga0209129_1000123
1318 Ga0209129_1000545
1319 Ga0209129_1001854
1320 Ga0209129_1009580
1321 Ga0209673_1000015
1322 Ga0209673_1000023
1323 Ga0209673_1000704
1324 Ga0209673_1000999
1325 Ga0209673_1001868
1326 Ga0209673_1009131
1327 Ga0209673_1015055
1328 Ga0209673_1017660
1329 Ga0209673_1021915
1330 Ga0209130_1000002
1331 Ga0209130_1000008
1332 Ga0209130_1000088
1333 Ga0209130_1000144
1334 Ga0209130_1025027
1335 Ga0209676_1023383
1336 Ga0209025_1000024
1337 Ga0209025_1000528
1338 Ga0209025_1000631
1339 Ga0209025_1000970
1340 Ga0209025_1001290
1341 Ga0209025_1004062
1342 Ga0209025_1008764
1343 Ga0209025_1008774
1344 Ga0209025_1020194
1345 Ga0209564_1000091
1346 Ga0209564_1000100
1347 Ga0209564_1000382
1348 Ga0209564_1000811
1349 Ga0209564_1001938
1350 Ga0209564_1021333
1351 Ga0209758_1000046
1352 Ga0209758_1000349
1353 Ga0209758_1001043
1354 Ga0209758_1001705
1355 Ga0209758_1003657
1356 Ga0209758_1005259
1357 Ga0209758_1007186
1358 Ga0209758_1032753
1359 Ga0209758_1045420
1360 Ga0209758_1053437
1361 Ga0209050_1008783
1362 Ga0209050_1020591
1363 Ga0209256_1000541
1364 Ga0209256_1000991
1365 Ga0209256_1002790
1366 Ga0209256_1003225
1367 Ga0209256_1005515
1368 Ga0209256_1006225
1369 Ga0209256_1008520
1370 Ga0207426_1000012
1371 Ga0207426_1000013
1372 Ga0207426_1000016
1373 Ga0207426_1000063
1374 Ga0207426_1000126
1375 Ga0207426_1000172
1376 Ga0207426_1002543
1377 Ga0209051_1000084
1378 Ga0209051_1001361
1379 Ga0209051_1002292
1380 Ga0209051_1007069
1381 Ga0209051_1011219
1382 Ga0209051_1018218
1383 Ga0209257_1003522
1384 Ga0209257_1004519
1385 Ga0209257_1015578
1386 Ga0209257_1021288
1387 Ga0207697_10023646
1388 Ga0207713_1001012
1389 Ga0207688_10027263
1390 Ga0207647_10005017
1391 Ga0207647_10014570
1392 Ga0207705_10000007
1393 Ga0207705_10000236
1394 Ga0207695_10005291
1395 Ga0207695_10111878
1396 Ga0207671_10000955
1397 Ga0207693_10009711
1398 Ga0207657_10000837
1399 Ga0207657_10083525
1400 Ga0207650_10070488
1401 Ga0207650_10139049
1402 Ga0207687_10028182
1403 Ga0207687_10233758
1404 Ga0207644_10000022
1405 Ga0207644_10002151
1406 Ga0207644_10018833
1407 Ga0207644_10074822
1408 Ga0207644_10164890
1409 Ga0207670_10090668
1410 Ga0207670_10115361
1411 Ga0207665_10139529
1412 Ga0207691_10130402
1413 Ga0207711_10017979
1414 Ga0207711_10033443
1415 Ga0207711_10090747
1416 Ga0207667_10000017
1417 Ga0207667_10009368
1418 Ga0207712_10078256
1419 Ga0207712_10094210
1420 Ga0207712_10402570
1421 Ga0207668_10024423
1422 Ga0207640_10000279
1423 Ga0207640_10043181
1424 Ga0207640_10554721
1425 Ga0207658_10003195
1426 Ga0207658_10004374
1427 Ga0207703_10010077
1428 Ga0207703_10014134
1429 Ga0207639_10108095
1430 Ga0207639_10113332
1431 Ga0207639_10386986
1432 Ga0207678_10020241
1433 Ga0207678_10144888
1434 Ga0207702_10037255
1435 Ga0207702_10049092
1436 Ga0207641_10000113
1437 Ga0207641_10001790
1438 Ga0207641_10094941
1439 Ga0207648_10057138
1440 Ga0207676_10007157
1441 Ga0207674_10048088
1442 Ga0207674_10056363
1443 Ga0207683_10029461
1444 Ga0207698_10000919
1445 Ga0207698_10149172
1446 Ga0209281_1000192
1447 Ga0209589_1000008
1448 Ga0268266_10000175
1449 Ga0268266_10002389
1450 Ga0268266_10063619
1451 Ga0268266_10596049
1452 Ga0268265_10003957
1453 Ga0268265_10014248
1454 Ga0268264_10000067
1455 Ga0268264_10004814
1456 Ga0268264_10319169
1457 Ga0307515_10000023
1458 Ga0307515_10002402
1459 Ga0307515_10011571
1460 Ga0307515_10080271
1461 Ga0307515_10083547
1462 Ga0265338_10012159
1463 Ga0307512_10023098
1464 Ga0307512_10204955
1465 Ga0265340_10092350
1466 Ga0265339_10052139
1467 Ga0265331_10025309
1468 Ga0307513_10001791
1469 Ga0307513_10007352
1470 Ga0307513_10135595
1471 Ga0307513_10252732
1472 Ga0307509_10213405
1473 Ga0307508_10000061
1474 Ga0307514_10006588
1475 Ga0265342_10042786
1476 Ga0307405_10004962
1477 Ga0316577_10225929
1478 Ga0307413_10012418
1479 Ga0307410_10136980
1480 Ga0307412_10001302
1481 Ga0307412_10019347
1482 Ga0307409_100027369
1483 Ga0307416_100914279
1484 Ga0307411_10105799
1485 Ga0307411_10226110
1486 Ga0307415_100445395
1487 Ga0307507_10017050
1488 Ga0307510_10045809
1489 Ga0316584_0139219
1490 Ga0373925_0003273
1491 Ga0395899_0126918
1492 Ga0395900_0003414
1493 Ga0395898_0003860
1494 Ga0395898_0276351
1495 Ga0395905_0003148
1496 Ga0395905_0138386
1497 Ga0395905_0173165
1498 Ga0395905_0381806
1499 Ga0395901_0007994
1500 Ga0395901_0054859
1501 Ga0395901_0592089
1502 Ga0439436_0000251
1503 Ga0439439_0006792
1504 Ga0439465_0005175
1505 Ga0439465_0010138
1506 Ga0439465_0037163
1507 Ga0451833_0527268
1508 Ga0451833_1293815
1509 Ga0451835_0106000
1510 Ga0451837_0282246
1511 Ga0451837_1449378
1512 Ga0451839_0592019
1513 Ga0451839_0649873
1514 Ga0451841_0195940
1515 Ga0451845_0049602
1516 Ga0451847_0597278
1517 Ga0451849_0316661
1518 Ga0451849_0889549
1519 Ga0451851_0538219
1520 Ga0451853_2795663
1521 Ga0451853_3659835
1522 Ga0439431_0015409
1523 Ga0439449_0002233
1524 Ga0450907_008476
1525 Ga0450918_000904
1526 Ga0466970_0001455
1527 Ga0466957_0036844
1528 Ga0466960_0177554
1529 Ga0451576_0000017
1530 Ga0466958_0002666
1531 Ga0495590_0040444
1532 Ga0495629_0013845
1533 Ga0495638_0002127
1534 Ga0495638_0042581
1535 Ga0495641_0041407
1536 Ga0495650_0022100
1537 Ga0495650_0086174
1538 Ga0495605_0004255
1539 Ga0495585_0003512
1540 Ga0495585_0107138
1541 Ga0495607_0026276
1542 Ga0495607_0058173
1543 Ga0495583_0000729
1544 Ga0495583_0038500
1545 Ga0495606_0028304
1546 Ga0495606_0028981
1547 Ga0495610_0003654
1548 Ga0495620_0012660
1549 Ga0495620_0031491
1550 Ga0495620_0034435
1551 Ga0495632_0004427
1552 Ga0495632_0008553
1553 Ga0495632_0038504
1554 Ga0495632_0054546
1555 Ga0495643_0020335
1556 Ga0495643_0022058
1557 Ga0495643_0076124
1558 Ga0495644_0065939
1559 Ga0495648_0012880
1560 Ga0495648_0026511
1561 Ga0495648_0131990
1562 Ga0495663_0037469
1563 Ga0495654_0065288
1564 Ga0495597_0103518
1565 Ga0495622_0054191
1566 Ga0495633_0048852
1567 Ga0495668_0033389
1568 Ga0495668_0062119
1569 Ga0495611_0004276
1570 Ga0495625_0001549
1571 Ga0495625_0008316
1572 Ga0495625_0124392
1573 Ga0495625_0198134
1574 Ga0495625_0290172
1575 Ga0495647_0066809
1576 Ga0495670_0088217
1577 Ga0495671_0005841
1578 Ga0495671_0072259
1579 Ga0495649_0047777
1580 Ga0495589_0053124
1581 Ga0495660_0033432
1582 Ga0495581_0053660
1583 Ga0495636_0032581
1584 Ga0495672_0040288
1585 Ga0495676_0014794
1586 Ga0495683_0116123
1587 Ga0495687_020132
1588 Ga0495687_056893
1589 Ga0495687_062756
1590 Ga0495673_0064543
1591 Ga0495673_0084977
1592 Ga0495686_0007642
1593 Ga0496100_0098884
1594 Ga0496101_0001718
1595 Ga0496101_0137123
1596 Ga0496101_0173358
1597 Ga0496102_0018972
1598 Ga0496102_0041249
1599 Ga0496102_0062080
1600 Ga0496102_0062589
1601 Ga0496102_0161723
1602 Ga0496102_0254200
1603 Ga0496103_0026313
1604 Ga0496104_0025236
1605 Ga0496104_0036153
1606 Ga0496105_0000224
1607 Ga0496105_0016215
1608 Ga0496106_0006361
1609 Ga0496106_0047264
1610 Ga0496106_0138906
1611 Ga0496106_0210824
1612 Ga0496107_0002345
1613 Ga0496107_0005917
1614 Ga0496107_0064381
1615 Ga0496108_0021911
1616 Ga0496108_0030237
1617 Ga0496109_0205114
1618 Ga0496110_0016139
1619 Ga0496110_0044333
1620 Ga0496110_0053787
1621 Ga0496111_0023729
1622 Ga0496111_0030124
1623 Ga0496111_0319858
1624 Ga0496113_0125018
1625 Ga0496114_0003970
1626 Ga0496114_0133321
1627 Ga0496115_0021954
1628 Ga0496116_0012667
1629 Ga0496116_0014264
1630 Ga0496116_0015539
1631 Ga0496116_0149291
1632 Ga0496117_0004882
1633 Ga0496117_0006044
1634 Ga0496117_0019305
1635 Ga0496117_0035745
1636 Ga0496117_0102571
1637 Ga0496118_0020924
1638 Ga0496118_0034239
1639 Ga0496118_0045801
1640 Ga0496118_0050460
1641 Ga0496118_0051624
1642 Ga0496118_0128450
1643 Ga0496119_0019149
1644 Ga0496119_0052448
1645 Ga0496119_0132140
1646 Ga0496120_0070466
1647 Ga0496121_0000274
1648 Ga0496121_0001339
1649 Ga0496121_0003000
1650 Ga0496121_0007348
1651 Ga0496121_0013331
1652 Ga0496121_0022925
1653 Ga0496121_0031341
1654 Ga0496121_0176750
1655 Ga0496121_0302587
1656 Ga0496121_0380691
1657 Ga0496122_0000147
1658 Ga0496122_0002476
1659 Ga0496122_0018439
1660 Ga0496122_0019098
1661 Ga0496122_0029419
1662 Ga0496122_0068652
1663 Ga0496123_0000020
1664 Ga0496123_0000158
1665 Ga0496123_0004863
1666 Ga0496123_0023631
1667 Ga0496123_0025896
1668 Ga0496123_0029027
1669 Ga0496123_0067858
1670 Ga0496124_0013299
1671 Ga0496124_0023052
1672 Ga0496124_0045132
1673 Ga0496124_0055657
1674 Ga0496124_0056012
1675 Ga0496124_0090155
1676 Ga0496124_0142682
1677 Ga0496124_0344217
1678 Ga0496125_0000695
1679 Ga0496125_0006025
1680 Ga0496125_0031254
1681 Ga0496125_0038164
1682 Ga0496125_0183467
1683 Ga0496126_0000195
1684 Ga0496126_0004852
1685 Ga0496126_0050974
1686 Ga0496126_0080772
1687 Ga0496126_0113074
1688 Ga0496126_0222638
1689 Ga0496126_0351490
1690 Ga0495678_039325
1691 Ga0501032_0150012
1692 Ga0501033_0065217
1693 Ga0501033_0210520
1694 Ga0501033_0250294
1695 Ga0501034_0068978
1696 Ga0501034_0144497
1697 Ga0501034_0459545
1698 Ga0501036_0379565
1699 Ga0501036_0621555
1700 Ga0501037_0113439
1701 Ga0501037_0273231
1702 Ga0501040_0112463
1703 Ga0501041_0069308
1704 Ga0501041_0257298
1705 Ga0501043_0011321
1706 Ga0501043_0085023
1707 Ga0501047_0156176
1708 Ga0501069_0230600
1709 Ga0501071_0015300
1710 Ga0501072_0178326
1711 Ga0501073_0099551
1712 Ga0501075_0068180
1713 Ga0501076_0105684
1714 Ga0501076_0190817
1715 Ga0501238_001781
1716 Ga0501079_0009362
1717 Ga0501080_0201868
1718 Ga0501083_0086168
1719 Ga0501044_0035147
1720 Ga0501045_0317051
1721 nmdc:mga03683_223_c1
1722 nmdc:mga00v17_48066_c1
1723 nmdc:mga0yw44_10889_c1
1724 nmdc:mga0yw44_25643_c1
1725 nmdc:mga0yw44_30853_c1
1726 nmdc:mga0k408_9_c2
1727 nmdc:mga07m45_13_c1
1728 nmdc:mga07m45_7936_c1
1729 nmdc:mga06r32_402360_c1
1730 nmdc:mga08y16_190503_c1
1731 nmdc:mga0n895_90481_c1
1732 nmdc:mga0rr50_91238_c1
1733 nmdc:mga0a205_120962_c1
1734 nmdc:mga0sz30_2726_c1
1735 Ga0495619_0093078
1736 Ga0500578_0074949
1737 Ga0500644_0027737
1738 Ga0500557_002864
1739 Ga0500569_059377
1740 Ga0500593_000262
1741 Ga0500607_003925
1742 Ga0500608_001223
1743 Ga0500608_005520
1744 Ga0500618_000380
1745 Ga0500618_020466
1746 Ga0500658_0000858
1747 Ga0500658_0015158
1748 Ga0500559_0012724
1749 Ga0500559_0014208
1750 Ga0500568_0042779
1751 Ga0500573_0000065
1752 Ga0500573_0000308
1753 Ga0500590_004524
1754 Ga0500604_0023632
1755 Ga0500616_0000817
1756 Ga0500616_0032869
1757 Ga0500619_000115
1758 Ga0500622_0000391
1759 Ga0500622_0065397
1760 Ga0500627_0123668
1761 Ga0500637_0013439
1762 Ga0500567_002040
1763 Ga0500625_000026
1764 Ga0500645_005655
1765 Ga0501084_0074481
1766 Ga0501082_0101087
1767 Ga0530510_0027672
1768 2509107018
1769 2509112576
1770 2509385695
1771 2509388464
1772 2509444012
1773 2510131389
1774 2510308366
1775 2510897743
1776 2511135422
1777 2511136303
1778 2511170135
1779 2511184763
1780 2511196842
1781 2511199480
1782 2511498680
1783 2512531963
1784 2513570608
1785 2513580239
1786 2513587943
1787 2513596710
1788 2513620725
1789 2513634226
1790 2513713215
1791 2513864875
1792 2513886896
1793 2513907047
1794 2513910330
1795 2513928278
1796 2513987666
1797 2513996743
1798 2514000731
1799 2514020271
1800 2515110342
1801 2515634550
1802 2515643775
1803 2515657173
1804 2515743326
1805 2516894957
1806 2517039027
1807 2517079293
1808 2517093222
1809 2517409491
1810 2520377550
1811 2524454370
1812 2524458338
1813 2530644751
1814 2530647846
1815 2535515072
1816 2551679083
1817 2551685277
1818 2551693482
1819 2551703160
1820 2551715246
1821 2551716910
1822 2551718718
1823 2551727897
1824 2551731765
1825 2551739574
1826 2585203648
1827 2585222285
1828 2585227051
1829 2585255939
1830 2585275466
1831 2585275467
1832 2585276408
1833 2585330173
1834 2585335347
1835 2585385512
1836 2585391929
1837 2585398575
1838 2585529290
1839 2585539658
1840 2585544762
1841 2585550524
1842 2585560091
1843 2585819275
1844 2585837615
1845 2585905728
1846 2587755786
1847 2587979156
1848 2588294193
1849 2599332986
1850 2599419212
1851 2599719571
1852 2600374682
1853 2616297092
1854 2616553150
1855 2616553382
1856 2616557217
1857 2616557371
1858 2617383764
1859 2643730796
1860 2644007294
1861 2644044551
1862 2644103265
1863 2644151863
1864 2644190562
1865 2644206728
1866 2644241572
1867 2644306193
1868 2644330443
1869 2644391524
1870 2644492272
1871 2644542811
1872 2644618857
1873 2644650375
1874 2644655917
1875 2719179544
1876 2719384098
1877 2719663889
1878 2719730214
1879 2720490308
1880 2720611685
1881 2720618534
1882 2720629942
1883 2720773637
1884 2721145637
1885 2721157154
1886 2721162516
1887 2721397868
1888 2722838686
1889 2723025308
1890 2723558893
1891 2723565463
1892 2724036678
1893 2724042970
1894 2724088244
1895 2724102728
1896 2724108624
1897 2725948968
1898 2730106244
1899 2730162781
1900 2730296786
1901 2738710399
1902 2738801266
1903 2738848824
1904 2738864553
1905 2739037048
1906 2739297071
1907 2739358749
1908 2739651111
1909 2740029584
1910 2766066592
1911 2770199497
1912 2776267965
1913 2776268167
1914 2776281939
1915 2776283992
1916 2792580500
1917 2793295235
1918 2793316355
1919 2793323413
1920 2793324779
1921 2793326193
1922 2793334253
1923 2793341831
1924 2793348168
1925 2793361537
1926 2793364649
1927 2805929344
1928 2805932397
1929 2806047570
1930 2806054989
1931 2806062109
1932 2806067165
1933 2806076486
1934 2808990109
1935 2819245294
1936 2819608434
1937 2819612398
1938 2821123617
1939 2821446575
1940 2838020257
1941 2838025776
1942 2838031872
1943 2838037104
1944 2838044454
1945 2838051527
1946 2838064002
1947 2838071083
1948 2838663720
1949 2838672422
1950 2838680557
1951 2838691610
1952 2838695410
1953 2838703836
1954 2838708787
1955 2838733906
1956 2838739349
1957 2838747030
1958 2841843247
1959 2841856171
1960 2841866840
1961 2842079978
1962 2842112182
1963 2842120597
1964 2842143029
1965 2842148372
1966 2842161959
1967 2842169665
1968 2842185801
1969 2842192858
1970 2842202927
1971 2842206979
1972 2842218822
1973 2842235329
1974 2842238198
1975 2842248216
1976 2842253438
1977 2842262190
1978 2842268789
1979 2842276583
1980 2842280328
1981 2842286810
1982 2842293639
1983 2842306529
1984 2842312649
1985 2842322486
1986 2842343102
1987 2842367173
1988 2842371020
1989 2842380036
1990 2842387107
1991 2842399220
1992 2842403637
1993 2842410661
1994 2842417307
1995 2842424699
1996 2842433011
1997 2842439316
1998 2842445945
1999 2842451874
2000 2842467131
2001 2842473841
2002 2842476252
2003 2842478604
2004 2842492488
2005 2842500068
2006 2842502846
2007 2842505451
2008 2842509179
2009 2842513658
2010 2842521674
2011 2842526600
2012 2842923294
2013 2844170779
2014 2844456019
2015 2844536556
2016 2852388454
2017 2852392779
2018 2852393100
2019 2855827592
2020 2855842967
2021 2857523467
2022 2857531181
2023 2858801923
2024 2888349715
2025 2891374960
2026 2896385701
2027 2899805294
2028 2915992355
2029 2915994404
2030 2916002857
2031 2916011265
2032 2916018715
2033 2916025375
2034 2916035040
2035 2916038082
2036 2916048139
2037 2916054299
2038 2916061042
2039 2916071658
2040 2916082703
2041 2919101376
2042 2919102851
2043 2919172113
2044 2919408773
2045 2920762042
2046 2921208448
2047 2921211276
2048 2921241176
2049 2921250311
2050 2921258656
2051 2921263399
2052 2921270148
2053 2921285296
2054 2921293386
2055 2921302760
2056 2923557118
2057 2924147878
2058 2924151340
2059 2924164793
2060 2924166444
2061 2924179218
2062 2924180520
2063 2924193296
2064 2924196320
2065 2924203964
2066 2924210630
2067 2924215933
2068 2924225582
2069 2924232360
2070 2928100497
2071 2928960561
2072 2933020918
2073 2933573598
2074 2933587511
2075 2933601882
2076 2935895934
2077 2935907192
2078 2936368956
2079 2936378428
2080 2936383716
2081 2936998887
2082 2937007097
2083 2937013230
2084 2937019920
2085 2937028310
2086 2937028777
2087 2937049438
2088 2937053124
2089 2937063767
2090 2937065674
2091 2937075721
2092 2937092482
2093 2937099302
2094 2937111164
2095 2937115911
2096 2937123545
2097 2937129132
2098 2941500736
2099 2957386294
2100 2957392645
2101 2957396118
2102 2957402081
2103 2957404929
2104 2957411970
2105 2957417108
2106 2957427954
2107 2957433036
2108 2957457560
2109 2957461170
2110 2957467654
2111 2957477414
2112 2957483923
2113 2957486947
2114 2957493817
2115 2957502297
2116 2957511610
2117 2960587168
2118 2960602448
2119 2960608135
2120 2960616625
2121 2960630701
2122 2960638695
2123 2960652661
2124 2960653766
2125 2960671357
2126 2960678067
2127 2960693414
2128 2964615271
2129 2964616713
2130 2964621128
2131 2964625382
2132 2964632016
2133 2964642799
2134 2964647337
2135 2964653711
2136 2964658038
2137 2964667397
2138 2964677761
2139 2964678353
2140 2964687788
2141 2964695753
2142 2964705024
2143 2964708113
2144 2964718922
2145 2964722549
2146 2967666019
2147 2967675259
2148 2967679211
2149 2967695789
2150 2967700250
2151 2967707303
2152 2967720700
2153 2967721821
2154 2967738550
2155 2967748509
2156 2967752921
2157 2967756959
2158 2967761975
2159 2967765298
2160 2967772998
2161 2967782695
2162 2970020194
2163 2970038065
2164 2970044412
2165 2970054319
2166 2970059098
2167 2970068076
2168 2970074293
2169 2970082013
2170 2970087675
2171 2970092099
2172 2970097822
2173 2970103293
2174 2970107799
2175 2970111829
2176 2970116912
2177 2970132235
2178 2970137710
2179 2970153729
2180 2970163492
2181 2970168556
2182 2970177655
2183 2970184409
2184 2970185326
2185 2970195910
2186 2977523502
2187 2977525717
2188 2977540657
2189 2977558259
2190 2977562111
2191 2977568720
2192 2977576750
2193 2977582526
2194 2987652774
2195 2989351435
2196 2989772765
2197 2989777394
2198 2996888487
2199 2996893406
2200 3000867205
2201 3003931927
2202 3005411205
2203 3005418205
2204 3005422834
2205 3005446156
2206 3005451879
2207 3005452815
2208 3005457188
2209 639646621
2210 648740415
2211 8003995547
2212 8005247418
2213 8005263451
2214 8005278809
2215 8005289037
2216 8005289383
2217 8005291111
2218 8005301522
2219 8005305284
2220 8005309222
2221 8005316155
2222 8005321630
2223 8005323014
2224 8005377462
2225 8005387325
2226 8005400098
2227 8005432903
2228 8005460981
2229 8005484922
2230 8005488171
2231 8005498633
2232 8005543743
2233 8005560594
2234 8005563947
2235 8005576893
2236 8005619825
2237 8005628397
2238 8005650119
2239 8005670044
2240 8005689306
2241 8005690238
2242 8005699282
2243 8018133096
2244 8018168996
2245 8018179485
2246 8023684269
2247 8024480248
2248 8024491439
2249 8024501631
2250 8049297407
2251 8055436167
2252 8056375606
2253 8056385920
2254 8057876020

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00763

THF_DHG_CYH

Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain

15

130

0.98

PF02882

THF_DHG_CYH_C

Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain

133

297

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6de8-assembly1.cif.gz_A crystal structure of bifunctional enzyme fold-methylenetetrahydrofolate dehydrogenase/cyclohydrolase from campylobacter jejuni 0.9634 8 266
6ape-assembly1.cif.gz_A crystal structure of bifunctional protein fold from helicobacter pylori 0.9627 9 270
4a5o-assembly2.cif.gz_D crystal structure of pseudomonas aeruginosa n5, n10- methylenetetrahydrofolate dehydrogenase-cyclohydrolase (fold) 0.9588 10 267
6ecr-assembly1.cif.gz_A the human methylenetetrahydrofolate dehydrogenase/cyclohydrolase (fold) complexed with nadp 0.9569 4 268
6v6y-assembly1.cif.gz_A-2 crystal structure of t. thermophilus methylenetetrahydrofolate dehydrogenase (mthfd) 0.9546 8 264
ID Description Score Start End Superfamily
4a5oB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.975 10 90 3.40.50.10860
af_Q54RI8_12_107_3.40.50.10860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9721 8 77 3.40.50.10860
af_K7KYI8_1_78_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9709 10 78 3.40.50.720
af_A0A0R0F3H3_60_174_3.40.50.10860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9691 10 99 3.40.50.10860
af_Q0E4G1_111_191_3.40.50.10860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9628 10 89 3.40.50.10860
ID Description Score Start End GO Terms
AF-A0A528CSZ1-F1-model_v4 methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9) 0.9918 96 275 GO:0004477
GO:0004488
GO:0005829
GO:0035999
AF-A0A530K4M7-F1-model_v4 methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9) 0.9904 93 275 GO:0004477
GO:0004488
GO:0005829
GO:0035999
AF-A0A0P1H4U0-F1-model_v4 methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9) 0.9887 115 274 GO:0004477
GO:0004488
GO:0005829
GO:0035999
AF-A0A526XTM2-F1-model_v4 methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9) 0.987 127 231 GO:0004477
GO:0004488
GO:0005829
GO:0035999
AF-E2CPW4-F1-model_v4 Bifunctional protein FolD [Includes: Methylenetetrahydrofolate dehydrogenase (EC 1.5.1.5); Methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9)] 0.9852 9 275 GO:0000105
GO:0004477
GO:0004488
GO:0005829
GO:0006164
GO:0009086
GO:0035999

Map