F490490
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1127 | 774 | 2254 | 297 |
Family's Representative Sequence
| Representative Sequence | 3300005353|Ga0070669_100088896|Ga0070669_1000888962 |
| Length | 306 |
| Sequence | VSVANDLTMTRAATIDGKAFAEGLRARVADKAAAFEAIAGRKAGLAVVLVGEDPASQVYVRNKGRQTVACGMESFEHKLPAEVPEADLLRLVGELNADPAVDGILVQLPLPAQIDEQKVIAAISPDKDVDGFHVINAGRLAVGQEGFVPCTPLGCLMLLKDRLGSLSGLEAVVIGRSNIVGKPMAQLLLGESCTVTVAHSRTHDLPAVVRRADIVVAAVGRAEMVKADWIKPGATVIDVGINRVPAAEAGKTRLVGDVDFDGVAEVAGAITPVPGGVGPMTIAVLLRNTLVAAHRNAGIALDPSGL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 7 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 8 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 9 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 10 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 11 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 12 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 13 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 14 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 15 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 16 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 17 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 18 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 21 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 24 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 26 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 27 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 58 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 59 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 60 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 61 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 62 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 65 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 66 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 67 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 70 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 71 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 72 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 74 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 75 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 76 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009763 | Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix | Metagenome | Nodule |
| 87 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 88 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 89 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 99 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 100 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 101 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 103 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 104 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 105 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 106 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 107 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 112 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 115 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 150 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 151 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 155 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 156 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 157 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 158 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 159 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 160 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 161 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 162 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 163 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 164 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 165 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 166 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 167 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 168 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 169 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 170 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 171 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 172 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 173 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 174 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 175 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 176 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 177 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 178 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 179 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 180 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 181 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 182 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 183 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 184 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 185 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 186 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 187 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 188 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 189 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 190 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 191 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 192 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 193 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 194 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 195 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 196 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 197 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 198 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 199 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 200 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 201 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 202 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 203 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 204 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 205 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 246 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 247 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 248 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 249 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 250 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 251 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 254 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 255 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 256 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 257 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 258 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 259 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 260 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 261 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 262 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 263 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 264 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 265 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 266 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 267 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 268 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 269 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 286 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 292 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 293 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 294 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 295 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 296 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 302 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 304 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 305 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 306 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 307 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 308 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 309 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 310 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 311 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 312 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 313 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 314 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 315 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 316 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 317 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 318 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 319 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 320 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 321 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 322 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 323 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 324 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 325 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 328 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 329 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 330 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 331 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 332 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 333 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 334 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 335 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 336 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 337 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 338 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 339 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 340 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 341 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 342 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 343 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 344 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 345 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 346 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 347 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 348 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 349 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 350 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 351 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 352 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 353 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 354 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 355 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 356 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 357 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 358 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 359 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 360 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 361 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 362 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 363 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 364 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 365 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 366 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 367 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 368 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 369 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 370 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 371 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 372 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 373 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 374 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 375 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 376 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 377 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 378 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 379 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 380 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 381 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 382 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 383 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 384 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 385 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 386 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 387 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 388 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 389 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 390 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 391 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 392 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 393 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 394 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 395 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 396 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 397 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 398 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 399 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 400 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 401 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 402 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 403 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 404 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 405 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 406 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 407 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 408 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 409 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 410 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 411 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 412 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 413 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 414 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 415 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 416 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 417 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 418 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 419 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 420 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 421 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 422 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 423 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 424 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 425 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 426 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 427 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 428 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 429 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 430 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 431 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 432 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 433 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 434 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 435 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 436 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 437 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 438 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 439 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 440 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 441 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 442 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 443 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 444 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 445 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 446 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 447 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 448 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 449 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 450 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 451 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 452 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 453 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 454 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 455 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 456 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 457 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 458 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 459 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 460 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 461 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 462 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 463 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 464 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 465 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 466 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 467 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 468 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 469 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 470 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 471 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 472 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 473 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 474 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 475 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 476 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 477 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 478 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 479 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 480 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 481 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 482 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 483 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 484 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 485 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 486 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 487 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 488 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 489 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 490 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 491 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 492 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 493 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 494 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 495 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 496 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 497 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 498 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 499 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 500 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 501 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 502 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 503 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 504 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 505 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 506 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 507 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 508 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 509 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 510 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 511 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 512 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 513 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 514 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 515 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 516 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 517 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 518 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 519 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 520 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 521 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 522 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 523 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 524 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 525 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 526 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 527 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 528 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 529 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 530 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 531 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 532 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 533 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 534 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 535 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 536 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 537 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 538 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 539 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 540 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 541 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 542 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 543 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 544 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 545 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 546 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 547 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 548 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 549 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 550 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 551 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 552 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 553 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 554 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 555 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 556 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 557 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 558 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 559 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 560 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 561 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 562 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 563 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 564 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 565 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 566 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 567 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 568 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 569 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 570 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 571 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 572 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 573 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 574 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 575 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 576 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 577 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 578 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 579 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 580 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 581 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 582 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 583 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 584 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 585 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 586 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 587 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 588 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 589 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 590 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 591 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 592 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 593 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 594 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 595 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 596 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 597 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 598 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 599 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 600 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 601 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 602 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 603 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 604 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 605 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 606 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 607 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 608 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 609 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 610 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 611 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 612 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 613 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 614 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 615 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 616 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 617 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 618 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 619 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 620 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 621 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 622 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 623 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 624 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 625 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 626 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 627 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 628 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 629 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 630 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 631 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 632 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 633 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 634 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 635 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 636 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 637 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 638 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 639 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 640 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 641 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 642 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 643 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 644 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 645 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 646 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 647 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 648 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 649 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 650 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 651 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 652 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 653 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 654 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 655 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 656 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 657 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 658 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 659 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 660 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 661 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 662 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 663 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 664 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 665 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 666 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 667 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 668 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 669 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 670 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 671 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 672 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 673 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 674 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 675 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 676 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 677 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 678 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 679 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 680 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 681 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 682 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 683 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 684 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 685 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 686 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 687 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 688 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 689 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 690 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 691 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 692 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 693 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 694 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 695 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 696 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 697 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 698 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 699 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 700 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 701 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 702 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 703 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 704 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 705 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 706 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 707 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 708 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 709 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 710 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 711 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 712 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 713 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 714 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 715 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 716 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 717 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 718 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 719 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 720 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 721 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 722 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 723 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 724 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 725 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 726 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 727 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 728 | 3000865235 | Altericroceibacterium indicum DSM 18604 | Isolate | Rhizosphere |
| 729 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 730 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 731 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 732 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 733 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 734 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 735 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 736 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 737 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 738 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 739 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 740 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 741 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 742 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 743 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 744 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 745 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 746 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 747 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 748 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 749 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 750 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 751 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 752 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 753 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 754 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 755 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 756 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 757 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 758 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 759 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 760 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 761 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 762 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 763 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 764 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 765 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 766 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 767 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 768 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 769 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 770 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 771 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 772 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 773 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 774 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 56.79 |
| Metatranscriptomes | 0 |
| Isolates | 43.21 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.88 |
| Nodule | 33.81 |
| Rhizoplane | 3.46 |
| Rhizosphere | 31.77 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070669_100088896 | 3300005353 | Bacteria | 2313 |
| 2 | JGI24740J21852_10005355 | 3300001979 | Bacteria | 5439 |
| 3 | JGI24739J22299_10008673 | 3300001989 | Bacteria | 3792 |
| 4 | JGI24737J22298_10001181 | 3300001990 | Bacteria | 9201 |
| 5 | JGI24735J21928_10005736 | 3300002067 | Bacteria | 4105 |
| 6 | JGI25155J39150_1000023 | 3300002704 | Bacteria | 136961 |
| 7 | JGI25156J39149_1000029 | 3300002705 | Bacteria | 126505 |
| 8 | JGI25154J39366_1000067 | 3300002738 | Bacteria | 100452 |
| 9 | JGI25158J39367_1000337 | 3300002739 | Bacteria | 10344 |
| 10 | JGI25157J39369_1000043 | 3300002741 | Bacteria | 122537 |
| 11 | JGI25152J39213_1000622 | 3300002773 | Bacteria | 18865 |
| 12 | JGI25152J39213_1001653 | 3300002773 | Bacteria | 9283 |
| 13 | JGI25150J39212_1000012 | 3300002774 | Bacteria | 182468 |
| 14 | JGI25159J45721_1000016 | 3300002987 | Bacteria | 139656 |
| 15 | JGI25159J45721_1000234 | 3300002987 | Bacteria | 26222 |
| 16 | JGI25151J46595_10000025 | 3300003187 | Bacteria | 213302 |
| 17 | JGI25151J46595_10000346 | 3300003187 | Bacteria | 49745 |
| 18 | JGI25151J46595_10004241 | 3300003187 | Bacteria | 7629 |
| 19 | JGI25151J46595_10027315 | 3300003187 | Bacteria | 2290 |
| 20 | JGI25153J46596_10005707 | 3300003215 | Bacteria | 6490 |
| 21 | JGI25153J46596_10045475 | 3300003215 | Bacteria | 1310 |
| 22 | JGI25160J50197_1000002 | 3300003354 | Bacteria | 561707 |
| 23 | JGI25160J50197_1000500 | 3300003354 | Bacteria | 23279 |
| 24 | JGI25160J50197_1007740 | 3300003354 | Bacteria | 4171 |
| 25 | JGI25161J50226_1000323 | 3300003374 | Bacteria | 26158 |
| 26 | JGI25161J50226_1000382 | 3300003374 | Bacteria | 22288 |
| 27 | JGI25161J50226_1003889 | 3300003374 | Bacteria | 3258 |
| 28 | Ga0055526_1000624 | 3300003771 | Bacteria | 27522 |
| 29 | Ga0055526_1006023 | 3300003771 | Bacteria | 6729 |
| 30 | Ga0055526_1011604 | 3300003771 | Bacteria | 3948 |
| 31 | Ga0055526_1014014 | 3300003771 | Bacteria | 3336 |
| 32 | Ga0055526_1015721 | 3300003771 | Bacteria | 3018 |
| 33 | Ga0055524_1001892 | 3300003775 | Bacteria | 11358 |
| 34 | Ga0055524_1004600 | 3300003775 | Bacteria | 6341 |
| 35 | Ga0055524_1013212 | 3300003775 | Bacteria | 3125 |
| 36 | Ga0055524_1020811 | 3300003775 | Bacteria | 2197 |
| 37 | Ga0055536_1002390 | 3300003781 | Bacteria | 10579 |
| 38 | Ga0055528_1000137 | 3300003790 | Bacteria | 58854 |
| 39 | Ga0055528_1000303 | 3300003790 | Bacteria | 41794 |
| 40 | Ga0055528_1001607 | 3300003790 | Bacteria | 13359 |
| 41 | Ga0055528_1012661 | 3300003790 | Bacteria | 3256 |
| 42 | Ga0055528_1025258 | 3300003790 | Bacteria | 1751 |
| 43 | Ga0055530_10015082 | 3300003791 | Bacteria | 2544 |
| 44 | Ga0055540_1001855 | 3300003792 | Bacteria | 11904 |
| 45 | Ga0055540_1002138 | 3300003792 | Bacteria | 10768 |
| 46 | Ga0055540_1002362 | 3300003792 | Bacteria | 10085 |
| 47 | Ga0055531_10001338 | 3300003794 | Bacteria | 18408 |
| 48 | Ga0055531_10003792 | 3300003794 | Bacteria | 9487 |
| 49 | Ga0055543_1000008 | 3300004625 | Bacteria | 202062 |
| 50 | Ga0055543_1000022 | 3300004625 | Bacteria | 140745 |
| 51 | Ga0055543_1000046 | 3300004625 | Bacteria | 113628 |
| 52 | Ga0055543_1000141 | 3300004625 | Bacteria | 60055 |
| 53 | Ga0055543_1002287 | 3300004625 | Bacteria | 6467 |
| 54 | Ga0065165_1000031 | 3300005262 | Bacteria | 216330 |
| 55 | Ga0065165_1000058 | 3300005262 | Bacteria | 184784 |
| 56 | Ga0065165_1000175 | 3300005262 | Bacteria | 113628 |
| 57 | Ga0065165_1004542 | 3300005262 | Bacteria | 8484 |
| 58 | Ga0065165_1008189 | 3300005262 | Bacteria | 4960 |
| 59 | Ga0065165_1029847 | 3300005262 | Bacteria | 1741 |
| 60 | Ga0065704_10004143 | 3300005289 | Bacteria | 3553 |
| 61 | Ga0070658_10000022 | 3300005327 | Bacteria | 186706 |
| 62 | Ga0070658_10000304 | 3300005327 | Bacteria | 42569 |
| 63 | Ga0070658_10333942 | 3300005327 | Bacteria | 1296 |
| 64 | Ga0070670_100129173 | 3300005331 | Bacteria | 2181 |
| 65 | Ga0070670_100257930 | 3300005331 | Bacteria | 1519 |
| 66 | Ga0070666_10014916 | 3300005335 | Bacteria | 4950 |
| 67 | Ga0070666_10127988 | 3300005335 | Bacteria | 1763 |
| 68 | Ga0070666_10374711 | 3300005335 | Bacteria | 1021 |
| 69 | Ga0070660_100009089 | 3300005339 | Bacteria | 6976 |
| 70 | Ga0070660_100059159 | 3300005339 | Bacteria | 2971 |
| 71 | Ga0070689_100117682 | 3300005340 | Bacteria | 2120 |
| 72 | Ga0070661_100280743 | 3300005344 | Bacteria | 1292 |
| 73 | Ga0070668_100018871 | 3300005347 | Bacteria | 5181 |
| 74 | Ga0070668_100078075 | 3300005347 | Bacteria | 2589 |
| 75 | Ga0070669_100000470 | 3300005353 | Bacteria | 30618 |
| 76 | Ga0070669_100001664 | 3300005353 | Bacteria | 16087 |
| 77 | Ga0070671_100000480 | 3300005355 | Bacteria | 27781 |
| 78 | Ga0070671_100000845 | 3300005355 | Bacteria | 22289 |
| 79 | Ga0070667_100003664 | 3300005367 | Bacteria | 13079 |
| 80 | Ga0070667_100038587 | 3300005367 | Bacteria | 4004 |
| 81 | Ga0070711_100047092 | 3300005439 | Bacteria | 2942 |
| 82 | Ga0070705_100093227 | 3300005440 | Bacteria | 1882 |
| 83 | Ga0070708_100533892 | 3300005445 | Bacteria | 1107 |
| 84 | Ga0070663_100010764 | 3300005455 | Bacteria | 5711 |
| 85 | Ga0070663_100121808 | 3300005455 | Bacteria | 1971 |
| 86 | Ga0070678_100074328 | 3300005456 | Bacteria | 2554 |
| 87 | Ga0070698_100562578 | 3300005471 | Bacteria | 1080 |
| 88 | Ga0068853_100142436 | 3300005539 | Bacteria | 2153 |
| 89 | Ga0068853_100283786 | 3300005539 | Bacteria | 1527 |
| 90 | Ga0070686_100057706 | 3300005544 | Bacteria | 2495 |
| 91 | Ga0070665_100000079 | 3300005548 | Bacteria | 186925 |
| 92 | Ga0070665_100007174 | 3300005548 | Bacteria | 11332 |
| 93 | Ga0070665_100069335 | 3300005548 | Bacteria | 3534 |
| 94 | Ga0070665_100244589 | 3300005548 | Bacteria | 1794 |
| 95 | Ga0070665_100708593 | 3300005548 | Bacteria | 1020 |
| 96 | Ga0070704_100184020 | 3300005549 | Bacteria | 1673 |
| 97 | Ga0068855_100001164 | 3300005563 | Bacteria | 32603 |
| 98 | Ga0068855_100012273 | 3300005563 | Bacteria | 10353 |
| 99 | Ga0068857_100045267 | 3300005577 | Bacteria | 3903 |
| 100 | Ga0068854_100001776 | 3300005578 | Bacteria | 13129 |
| 101 | Ga0068854_100047329 | 3300005578 | Bacteria | 3065 |
| 102 | Ga0068854_100090117 | 3300005578 | Bacteria | 2280 |
| 103 | Ga0068856_100088241 | 3300005614 | Bacteria | 3084 |
| 104 | Ga0068852_100000357 | 3300005616 | Bacteria | 30774 |
| 105 | Ga0068852_100122683 | 3300005616 | Bacteria | 2382 |
| 106 | Ga0068859_100012881 | 3300005617 | Bacteria | 8400 |
| 107 | Ga0068859_100031806 | 3300005617 | Bacteria | 5300 |
| 108 | Ga0068864_100008530 | 3300005618 | Bacteria | 8456 |
| 109 | Ga0068863_100000103 | 3300005841 | Bacteria | 91380 |
| 110 | Ga0068858_100001349 | 3300005842 | Bacteria | 25309 |
| 111 | Ga0068858_100016792 | 3300005842 | Bacteria | 6874 |
| 112 | Ga0068858_100023512 | 3300005842 | Bacteria | 5740 |
| 113 | Ga0068858_100040602 | 3300005842 | Bacteria | 4315 |
| 114 | Ga0068860_100000093 | 3300005843 | Bacteria | 150034 |
| 115 | Ga0068862_100024495 | 3300005844 | Bacteria | 5064 |
| 116 | Ga0068862_100408680 | 3300005844 | Bacteria | 1271 |
| 117 | Ga0081455_10042227 | 3300005937 | Bacteria | 4003 |
| 118 | Ga0081455_10063732 | 3300005937 | Bacteria | 3091 |
| 119 | Ga0081538_10001207 | 3300005981 | Bacteria | 27113 |
| 120 | Ga0081538_10089373 | 3300005981 | Bacteria | 1599 |
| 121 | Ga0075365_10004118 | 3300006038 | Bacteria | 7645 |
| 122 | Ga0075365_10007525 | 3300006038 | Bacteria | 6110 |
| 123 | Ga0075365_10054188 | 3300006038 | Bacteria | 2659 |
| 124 | Ga0075365_10063111 | 3300006038 | Bacteria | 2480 |
| 125 | Ga0075365_10105120 | 3300006038 | Bacteria | 1936 |
| 126 | Ga0075363_100060745 | 3300006048 | Bacteria | 2035 |
| 127 | Ga0070716_100132228 | 3300006173 | Bacteria | 1579 |
| 128 | Ga0070712_100003467 | 3300006175 | Bacteria | 9712 |
| 129 | Ga0075362_10000728 | 3300006177 | Bacteria | 9734 |
| 130 | Ga0075362_10009130 | 3300006177 | Bacteria | 3819 |
| 131 | Ga0075367_10061193 | 3300006178 | Bacteria | 2246 |
| 132 | Ga0075367_10142283 | 3300006178 | Bacteria | 1486 |
| 133 | Ga0075369_10008880 | 3300006186 | Bacteria | 3886 |
| 134 | Ga0075369_10029915 | 3300006186 | Bacteria | 2291 |
| 135 | Ga0075369_10035252 | 3300006186 | Bacteria | 2126 |
| 136 | Ga0075366_10000192 | 3300006195 | Bacteria | 26957 |
| 137 | Ga0097621_100112786 | 3300006237 | Bacteria | 2299 |
| 138 | Ga0075370_10000015 | 3300006353 | Bacteria | 62164 |
| 139 | Ga0075433_10063700 | 3300006852 | Bacteria | 3231 |
| 140 | Ga0075434_100021327 | 3300006871 | Bacteria | 6297 |
| 141 | Ga0097620_100012881 | 3300006931 | Bacteria | 8400 |
| 142 | Ga0097620_100031806 | 3300006931 | Bacteria | 5300 |
| 143 | Ga0099822_1047390 | 3300006943 | Bacteria | 1958 |
| 144 | Ga0079104_1000069 | 3300006946 | Bacteria | 153993 |
| 145 | Ga0075435_100070211 | 3300007076 | Bacteria | 2859 |
| 146 | Ga0105251_10000232 | 3300009011 | Bacteria | 56006 |
| 147 | Ga0105251_10033414 | 3300009011 | Bacteria | 2554 |
| 148 | Ga0105240_10035774 | 3300009093 | Bacteria | 6395 |
| 149 | Ga0105240_10108042 | 3300009093 | Bacteria | 3371 |
| 150 | Ga0105245_10096781 | 3300009098 | Bacteria | 2724 |
| 151 | Ga0105247_10053619 | 3300009101 | Bacteria | 2488 |
| 152 | Ga0114129_10668261 | 3300009147 | Bacteria | 1339 |
| 153 | Ga0105243_10570893 | 3300009148 | Bacteria | 1084 |
| 154 | Ga0105242_10326049 | 3300009176 | Bacteria | 1410 |
| 155 | Ga0105248_10024368 | 3300009177 | Bacteria | 6730 |
| 156 | Ga0105248_10091196 | 3300009177 | Bacteria | 3432 |
| 157 | Ga0105237_10005695 | 3300009545 | Bacteria | 14014 |
| 158 | Ga0105249_10302920 | 3300009553 | Bacteria | 1604 |
| 159 | Ga0105249_10553474 | 3300009553 | Bacteria | 1201 |
| 160 | Ga0123340_1032850 | 3300009763 | Bacteria | 2973 |
| 161 | Ga0123341_1000192 | 3300009765 | Bacteria | 31290 |
| 162 | Ga0123341_1068856 | 3300009765 | Bacteria | 1577 |
| 163 | Ga0123342_1011318 | 3300009766 | Bacteria | 9808 |
| 164 | Ga0123342_1017436 | 3300009766 | Bacteria | 5965 |
| 165 | Ga0105239_10000271 | 3300010375 | Bacteria | 76812 |
| 166 | Ga0105239_10147014 | 3300010375 | Bacteria | 2629 |
| 167 | Ga0105246_10156264 | 3300011119 | Bacteria | 1732 |
| 168 | Ga0157369_10276980 | 3300013105 | Bacteria | 1747 |
| 169 | Ga0163162_10009970 | 3300013306 | Bacteria | 9240 |
| 170 | Ga0163162_10088278 | 3300013306 | Bacteria | 3180 |
| 171 | Ga0163162_10183231 | 3300013306 | Bacteria | 2220 |
| 172 | Ga0163162_10578988 | 3300013306 | Bacteria | 1250 |
| 173 | Ga0157372_10093707 | 3300013307 | Bacteria | 3418 |
| 174 | Ga0157375_10642267 | 3300013308 | Bacteria | 1218 |
| 175 | Ga0163163_10153611 | 3300014325 | Bacteria | 2345 |
| 176 | Ga0157379_10152633 | 3300014968 | Bacteria | 2084 |
| 177 | Ga0163161_10095125 | 3300017792 | Bacteria | 2209 |
| 178 | Ga0214542_1001787 | 3300021321 | Bacteria | 44536 |
| 179 | Ga0214543_1001073 | 3300021327 | Bacteria | 51004 |
| 180 | Ga0209435_100011 | 3300025206 | Bacteria | 413027 |
| 181 | Ga0209436_100051 | 3300025208 | Bacteria | 64359 |
| 182 | Ga0209436_100142 | 3300025208 | Bacteria | 34468 |
| 183 | Ga0207425_1000012 | 3300025245 | Bacteria | 528324 |
| 184 | Ga0207425_1003170 | 3300025245 | Bacteria | 5378 |
| 185 | Ga0207425_1010785 | 3300025245 | Bacteria | 2209 |
| 186 | Ga0209646_1000024 | 3300025246 | Bacteria | 413027 |
| 187 | Ga0209026_1000030 | 3300025250 | Bacteria | 329811 |
| 188 | Ga0209759_1000011 | 3300025256 | Bacteria | 413027 |
| 189 | Ga0209129_1000081 | 3300025258 | Bacteria | 183694 |
| 190 | Ga0209129_1000123 | 3300025258 | Bacteria | 133661 |
| 191 | Ga0209129_1000545 | 3300025258 | Bacteria | 26086 |
| 192 | Ga0209129_1001854 | 3300025258 | Bacteria | 11184 |
| 193 | Ga0209129_1009580 | 3300025258 | Bacteria | 2529 |
| 194 | Ga0209673_1000015 | 3300025273 | Bacteria | 530618 |
| 195 | Ga0209673_1000023 | 3300025273 | Bacteria | 411385 |
| 196 | Ga0209673_1000704 | 3300025273 | Bacteria | 47438 |
| 197 | Ga0209673_1000999 | 3300025273 | Bacteria | 34430 |
| 198 | Ga0209673_1001868 | 3300025273 | Bacteria | 17068 |
| 199 | Ga0209673_1009131 | 3300025273 | Bacteria | 4328 |
| 200 | Ga0209673_1015055 | 3300025273 | Bacteria | 2958 |
| 201 | Ga0209673_1017660 | 3300025273 | Bacteria | 2624 |
| 202 | Ga0209673_1021915 | 3300025273 | Bacteria | 2220 |
| 203 | Ga0209130_1000002 | 3300025284 | Bacteria | 722648 |
| 204 | Ga0209130_1000008 | 3300025284 | Bacteria | 581232 |
| 205 | Ga0209130_1000088 | 3300025284 | Bacteria | 152927 |
| 206 | Ga0209130_1000144 | 3300025284 | Bacteria | 114000 |
| 207 | Ga0209130_1025027 | 3300025284 | Bacteria | 1297 |
| 208 | Ga0209676_1023383 | 3300025292 | Bacteria | 2024 |
| 209 | Ga0209025_1000024 | 3300025294 | Bacteria | 528324 |
| 210 | Ga0209025_1000528 | 3300025294 | Bacteria | 72802 |
| 211 | Ga0209025_1000631 | 3300025294 | Bacteria | 62429 |
| 212 | Ga0209025_1000970 | 3300025294 | Bacteria | 43006 |
| 213 | Ga0209025_1001290 | 3300025294 | Bacteria | 34276 |
| 214 | Ga0209025_1004062 | 3300025294 | Bacteria | 13089 |
| 215 | Ga0209025_1008764 | 3300025294 | Bacteria | 7200 |
| 216 | Ga0209025_1008774 | 3300025294 | Bacteria | 7195 |
| 217 | Ga0209025_1020194 | 3300025294 | Bacteria | 3657 |
| 218 | Ga0209564_1000091 | 3300025295 | Bacteria | 249103 |
| 219 | Ga0209564_1000100 | 3300025295 | Bacteria | 224016 |
| 220 | Ga0209564_1000382 | 3300025295 | Bacteria | 81070 |
| 221 | Ga0209564_1000811 | 3300025295 | Bacteria | 42680 |
| 222 | Ga0209564_1001938 | 3300025295 | Bacteria | 18408 |
| 223 | Ga0209564_1021333 | 3300025295 | Bacteria | 2333 |
| 224 | Ga0209758_1000046 | 3300025297 | Bacteria | 364931 |
| 225 | Ga0209758_1000349 | 3300025297 | Bacteria | 84164 |
| 226 | Ga0209758_1001043 | 3300025297 | Bacteria | 36278 |
| 227 | Ga0209758_1001705 | 3300025297 | Bacteria | 24677 |
| 228 | Ga0209758_1003657 | 3300025297 | Bacteria | 13703 |
| 229 | Ga0209758_1005259 | 3300025297 | Bacteria | 10125 |
| 230 | Ga0209758_1007186 | 3300025297 | Bacteria | 7677 |
| 231 | Ga0209758_1032753 | 3300025297 | Bacteria | 2103 |
| 232 | Ga0209758_1045420 | 3300025297 | Bacteria | 1595 |
| 233 | Ga0209758_1053437 | 3300025297 | Bacteria | 1388 |
| 234 | Ga0209050_1008783 | 3300025298 | Bacteria | 5309 |
| 235 | Ga0209050_1020591 | 3300025298 | Bacteria | 2447 |
| 236 | Ga0209256_1000541 | 3300025299 | Bacteria | 54431 |
| 237 | Ga0209256_1000991 | 3300025299 | Bacteria | 33849 |
| 238 | Ga0209256_1002790 | 3300025299 | Bacteria | 13386 |
| 239 | Ga0209256_1003225 | 3300025299 | Bacteria | 11770 |
| 240 | Ga0209256_1005515 | 3300025299 | Bacteria | 7239 |
| 241 | Ga0209256_1006225 | 3300025299 | Bacteria | 6429 |
| 242 | Ga0209256_1008520 | 3300025299 | Bacteria | 4734 |
| 243 | Ga0207426_1000012 | 3300025302 | Bacteria | 730942 |
| 244 | Ga0207426_1000013 | 3300025302 | Bacteria | 721897 |
| 245 | Ga0207426_1000016 | 3300025302 | Bacteria | 581232 |
| 246 | Ga0207426_1000063 | 3300025302 | Bacteria | 358920 |
| 247 | Ga0207426_1000126 | 3300025302 | Bacteria | 213341 |
| 248 | Ga0207426_1000172 | 3300025302 | Bacteria | 163690 |
| 249 | Ga0207426_1002543 | 3300025302 | Bacteria | 11441 |
| 250 | Ga0209051_1000084 | 3300025303 | Bacteria | 190324 |
| 251 | Ga0209051_1001361 | 3300025303 | Bacteria | 21200 |
| 252 | Ga0209051_1002292 | 3300025303 | Bacteria | 13969 |
| 253 | Ga0209051_1007069 | 3300025303 | Bacteria | 6209 |
| 254 | Ga0209051_1011219 | 3300025303 | Bacteria | 4446 |
| 255 | Ga0209051_1018218 | 3300025303 | Bacteria | 3112 |
| 256 | Ga0209257_1003522 | 3300025304 | Bacteria | 13313 |
| 257 | Ga0209257_1004519 | 3300025304 | Bacteria | 10694 |
| 258 | Ga0209257_1015578 | 3300025304 | Bacteria | 3152 |
| 259 | Ga0209257_1021288 | 3300025304 | Bacteria | 2361 |
| 260 | Ga0207697_10023646 | 3300025315 | Bacteria | 2515 |
| 261 | Ga0207713_1001012 | 3300025735 | Bacteria | 24466 |
| 262 | Ga0207688_10027263 | 3300025901 | Bacteria | 3142 |
| 263 | Ga0207647_10005017 | 3300025904 | Bacteria | 9754 |
| 264 | Ga0207647_10014570 | 3300025904 | Bacteria | 5418 |
| 265 | Ga0207705_10000007 | 3300025909 | Bacteria | 597387 |
| 266 | Ga0207705_10000236 | 3300025909 | Bacteria | 54788 |
| 267 | Ga0207695_10005291 | 3300025913 | Bacteria | 17200 |
| 268 | Ga0207695_10111878 | 3300025913 | Bacteria | 2709 |
| 269 | Ga0207671_10000955 | 3300025914 | Bacteria | 35890 |
| 270 | Ga0207693_10009711 | 3300025915 | Bacteria | 7834 |
| 271 | Ga0207657_10000837 | 3300025919 | Bacteria | 32516 |
| 272 | Ga0207657_10083525 | 3300025919 | Bacteria | 2679 |
| 273 | Ga0207650_10070488 | 3300025925 | Bacteria | 2628 |
| 274 | Ga0207650_10139049 | 3300025925 | Bacteria | 1908 |
| 275 | Ga0207687_10028182 | 3300025927 | Bacteria | 3773 |
| 276 | Ga0207687_10233758 | 3300025927 | Bacteria | 1453 |
| 277 | Ga0207644_10000022 | 3300025931 | Bacteria | 160689 |
| 278 | Ga0207644_10002151 | 3300025931 | Bacteria | 12784 |
| 279 | Ga0207644_10018833 | 3300025931 | Bacteria | 4677 |
| 280 | Ga0207644_10074822 | 3300025931 | Bacteria | 2487 |
| 281 | Ga0207644_10164890 | 3300025931 | Bacteria | 1725 |
| 282 | Ga0207670_10090668 | 3300025936 | Bacteria | 2160 |
| 283 | Ga0207670_10115361 | 3300025936 | Bacteria | 1943 |
| 284 | Ga0207665_10139529 | 3300025939 | Bacteria | 1727 |
| 285 | Ga0207691_10130402 | 3300025940 | Bacteria | 2221 |
| 286 | Ga0207711_10017979 | 3300025941 | Bacteria | 5875 |
| 287 | Ga0207711_10033443 | 3300025941 | Bacteria | 4350 |
| 288 | Ga0207711_10090747 | 3300025941 | Bacteria | 2686 |
| 289 | Ga0207667_10000017 | 3300025949 | Bacteria | 390654 |
| 290 | Ga0207667_10009368 | 3300025949 | Bacteria | 11544 |
| 291 | Ga0207712_10078256 | 3300025961 | Bacteria | 2399 |
| 292 | Ga0207712_10094210 | 3300025961 | Bacteria | 2211 |
| 293 | Ga0207712_10402570 | 3300025961 | Bacteria | 1151 |
| 294 | Ga0207668_10024423 | 3300025972 | Bacteria | 3900 |
| 295 | Ga0207640_10000279 | 3300025981 | Bacteria | 34340 |
| 296 | Ga0207640_10043181 | 3300025981 | Bacteria | 2880 |
| 297 | Ga0207640_10554721 | 3300025981 | Bacteria | 966 |
| 298 | Ga0207658_10003195 | 3300025986 | Bacteria | 11669 |
| 299 | Ga0207658_10004374 | 3300025986 | Bacteria | 9823 |
| 300 | Ga0207703_10010077 | 3300026035 | Bacteria | 7407 |
| 301 | Ga0207703_10014134 | 3300026035 | Bacteria | 6223 |
| 302 | Ga0207639_10108095 | 3300026041 | Bacteria | 2261 |
| 303 | Ga0207639_10113332 | 3300026041 | Bacteria | 2214 |
| 304 | Ga0207639_10386986 | 3300026041 | Bacteria | 1257 |
| 305 | Ga0207678_10020241 | 3300026067 | Bacteria | 5841 |
| 306 | Ga0207678_10144888 | 3300026067 | Bacteria | 2028 |
| 307 | Ga0207702_10037255 | 3300026078 | Bacteria | 4070 |
| 308 | Ga0207702_10049092 | 3300026078 | Bacteria | 3560 |
| 309 | Ga0207641_10000113 | 3300026088 | Bacteria | 119188 |
| 310 | Ga0207641_10001790 | 3300026088 | Bacteria | 20701 |
| 311 | Ga0207641_10094941 | 3300026088 | Bacteria | 2616 |
| 312 | Ga0207648_10057138 | 3300026089 | Bacteria | 3404 |
| 313 | Ga0207676_10007157 | 3300026095 | Bacteria | 7901 |
| 314 | Ga0207674_10048088 | 3300026116 | Bacteria | 4368 |
| 315 | Ga0207674_10056363 | 3300026116 | Bacteria | 3992 |
| 316 | Ga0207683_10029461 | 3300026121 | Bacteria | 4753 |
| 317 | Ga0207698_10000919 | 3300026142 | Bacteria | 17125 |
| 318 | Ga0207698_10149172 | 3300026142 | Bacteria | 2027 |
| 319 | Ga0209281_1000192 | 3300027111 | Bacteria | 140252 |
| 320 | Ga0209589_1000008 | 3300027357 | Bacteria | 259970 |
| 321 | Ga0268266_10000175 | 3300028379 | Bacteria | 115897 |
| 322 | Ga0268266_10002389 | 3300028379 | Bacteria | 20264 |
| 323 | Ga0268266_10063619 | 3300028379 | Bacteria | 3185 |
| 324 | Ga0268266_10596049 | 3300028379 | Bacteria | 1061 |
| 325 | Ga0268265_10003957 | 3300028380 | Bacteria | 10437 |
| 326 | Ga0268265_10014248 | 3300028380 | Bacteria | 5416 |
| 327 | Ga0268264_10000067 | 3300028381 | Bacteria | 284445 |
| 328 | Ga0268264_10004814 | 3300028381 | Bacteria | 11451 |
| 329 | Ga0268264_10319169 | 3300028381 | Bacteria | 1468 |
| 330 | Ga0307515_10000023 | 3300028794 | Bacteria | 400846 |
| 331 | Ga0307515_10002402 | 3300028794 | Bacteria | 40839 |
| 332 | Ga0307515_10011571 | 3300028794 | Bacteria | 16734 |
| 333 | Ga0307515_10080271 | 3300028794 | Bacteria | 4257 |
| 334 | Ga0307515_10083547 | 3300028794 | Bacteria | 4114 |
| 335 | Ga0265338_10012159 | 3300028800 | Bacteria | 9836 |
| 336 | Ga0307512_10023098 | 3300030522 | Bacteria | 5563 |
| 337 | Ga0307512_10204955 | 3300030522 | Bacteria | 1060 |
| 338 | Ga0265340_10092350 | 3300031247 | Bacteria | 1413 |
| 339 | Ga0265339_10052139 | 3300031249 | Bacteria | 2229 |
| 340 | Ga0265331_10025309 | 3300031250 | Bacteria | 2997 |
| 341 | Ga0307513_10001791 | 3300031456 | Bacteria | 30530 |
| 342 | Ga0307513_10007352 | 3300031456 | Bacteria | 14292 |
| 343 | Ga0307513_10135595 | 3300031456 | Bacteria | 2398 |
| 344 | Ga0307513_10252732 | 3300031456 | Bacteria | 1558 |
| 345 | Ga0307509_10213405 | 3300031507 | Bacteria | 1752 |
| 346 | Ga0307508_10000061 | 3300031616 | Bacteria | 124749 |
| 347 | Ga0307514_10006588 | 3300031649 | Bacteria | 10081 |
| 348 | Ga0265342_10042786 | 3300031712 | Bacteria | 2735 |
| 349 | Ga0307405_10004962 | 3300031731 | Bacteria | 6356 |
| 350 | Ga0316577_10225929 | 3300031733 | Bacteria | 1059 |
| 351 | Ga0307413_10012418 | 3300031824 | Bacteria | 4240 |
| 352 | Ga0307410_10136980 | 3300031852 | Bacteria | 1806 |
| 353 | Ga0307412_10001302 | 3300031911 | Bacteria | 13994 |
| 354 | Ga0307412_10019347 | 3300031911 | Bacteria | 4121 |
| 355 | Ga0307409_100027369 | 3300031995 | Bacteria | 4039 |
| 356 | Ga0307416_100914279 | 3300032002 | Bacteria | 978 |
| 357 | Ga0307411_10105799 | 3300032005 | Bacteria | 2001 |
| 358 | Ga0307411_10226110 | 3300032005 | Bacteria | 1455 |
| 359 | Ga0307415_100445395 | 3300032126 | Bacteria | 1118 |
| 360 | Ga0307507_10017050 | 3300033179 | Bacteria | 8381 |
| 361 | Ga0307510_10045809 | 3300033180 | Bacteria | 4713 |
| 362 | Ga0316584_0139219 | 3300036712 | Bacteria | 1811 |
| 363 | Ga0373925_0003273 | 3300037068 | Bacteria | 12613 |
| 364 | Ga0395899_0126918 | 3300037312 | Bacteria | 1824 |
| 365 | Ga0395900_0003414 | 3300037418 | Bacteria | 17170 |
| 366 | Ga0395898_0003860 | 3300037466 | Bacteria | 16582 |
| 367 | Ga0395898_0276351 | 3300037466 | Bacteria | 1602 |
| 368 | Ga0395905_0003148 | 3300037471 | Bacteria | 17774 |
| 369 | Ga0395905_0138386 | 3300037471 | Bacteria | 2291 |
| 370 | Ga0395905_0173165 | 3300037471 | Bacteria | 2027 |
| 371 | Ga0395905_0381806 | 3300037471 | Bacteria | 1303 |
| 372 | Ga0395901_0007994 | 3300038443 | Bacteria | 10676 |
| 373 | Ga0395901_0054859 | 3300038443 | Bacteria | 4143 |
| 374 | Ga0395901_0592089 | 3300038443 | Bacteria | 1119 |
| 375 | Ga0439436_0000251 | 3300041404 | Bacteria | 12861 |
| 376 | Ga0439439_0006792 | 3300041406 | Bacteria | 2654 |
| 377 | Ga0439465_0005175 | 3300041413 | Bacteria | 4185 |
| 378 | Ga0439465_0010138 | 3300041413 | Bacteria | 2962 |
| 379 | Ga0439465_0037163 | 3300041413 | Bacteria | 1565 |
| 380 | Ga0451833_0527268 | 3300041491 | Bacteria | 1942 |
| 381 | Ga0451833_1293815 | 3300041491 | Bacteria | 1526 |
| 382 | Ga0451835_0106000 | 3300041492 | Bacteria | 1820 |
| 383 | Ga0451837_0282246 | 3300041494 | Bacteria | 2722 |
| 384 | Ga0451837_1449378 | 3300041494 | Bacteria | 1096 |
| 385 | Ga0451839_0592019 | 3300041496 | Bacteria | 2152 |
| 386 | Ga0451839_0649873 | 3300041496 | Bacteria | 3395 |
| 387 | Ga0451841_0195940 | 3300041498 | Bacteria | 2418 |
| 388 | Ga0451845_0049602 | 3300041501 | Bacteria | 1231 |
| 389 | Ga0451847_0597278 | 3300041503 | Bacteria | 1024 |
| 390 | Ga0451849_0316661 | 3300041505 | Bacteria | 1892 |
| 391 | Ga0451849_0889549 | 3300041505 | Bacteria | 2431 |
| 392 | Ga0451851_0538219 | 3300041507 | Bacteria | 4548 |
| 393 | Ga0451853_2795663 | 3300041512 | Bacteria | 1910 |
| 394 | Ga0451853_3659835 | 3300041512 | Bacteria | 1693 |
| 395 | Ga0439431_0015409 | 3300041997 | Bacteria | 1780 |
| 396 | Ga0439449_0002233 | 3300042007 | Bacteria | 7624 |
| 397 | Ga0450907_008476 | 3300042146 | Bacteria | 1707 |
| 398 | Ga0450918_000904 | 3300042531 | Bacteria | 6226 |
| 399 | Ga0466970_0001455 | 3300044765 | Bacteria | 11448 |
| 400 | Ga0466957_0036844 | 3300044842 | Bacteria | 2942 |
| 401 | Ga0466960_0177554 | 3300044901 | Bacteria | 1153 |
| 402 | Ga0451576_0000017 | 3300045051 | Bacteria | 558261 |
| 403 | Ga0466958_0002666 | 3300045836 | Bacteria | 9031 |
| 404 | Ga0495590_0040444 | 3300046457 | Bacteria | 1626 |
| 405 | Ga0495629_0013845 | 3300046459 | Bacteria | 5819 |
| 406 | Ga0495638_0002127 | 3300046460 | Bacteria | 16661 |
| 407 | Ga0495638_0042581 | 3300046460 | Bacteria | 2867 |
| 408 | Ga0495641_0041407 | 3300046461 | Bacteria | 2140 |
| 409 | Ga0495650_0022100 | 3300046471 | Bacteria | 3058 |
| 410 | Ga0495650_0086174 | 3300046471 | Bacteria | 1203 |
| 411 | Ga0495605_0004255 | 3300046474 | Bacteria | 8434 |
| 412 | Ga0495585_0003512 | 3300046492 | Bacteria | 10572 |
| 413 | Ga0495585_0107138 | 3300046492 | Bacteria | 1489 |
| 414 | Ga0495607_0026276 | 3300046501 | Bacteria | 3613 |
| 415 | Ga0495607_0058173 | 3300046501 | Bacteria | 2212 |
| 416 | Ga0495583_0000729 | 3300046506 | Bacteria | 41893 |
| 417 | Ga0495583_0038500 | 3300046506 | Bacteria | 2259 |
| 418 | Ga0495606_0028304 | 3300046507 | Bacteria | 3957 |
| 419 | Ga0495606_0028981 | 3300046507 | Bacteria | 3894 |
| 420 | Ga0495610_0003654 | 3300046512 | Bacteria | 11836 |
| 421 | Ga0495620_0012660 | 3300046515 | Bacteria | 4345 |
| 422 | Ga0495620_0031491 | 3300046515 | Bacteria | 2430 |
| 423 | Ga0495620_0034435 | 3300046515 | Bacteria | 2288 |
| 424 | Ga0495632_0004427 | 3300046519 | Bacteria | 9548 |
| 425 | Ga0495632_0008553 | 3300046519 | Bacteria | 6262 |
| 426 | Ga0495632_0038504 | 3300046519 | Bacteria | 2421 |
| 427 | Ga0495632_0054546 | 3300046519 | Bacteria | 1959 |
| 428 | Ga0495643_0020335 | 3300046522 | Bacteria | 3828 |
| 429 | Ga0495643_0022058 | 3300046522 | Bacteria | 3640 |
| 430 | Ga0495643_0076124 | 3300046522 | Bacteria | 1755 |
| 431 | Ga0495644_0065939 | 3300046523 | Bacteria | 1360 |
| 432 | Ga0495648_0012880 | 3300046524 | Bacteria | 6212 |
| 433 | Ga0495648_0026511 | 3300046524 | Bacteria | 3899 |
| 434 | Ga0495648_0131990 | 3300046524 | Bacteria | 1327 |
| 435 | Ga0495663_0037469 | 3300046525 | Bacteria | 1463 |
| 436 | Ga0495654_0065288 | 3300046530 | Bacteria | 1738 |
| 437 | Ga0495597_0103518 | 3300046542 | Bacteria | 1198 |
| 438 | Ga0495622_0054191 | 3300046557 | Bacteria | 1861 |
| 439 | Ga0495633_0048852 | 3300046558 | Bacteria | 1997 |
| 440 | Ga0495668_0033389 | 3300046616 | Bacteria | 2891 |
| 441 | Ga0495668_0062119 | 3300046616 | Bacteria | 2059 |
| 442 | Ga0495611_0004276 | 3300046648 | Bacteria | 6208 |
| 443 | Ga0495625_0001549 | 3300046660 | Bacteria | 27422 |
| 444 | Ga0495625_0008316 | 3300046660 | Bacteria | 8864 |
| 445 | Ga0495625_0124392 | 3300046660 | Bacteria | 1752 |
| 446 | Ga0495625_0198134 | 3300046660 | Bacteria | 1327 |
| 447 | Ga0495625_0290172 | 3300046660 | Bacteria | 1050 |
| 448 | Ga0495647_0066809 | 3300046681 | Bacteria | 1431 |
| 449 | Ga0495670_0088217 | 3300046691 | Bacteria | 1585 |
| 450 | Ga0495671_0005841 | 3300046692 | Bacteria | 7166 |
| 451 | Ga0495671_0072259 | 3300046692 | Bacteria | 1694 |
| 452 | Ga0495649_0047777 | 3300046694 | Bacteria | 2327 |
| 453 | Ga0495589_0053124 | 3300046794 | Bacteria | 2000 |
| 454 | Ga0495660_0033432 | 3300046810 | Bacteria | 2883 |
| 455 | Ga0495581_0053660 | 3300047315 | Bacteria | 2328 |
| 456 | Ga0495636_0032581 | 3300047318 | Bacteria | 2138 |
| 457 | Ga0495672_0040288 | 3300047320 | Bacteria | 2834 |
| 458 | Ga0495676_0014794 | 3300047321 | Bacteria | 6967 |
| 459 | Ga0495683_0116123 | 3300047323 | Bacteria | 1274 |
| 460 | Ga0495687_020132 | 3300047443 | Bacteria | 3258 |
| 461 | Ga0495687_056893 | 3300047443 | Bacteria | 1629 |
| 462 | Ga0495687_062756 | 3300047443 | Bacteria | 1524 |
| 463 | Ga0495673_0064543 | 3300047469 | Bacteria | 1557 |
| 464 | Ga0495673_0084977 | 3300047469 | Bacteria | 1303 |
| 465 | Ga0495686_0007642 | 3300047472 | Bacteria | 8070 |
| 466 | Ga0496100_0098884 | 3300048903 | Bacteria | 2006 |
| 467 | Ga0496101_0001718 | 3300048904 | Bacteria | 13120 |
| 468 | Ga0496101_0137123 | 3300048904 | Bacteria | 1863 |
| 469 | Ga0496101_0173358 | 3300048904 | Bacteria | 1658 |
| 470 | Ga0496102_0018972 | 3300048905 | Bacteria | 6050 |
| 471 | Ga0496102_0041249 | 3300048905 | Bacteria | 4178 |
| 472 | Ga0496102_0062080 | 3300048905 | Bacteria | 3421 |
| 473 | Ga0496102_0062589 | 3300048905 | Bacteria | 3407 |
| 474 | Ga0496102_0161723 | 3300048905 | Bacteria | 2106 |
| 475 | Ga0496102_0254200 | 3300048905 | Bacteria | 1657 |
| 476 | Ga0496103_0026313 | 3300048906 | Bacteria | 3522 |
| 477 | Ga0496104_0025236 | 3300048907 | Bacteria | 5478 |
| 478 | Ga0496104_0036153 | 3300048907 | Bacteria | 4615 |
| 479 | Ga0496105_0000224 | 3300048908 | Bacteria | 38048 |
| 480 | Ga0496105_0016215 | 3300048908 | Bacteria | 5944 |
| 481 | Ga0496106_0006361 | 3300048909 | Bacteria | 8744 |
| 482 | Ga0496106_0047264 | 3300048909 | Bacteria | 3238 |
| 483 | Ga0496106_0138906 | 3300048909 | Bacteria | 1910 |
| 484 | Ga0496106_0210824 | 3300048909 | Bacteria | 1547 |
| 485 | Ga0496107_0002345 | 3300048910 | Bacteria | 12230 |
| 486 | Ga0496107_0005917 | 3300048910 | Bacteria | 8381 |
| 487 | Ga0496107_0064381 | 3300048910 | Bacteria | 2658 |
| 488 | Ga0496108_0021911 | 3300048911 | Bacteria | 5252 |
| 489 | Ga0496108_0030237 | 3300048911 | Bacteria | 4489 |
| 490 | Ga0496109_0205114 | 3300048912 | Bacteria | 1854 |
| 491 | Ga0496110_0016139 | 3300048913 | Bacteria | 6227 |
| 492 | Ga0496110_0044333 | 3300048913 | Bacteria | 3884 |
| 493 | Ga0496110_0053787 | 3300048913 | Bacteria | 3540 |
| 494 | Ga0496111_0023729 | 3300048914 | Bacteria | 4308 |
| 495 | Ga0496111_0030124 | 3300048914 | Bacteria | 3858 |
| 496 | Ga0496111_0319858 | 3300048914 | Bacteria | 1149 |
| 497 | Ga0496113_0125018 | 3300048916 | Bacteria | 2013 |
| 498 | Ga0496114_0003970 | 3300048917 | Bacteria | 11423 |
| 499 | Ga0496114_0133321 | 3300048917 | Bacteria | 2147 |
| 500 | Ga0496115_0021954 | 3300048918 | Bacteria | 4936 |
| 501 | Ga0496116_0012667 | 3300048919 | Bacteria | 6864 |
| 502 | Ga0496116_0014264 | 3300048919 | Bacteria | 6355 |
| 503 | Ga0496116_0015539 | 3300048919 | Bacteria | 6013 |
| 504 | Ga0496116_0149291 | 3300048919 | Bacteria | 1301 |
| 505 | Ga0496117_0004882 | 3300048920 | Bacteria | 14459 |
| 506 | Ga0496117_0006044 | 3300048920 | Bacteria | 12434 |
| 507 | Ga0496117_0019305 | 3300048920 | Bacteria | 5605 |
| 508 | Ga0496117_0035745 | 3300048920 | Bacteria | 3725 |
| 509 | Ga0496117_0102571 | 3300048920 | Bacteria | 1805 |
| 510 | Ga0496118_0020924 | 3300048921 | Bacteria | 5783 |
| 511 | Ga0496118_0034239 | 3300048921 | Bacteria | 4149 |
| 512 | Ga0496118_0045801 | 3300048921 | Bacteria | 3409 |
| 513 | Ga0496118_0050460 | 3300048921 | Bacteria | 3192 |
| 514 | Ga0496118_0051624 | 3300048921 | Bacteria | 3144 |
| 515 | Ga0496118_0128450 | 3300048921 | Bacteria | 1633 |
| 516 | Ga0496119_0019149 | 3300048922 | Bacteria | 5057 |
| 517 | Ga0496119_0052448 | 3300048922 | Bacteria | 2498 |
| 518 | Ga0496119_0132140 | 3300048922 | Bacteria | 1359 |
| 519 | Ga0496120_0070466 | 3300048923 | Bacteria | 1923 |
| 520 | Ga0496121_0000274 | 3300048924 | Bacteria | 107140 |
| 521 | Ga0496121_0001339 | 3300048924 | Bacteria | 42173 |
| 522 | Ga0496121_0003000 | 3300048924 | Bacteria | 24522 |
| 523 | Ga0496121_0007348 | 3300048924 | Bacteria | 13323 |
| 524 | Ga0496121_0013331 | 3300048924 | Bacteria | 8844 |
| 525 | Ga0496121_0022925 | 3300048924 | Bacteria | 6033 |
| 526 | Ga0496121_0031341 | 3300048924 | Bacteria | 4859 |
| 527 | Ga0496121_0176750 | 3300048924 | Bacteria | 1545 |
| 528 | Ga0496121_0302587 | 3300048924 | Bacteria | 1084 |
| 529 | Ga0496121_0380691 | 3300048924 | Bacteria | 930 |
| 530 | Ga0496122_0000147 | 3300048925 | Bacteria | 165589 |
| 531 | Ga0496122_0002476 | 3300048925 | Bacteria | 26097 |
| 532 | Ga0496122_0018439 | 3300048925 | Bacteria | 6447 |
| 533 | Ga0496122_0019098 | 3300048925 | Bacteria | 6284 |
| 534 | Ga0496122_0029419 | 3300048925 | Bacteria | 4634 |
| 535 | Ga0496122_0068652 | 3300048925 | Bacteria | 2543 |
| 536 | Ga0496123_0000020 | 3300048926 | Bacteria | 388748 |
| 537 | Ga0496123_0000158 | 3300048926 | Bacteria | 136078 |
| 538 | Ga0496123_0004863 | 3300048926 | Bacteria | 13829 |
| 539 | Ga0496123_0023631 | 3300048926 | Bacteria | 4699 |
| 540 | Ga0496123_0025896 | 3300048926 | Bacteria | 4408 |
| 541 | Ga0496123_0029027 | 3300048926 | Bacteria | 4083 |
| 542 | Ga0496123_0067858 | 3300048926 | Bacteria | 2250 |
| 543 | Ga0496124_0013299 | 3300048927 | Bacteria | 8042 |
| 544 | Ga0496124_0023052 | 3300048927 | Bacteria | 5694 |
| 545 | Ga0496124_0045132 | 3300048927 | Bacteria | 3779 |
| 546 | Ga0496124_0055657 | 3300048927 | Bacteria | 3341 |
| 547 | Ga0496124_0056012 | 3300048927 | Bacteria | 3328 |
| 548 | Ga0496124_0090155 | 3300048927 | Bacteria | 2502 |
| 549 | Ga0496124_0142682 | 3300048927 | Bacteria | 1888 |
| 550 | Ga0496124_0344217 | 3300048927 | Bacteria | 1057 |
| 551 | Ga0496125_0000695 | 3300048928 | Bacteria | 55563 |
| 552 | Ga0496125_0006025 | 3300048928 | Bacteria | 13262 |
| 553 | Ga0496125_0031254 | 3300048928 | Bacteria | 4747 |
| 554 | Ga0496125_0038164 | 3300048928 | Bacteria | 4163 |
| 555 | Ga0496125_0183467 | 3300048928 | Bacteria | 1391 |
| 556 | Ga0496126_0000195 | 3300048929 | Bacteria | 135582 |
| 557 | Ga0496126_0004852 | 3300048929 | Bacteria | 15748 |
| 558 | Ga0496126_0050974 | 3300048929 | Bacteria | 3771 |
| 559 | Ga0496126_0080772 | 3300048929 | Bacteria | 2876 |
| 560 | Ga0496126_0113074 | 3300048929 | Bacteria | 2364 |
| 561 | Ga0496126_0222638 | 3300048929 | Bacteria | 1584 |
| 562 | Ga0496126_0351490 | 3300048929 | Bacteria | 1205 |
| 563 | Ga0495678_039325 | 3300049459 | Bacteria | 1908 |
| 564 | Ga0501032_0150012 | 3300049569 | Bacteria | 1533 |
| 565 | Ga0501033_0065217 | 3300049570 | Bacteria | 2679 |
| 566 | Ga0501033_0210520 | 3300049570 | Bacteria | 1386 |
| 567 | Ga0501033_0250294 | 3300049570 | Bacteria | 1256 |
| 568 | Ga0501034_0068978 | 3300049571 | Bacteria | 3546 |
| 569 | Ga0501034_0144497 | 3300049571 | Bacteria | 2356 |
| 570 | Ga0501034_0459545 | 3300049571 | Bacteria | 1190 |
| 571 | Ga0501036_0379565 | 3300049572 | Bacteria | 1180 |
| 572 | Ga0501036_0621555 | 3300049572 | Bacteria | 895 |
| 573 | Ga0501037_0113439 | 3300049573 | Bacteria | 1951 |
| 574 | Ga0501037_0273231 | 3300049573 | Bacteria | 1179 |
| 575 | Ga0501040_0112463 | 3300049576 | Bacteria | 1905 |
| 576 | Ga0501041_0069308 | 3300049577 | Bacteria | 2163 |
| 577 | Ga0501041_0257298 | 3300049577 | Bacteria | 1098 |
| 578 | Ga0501043_0011321 | 3300049579 | Bacteria | 6982 |
| 579 | Ga0501043_0085023 | 3300049579 | Bacteria | 2486 |
| 580 | Ga0501047_0156176 | 3300049581 | Bacteria | 2155 |
| 581 | Ga0501069_0230600 | 3300049585 | Bacteria | 1078 |
| 582 | Ga0501071_0015300 | 3300049587 | Bacteria | 5266 |
| 583 | Ga0501072_0178326 | 3300049588 | Bacteria | 1695 |
| 584 | Ga0501073_0099551 | 3300049589 | Bacteria | 2018 |
| 585 | Ga0501075_0068180 | 3300049591 | Bacteria | 2687 |
| 586 | Ga0501076_0105684 | 3300049592 | Bacteria | 2272 |
| 587 | Ga0501076_0190817 | 3300049592 | Bacteria | 1672 |
| 588 | Ga0501238_001781 | 3300049671 | Bacteria | 2514 |
| 589 | Ga0501079_0009362 | 3300049741 | Bacteria | 7422 |
| 590 | Ga0501080_0201868 | 3300049742 | Bacteria | 1825 |
| 591 | Ga0501083_0086168 | 3300049744 | Bacteria | 2077 |
| 592 | Ga0501044_0035147 | 3300049823 | Bacteria | 5250 |
| 593 | Ga0501045_0317051 | 3300049824 | Bacteria | 1160 |
| 594 | nmdc:mga03683_223_c1 | 3300050489 | Bacteria | 18101 |
| 595 | nmdc:mga00v17_48066_c1 | 3300050491 | Bacteria | 2585 |
| 596 | nmdc:mga0yw44_10889_c1 | 3300050492 | Bacteria | 4663 |
| 597 | nmdc:mga0yw44_25643_c1 | 3300050492 | Bacteria | 3356 |
| 598 | nmdc:mga0yw44_30853_c1 | 3300050492 | Bacteria | 3112 |
| 599 | nmdc:mga0k408_9_c2 | 3300050493 | Bacteria | 64937 |
| 600 | nmdc:mga07m45_13_c1 | 3300050496 | Bacteria | 65600 |
| 601 | nmdc:mga07m45_7936_c1 | 3300050496 | Bacteria | 5436 |
| 602 | nmdc:mga06r32_402360_c1 | 3300050510 | Bacteria | 1351 |
| 603 | nmdc:mga08y16_190503_c1 | 3300050511 | Bacteria | 1508 |
| 604 | nmdc:mga0n895_90481_c1 | 3300050512 | Bacteria | 3062 |
| 605 | nmdc:mga0rr50_91238_c1 | 3300050513 | Bacteria | 2372 |
| 606 | nmdc:mga0a205_120962_c1 | 3300050515 | Bacteria | 2517 |
| 607 | nmdc:mga0sz30_2726_c1 | 3300050516 | Bacteria | 6304 |
| 608 | Ga0495619_0093078 | 3300053085 | Bacteria | 2043 |
| 609 | Ga0500578_0074949 | 3300053086 | Bacteria | 2155 |
| 610 | Ga0500644_0027737 | 3300053088 | Bacteria | 1764 |
| 611 | Ga0500557_002864 | 3300053105 | Bacteria | 3281 |
| 612 | Ga0500569_059377 | 3300053109 | Bacteria | 1176 |
| 613 | Ga0500593_000262 | 3300053117 | Bacteria | 21599 |
| 614 | Ga0500607_003925 | 3300053121 | Bacteria | 10528 |
| 615 | Ga0500608_001223 | 3300053122 | Bacteria | 9169 |
| 616 | Ga0500608_005520 | 3300053122 | Bacteria | 5039 |
| 617 | Ga0500618_000380 | 3300053125 | Bacteria | 30639 |
| 618 | Ga0500618_020466 | 3300053125 | Bacteria | 1620 |
| 619 | Ga0500658_0000858 | 3300053134 | Bacteria | 12470 |
| 620 | Ga0500658_0015158 | 3300053134 | Bacteria | 2858 |
| 621 | Ga0500559_0012724 | 3300053136 | Bacteria | 3572 |
| 622 | Ga0500559_0014208 | 3300053136 | Bacteria | 3364 |
| 623 | Ga0500568_0042779 | 3300053139 | Bacteria | 1813 |
| 624 | Ga0500573_0000065 | 3300053140 | Bacteria | 64628 |
| 625 | Ga0500573_0000308 | 3300053140 | Bacteria | 20963 |
| 626 | Ga0500590_004524 | 3300053148 | Bacteria | 6573 |
| 627 | Ga0500604_0023632 | 3300053151 | Bacteria | 1754 |
| 628 | Ga0500616_0000817 | 3300053153 | Bacteria | 35314 |
| 629 | Ga0500616_0032869 | 3300053153 | Bacteria | 2834 |
| 630 | Ga0500619_000115 | 3300053154 | Bacteria | 21281 |
| 631 | Ga0500622_0000391 | 3300053156 | Bacteria | 42302 |
| 632 | Ga0500622_0065397 | 3300053156 | Bacteria | 1847 |
| 633 | Ga0500627_0123668 | 3300053158 | Bacteria | 1167 |
| 634 | Ga0500637_0013439 | 3300053178 | Bacteria | 4294 |
| 635 | Ga0500567_002040 | 3300053723 | Bacteria | 8449 |
| 636 | Ga0500625_000026 | 3300053729 | Bacteria | 60801 |
| 637 | Ga0500645_005655 | 3300053730 | Bacteria | 4566 |
| 638 | Ga0501084_0074481 | 3300054114 | Bacteria | 2843 |
| 639 | Ga0501082_0101087 | 3300060353 | Bacteria | 2494 |
| 640 | Ga0530510_0027672 | 3300061734 | Bacteria | 4062 |
| 641 | 2509107018 | 2508501122 | Bacteria | 6292184 |
| 642 | 2509112576 | 2508501122 | Bacteria | 6292184 |
| 643 | 2509385695 | 2509276021 | Bacteria | 7634384 |
| 644 | 2509388464 | 2509276021 | Bacteria | 7634384 |
| 645 | 2509444012 | 2509276033 | Bacteria | 7180565 |
| 646 | 2510131389 | 2510065019 | Bacteria | 6903379 |
| 647 | 2510308366 | 2510065057 | Bacteria | 6649661 |
| 648 | 2510897743 | 2510461076 | Bacteria | 8618824 |
| 649 | 2511135422 | 2510917022 | Bacteria | 6504556 |
| 650 | 2511136303 | 2510917022 | Bacteria | 6504556 |
| 651 | 2511170135 | 2510917026 | Bacteria | 7046020 |
| 652 | 2511184763 | 2510917028 | Bacteria | 6185411 |
| 653 | 2511196842 | 2510917030 | Bacteria | 7460662 |
| 654 | 2511199480 | 2510917030 | Bacteria | 7460662 |
| 655 | 2511498680 | 2511231052 | Bacteria | 6974333 |
| 656 | 2512531963 | 2512047086 | Bacteria | 6850303 |
| 657 | 2513570608 | 2513237084 | Bacteria | 7231967 |
| 658 | 2513580239 | 2513237085 | Bacteria | 7695351 |
| 659 | 2513587943 | 2513237086 | Bacteria | 7265287 |
| 660 | 2513596710 | 2513237088 | Bacteria | 6927906 |
| 661 | 2513620725 | 2513237091 | Bacteria | 6900273 |
| 662 | 2513634226 | 2513237093 | Bacteria | 7545552 |
| 663 | 2513713215 | 2513237103 | Bacteria | 7647401 |
| 664 | 2513864875 | 2513237138 | Bacteria | 7368160 |
| 665 | 2513886896 | 2513237140 | Bacteria | 7076289 |
| 666 | 2513907047 | 2513237143 | Bacteria | 6664116 |
| 667 | 2513910330 | 2513237144 | Bacteria | 7530820 |
| 668 | 2513928278 | 2513237146 | Bacteria | 7166346 |
| 669 | 2513987666 | 2513237156 | Bacteria | 6402557 |
| 670 | 2513996743 | 2513237159 | Bacteria | 6810126 |
| 671 | 2514000731 | 2513237159 | Bacteria | 6810126 |
| 672 | 2514020271 | 2513237162 | Bacteria | 7468464 |
| 673 | 2515110342 | 2515075009 | Bacteria | 7288508 |
| 674 | 2515634550 | 2515154113 | Bacteria | 7807172 |
| 675 | 2515643775 | 2515154114 | Bacteria | 7848616 |
| 676 | 2515657173 | 2515154116 | Bacteria | 7552979 |
| 677 | 2515743326 | 2515154134 | Bacteria | 7220242 |
| 678 | 2516894957 | 2516653046 | Bacteria | 6989037 |
| 679 | 2517039027 | 2516653077 | Bacteria | 7555578 |
| 680 | 2517079293 | 2516653085 | Bacteria | 7346596 |
| 681 | 2517093222 | 2517093000 | Bacteria | 7412387 |
| 682 | 2517409491 | 2517287029 | Bacteria | 6905599 |
| 683 | 2520377550 | 2519899620 | Bacteria | 6499161 |
| 684 | 2524454370 | 2524023207 | Bacteria | 6813453 |
| 685 | 2524458338 | 2524023209 | Bacteria | 6679728 |
| 686 | 2530644751 | 2529292951 | Bacteria | 6916614 |
| 687 | 2530647846 | 2529292951 | Bacteria | 6916614 |
| 688 | 2535515072 | 2534681796 | Bacteria | 7146037 |
| 689 | 2551679083 | 2551306084 | Bacteria | 8942552 |
| 690 | 2551685277 | 2551306085 | Bacteria | 7347181 |
| 691 | 2551693482 | 2551306086 | Bacteria | 6843938 |
| 692 | 2551703160 | 2551306087 | Bacteria | 7351905 |
| 693 | 2551715246 | 2551306089 | Bacteria | 7162724 |
| 694 | 2551716910 | 2551306090 | Bacteria | 7953713 |
| 695 | 2551718718 | 2551306090 | Bacteria | 7953713 |
| 696 | 2551727897 | 2551306091 | Bacteria | 7086830 |
| 697 | 2551731765 | 2551306092 | Bacteria | 6992595 |
| 698 | 2551739574 | 2551306093 | Bacteria | 7064773 |
| 699 | 2585203648 | 2582581294 | Bacteria | 6626667 |
| 700 | 2585222285 | 2582581298 | Bacteria | 7315509 |
| 701 | 2585227051 | 2582581298 | Bacteria | 7315509 |
| 702 | 2585255939 | 2582581304 | Bacteria | 5831370 |
| 703 | 2585275466 | 2582581307 | Bacteria | 6597605 |
| 704 | 2585275467 | 2582581307 | Bacteria | 6597605 |
| 705 | 2585276408 | 2582581307 | Bacteria | 6597605 |
| 706 | 2585330173 | 2582581316 | Bacteria | 7774528 |
| 707 | 2585335347 | 2582581316 | Bacteria | 7774528 |
| 708 | 2585385512 | 2582581865 | Bacteria | 6644329 |
| 709 | 2585391929 | 2582581866 | Bacteria | 6859583 |
| 710 | 2585398575 | 2582581867 | Bacteria | 7184437 |
| 711 | 2585529290 | 2585427526 | Bacteria | 7258840 |
| 712 | 2585539658 | 2585427528 | Bacteria | 6842387 |
| 713 | 2585544762 | 2585427529 | Bacteria | 7395659 |
| 714 | 2585550524 | 2585427529 | Bacteria | 7395659 |
| 715 | 2585560091 | 2585427531 | Bacteria | 6992870 |
| 716 | 2585819275 | 2585427590 | Bacteria | 6824633 |
| 717 | 2585837615 | 2585427593 | Bacteria | 7141551 |
| 718 | 2585905728 | 2585427609 | Bacteria | 6667127 |
| 719 | 2587755786 | 2585428062 | Bacteria | 6842168 |
| 720 | 2587979156 | 2585428125 | Bacteria | 6662905 |
| 721 | 2588294193 | 2588253510 | Bacteria | 6901809 |
| 722 | 2599332986 | 2599185156 | Bacteria | 5403036 |
| 723 | 2599419212 | 2599185170 | Bacteria | 7295545 |
| 724 | 2599719571 | 2599185236 | Bacteria | 6875203 |
| 725 | 2600374682 | 2600254933 | Bacteria | 4750527 |
| 726 | 2616297092 | 2615840624 | Bacteria | 6557588 |
| 727 | 2616553150 | 2615840698 | Bacteria | 7319877 |
| 728 | 2616553382 | 2615840698 | Bacteria | 7319877 |
| 729 | 2616557217 | 2615840698 | Bacteria | 7319877 |
| 730 | 2616557371 | 2615840698 | Bacteria | 7319877 |
| 731 | 2617383764 | 2617270742 | Bacteria | 6808054 |
| 732 | 2643730796 | 2643221541 | Bacteria | 5498788 |
| 733 | 2644007294 | 2643221599 | Bacteria | 6292121 |
| 734 | 2644044551 | 2643221606 | Bacteria | 5588032 |
| 735 | 2644103265 | 2643221618 | Bacteria | 7717186 |
| 736 | 2644151863 | 2643221626 | Bacteria | 8069654 |
| 737 | 2644190562 | 2643221634 | Bacteria | 6705461 |
| 738 | 2644206728 | 2643221637 | Bacteria | 5345260 |
| 739 | 2644241572 | 2643221643 | Bacteria | 5749658 |
| 740 | 2644306193 | 2643221655 | Bacteria | 7722067 |
| 741 | 2644330443 | 2643221659 | Bacteria | 7890716 |
| 742 | 2644391524 | 2643221671 | Bacteria | 5496681 |
| 743 | 2644492272 | 2643221688 | Bacteria | 5260751 |
| 744 | 2644542811 | 2643221698 | Bacteria | 7756764 |
| 745 | 2644618857 | 2643221712 | Bacteria | 7729434 |
| 746 | 2644650375 | 2643221718 | Bacteria | 5345506 |
| 747 | 2644655917 | 2643221719 | Bacteria | 4568197 |
| 748 | 2719179544 | 2718217882 | Bacteria | 6556348 |
| 749 | 2719384098 | 2718217927 | Bacteria | 6972593 |
| 750 | 2719663889 | 2718217997 | Bacteria | 6740740 |
| 751 | 2719730214 | 2718218009 | Bacteria | 6478651 |
| 752 | 2720490308 | 2718218199 | Bacteria | 6740745 |
| 753 | 2720611685 | 2718218232 | Bacteria | 6720332 |
| 754 | 2720618534 | 2718218233 | Bacteria | 6662049 |
| 755 | 2720629942 | 2718218235 | Bacteria | 6630699 |
| 756 | 2720773637 | 2718218269 | Bacteria | 6906114 |
| 757 | 2721145637 | 2718218363 | Bacteria | 6524337 |
| 758 | 2721157154 | 2718218365 | Bacteria | 6274507 |
| 759 | 2721162516 | 2718218366 | Bacteria | 6425255 |
| 760 | 2721397868 | 2718218423 | Bacteria | 6438183 |
| 761 | 2722838686 | 2721755514 | Bacteria | 6424414 |
| 762 | 2723025308 | 2721755556 | Bacteria | 6745503 |
| 763 | 2723558893 | 2721755684 | Bacteria | 6859907 |
| 764 | 2723565463 | 2721755685 | Bacteria | 6704835 |
| 765 | 2724036678 | 2721755809 | Bacteria | 6438790 |
| 766 | 2724042970 | 2721755810 | Bacteria | 6479005 |
| 767 | 2724088244 | 2721755819 | Bacteria | 6906405 |
| 768 | 2724102728 | 2721755822 | Bacteria | 6726041 |
| 769 | 2724108624 | 2721755823 | Bacteria | 6752556 |
| 770 | 2725948968 | 2724679232 | Bacteria | 7646494 |
| 771 | 2730106244 | 2728369352 | Bacteria | 6745171 |
| 772 | 2730162781 | 2728369365 | Bacteria | 6555560 |
| 773 | 2730296786 | 2728369397 | Bacteria | 6274511 |
| 774 | 2738710399 | 2738541275 | Bacteria | 4830863 |
| 775 | 2738801266 | 2738541293 | Bacteria | 7065685 |
| 776 | 2738848824 | 2738541301 | Bacteria | 4834102 |
| 777 | 2738864553 | 2738541304 | Bacteria | 4833665 |
| 778 | 2739037048 | 2738541333 | Bacteria | 7106503 |
| 779 | 2739297071 | 2738543022 | Bacteria | 4835059 |
| 780 | 2739358749 | 2738543033 | Bacteria | 4833336 |
| 781 | 2739651111 | 2739367664 | Bacteria | 4114334 |
| 782 | 2740029584 | 2739367865 | Bacteria | 4114482 |
| 783 | 2766066592 | 2765235942 | Bacteria | 7445910 |
| 784 | 2770199497 | 2767802442 | Bacteria | 5747986 |
| 785 | 2776267965 | 2775506902 | Bacteria | 6208009 |
| 786 | 2776268167 | 2775506902 | Bacteria | 6208009 |
| 787 | 2776281939 | 2775506904 | Bacteria | 5954060 |
| 788 | 2776283992 | 2775506904 | Bacteria | 5954060 |
| 789 | 2792580500 | 2791355082 | Bacteria | 5973319 |
| 790 | 2793295235 | 2791355256 | Bacteria | 6798008 |
| 791 | 2793316355 | 2791355259 | Bacteria | 7254731 |
| 792 | 2793323413 | 2791355260 | Bacteria | 6598818 |
| 793 | 2793324779 | 2791355260 | Bacteria | 6598818 |
| 794 | 2793326193 | 2791355261 | Bacteria | 6661293 |
| 795 | 2793334253 | 2791355262 | Bacteria | 6774204 |
| 796 | 2793341831 | 2791355263 | Bacteria | 6872478 |
| 797 | 2793348168 | 2791355264 | Bacteria | 6429314 |
| 798 | 2793361537 | 2791355266 | Bacteria | 7116587 |
| 799 | 2793364649 | 2791355267 | Bacteria | 7222458 |
| 800 | 2805929344 | 2802429605 | Bacteria | 6875453 |
| 801 | 2805932397 | 2802429606 | Bacteria | 6346811 |
| 802 | 2806047570 | 2802429633 | Bacteria | 7341974 |
| 803 | 2806054989 | 2802429634 | Bacteria | 7083200 |
| 804 | 2806062109 | 2802429635 | Bacteria | 7650140 |
| 805 | 2806067165 | 2802429636 | Bacteria | 7597525 |
| 806 | 2806076486 | 2802429637 | Bacteria | 7067217 |
| 807 | 2808990109 | 2808606387 | Bacteria | 5697198 |
| 808 | 2819245294 | 2818991272 | Bacteria | 4622173 |
| 809 | 2819608434 | 2818991448 | Bacteria | 6772224 |
| 810 | 2819612398 | 2818991448 | Bacteria | 6772224 |
| 811 | 2821123617 | 2821123053 | Bacteria | 7836056 |
| 812 | 2821446575 | 2821443989 | Bacteria | 7658172 |
| 813 | 2838020257 | 2838016132 | Bacteria | 6577831 |
| 814 | 2838025776 | 2838022645 | Bacteria | 6494267 |
| 815 | 2838031872 | 2838029111 | Bacteria | 6603031 |
| 816 | 2838037104 | 2838035591 | Bacteria | 7166484 |
| 817 | 2838044454 | 2838042994 | Bacteria | 6046894 |
| 818 | 2838051527 | 2838048938 | Bacteria | 6044578 |
| 819 | 2838064002 | 2838061910 | Bacteria | 6794874 |
| 820 | 2838071083 | 2838068647 | Bacteria | 6208656 |
| 821 | 2838663720 | 2838661181 | Bacteria | 7385261 |
| 822 | 2838672422 | 2838668709 | Bacteria | 6671819 |
| 823 | 2838680557 | 2838680041 | Bacteria | 6545511 |
| 824 | 2838691610 | 2838686498 | Bacteria | 7807632 |
| 825 | 2838695410 | 2838694306 | Bacteria | 6853137 |
| 826 | 2838703836 | 2838701080 | Bacteria | 6669771 |
| 827 | 2838708787 | 2838707686 | Bacteria | 6619912 |
| 828 | 2838733906 | 2838729681 | Bacteria | 7400765 |
| 829 | 2838739349 | 2838736955 | Bacteria | 5760694 |
| 830 | 2838747030 | 2838742623 | Bacteria | 7396178 |
| 831 | 2841843247 | 2841840854 | Bacteria | 5761912 |
| 832 | 2841856171 | 2841851746 | Bacteria | 7532261 |
| 833 | 2841866840 | 2841864319 | Bacteria | 6742987 |
| 834 | 2842079978 | 2842077413 | Bacteria | 6508645 |
| 835 | 2842112182 | 2842110456 | Bacteria | 7656360 |
| 836 | 2842120597 | 2842118031 | Bacteria | 7033875 |
| 837 | 2842143029 | 2842140634 | Bacteria | 5759631 |
| 838 | 2842148372 | 2842146304 | Bacteria | 5957337 |
| 839 | 2842161959 | 2842156927 | Bacteria | 6894975 |
| 840 | 2842169665 | 2842163707 | Bacteria | 6916235 |
| 841 | 2842185801 | 2842180545 | Bacteria | 6888678 |
| 842 | 2842192858 | 2842192696 | Bacteria | 6147454 |
| 843 | 2842202927 | 2842198810 | Bacteria | 6608673 |
| 844 | 2842206979 | 2842205361 | Bacteria | 6340321 |
| 845 | 2842218822 | 2842217011 | Bacteria | 7497767 |
| 846 | 2842235329 | 2842229732 | Bacteria | 7475766 |
| 847 | 2842238198 | 2842237096 | Bacteria | 6620661 |
| 848 | 2842248216 | 2842243621 | Bacteria | 7421798 |
| 849 | 2842253438 | 2842250916 | Bacteria | 6579627 |
| 850 | 2842262190 | 2842257432 | Bacteria | 7401195 |
| 851 | 2842268789 | 2842264693 | Bacteria | 6472963 |
| 852 | 2842276583 | 2842271015 | Bacteria | 7807131 |
| 853 | 2842280328 | 2842278818 | Bacteria | 6340002 |
| 854 | 2842286810 | 2842285085 | Bacteria | 6011953 |
| 855 | 2842293639 | 2842291075 | Bacteria | 7076806 |
| 856 | 2842306529 | 2842304105 | Bacteria | 7023636 |
| 857 | 2842312649 | 2842311132 | Bacteria | 6616990 |
| 858 | 2842322486 | 2842317721 | Bacteria | 6793725 |
| 859 | 2842343102 | 2842341865 | Bacteria | 7003929 |
| 860 | 2842367173 | 2842363717 | Bacteria | 6844742 |
| 861 | 2842371020 | 2842370503 | Bacteria | 7038661 |
| 862 | 2842380036 | 2842377471 | Bacteria | 7140707 |
| 863 | 2842387107 | 2842384541 | Bacteria | 7057858 |
| 864 | 2842399220 | 2842395702 | Bacteria | 6780583 |
| 865 | 2842403637 | 2842402390 | Bacteria | 6681310 |
| 866 | 2842410661 | 2842409023 | Bacteria | 6687331 |
| 867 | 2842417307 | 2842415677 | Bacteria | 6596907 |
| 868 | 2842424699 | 2842422224 | Bacteria | 6239196 |
| 869 | 2842433011 | 2842428310 | Bacteria | 6767288 |
| 870 | 2842439316 | 2842434925 | Bacteria | 6502746 |
| 871 | 2842445945 | 2842441272 | Bacteria | 6769273 |
| 872 | 2842451874 | 2842447887 | Bacteria | 6754142 |
| 873 | 2842467131 | 2842462802 | Bacteria | 6588055 |
| 874 | 2842473841 | 2842469257 | Bacteria | 6752936 |
| 875 | 2842476252 | 2842475841 | Bacteria | 6603183 |
| 876 | 2842478604 | 2842475841 | Bacteria | 6603183 |
| 877 | 2842492488 | 2842489311 | Bacteria | 6620893 |
| 878 | 2842500068 | 2842495871 | Bacteria | 6820686 |
| 879 | 2842502846 | 2842502639 | Bacteria | 6604161 |
| 880 | 2842505451 | 2842502639 | Bacteria | 6604161 |
| 881 | 2842509179 | 2842509118 | Bacteria | 6850950 |
| 882 | 2842513658 | 2842509118 | Bacteria | 6850950 |
| 883 | 2842521674 | 2842521101 | Bacteria | 6569494 |
| 884 | 2842526600 | 2842521101 | Bacteria | 6569494 |
| 885 | 2842923294 | 2842922631 | Bacteria | 5824079 |
| 886 | 2844170779 | 2844163670 | Bacteria | 7266046 |
| 887 | 2844456019 | 2844454524 | Bacteria | 7952546 |
| 888 | 2844536556 | 2844533157 | Bacteria | 7517899 |
| 889 | 2852388454 | 2852387548 | Bacteria | 8025568 |
| 890 | 2852392779 | 2852387548 | Bacteria | 8025568 |
| 891 | 2852393100 | 2852387548 | Bacteria | 8025568 |
| 892 | 2855827592 | 2855825444 | Bacteria | 6785811 |
| 893 | 2855842967 | 2855839649 | Bacteria | 7135830 |
| 894 | 2857523467 | 2857516855 | Bacteria | 7787325 |
| 895 | 2857531181 | 2857531043 | Bacteria | 6754041 |
| 896 | 2858801923 | 2858800743 | Bacteria | 6603254 |
| 897 | 2888349715 | 2888343758 | Bacteria | 6611049 |
| 898 | 2891374960 | 2891373044 | Bacteria | 5202277 |
| 899 | 2896385701 | 2896384573 | Bacteria | 7700774 |
| 900 | 2899805294 | 2899803654 | Bacteria | 5577784 |
| 901 | 2915992355 | 2915986958 | Bacteria | 6739310 |
| 902 | 2915994404 | 2915993759 | Bacteria | 7016183 |
| 903 | 2916002857 | 2916000859 | Bacteria | 6865702 |
| 904 | 2916011265 | 2916007675 | Bacteria | 6898660 |
| 905 | 2916018715 | 2916014648 | Bacteria | 6946486 |
| 906 | 2916025375 | 2916021584 | Bacteria | 6854472 |
| 907 | 2916035040 | 2916028427 | Bacteria | 6748433 |
| 908 | 2916038082 | 2916035215 | Bacteria | 6755766 |
| 909 | 2916048139 | 2916041962 | Bacteria | 6820487 |
| 910 | 2916054299 | 2916048683 | Bacteria | 6543552 |
| 911 | 2916061042 | 2916055098 | Bacteria | 6758838 |
| 912 | 2916071658 | 2916068649 | Bacteria | 6943657 |
| 913 | 2916082703 | 2916076590 | Bacteria | 6596108 |
| 914 | 2919101376 | 2919100787 | Bacteria | 7710546 |
| 915 | 2919102851 | 2919100787 | Bacteria | 7710546 |
| 916 | 2919172113 | 2919171160 | Bacteria | 6499771 |
| 917 | 2919408773 | 2919408235 | Bacteria | 6149349 |
| 918 | 2920762042 | 2920760137 | Bacteria | 7427611 |
| 919 | 2921208448 | 2921201388 | Bacteria | 6926299 |
| 920 | 2921211276 | 2921208531 | Bacteria | 6745326 |
| 921 | 2921241176 | 2921237296 | Bacteria | 6876710 |
| 922 | 2921250311 | 2921244191 | Bacteria | 6568419 |
| 923 | 2921258656 | 2921257292 | Bacteria | 6808382 |
| 924 | 2921263399 | 2921257292 | Bacteria | 6808382 |
| 925 | 2921270148 | 2921263974 | Bacteria | 6864552 |
| 926 | 2921285296 | 2921282425 | Bacteria | 6826397 |
| 927 | 2921293386 | 2921289301 | Bacteria | 7316391 |
| 928 | 2921302760 | 2921296804 | Bacteria | 7176999 |
| 929 | 2923557118 | 2923556063 | Bacteria | 6793593 |
| 930 | 2924147878 | 2924144063 | Bacteria | 6883928 |
| 931 | 2924151340 | 2924150972 | Bacteria | 7169444 |
| 932 | 2924164793 | 2924158325 | Bacteria | 7188855 |
| 933 | 2924166444 | 2924165586 | Bacteria | 7260590 |
| 934 | 2924179218 | 2924172951 | Bacteria | 6749356 |
| 935 | 2924180520 | 2924179722 | Bacteria | 6843264 |
| 936 | 2924193296 | 2924186466 | Bacteria | 6876637 |
| 937 | 2924196320 | 2924193448 | Bacteria | 6955718 |
| 938 | 2924203964 | 2924200457 | Bacteria | 6757188 |
| 939 | 2924210630 | 2924207177 | Bacteria | 6917007 |
| 940 | 2924215933 | 2924214083 | Bacteria | 7080103 |
| 941 | 2924225582 | 2924221636 | Bacteria | 7113495 |
| 942 | 2924232360 | 2924228884 | Bacteria | 6633132 |
| 943 | 2928100497 | 2928100450 | Bacteria | 4837635 |
| 944 | 2928960561 | 2928959182 | Bacteria | 4725774 |
| 945 | 2933020918 | 2933016740 | Bacteria | 6355406 |
| 946 | 2933573598 | 2933570622 | Bacteria | 7023390 |
| 947 | 2933587511 | 2933586486 | Bacteria | 7667493 |
| 948 | 2933601882 | 2933599457 | Bacteria | 5858799 |
| 949 | 2935895934 | 2935894831 | Bacteria | 6620579 |
| 950 | 2935907192 | 2935901341 | Bacteria | 7341747 |
| 951 | 2936368956 | 2936367885 | Bacteria | 7324495 |
| 952 | 2936378428 | 2936375103 | Bacteria | 6652732 |
| 953 | 2936383716 | 2936381700 | Bacteria | 7006523 |
| 954 | 2936998887 | 2936996657 | Bacteria | 6298727 |
| 955 | 2937007097 | 2937002841 | Bacteria | 6934057 |
| 956 | 2937013230 | 2937009748 | Bacteria | 6746052 |
| 957 | 2937019920 | 2937016420 | Bacteria | 6782579 |
| 958 | 2937028310 | 2937023124 | Bacteria | 6815156 |
| 959 | 2937028777 | 2937023124 | Bacteria | 6815156 |
| 960 | 2937049438 | 2937042894 | Bacteria | 6741576 |
| 961 | 2937053124 | 2937049772 | Bacteria | 6757901 |
| 962 | 2937063767 | 2937056579 | Bacteria | 7107896 |
| 963 | 2937065674 | 2937063883 | Bacteria | 7199456 |
| 964 | 2937075721 | 2937071275 | Bacteria | 6984483 |
| 965 | 2937092482 | 2937091812 | Bacteria | 6979387 |
| 966 | 2937099302 | 2937098957 | Bacteria | 7249374 |
| 967 | 2937111164 | 2937106411 | Bacteria | 6947143 |
| 968 | 2937115911 | 2937113482 | Bacteria | 6505872 |
| 969 | 2937123545 | 2937119839 | Bacteria | 6597547 |
| 970 | 2937129132 | 2937126314 | Bacteria | 6771275 |
| 971 | 2941500736 | 2941499720 | Bacteria | 7599444 |
| 972 | 2957386294 | 2957382221 | Bacteria | 6737050 |
| 973 | 2957392645 | 2957388812 | Bacteria | 6778072 |
| 974 | 2957396118 | 2957395598 | Bacteria | 6822399 |
| 975 | 2957402081 | 2957395598 | Bacteria | 6822399 |
| 976 | 2957404929 | 2957402308 | Bacteria | 6741770 |
| 977 | 2957411970 | 2957408893 | Bacteria | 6558585 |
| 978 | 2957417108 | 2957415311 | Bacteria | 6991633 |
| 979 | 2957427954 | 2957422303 | Bacteria | 7172205 |
| 980 | 2957433036 | 2957430029 | Bacteria | 7022557 |
| 981 | 2957457560 | 2957450854 | Bacteria | 6765715 |
| 982 | 2957461170 | 2957457609 | Bacteria | 6967680 |
| 983 | 2957467654 | 2957464669 | Bacteria | 6568877 |
| 984 | 2957477414 | 2957471148 | Bacteria | 6797643 |
| 985 | 2957483923 | 2957478035 | Bacteria | 6756658 |
| 986 | 2957486947 | 2957484790 | Bacteria | 6703082 |
| 987 | 2957493817 | 2957491536 | Bacteria | 6695180 |
| 988 | 2957502297 | 2957498199 | Bacteria | 7126688 |
| 989 | 2957511610 | 2957505466 | Bacteria | 7253085 |
| 990 | 2960587168 | 2960584000 | Bacteria | 6864594 |
| 991 | 2960602448 | 2960597568 | Bacteria | 6550735 |
| 992 | 2960608135 | 2960603979 | Bacteria | 6898737 |
| 993 | 2960616625 | 2960610863 | Bacteria | 6691244 |
| 994 | 2960630701 | 2960624210 | Bacteria | 6875384 |
| 995 | 2960638695 | 2960637947 | Bacteria | 7296468 |
| 996 | 2960652661 | 2960645483 | Bacteria | 7211087 |
| 997 | 2960653766 | 2960652885 | Bacteria | 7083688 |
| 998 | 2960671357 | 2960667422 | Bacteria | 6763020 |
| 999 | 2960678067 | 2960674078 | Bacteria | 6609048 |
| 1000 | 2960693414 | 2960687367 | Bacteria | 6535474 |
| 1001 | 2964615271 | 2964607997 | Bacteria | 7101408 |
| 1002 | 2964616713 | 2964615318 | Bacteria | 6809089 |
| 1003 | 2964621128 | 2964615318 | Bacteria | 6809089 |
| 1004 | 2964625382 | 2964621998 | Bacteria | 6834995 |
| 1005 | 2964632016 | 2964628898 | Bacteria | 7083044 |
| 1006 | 2964642799 | 2964636051 | Bacteria | 7091832 |
| 1007 | 2964647337 | 2964643177 | Bacteria | 6820887 |
| 1008 | 2964653711 | 2964649959 | Bacteria | 6675118 |
| 1009 | 2964658038 | 2964656573 | Bacteria | 7100150 |
| 1010 | 2964667397 | 2964663802 | Bacteria | 7019362 |
| 1011 | 2964677761 | 2964670856 | Bacteria | 6851364 |
| 1012 | 2964678353 | 2964678106 | Bacteria | 6792020 |
| 1013 | 2964687788 | 2964685014 | Bacteria | 6839111 |
| 1014 | 2964695753 | 2964691889 | Bacteria | 6802758 |
| 1015 | 2964705024 | 2964698721 | Bacteria | 6765331 |
| 1016 | 2964708113 | 2964705432 | Bacteria | 7114648 |
| 1017 | 2964718922 | 2964712639 | Bacteria | 6695970 |
| 1018 | 2964722549 | 2964719344 | Bacteria | 7286602 |
| 1019 | 2967666019 | 2967664464 | Bacteria | 6948836 |
| 1020 | 2967675259 | 2967671571 | Bacteria | 7021409 |
| 1021 | 2967679211 | 2967678726 | Bacteria | 7264382 |
| 1022 | 2967695789 | 2967693043 | Bacteria | 6804451 |
| 1023 | 2967700250 | 2967699805 | Bacteria | 6854538 |
| 1024 | 2967707303 | 2967706974 | Bacteria | 7186053 |
| 1025 | 2967720700 | 2967714385 | Bacteria | 7000047 |
| 1026 | 2967721821 | 2967721400 | Bacteria | 7073753 |
| 1027 | 2967738550 | 2967735183 | Bacteria | 6827012 |
| 1028 | 2967748509 | 2967742019 | Bacteria | 6794534 |
| 1029 | 2967752921 | 2967748971 | Bacteria | 6733771 |
| 1030 | 2967756959 | 2967755722 | Bacteria | 6814706 |
| 1031 | 2967761975 | 2967755722 | Bacteria | 6814706 |
| 1032 | 2967765298 | 2967762386 | Bacteria | 6923502 |
| 1033 | 2967772998 | 2967769361 | Bacteria | 6587838 |
| 1034 | 2967782695 | 2967775926 | Bacteria | 6738189 |
| 1035 | 2970020194 | 2970019648 | Bacteria | 7072033 |
| 1036 | 2970038065 | 2970033650 | Bacteria | 7118744 |
| 1037 | 2970044412 | 2970040964 | Bacteria | 6731123 |
| 1038 | 2970054319 | 2970047711 | Bacteria | 7088379 |
| 1039 | 2970059098 | 2970054988 | Bacteria | 6611507 |
| 1040 | 2970068076 | 2970061556 | Bacteria | 7099761 |
| 1041 | 2970074293 | 2970068827 | Bacteria | 7123112 |
| 1042 | 2970082013 | 2970076120 | Bacteria | 6697332 |
| 1043 | 2970087675 | 2970082768 | Bacteria | 6183754 |
| 1044 | 2970092099 | 2970088815 | Bacteria | 6933825 |
| 1045 | 2970097822 | 2970095765 | Bacteria | 6936963 |
| 1046 | 2970103293 | 2970102677 | Bacteria | 6812532 |
| 1047 | 2970107799 | 2970102677 | Bacteria | 6812532 |
| 1048 | 2970111829 | 2970109326 | Bacteria | 6863976 |
| 1049 | 2970116912 | 2970116247 | Bacteria | 6501857 |
| 1050 | 2970132235 | 2970129317 | Bacteria | 6806560 |
| 1051 | 2970137710 | 2970136068 | Bacteria | 7207982 |
| 1052 | 2970153729 | 2970149975 | Bacteria | 6779706 |
| 1053 | 2970163492 | 2970156795 | Bacteria | 7168044 |
| 1054 | 2970168556 | 2970164137 | Bacteria | 6861252 |
| 1055 | 2970177655 | 2970170962 | Bacteria | 6876229 |
| 1056 | 2970184409 | 2970177841 | Bacteria | 6768001 |
| 1057 | 2970185326 | 2970184632 | Bacteria | 7054431 |
| 1058 | 2970195910 | 2970191845 | Bacteria | 7032787 |
| 1059 | 2977523502 | 2977516862 | Bacteria | 6940108 |
| 1060 | 2977525717 | 2977523885 | Bacteria | 6960446 |
| 1061 | 2977540657 | 2977537788 | Bacteria | 6929320 |
| 1062 | 2977558259 | 2977551784 | Bacteria | 7125765 |
| 1063 | 2977562111 | 2977558990 | Bacteria | 6863948 |
| 1064 | 2977568720 | 2977565890 | Bacteria | 6901543 |
| 1065 | 2977576750 | 2977572785 | Bacteria | 6763888 |
| 1066 | 2977582526 | 2977579622 | Bacteria | 6772100 |
| 1067 | 2987652774 | 2987652177 | Bacteria | 6969023 |
| 1068 | 2989351435 | 2989349275 | Bacteria | 6349068 |
| 1069 | 2989772765 | 2989771324 | Bacteria | 5605128 |
| 1070 | 2989777394 | 2989776772 | Bacteria | 4843317 |
| 1071 | 2996888487 | 2996887358 | Bacteria | 5795980 |
| 1072 | 2996893406 | 2996893221 | Bacteria | 5823108 |
| 1073 | 3000867205 | 3000865235 | Bacteria | 3106258 |
| 1074 | 3003931927 | 3003930520 | Bacteria | 5667563 |
| 1075 | 3005411205 | 3005409236 | Bacteria | 7188837 |
| 1076 | 3005418205 | 3005416602 | Bacteria | 7064308 |
| 1077 | 3005422834 | 3005416602 | Bacteria | 7064308 |
| 1078 | 3005446156 | 3005445848 | Bacteria | 6906074 |
| 1079 | 3005451879 | 3005445848 | Bacteria | 6906074 |
| 1080 | 3005452815 | 3005452660 | Bacteria | 5889319 |
| 1081 | 3005457188 | 3005452660 | Bacteria | 5889319 |
| 1082 | 639646621 | 639633055 | Bacteria | 7751309 |
| 1083 | 648740415 | 648276728 | Bacteria | 6968865 |
| 1084 | 8003995547 | 8003992118 | Bacteria | 7266902 |
| 1085 | 8005247418 | 8005246636 | Bacteria | 4933972 |
| 1086 | 8005263451 | 8005258706 | Bacteria | 6184835 |
| 1087 | 8005278809 | 8005275841 | Bacteria | 6929066 |
| 1088 | 8005289037 | 8005282627 | Bacteria | 6675747 |
| 1089 | 8005289383 | 8005289223 | Bacteria | 6634003 |
| 1090 | 8005291111 | 8005289223 | Bacteria | 6634003 |
| 1091 | 8005301522 | 8005301065 | Bacteria | 6614431 |
| 1092 | 8005305284 | 8005301065 | Bacteria | 6614431 |
| 1093 | 8005309222 | 8005307578 | Bacteria | 7395396 |
| 1094 | 8005316155 | 8005314921 | Bacteria | 7072929 |
| 1095 | 8005321630 | 8005314921 | Bacteria | 7072929 |
| 1096 | 8005323014 | 8005321885 | Bacteria | 5795980 |
| 1097 | 8005377462 | 8005376324 | Bacteria | 6590079 |
| 1098 | 8005387325 | 8005382845 | Bacteria | 6732062 |
| 1099 | 8005400098 | 8005395548 | Bacteria | 6806915 |
| 1100 | 8005432903 | 8005430974 | Bacteria | 6689030 |
| 1101 | 8005460981 | 8005460587 | Bacteria | 7157962 |
| 1102 | 8005484922 | 8005484373 | Bacteria | 6297373 |
| 1103 | 8005488171 | 8005484373 | Bacteria | 6297373 |
| 1104 | 8005498633 | 8005497431 | Bacteria | 6477605 |
| 1105 | 8005543743 | 8005542996 | Bacteria | 7077758 |
| 1106 | 8005560594 | 8005556819 | Bacteria | 6908598 |
| 1107 | 8005563947 | 8005563573 | Bacteria | 7153261 |
| 1108 | 8005576893 | 8005570704 | Bacteria | 6957481 |
| 1109 | 8005619825 | 8005619151 | Bacteria | 7030230 |
| 1110 | 8005628397 | 8005626139 | Bacteria | 6534237 |
| 1111 | 8005650119 | 8005645114 | Bacteria | 6950293 |
| 1112 | 8005670044 | 8005668836 | Bacteria | 6953162 |
| 1113 | 8005689306 | 8005688590 | Bacteria | 6610080 |
| 1114 | 8005690238 | 8005688590 | Bacteria | 6610080 |
| 1115 | 8005699282 | 8005695170 | Bacteria | 6912330 |
| 1116 | 8018133096 | 8018127388 | Bacteria | 7351159 |
| 1117 | 8018168996 | 8018163183 | Bacteria | 7277977 |
| 1118 | 8018179485 | 8018176218 | Bacteria | 6896178 |
| 1119 | 8023684269 | 8023680758 | Bacteria | 7729763 |
| 1120 | 8024480248 | 8024479707 | Bacteria | 6954785 |
| 1121 | 8024491439 | 8024486573 | Bacteria | 6540512 |
| 1122 | 8024501631 | 8024501048 | Bacteria | 6427847 |
| 1123 | 8049297407 | 8049293176 | Bacteria | 6128433 |
| 1124 | 8055436167 | 8055431914 | Bacteria | 4551896 |
| 1125 | 8056375606 | 8056375014 | Bacteria | 7006639 |
| 1126 | 8056385920 | 8056382006 | Bacteria | 6408074 |
| 1127 | 8057876020 | 8057874678 | Bacteria | 7494653 |
| 1128 | Ga0070669_100088896 | |||
| 1129 | JGI24740J21852_10005355 | |||
| 1130 | JGI24739J22299_10008673 | |||
| 1131 | JGI24737J22298_10001181 | |||
| 1132 | JGI24735J21928_10005736 | |||
| 1133 | JGI25155J39150_1000023 | |||
| 1134 | JGI25156J39149_1000029 | |||
| 1135 | JGI25154J39366_1000067 | |||
| 1136 | JGI25158J39367_1000337 | |||
| 1137 | JGI25157J39369_1000043 | |||
| 1138 | JGI25152J39213_1000622 | |||
| 1139 | JGI25152J39213_1001653 | |||
| 1140 | JGI25150J39212_1000012 | |||
| 1141 | JGI25159J45721_1000016 | |||
| 1142 | JGI25159J45721_1000234 | |||
| 1143 | JGI25151J46595_10000025 | |||
| 1144 | JGI25151J46595_10000346 | |||
| 1145 | JGI25151J46595_10004241 | |||
| 1146 | JGI25151J46595_10027315 | |||
| 1147 | JGI25153J46596_10005707 | |||
| 1148 | JGI25153J46596_10045475 | |||
| 1149 | JGI25160J50197_1000002 | |||
| 1150 | JGI25160J50197_1000500 | |||
| 1151 | JGI25160J50197_1007740 | |||
| 1152 | JGI25161J50226_1000323 | |||
| 1153 | JGI25161J50226_1000382 | |||
| 1154 | JGI25161J50226_1003889 | |||
| 1155 | Ga0055526_1000624 | |||
| 1156 | Ga0055526_1006023 | |||
| 1157 | Ga0055526_1011604 | |||
| 1158 | Ga0055526_1014014 | |||
| 1159 | Ga0055526_1015721 | |||
| 1160 | Ga0055524_1001892 | |||
| 1161 | Ga0055524_1004600 | |||
| 1162 | Ga0055524_1013212 | |||
| 1163 | Ga0055524_1020811 | |||
| 1164 | Ga0055536_1002390 | |||
| 1165 | Ga0055528_1000137 | |||
| 1166 | Ga0055528_1000303 | |||
| 1167 | Ga0055528_1001607 | |||
| 1168 | Ga0055528_1012661 | |||
| 1169 | Ga0055528_1025258 | |||
| 1170 | Ga0055530_10015082 | |||
| 1171 | Ga0055540_1001855 | |||
| 1172 | Ga0055540_1002138 | |||
| 1173 | Ga0055540_1002362 | |||
| 1174 | Ga0055531_10001338 | |||
| 1175 | Ga0055531_10003792 | |||
| 1176 | Ga0055543_1000008 | |||
| 1177 | Ga0055543_1000022 | |||
| 1178 | Ga0055543_1000046 | |||
| 1179 | Ga0055543_1000141 | |||
| 1180 | Ga0055543_1002287 | |||
| 1181 | Ga0065165_1000031 | |||
| 1182 | Ga0065165_1000058 | |||
| 1183 | Ga0065165_1000175 | |||
| 1184 | Ga0065165_1004542 | |||
| 1185 | Ga0065165_1008189 | |||
| 1186 | Ga0065165_1029847 | |||
| 1187 | Ga0065704_10004143 | |||
| 1188 | Ga0070658_10000022 | |||
| 1189 | Ga0070658_10000304 | |||
| 1190 | Ga0070658_10333942 | |||
| 1191 | Ga0070670_100129173 | |||
| 1192 | Ga0070670_100257930 | |||
| 1193 | Ga0070666_10014916 | |||
| 1194 | Ga0070666_10127988 | |||
| 1195 | Ga0070666_10374711 | |||
| 1196 | Ga0070660_100009089 | |||
| 1197 | Ga0070660_100059159 | |||
| 1198 | Ga0070689_100117682 | |||
| 1199 | Ga0070661_100280743 | |||
| 1200 | Ga0070668_100018871 | |||
| 1201 | Ga0070668_100078075 | |||
| 1202 | Ga0070669_100000470 | |||
| 1203 | Ga0070669_100001664 | |||
| 1204 | Ga0070671_100000480 | |||
| 1205 | Ga0070671_100000845 | |||
| 1206 | Ga0070667_100003664 | |||
| 1207 | Ga0070667_100038587 | |||
| 1208 | Ga0070711_100047092 | |||
| 1209 | Ga0070705_100093227 | |||
| 1210 | Ga0070708_100533892 | |||
| 1211 | Ga0070663_100010764 | |||
| 1212 | Ga0070663_100121808 | |||
| 1213 | Ga0070678_100074328 | |||
| 1214 | Ga0070698_100562578 | |||
| 1215 | Ga0068853_100142436 | |||
| 1216 | Ga0068853_100283786 | |||
| 1217 | Ga0070686_100057706 | |||
| 1218 | Ga0070665_100000079 | |||
| 1219 | Ga0070665_100007174 | |||
| 1220 | Ga0070665_100069335 | |||
| 1221 | Ga0070665_100244589 | |||
| 1222 | Ga0070665_100708593 | |||
| 1223 | Ga0070704_100184020 | |||
| 1224 | Ga0068855_100001164 | |||
| 1225 | Ga0068855_100012273 | |||
| 1226 | Ga0068857_100045267 | |||
| 1227 | Ga0068854_100001776 | |||
| 1228 | Ga0068854_100047329 | |||
| 1229 | Ga0068854_100090117 | |||
| 1230 | Ga0068856_100088241 | |||
| 1231 | Ga0068852_100000357 | |||
| 1232 | Ga0068852_100122683 | |||
| 1233 | Ga0068859_100012881 | |||
| 1234 | Ga0068859_100031806 | |||
| 1235 | Ga0068864_100008530 | |||
| 1236 | Ga0068863_100000103 | |||
| 1237 | Ga0068858_100001349 | |||
| 1238 | Ga0068858_100016792 | |||
| 1239 | Ga0068858_100023512 | |||
| 1240 | Ga0068858_100040602 | |||
| 1241 | Ga0068860_100000093 | |||
| 1242 | Ga0068862_100024495 | |||
| 1243 | Ga0068862_100408680 | |||
| 1244 | Ga0081455_10042227 | |||
| 1245 | Ga0081455_10063732 | |||
| 1246 | Ga0081538_10001207 | |||
| 1247 | Ga0081538_10089373 | |||
| 1248 | Ga0075365_10004118 | |||
| 1249 | Ga0075365_10007525 | |||
| 1250 | Ga0075365_10054188 | |||
| 1251 | Ga0075365_10063111 | |||
| 1252 | Ga0075365_10105120 | |||
| 1253 | Ga0075363_100060745 | |||
| 1254 | Ga0070716_100132228 | |||
| 1255 | Ga0070712_100003467 | |||
| 1256 | Ga0075362_10000728 | |||
| 1257 | Ga0075362_10009130 | |||
| 1258 | Ga0075367_10061193 | |||
| 1259 | Ga0075367_10142283 | |||
| 1260 | Ga0075369_10008880 | |||
| 1261 | Ga0075369_10029915 | |||
| 1262 | Ga0075369_10035252 | |||
| 1263 | Ga0075366_10000192 | |||
| 1264 | Ga0097621_100112786 | |||
| 1265 | Ga0075370_10000015 | |||
| 1266 | Ga0075433_10063700 | |||
| 1267 | Ga0075434_100021327 | |||
| 1268 | Ga0097620_100012881 | |||
| 1269 | Ga0097620_100031806 | |||
| 1270 | Ga0099822_1047390 | |||
| 1271 | Ga0079104_1000069 | |||
| 1272 | Ga0075435_100070211 | |||
| 1273 | Ga0105251_10000232 | |||
| 1274 | Ga0105251_10033414 | |||
| 1275 | Ga0105240_10035774 | |||
| 1276 | Ga0105240_10108042 | |||
| 1277 | Ga0105245_10096781 | |||
| 1278 | Ga0105247_10053619 | |||
| 1279 | Ga0114129_10668261 | |||
| 1280 | Ga0105243_10570893 | |||
| 1281 | Ga0105242_10326049 | |||
| 1282 | Ga0105248_10024368 | |||
| 1283 | Ga0105248_10091196 | |||
| 1284 | Ga0105237_10005695 | |||
| 1285 | Ga0105249_10302920 | |||
| 1286 | Ga0105249_10553474 | |||
| 1287 | Ga0123340_1032850 | |||
| 1288 | Ga0123341_1000192 | |||
| 1289 | Ga0123341_1068856 | |||
| 1290 | Ga0123342_1011318 | |||
| 1291 | Ga0123342_1017436 | |||
| 1292 | Ga0105239_10000271 | |||
| 1293 | Ga0105239_10147014 | |||
| 1294 | Ga0105246_10156264 | |||
| 1295 | Ga0157369_10276980 | |||
| 1296 | Ga0163162_10009970 | |||
| 1297 | Ga0163162_10088278 | |||
| 1298 | Ga0163162_10183231 | |||
| 1299 | Ga0163162_10578988 | |||
| 1300 | Ga0157372_10093707 | |||
| 1301 | Ga0157375_10642267 | |||
| 1302 | Ga0163163_10153611 | |||
| 1303 | Ga0157379_10152633 | |||
| 1304 | Ga0163161_10095125 | |||
| 1305 | Ga0214542_1001787 | |||
| 1306 | Ga0214543_1001073 | |||
| 1307 | Ga0209435_100011 | |||
| 1308 | Ga0209436_100051 | |||
| 1309 | Ga0209436_100142 | |||
| 1310 | Ga0207425_1000012 | |||
| 1311 | Ga0207425_1003170 | |||
| 1312 | Ga0207425_1010785 | |||
| 1313 | Ga0209646_1000024 | |||
| 1314 | Ga0209026_1000030 | |||
| 1315 | Ga0209759_1000011 | |||
| 1316 | Ga0209129_1000081 | |||
| 1317 | Ga0209129_1000123 | |||
| 1318 | Ga0209129_1000545 | |||
| 1319 | Ga0209129_1001854 | |||
| 1320 | Ga0209129_1009580 | |||
| 1321 | Ga0209673_1000015 | |||
| 1322 | Ga0209673_1000023 | |||
| 1323 | Ga0209673_1000704 | |||
| 1324 | Ga0209673_1000999 | |||
| 1325 | Ga0209673_1001868 | |||
| 1326 | Ga0209673_1009131 | |||
| 1327 | Ga0209673_1015055 | |||
| 1328 | Ga0209673_1017660 | |||
| 1329 | Ga0209673_1021915 | |||
| 1330 | Ga0209130_1000002 | |||
| 1331 | Ga0209130_1000008 | |||
| 1332 | Ga0209130_1000088 | |||
| 1333 | Ga0209130_1000144 | |||
| 1334 | Ga0209130_1025027 | |||
| 1335 | Ga0209676_1023383 | |||
| 1336 | Ga0209025_1000024 | |||
| 1337 | Ga0209025_1000528 | |||
| 1338 | Ga0209025_1000631 | |||
| 1339 | Ga0209025_1000970 | |||
| 1340 | Ga0209025_1001290 | |||
| 1341 | Ga0209025_1004062 | |||
| 1342 | Ga0209025_1008764 | |||
| 1343 | Ga0209025_1008774 | |||
| 1344 | Ga0209025_1020194 | |||
| 1345 | Ga0209564_1000091 | |||
| 1346 | Ga0209564_1000100 | |||
| 1347 | Ga0209564_1000382 | |||
| 1348 | Ga0209564_1000811 | |||
| 1349 | Ga0209564_1001938 | |||
| 1350 | Ga0209564_1021333 | |||
| 1351 | Ga0209758_1000046 | |||
| 1352 | Ga0209758_1000349 | |||
| 1353 | Ga0209758_1001043 | |||
| 1354 | Ga0209758_1001705 | |||
| 1355 | Ga0209758_1003657 | |||
| 1356 | Ga0209758_1005259 | |||
| 1357 | Ga0209758_1007186 | |||
| 1358 | Ga0209758_1032753 | |||
| 1359 | Ga0209758_1045420 | |||
| 1360 | Ga0209758_1053437 | |||
| 1361 | Ga0209050_1008783 | |||
| 1362 | Ga0209050_1020591 | |||
| 1363 | Ga0209256_1000541 | |||
| 1364 | Ga0209256_1000991 | |||
| 1365 | Ga0209256_1002790 | |||
| 1366 | Ga0209256_1003225 | |||
| 1367 | Ga0209256_1005515 | |||
| 1368 | Ga0209256_1006225 | |||
| 1369 | Ga0209256_1008520 | |||
| 1370 | Ga0207426_1000012 | |||
| 1371 | Ga0207426_1000013 | |||
| 1372 | Ga0207426_1000016 | |||
| 1373 | Ga0207426_1000063 | |||
| 1374 | Ga0207426_1000126 | |||
| 1375 | Ga0207426_1000172 | |||
| 1376 | Ga0207426_1002543 | |||
| 1377 | Ga0209051_1000084 | |||
| 1378 | Ga0209051_1001361 | |||
| 1379 | Ga0209051_1002292 | |||
| 1380 | Ga0209051_1007069 | |||
| 1381 | Ga0209051_1011219 | |||
| 1382 | Ga0209051_1018218 | |||
| 1383 | Ga0209257_1003522 | |||
| 1384 | Ga0209257_1004519 | |||
| 1385 | Ga0209257_1015578 | |||
| 1386 | Ga0209257_1021288 | |||
| 1387 | Ga0207697_10023646 | |||
| 1388 | Ga0207713_1001012 | |||
| 1389 | Ga0207688_10027263 | |||
| 1390 | Ga0207647_10005017 | |||
| 1391 | Ga0207647_10014570 | |||
| 1392 | Ga0207705_10000007 | |||
| 1393 | Ga0207705_10000236 | |||
| 1394 | Ga0207695_10005291 | |||
| 1395 | Ga0207695_10111878 | |||
| 1396 | Ga0207671_10000955 | |||
| 1397 | Ga0207693_10009711 | |||
| 1398 | Ga0207657_10000837 | |||
| 1399 | Ga0207657_10083525 | |||
| 1400 | Ga0207650_10070488 | |||
| 1401 | Ga0207650_10139049 | |||
| 1402 | Ga0207687_10028182 | |||
| 1403 | Ga0207687_10233758 | |||
| 1404 | Ga0207644_10000022 | |||
| 1405 | Ga0207644_10002151 | |||
| 1406 | Ga0207644_10018833 | |||
| 1407 | Ga0207644_10074822 | |||
| 1408 | Ga0207644_10164890 | |||
| 1409 | Ga0207670_10090668 | |||
| 1410 | Ga0207670_10115361 | |||
| 1411 | Ga0207665_10139529 | |||
| 1412 | Ga0207691_10130402 | |||
| 1413 | Ga0207711_10017979 | |||
| 1414 | Ga0207711_10033443 | |||
| 1415 | Ga0207711_10090747 | |||
| 1416 | Ga0207667_10000017 | |||
| 1417 | Ga0207667_10009368 | |||
| 1418 | Ga0207712_10078256 | |||
| 1419 | Ga0207712_10094210 | |||
| 1420 | Ga0207712_10402570 | |||
| 1421 | Ga0207668_10024423 | |||
| 1422 | Ga0207640_10000279 | |||
| 1423 | Ga0207640_10043181 | |||
| 1424 | Ga0207640_10554721 | |||
| 1425 | Ga0207658_10003195 | |||
| 1426 | Ga0207658_10004374 | |||
| 1427 | Ga0207703_10010077 | |||
| 1428 | Ga0207703_10014134 | |||
| 1429 | Ga0207639_10108095 | |||
| 1430 | Ga0207639_10113332 | |||
| 1431 | Ga0207639_10386986 | |||
| 1432 | Ga0207678_10020241 | |||
| 1433 | Ga0207678_10144888 | |||
| 1434 | Ga0207702_10037255 | |||
| 1435 | Ga0207702_10049092 | |||
| 1436 | Ga0207641_10000113 | |||
| 1437 | Ga0207641_10001790 | |||
| 1438 | Ga0207641_10094941 | |||
| 1439 | Ga0207648_10057138 | |||
| 1440 | Ga0207676_10007157 | |||
| 1441 | Ga0207674_10048088 | |||
| 1442 | Ga0207674_10056363 | |||
| 1443 | Ga0207683_10029461 | |||
| 1444 | Ga0207698_10000919 | |||
| 1445 | Ga0207698_10149172 | |||
| 1446 | Ga0209281_1000192 | |||
| 1447 | Ga0209589_1000008 | |||
| 1448 | Ga0268266_10000175 | |||
| 1449 | Ga0268266_10002389 | |||
| 1450 | Ga0268266_10063619 | |||
| 1451 | Ga0268266_10596049 | |||
| 1452 | Ga0268265_10003957 | |||
| 1453 | Ga0268265_10014248 | |||
| 1454 | Ga0268264_10000067 | |||
| 1455 | Ga0268264_10004814 | |||
| 1456 | Ga0268264_10319169 | |||
| 1457 | Ga0307515_10000023 | |||
| 1458 | Ga0307515_10002402 | |||
| 1459 | Ga0307515_10011571 | |||
| 1460 | Ga0307515_10080271 | |||
| 1461 | Ga0307515_10083547 | |||
| 1462 | Ga0265338_10012159 | |||
| 1463 | Ga0307512_10023098 | |||
| 1464 | Ga0307512_10204955 | |||
| 1465 | Ga0265340_10092350 | |||
| 1466 | Ga0265339_10052139 | |||
| 1467 | Ga0265331_10025309 | |||
| 1468 | Ga0307513_10001791 | |||
| 1469 | Ga0307513_10007352 | |||
| 1470 | Ga0307513_10135595 | |||
| 1471 | Ga0307513_10252732 | |||
| 1472 | Ga0307509_10213405 | |||
| 1473 | Ga0307508_10000061 | |||
| 1474 | Ga0307514_10006588 | |||
| 1475 | Ga0265342_10042786 | |||
| 1476 | Ga0307405_10004962 | |||
| 1477 | Ga0316577_10225929 | |||
| 1478 | Ga0307413_10012418 | |||
| 1479 | Ga0307410_10136980 | |||
| 1480 | Ga0307412_10001302 | |||
| 1481 | Ga0307412_10019347 | |||
| 1482 | Ga0307409_100027369 | |||
| 1483 | Ga0307416_100914279 | |||
| 1484 | Ga0307411_10105799 | |||
| 1485 | Ga0307411_10226110 | |||
| 1486 | Ga0307415_100445395 | |||
| 1487 | Ga0307507_10017050 | |||
| 1488 | Ga0307510_10045809 | |||
| 1489 | Ga0316584_0139219 | |||
| 1490 | Ga0373925_0003273 | |||
| 1491 | Ga0395899_0126918 | |||
| 1492 | Ga0395900_0003414 | |||
| 1493 | Ga0395898_0003860 | |||
| 1494 | Ga0395898_0276351 | |||
| 1495 | Ga0395905_0003148 | |||
| 1496 | Ga0395905_0138386 | |||
| 1497 | Ga0395905_0173165 | |||
| 1498 | Ga0395905_0381806 | |||
| 1499 | Ga0395901_0007994 | |||
| 1500 | Ga0395901_0054859 | |||
| 1501 | Ga0395901_0592089 | |||
| 1502 | Ga0439436_0000251 | |||
| 1503 | Ga0439439_0006792 | |||
| 1504 | Ga0439465_0005175 | |||
| 1505 | Ga0439465_0010138 | |||
| 1506 | Ga0439465_0037163 | |||
| 1507 | Ga0451833_0527268 | |||
| 1508 | Ga0451833_1293815 | |||
| 1509 | Ga0451835_0106000 | |||
| 1510 | Ga0451837_0282246 | |||
| 1511 | Ga0451837_1449378 | |||
| 1512 | Ga0451839_0592019 | |||
| 1513 | Ga0451839_0649873 | |||
| 1514 | Ga0451841_0195940 | |||
| 1515 | Ga0451845_0049602 | |||
| 1516 | Ga0451847_0597278 | |||
| 1517 | Ga0451849_0316661 | |||
| 1518 | Ga0451849_0889549 | |||
| 1519 | Ga0451851_0538219 | |||
| 1520 | Ga0451853_2795663 | |||
| 1521 | Ga0451853_3659835 | |||
| 1522 | Ga0439431_0015409 | |||
| 1523 | Ga0439449_0002233 | |||
| 1524 | Ga0450907_008476 | |||
| 1525 | Ga0450918_000904 | |||
| 1526 | Ga0466970_0001455 | |||
| 1527 | Ga0466957_0036844 | |||
| 1528 | Ga0466960_0177554 | |||
| 1529 | Ga0451576_0000017 | |||
| 1530 | Ga0466958_0002666 | |||
| 1531 | Ga0495590_0040444 | |||
| 1532 | Ga0495629_0013845 | |||
| 1533 | Ga0495638_0002127 | |||
| 1534 | Ga0495638_0042581 | |||
| 1535 | Ga0495641_0041407 | |||
| 1536 | Ga0495650_0022100 | |||
| 1537 | Ga0495650_0086174 | |||
| 1538 | Ga0495605_0004255 | |||
| 1539 | Ga0495585_0003512 | |||
| 1540 | Ga0495585_0107138 | |||
| 1541 | Ga0495607_0026276 | |||
| 1542 | Ga0495607_0058173 | |||
| 1543 | Ga0495583_0000729 | |||
| 1544 | Ga0495583_0038500 | |||
| 1545 | Ga0495606_0028304 | |||
| 1546 | Ga0495606_0028981 | |||
| 1547 | Ga0495610_0003654 | |||
| 1548 | Ga0495620_0012660 | |||
| 1549 | Ga0495620_0031491 | |||
| 1550 | Ga0495620_0034435 | |||
| 1551 | Ga0495632_0004427 | |||
| 1552 | Ga0495632_0008553 | |||
| 1553 | Ga0495632_0038504 | |||
| 1554 | Ga0495632_0054546 | |||
| 1555 | Ga0495643_0020335 | |||
| 1556 | Ga0495643_0022058 | |||
| 1557 | Ga0495643_0076124 | |||
| 1558 | Ga0495644_0065939 | |||
| 1559 | Ga0495648_0012880 | |||
| 1560 | Ga0495648_0026511 | |||
| 1561 | Ga0495648_0131990 | |||
| 1562 | Ga0495663_0037469 | |||
| 1563 | Ga0495654_0065288 | |||
| 1564 | Ga0495597_0103518 | |||
| 1565 | Ga0495622_0054191 | |||
| 1566 | Ga0495633_0048852 | |||
| 1567 | Ga0495668_0033389 | |||
| 1568 | Ga0495668_0062119 | |||
| 1569 | Ga0495611_0004276 | |||
| 1570 | Ga0495625_0001549 | |||
| 1571 | Ga0495625_0008316 | |||
| 1572 | Ga0495625_0124392 | |||
| 1573 | Ga0495625_0198134 | |||
| 1574 | Ga0495625_0290172 | |||
| 1575 | Ga0495647_0066809 | |||
| 1576 | Ga0495670_0088217 | |||
| 1577 | Ga0495671_0005841 | |||
| 1578 | Ga0495671_0072259 | |||
| 1579 | Ga0495649_0047777 | |||
| 1580 | Ga0495589_0053124 | |||
| 1581 | Ga0495660_0033432 | |||
| 1582 | Ga0495581_0053660 | |||
| 1583 | Ga0495636_0032581 | |||
| 1584 | Ga0495672_0040288 | |||
| 1585 | Ga0495676_0014794 | |||
| 1586 | Ga0495683_0116123 | |||
| 1587 | Ga0495687_020132 | |||
| 1588 | Ga0495687_056893 | |||
| 1589 | Ga0495687_062756 | |||
| 1590 | Ga0495673_0064543 | |||
| 1591 | Ga0495673_0084977 | |||
| 1592 | Ga0495686_0007642 | |||
| 1593 | Ga0496100_0098884 | |||
| 1594 | Ga0496101_0001718 | |||
| 1595 | Ga0496101_0137123 | |||
| 1596 | Ga0496101_0173358 | |||
| 1597 | Ga0496102_0018972 | |||
| 1598 | Ga0496102_0041249 | |||
| 1599 | Ga0496102_0062080 | |||
| 1600 | Ga0496102_0062589 | |||
| 1601 | Ga0496102_0161723 | |||
| 1602 | Ga0496102_0254200 | |||
| 1603 | Ga0496103_0026313 | |||
| 1604 | Ga0496104_0025236 | |||
| 1605 | Ga0496104_0036153 | |||
| 1606 | Ga0496105_0000224 | |||
| 1607 | Ga0496105_0016215 | |||
| 1608 | Ga0496106_0006361 | |||
| 1609 | Ga0496106_0047264 | |||
| 1610 | Ga0496106_0138906 | |||
| 1611 | Ga0496106_0210824 | |||
| 1612 | Ga0496107_0002345 | |||
| 1613 | Ga0496107_0005917 | |||
| 1614 | Ga0496107_0064381 | |||
| 1615 | Ga0496108_0021911 | |||
| 1616 | Ga0496108_0030237 | |||
| 1617 | Ga0496109_0205114 | |||
| 1618 | Ga0496110_0016139 | |||
| 1619 | Ga0496110_0044333 | |||
| 1620 | Ga0496110_0053787 | |||
| 1621 | Ga0496111_0023729 | |||
| 1622 | Ga0496111_0030124 | |||
| 1623 | Ga0496111_0319858 | |||
| 1624 | Ga0496113_0125018 | |||
| 1625 | Ga0496114_0003970 | |||
| 1626 | Ga0496114_0133321 | |||
| 1627 | Ga0496115_0021954 | |||
| 1628 | Ga0496116_0012667 | |||
| 1629 | Ga0496116_0014264 | |||
| 1630 | Ga0496116_0015539 | |||
| 1631 | Ga0496116_0149291 | |||
| 1632 | Ga0496117_0004882 | |||
| 1633 | Ga0496117_0006044 | |||
| 1634 | Ga0496117_0019305 | |||
| 1635 | Ga0496117_0035745 | |||
| 1636 | Ga0496117_0102571 | |||
| 1637 | Ga0496118_0020924 | |||
| 1638 | Ga0496118_0034239 | |||
| 1639 | Ga0496118_0045801 | |||
| 1640 | Ga0496118_0050460 | |||
| 1641 | Ga0496118_0051624 | |||
| 1642 | Ga0496118_0128450 | |||
| 1643 | Ga0496119_0019149 | |||
| 1644 | Ga0496119_0052448 | |||
| 1645 | Ga0496119_0132140 | |||
| 1646 | Ga0496120_0070466 | |||
| 1647 | Ga0496121_0000274 | |||
| 1648 | Ga0496121_0001339 | |||
| 1649 | Ga0496121_0003000 | |||
| 1650 | Ga0496121_0007348 | |||
| 1651 | Ga0496121_0013331 | |||
| 1652 | Ga0496121_0022925 | |||
| 1653 | Ga0496121_0031341 | |||
| 1654 | Ga0496121_0176750 | |||
| 1655 | Ga0496121_0302587 | |||
| 1656 | Ga0496121_0380691 | |||
| 1657 | Ga0496122_0000147 | |||
| 1658 | Ga0496122_0002476 | |||
| 1659 | Ga0496122_0018439 | |||
| 1660 | Ga0496122_0019098 | |||
| 1661 | Ga0496122_0029419 | |||
| 1662 | Ga0496122_0068652 | |||
| 1663 | Ga0496123_0000020 | |||
| 1664 | Ga0496123_0000158 | |||
| 1665 | Ga0496123_0004863 | |||
| 1666 | Ga0496123_0023631 | |||
| 1667 | Ga0496123_0025896 | |||
| 1668 | Ga0496123_0029027 | |||
| 1669 | Ga0496123_0067858 | |||
| 1670 | Ga0496124_0013299 | |||
| 1671 | Ga0496124_0023052 | |||
| 1672 | Ga0496124_0045132 | |||
| 1673 | Ga0496124_0055657 | |||
| 1674 | Ga0496124_0056012 | |||
| 1675 | Ga0496124_0090155 | |||
| 1676 | Ga0496124_0142682 | |||
| 1677 | Ga0496124_0344217 | |||
| 1678 | Ga0496125_0000695 | |||
| 1679 | Ga0496125_0006025 | |||
| 1680 | Ga0496125_0031254 | |||
| 1681 | Ga0496125_0038164 | |||
| 1682 | Ga0496125_0183467 | |||
| 1683 | Ga0496126_0000195 | |||
| 1684 | Ga0496126_0004852 | |||
| 1685 | Ga0496126_0050974 | |||
| 1686 | Ga0496126_0080772 | |||
| 1687 | Ga0496126_0113074 | |||
| 1688 | Ga0496126_0222638 | |||
| 1689 | Ga0496126_0351490 | |||
| 1690 | Ga0495678_039325 | |||
| 1691 | Ga0501032_0150012 | |||
| 1692 | Ga0501033_0065217 | |||
| 1693 | Ga0501033_0210520 | |||
| 1694 | Ga0501033_0250294 | |||
| 1695 | Ga0501034_0068978 | |||
| 1696 | Ga0501034_0144497 | |||
| 1697 | Ga0501034_0459545 | |||
| 1698 | Ga0501036_0379565 | |||
| 1699 | Ga0501036_0621555 | |||
| 1700 | Ga0501037_0113439 | |||
| 1701 | Ga0501037_0273231 | |||
| 1702 | Ga0501040_0112463 | |||
| 1703 | Ga0501041_0069308 | |||
| 1704 | Ga0501041_0257298 | |||
| 1705 | Ga0501043_0011321 | |||
| 1706 | Ga0501043_0085023 | |||
| 1707 | Ga0501047_0156176 | |||
| 1708 | Ga0501069_0230600 | |||
| 1709 | Ga0501071_0015300 | |||
| 1710 | Ga0501072_0178326 | |||
| 1711 | Ga0501073_0099551 | |||
| 1712 | Ga0501075_0068180 | |||
| 1713 | Ga0501076_0105684 | |||
| 1714 | Ga0501076_0190817 | |||
| 1715 | Ga0501238_001781 | |||
| 1716 | Ga0501079_0009362 | |||
| 1717 | Ga0501080_0201868 | |||
| 1718 | Ga0501083_0086168 | |||
| 1719 | Ga0501044_0035147 | |||
| 1720 | Ga0501045_0317051 | |||
| 1721 | nmdc:mga03683_223_c1 | |||
| 1722 | nmdc:mga00v17_48066_c1 | |||
| 1723 | nmdc:mga0yw44_10889_c1 | |||
| 1724 | nmdc:mga0yw44_25643_c1 | |||
| 1725 | nmdc:mga0yw44_30853_c1 | |||
| 1726 | nmdc:mga0k408_9_c2 | |||
| 1727 | nmdc:mga07m45_13_c1 | |||
| 1728 | nmdc:mga07m45_7936_c1 | |||
| 1729 | nmdc:mga06r32_402360_c1 | |||
| 1730 | nmdc:mga08y16_190503_c1 | |||
| 1731 | nmdc:mga0n895_90481_c1 | |||
| 1732 | nmdc:mga0rr50_91238_c1 | |||
| 1733 | nmdc:mga0a205_120962_c1 | |||
| 1734 | nmdc:mga0sz30_2726_c1 | |||
| 1735 | Ga0495619_0093078 | |||
| 1736 | Ga0500578_0074949 | |||
| 1737 | Ga0500644_0027737 | |||
| 1738 | Ga0500557_002864 | |||
| 1739 | Ga0500569_059377 | |||
| 1740 | Ga0500593_000262 | |||
| 1741 | Ga0500607_003925 | |||
| 1742 | Ga0500608_001223 | |||
| 1743 | Ga0500608_005520 | |||
| 1744 | Ga0500618_000380 | |||
| 1745 | Ga0500618_020466 | |||
| 1746 | Ga0500658_0000858 | |||
| 1747 | Ga0500658_0015158 | |||
| 1748 | Ga0500559_0012724 | |||
| 1749 | Ga0500559_0014208 | |||
| 1750 | Ga0500568_0042779 | |||
| 1751 | Ga0500573_0000065 | |||
| 1752 | Ga0500573_0000308 | |||
| 1753 | Ga0500590_004524 | |||
| 1754 | Ga0500604_0023632 | |||
| 1755 | Ga0500616_0000817 | |||
| 1756 | Ga0500616_0032869 | |||
| 1757 | Ga0500619_000115 | |||
| 1758 | Ga0500622_0000391 | |||
| 1759 | Ga0500622_0065397 | |||
| 1760 | Ga0500627_0123668 | |||
| 1761 | Ga0500637_0013439 | |||
| 1762 | Ga0500567_002040 | |||
| 1763 | Ga0500625_000026 | |||
| 1764 | Ga0500645_005655 | |||
| 1765 | Ga0501084_0074481 | |||
| 1766 | Ga0501082_0101087 | |||
| 1767 | Ga0530510_0027672 | |||
| 1768 | 2509107018 | |||
| 1769 | 2509112576 | |||
| 1770 | 2509385695 | |||
| 1771 | 2509388464 | |||
| 1772 | 2509444012 | |||
| 1773 | 2510131389 | |||
| 1774 | 2510308366 | |||
| 1775 | 2510897743 | |||
| 1776 | 2511135422 | |||
| 1777 | 2511136303 | |||
| 1778 | 2511170135 | |||
| 1779 | 2511184763 | |||
| 1780 | 2511196842 | |||
| 1781 | 2511199480 | |||
| 1782 | 2511498680 | |||
| 1783 | 2512531963 | |||
| 1784 | 2513570608 | |||
| 1785 | 2513580239 | |||
| 1786 | 2513587943 | |||
| 1787 | 2513596710 | |||
| 1788 | 2513620725 | |||
| 1789 | 2513634226 | |||
| 1790 | 2513713215 | |||
| 1791 | 2513864875 | |||
| 1792 | 2513886896 | |||
| 1793 | 2513907047 | |||
| 1794 | 2513910330 | |||
| 1795 | 2513928278 | |||
| 1796 | 2513987666 | |||
| 1797 | 2513996743 | |||
| 1798 | 2514000731 | |||
| 1799 | 2514020271 | |||
| 1800 | 2515110342 | |||
| 1801 | 2515634550 | |||
| 1802 | 2515643775 | |||
| 1803 | 2515657173 | |||
| 1804 | 2515743326 | |||
| 1805 | 2516894957 | |||
| 1806 | 2517039027 | |||
| 1807 | 2517079293 | |||
| 1808 | 2517093222 | |||
| 1809 | 2517409491 | |||
| 1810 | 2520377550 | |||
| 1811 | 2524454370 | |||
| 1812 | 2524458338 | |||
| 1813 | 2530644751 | |||
| 1814 | 2530647846 | |||
| 1815 | 2535515072 | |||
| 1816 | 2551679083 | |||
| 1817 | 2551685277 | |||
| 1818 | 2551693482 | |||
| 1819 | 2551703160 | |||
| 1820 | 2551715246 | |||
| 1821 | 2551716910 | |||
| 1822 | 2551718718 | |||
| 1823 | 2551727897 | |||
| 1824 | 2551731765 | |||
| 1825 | 2551739574 | |||
| 1826 | 2585203648 | |||
| 1827 | 2585222285 | |||
| 1828 | 2585227051 | |||
| 1829 | 2585255939 | |||
| 1830 | 2585275466 | |||
| 1831 | 2585275467 | |||
| 1832 | 2585276408 | |||
| 1833 | 2585330173 | |||
| 1834 | 2585335347 | |||
| 1835 | 2585385512 | |||
| 1836 | 2585391929 | |||
| 1837 | 2585398575 | |||
| 1838 | 2585529290 | |||
| 1839 | 2585539658 | |||
| 1840 | 2585544762 | |||
| 1841 | 2585550524 | |||
| 1842 | 2585560091 | |||
| 1843 | 2585819275 | |||
| 1844 | 2585837615 | |||
| 1845 | 2585905728 | |||
| 1846 | 2587755786 | |||
| 1847 | 2587979156 | |||
| 1848 | 2588294193 | |||
| 1849 | 2599332986 | |||
| 1850 | 2599419212 | |||
| 1851 | 2599719571 | |||
| 1852 | 2600374682 | |||
| 1853 | 2616297092 | |||
| 1854 | 2616553150 | |||
| 1855 | 2616553382 | |||
| 1856 | 2616557217 | |||
| 1857 | 2616557371 | |||
| 1858 | 2617383764 | |||
| 1859 | 2643730796 | |||
| 1860 | 2644007294 | |||
| 1861 | 2644044551 | |||
| 1862 | 2644103265 | |||
| 1863 | 2644151863 | |||
| 1864 | 2644190562 | |||
| 1865 | 2644206728 | |||
| 1866 | 2644241572 | |||
| 1867 | 2644306193 | |||
| 1868 | 2644330443 | |||
| 1869 | 2644391524 | |||
| 1870 | 2644492272 | |||
| 1871 | 2644542811 | |||
| 1872 | 2644618857 | |||
| 1873 | 2644650375 | |||
| 1874 | 2644655917 | |||
| 1875 | 2719179544 | |||
| 1876 | 2719384098 | |||
| 1877 | 2719663889 | |||
| 1878 | 2719730214 | |||
| 1879 | 2720490308 | |||
| 1880 | 2720611685 | |||
| 1881 | 2720618534 | |||
| 1882 | 2720629942 | |||
| 1883 | 2720773637 | |||
| 1884 | 2721145637 | |||
| 1885 | 2721157154 | |||
| 1886 | 2721162516 | |||
| 1887 | 2721397868 | |||
| 1888 | 2722838686 | |||
| 1889 | 2723025308 | |||
| 1890 | 2723558893 | |||
| 1891 | 2723565463 | |||
| 1892 | 2724036678 | |||
| 1893 | 2724042970 | |||
| 1894 | 2724088244 | |||
| 1895 | 2724102728 | |||
| 1896 | 2724108624 | |||
| 1897 | 2725948968 | |||
| 1898 | 2730106244 | |||
| 1899 | 2730162781 | |||
| 1900 | 2730296786 | |||
| 1901 | 2738710399 | |||
| 1902 | 2738801266 | |||
| 1903 | 2738848824 | |||
| 1904 | 2738864553 | |||
| 1905 | 2739037048 | |||
| 1906 | 2739297071 | |||
| 1907 | 2739358749 | |||
| 1908 | 2739651111 | |||
| 1909 | 2740029584 | |||
| 1910 | 2766066592 | |||
| 1911 | 2770199497 | |||
| 1912 | 2776267965 | |||
| 1913 | 2776268167 | |||
| 1914 | 2776281939 | |||
| 1915 | 2776283992 | |||
| 1916 | 2792580500 | |||
| 1917 | 2793295235 | |||
| 1918 | 2793316355 | |||
| 1919 | 2793323413 | |||
| 1920 | 2793324779 | |||
| 1921 | 2793326193 | |||
| 1922 | 2793334253 | |||
| 1923 | 2793341831 | |||
| 1924 | 2793348168 | |||
| 1925 | 2793361537 | |||
| 1926 | 2793364649 | |||
| 1927 | 2805929344 | |||
| 1928 | 2805932397 | |||
| 1929 | 2806047570 | |||
| 1930 | 2806054989 | |||
| 1931 | 2806062109 | |||
| 1932 | 2806067165 | |||
| 1933 | 2806076486 | |||
| 1934 | 2808990109 | |||
| 1935 | 2819245294 | |||
| 1936 | 2819608434 | |||
| 1937 | 2819612398 | |||
| 1938 | 2821123617 | |||
| 1939 | 2821446575 | |||
| 1940 | 2838020257 | |||
| 1941 | 2838025776 | |||
| 1942 | 2838031872 | |||
| 1943 | 2838037104 | |||
| 1944 | 2838044454 | |||
| 1945 | 2838051527 | |||
| 1946 | 2838064002 | |||
| 1947 | 2838071083 | |||
| 1948 | 2838663720 | |||
| 1949 | 2838672422 | |||
| 1950 | 2838680557 | |||
| 1951 | 2838691610 | |||
| 1952 | 2838695410 | |||
| 1953 | 2838703836 | |||
| 1954 | 2838708787 | |||
| 1955 | 2838733906 | |||
| 1956 | 2838739349 | |||
| 1957 | 2838747030 | |||
| 1958 | 2841843247 | |||
| 1959 | 2841856171 | |||
| 1960 | 2841866840 | |||
| 1961 | 2842079978 | |||
| 1962 | 2842112182 | |||
| 1963 | 2842120597 | |||
| 1964 | 2842143029 | |||
| 1965 | 2842148372 | |||
| 1966 | 2842161959 | |||
| 1967 | 2842169665 | |||
| 1968 | 2842185801 | |||
| 1969 | 2842192858 | |||
| 1970 | 2842202927 | |||
| 1971 | 2842206979 | |||
| 1972 | 2842218822 | |||
| 1973 | 2842235329 | |||
| 1974 | 2842238198 | |||
| 1975 | 2842248216 | |||
| 1976 | 2842253438 | |||
| 1977 | 2842262190 | |||
| 1978 | 2842268789 | |||
| 1979 | 2842276583 | |||
| 1980 | 2842280328 | |||
| 1981 | 2842286810 | |||
| 1982 | 2842293639 | |||
| 1983 | 2842306529 | |||
| 1984 | 2842312649 | |||
| 1985 | 2842322486 | |||
| 1986 | 2842343102 | |||
| 1987 | 2842367173 | |||
| 1988 | 2842371020 | |||
| 1989 | 2842380036 | |||
| 1990 | 2842387107 | |||
| 1991 | 2842399220 | |||
| 1992 | 2842403637 | |||
| 1993 | 2842410661 | |||
| 1994 | 2842417307 | |||
| 1995 | 2842424699 | |||
| 1996 | 2842433011 | |||
| 1997 | 2842439316 | |||
| 1998 | 2842445945 | |||
| 1999 | 2842451874 | |||
| 2000 | 2842467131 | |||
| 2001 | 2842473841 | |||
| 2002 | 2842476252 | |||
| 2003 | 2842478604 | |||
| 2004 | 2842492488 | |||
| 2005 | 2842500068 | |||
| 2006 | 2842502846 | |||
| 2007 | 2842505451 | |||
| 2008 | 2842509179 | |||
| 2009 | 2842513658 | |||
| 2010 | 2842521674 | |||
| 2011 | 2842526600 | |||
| 2012 | 2842923294 | |||
| 2013 | 2844170779 | |||
| 2014 | 2844456019 | |||
| 2015 | 2844536556 | |||
| 2016 | 2852388454 | |||
| 2017 | 2852392779 | |||
| 2018 | 2852393100 | |||
| 2019 | 2855827592 | |||
| 2020 | 2855842967 | |||
| 2021 | 2857523467 | |||
| 2022 | 2857531181 | |||
| 2023 | 2858801923 | |||
| 2024 | 2888349715 | |||
| 2025 | 2891374960 | |||
| 2026 | 2896385701 | |||
| 2027 | 2899805294 | |||
| 2028 | 2915992355 | |||
| 2029 | 2915994404 | |||
| 2030 | 2916002857 | |||
| 2031 | 2916011265 | |||
| 2032 | 2916018715 | |||
| 2033 | 2916025375 | |||
| 2034 | 2916035040 | |||
| 2035 | 2916038082 | |||
| 2036 | 2916048139 | |||
| 2037 | 2916054299 | |||
| 2038 | 2916061042 | |||
| 2039 | 2916071658 | |||
| 2040 | 2916082703 | |||
| 2041 | 2919101376 | |||
| 2042 | 2919102851 | |||
| 2043 | 2919172113 | |||
| 2044 | 2919408773 | |||
| 2045 | 2920762042 | |||
| 2046 | 2921208448 | |||
| 2047 | 2921211276 | |||
| 2048 | 2921241176 | |||
| 2049 | 2921250311 | |||
| 2050 | 2921258656 | |||
| 2051 | 2921263399 | |||
| 2052 | 2921270148 | |||
| 2053 | 2921285296 | |||
| 2054 | 2921293386 | |||
| 2055 | 2921302760 | |||
| 2056 | 2923557118 | |||
| 2057 | 2924147878 | |||
| 2058 | 2924151340 | |||
| 2059 | 2924164793 | |||
| 2060 | 2924166444 | |||
| 2061 | 2924179218 | |||
| 2062 | 2924180520 | |||
| 2063 | 2924193296 | |||
| 2064 | 2924196320 | |||
| 2065 | 2924203964 | |||
| 2066 | 2924210630 | |||
| 2067 | 2924215933 | |||
| 2068 | 2924225582 | |||
| 2069 | 2924232360 | |||
| 2070 | 2928100497 | |||
| 2071 | 2928960561 | |||
| 2072 | 2933020918 | |||
| 2073 | 2933573598 | |||
| 2074 | 2933587511 | |||
| 2075 | 2933601882 | |||
| 2076 | 2935895934 | |||
| 2077 | 2935907192 | |||
| 2078 | 2936368956 | |||
| 2079 | 2936378428 | |||
| 2080 | 2936383716 | |||
| 2081 | 2936998887 | |||
| 2082 | 2937007097 | |||
| 2083 | 2937013230 | |||
| 2084 | 2937019920 | |||
| 2085 | 2937028310 | |||
| 2086 | 2937028777 | |||
| 2087 | 2937049438 | |||
| 2088 | 2937053124 | |||
| 2089 | 2937063767 | |||
| 2090 | 2937065674 | |||
| 2091 | 2937075721 | |||
| 2092 | 2937092482 | |||
| 2093 | 2937099302 | |||
| 2094 | 2937111164 | |||
| 2095 | 2937115911 | |||
| 2096 | 2937123545 | |||
| 2097 | 2937129132 | |||
| 2098 | 2941500736 | |||
| 2099 | 2957386294 | |||
| 2100 | 2957392645 | |||
| 2101 | 2957396118 | |||
| 2102 | 2957402081 | |||
| 2103 | 2957404929 | |||
| 2104 | 2957411970 | |||
| 2105 | 2957417108 | |||
| 2106 | 2957427954 | |||
| 2107 | 2957433036 | |||
| 2108 | 2957457560 | |||
| 2109 | 2957461170 | |||
| 2110 | 2957467654 | |||
| 2111 | 2957477414 | |||
| 2112 | 2957483923 | |||
| 2113 | 2957486947 | |||
| 2114 | 2957493817 | |||
| 2115 | 2957502297 | |||
| 2116 | 2957511610 | |||
| 2117 | 2960587168 | |||
| 2118 | 2960602448 | |||
| 2119 | 2960608135 | |||
| 2120 | 2960616625 | |||
| 2121 | 2960630701 | |||
| 2122 | 2960638695 | |||
| 2123 | 2960652661 | |||
| 2124 | 2960653766 | |||
| 2125 | 2960671357 | |||
| 2126 | 2960678067 | |||
| 2127 | 2960693414 | |||
| 2128 | 2964615271 | |||
| 2129 | 2964616713 | |||
| 2130 | 2964621128 | |||
| 2131 | 2964625382 | |||
| 2132 | 2964632016 | |||
| 2133 | 2964642799 | |||
| 2134 | 2964647337 | |||
| 2135 | 2964653711 | |||
| 2136 | 2964658038 | |||
| 2137 | 2964667397 | |||
| 2138 | 2964677761 | |||
| 2139 | 2964678353 | |||
| 2140 | 2964687788 | |||
| 2141 | 2964695753 | |||
| 2142 | 2964705024 | |||
| 2143 | 2964708113 | |||
| 2144 | 2964718922 | |||
| 2145 | 2964722549 | |||
| 2146 | 2967666019 | |||
| 2147 | 2967675259 | |||
| 2148 | 2967679211 | |||
| 2149 | 2967695789 | |||
| 2150 | 2967700250 | |||
| 2151 | 2967707303 | |||
| 2152 | 2967720700 | |||
| 2153 | 2967721821 | |||
| 2154 | 2967738550 | |||
| 2155 | 2967748509 | |||
| 2156 | 2967752921 | |||
| 2157 | 2967756959 | |||
| 2158 | 2967761975 | |||
| 2159 | 2967765298 | |||
| 2160 | 2967772998 | |||
| 2161 | 2967782695 | |||
| 2162 | 2970020194 | |||
| 2163 | 2970038065 | |||
| 2164 | 2970044412 | |||
| 2165 | 2970054319 | |||
| 2166 | 2970059098 | |||
| 2167 | 2970068076 | |||
| 2168 | 2970074293 | |||
| 2169 | 2970082013 | |||
| 2170 | 2970087675 | |||
| 2171 | 2970092099 | |||
| 2172 | 2970097822 | |||
| 2173 | 2970103293 | |||
| 2174 | 2970107799 | |||
| 2175 | 2970111829 | |||
| 2176 | 2970116912 | |||
| 2177 | 2970132235 | |||
| 2178 | 2970137710 | |||
| 2179 | 2970153729 | |||
| 2180 | 2970163492 | |||
| 2181 | 2970168556 | |||
| 2182 | 2970177655 | |||
| 2183 | 2970184409 | |||
| 2184 | 2970185326 | |||
| 2185 | 2970195910 | |||
| 2186 | 2977523502 | |||
| 2187 | 2977525717 | |||
| 2188 | 2977540657 | |||
| 2189 | 2977558259 | |||
| 2190 | 2977562111 | |||
| 2191 | 2977568720 | |||
| 2192 | 2977576750 | |||
| 2193 | 2977582526 | |||
| 2194 | 2987652774 | |||
| 2195 | 2989351435 | |||
| 2196 | 2989772765 | |||
| 2197 | 2989777394 | |||
| 2198 | 2996888487 | |||
| 2199 | 2996893406 | |||
| 2200 | 3000867205 | |||
| 2201 | 3003931927 | |||
| 2202 | 3005411205 | |||
| 2203 | 3005418205 | |||
| 2204 | 3005422834 | |||
| 2205 | 3005446156 | |||
| 2206 | 3005451879 | |||
| 2207 | 3005452815 | |||
| 2208 | 3005457188 | |||
| 2209 | 639646621 | |||
| 2210 | 648740415 | |||
| 2211 | 8003995547 | |||
| 2212 | 8005247418 | |||
| 2213 | 8005263451 | |||
| 2214 | 8005278809 | |||
| 2215 | 8005289037 | |||
| 2216 | 8005289383 | |||
| 2217 | 8005291111 | |||
| 2218 | 8005301522 | |||
| 2219 | 8005305284 | |||
| 2220 | 8005309222 | |||
| 2221 | 8005316155 | |||
| 2222 | 8005321630 | |||
| 2223 | 8005323014 | |||
| 2224 | 8005377462 | |||
| 2225 | 8005387325 | |||
| 2226 | 8005400098 | |||
| 2227 | 8005432903 | |||
| 2228 | 8005460981 | |||
| 2229 | 8005484922 | |||
| 2230 | 8005488171 | |||
| 2231 | 8005498633 | |||
| 2232 | 8005543743 | |||
| 2233 | 8005560594 | |||
| 2234 | 8005563947 | |||
| 2235 | 8005576893 | |||
| 2236 | 8005619825 | |||
| 2237 | 8005628397 | |||
| 2238 | 8005650119 | |||
| 2239 | 8005670044 | |||
| 2240 | 8005689306 | |||
| 2241 | 8005690238 | |||
| 2242 | 8005699282 | |||
| 2243 | 8018133096 | |||
| 2244 | 8018168996 | |||
| 2245 | 8018179485 | |||
| 2246 | 8023684269 | |||
| 2247 | 8024480248 | |||
| 2248 | 8024491439 | |||
| 2249 | 8024501631 | |||
| 2250 | 8049297407 | |||
| 2251 | 8055436167 | |||
| 2252 | 8056375606 | |||
| 2253 | 8056385920 | |||
| 2254 | 8057876020 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF02882
THF_DHG_CYH_C
Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain
133
297
0.98
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6de8-assembly1.cif.gz_A | crystal structure of bifunctional enzyme fold-methylenetetrahydrofolate dehydrogenase/cyclohydrolase from campylobacter jejuni | 0.9634 | 8 | 266 |
| 6ape-assembly1.cif.gz_A | crystal structure of bifunctional protein fold from helicobacter pylori | 0.9627 | 9 | 270 |
| 4a5o-assembly2.cif.gz_D | crystal structure of pseudomonas aeruginosa n5, n10- methylenetetrahydrofolate dehydrogenase-cyclohydrolase (fold) | 0.9588 | 10 | 267 |
| 6ecr-assembly1.cif.gz_A | the human methylenetetrahydrofolate dehydrogenase/cyclohydrolase (fold) complexed with nadp | 0.9569 | 4 | 268 |
| 6v6y-assembly1.cif.gz_A-2 | crystal structure of t. thermophilus methylenetetrahydrofolate dehydrogenase (mthfd) | 0.9546 | 8 | 264 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4a5oB02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 | 0.975 | 10 | 90 | 3.40.50.10860 |
| af_Q54RI8_12_107_3.40.50.10860 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 | 0.9721 | 8 | 77 | 3.40.50.10860 |
| af_K7KYI8_1_78_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9709 | 10 | 78 | 3.40.50.720 |
| af_A0A0R0F3H3_60_174_3.40.50.10860 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 | 0.9691 | 10 | 99 | 3.40.50.10860 |
| af_Q0E4G1_111_191_3.40.50.10860 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 | 0.9628 | 10 | 89 | 3.40.50.10860 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A528CSZ1-F1-model_v4 | methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9) | 0.9918 | 96 | 275 |
GO:0004477
GO:0004488 GO:0005829 GO:0035999 |
| AF-A0A530K4M7-F1-model_v4 | methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9) | 0.9904 | 93 | 275 |
GO:0004477
GO:0004488 GO:0005829 GO:0035999 |
| AF-A0A0P1H4U0-F1-model_v4 | methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9) | 0.9887 | 115 | 274 |
GO:0004477
GO:0004488 GO:0005829 GO:0035999 |
| AF-A0A526XTM2-F1-model_v4 | methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9) | 0.987 | 127 | 231 |
GO:0004477
GO:0004488 GO:0005829 GO:0035999 |
| AF-E2CPW4-F1-model_v4 | Bifunctional protein FolD [Includes: Methylenetetrahydrofolate dehydrogenase (EC 1.5.1.5); Methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9)] | 0.9852 | 9 | 275 |
GO:0000105
GO:0004477 GO:0004488 GO:0005829 GO:0006164 GO:0009086 GO:0035999 |