F490551

General Info

Members Datasets Scaffolds Average Seq Length
1131 761 2254 310

Family's Representative Sequence

Representative Sequence 3300044765|Ga0466970_0016669|Ga0466970_0016669_2051_3124
Length 357
Sequence MAFPLPWPDRPPNAPQHKIRAVACDRFDHAKQERIMSQTETKPHTIAQQETNMSLENNSRVGRTGADELVPSRYAVQIGDIEVLVISDGVLPLPTKMLGYNANPADHAAWLKDMFLPQDAFDWALNVVVVRSGKQTILIDAGLGLDPELNLPRAGQLIKRLEAAGIDLGSVTDVVLTHMHMDHVGGLLVDGVKARLRPDLKIHVAAAEVKFWEAPDFSHVSMPPGFPDALRAAAKQFRKEYDSHLRLFADEHEVAPGVVVSRTGGHTPGHSVVRVASGKDRLMFAGDAVFAVGFDHPDWFNGFEHDPEEAARVRVRLLRELAETGELLVATHMPFPSVGHVAADGDRFRWVPVFWDY

Samples

Sample ID Description Type Environment
1 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
12 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
21 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
74 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
80 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
87 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
88 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
89 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
90 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
91 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
92 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
93 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
114 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
115 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
118 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
119 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
120 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
121 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
123 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
125 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
126 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
127 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
130 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
131 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
132 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
136 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
138 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
140 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
143 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
189 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
190 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
192 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
193 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
194 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
195 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
197 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
201 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
202 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
203 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
204 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
205 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
206 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
207 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
208 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
209 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
210 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
211 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
212 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
213 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
214 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
215 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
216 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
217 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
218 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
219 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
220 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
221 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
222 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
223 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
224 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
225 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
226 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
227 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
228 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
229 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
230 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
231 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
232 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
233 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
234 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
235 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
236 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
237 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
238 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
239 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
240 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
241 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
242 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
243 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
244 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
245 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
246 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
247 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
248 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
249 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
250 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
251 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
252 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
253 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
254 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
255 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
256 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
257 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
258 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
259 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
260 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
261 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
262 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
263 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
264 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
265 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
266 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
267 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
268 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
269 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
270 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
271 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
272 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
273 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
274 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
275 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
276 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
277 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
278 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
279 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
280 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
281 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
282 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
283 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
284 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
285 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
286 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
287 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
288 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
289 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
290 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
291 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
292 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
293 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
294 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
295 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
296 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
297 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
298 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
299 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
300 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
301 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
302 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
303 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
304 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
305 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
306 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
307 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
308 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
309 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
310 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
311 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
312 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
313 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
314 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
315 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
316 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
330 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
331 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
332 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
333 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
334 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
337 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
338 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
339 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
340 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
341 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
342 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
343 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
344 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
345 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
346 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
347 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
348 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
349 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
350 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
351 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
352 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
353 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
354 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
355 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
356 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
357 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
358 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
359 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
360 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
361 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
362 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
363 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
364 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
365 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
366 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
367 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
368 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
369 2509276019 Ensifer aridi TW10 Isolate Nodule
370 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
371 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
372 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
373 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
374 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
375 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
376 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
377 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
378 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
379 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
380 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
381 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
382 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
383 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
384 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
385 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
386 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
387 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
388 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
389 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
390 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
391 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
392 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
393 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
394 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
395 2519899620 Rhizobium sp. Pop5 Isolate Nodule
396 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
397 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
398 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
399 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
400 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
401 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
402 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
403 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
404 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
405 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
406 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
407 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
408 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
409 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
410 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
411 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
412 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
413 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
414 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
415 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
416 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
417 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
418 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
419 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
420 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
421 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
422 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
423 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
424 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
425 2643221557 Ensifer sp. Root558 Isolate Unclassified
426 2643221610 Ensifer sp. Root74 Isolate Unclassified
427 2643221618 Ensifer sp. Root231 Isolate Unclassified
428 2643221626 Ensifer sp. Root31 Isolate Unclassified
429 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
430 2643221651 Afipia sp. Root123D2 Isolate Unclassified
431 2643221655 Ensifer sp. Root1252 Isolate Unclassified
432 2643221659 Ensifer sp. Root127 Isolate Unclassified
433 2643221664 Massilia sp. Root418 Isolate Unclassified
434 2643221668 Ensifer sp. Root423 Isolate Unclassified
435 2643221675 Ensifer sp. Root1298 Isolate Unclassified
436 2643221680 Ensifer sp. Root1312 Isolate Unclassified
437 2643221698 Ensifer sp. Root142 Isolate Unclassified
438 2643221712 Ensifer sp. Root258 Isolate Unclassified
439 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
440 2643221723 Ensifer sp. Root278 Isolate Unclassified
441 2643221726 Ensifer sp. Root954 Isolate Unclassified
442 2643221734 Bosea sp. Root670 Isolate Unclassified
443 2643221736 Bosea sp. Root483D1 Isolate Unclassified
444 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
445 2718217927 Rhizobium sp. N324 Isolate Nodule
446 2718218423 Rhizobium sp. N941 Isolate Nodule
447 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
448 2721755809 Rhizobium sp. N541 Isolate Nodule
449 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
450 2739367651 Pedobacter sp. OK291 Isolate Unclassified
451 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
452 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
453 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
454 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
455 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
456 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
457 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
458 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
459 2791355199
460 2791355256 Rhizobium sp. M10 Isolate Nodule
461 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
462 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
463 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
464 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
465 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
466 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
467 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
468 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
469 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
470 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
471 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
472 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
473 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
474 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
475 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
476 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
477 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
478 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
479 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
480 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
481 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
482 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
483 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
484 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
485 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
486 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
487 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
488 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
489 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
490 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
491 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
492 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
493 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
494 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
495 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
496 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
497 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
498 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
499 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
500 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
501 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
502 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
503 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
504 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
505 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
506 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
507 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
508 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
509 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
510 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
511 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
512 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
513 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
514 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
515 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
516 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
517 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
518 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
519 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
520 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
521 2842694124 Methylopila sp. R-72369 Isolate Unclassified
522 2842711865 Duganella sp. R-73148 Isolate Unclassified
523 2844163670 Ensifer sp. 1H6 Isolate Unclassified
524 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
525 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
526 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
527 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
528 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
529 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
530 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
531 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
532 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
533 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
534 2858950400 Achromobacter sp. K91 Isolate Unclassified
535 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
536 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
537 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
538 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
539 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
540 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
541 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
542 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
543 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
544 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
545 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
546 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
547 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
548 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
549 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
550 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
551 2904699407
552 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
553 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
554 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
555 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
556 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
557 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
558 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
559 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
560 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
561 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
562 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
563 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
564 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
565 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
566 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
567 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
568 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
569 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
570 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
571 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
572 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
573 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
574 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
575 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
576 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
577 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
578 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
579 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
580 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
581 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
582 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
583 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
584 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
585 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
586 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
587 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
588 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
589 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
590 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
591 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
592 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
593 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
594 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
595 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
596 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
597 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
598 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
599 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
600 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
601 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
602 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
603 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
604 2936381700 Rhizobium chutanense C16 Isolate Unclassified
605 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
606 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
607 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
608 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
609 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
610 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
611 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
612 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
613 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
614 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
615 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
616 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
617 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
618 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
619 2941479691
620 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
621 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
622 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
623 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
624 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
625 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
626 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
627 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
628 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
629 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
630 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
631 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
632 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
633 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
634 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
635 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
636 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
637 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
638 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
639 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
640 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
641 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
642 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
643 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
644 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
645 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
646 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
647 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
648 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
649 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
650 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
651 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
652 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
653 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
654 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
655 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
656 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
657 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
658 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
659 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
660 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
661 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
662 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
663 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
664 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
665 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
666 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
667 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
668 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
669 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
670 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
671 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
672 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
673 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
674 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
675 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
676 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
677 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
678 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
679 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
680 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
681 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
682 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
683 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
684 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
685 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
686 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
687 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
688 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
689 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
690 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
691 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
692 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
693 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
694 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
695 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
696 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
697 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
698 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
699 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
700 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
701 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
702 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
703 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
704 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
705 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
706 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
707 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
708 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
709 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
710 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
711 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
712 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
713 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
714 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
715 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
716 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
717 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
718 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
719 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
720 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
721 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
722 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
723 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
724 2996893221 Rhizobium sp. R635 Isolate Nodule
725 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
726 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
727 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
728 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
729 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
730 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
731 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
732 8005258706 Rhizobium sp. R693 Isolate Nodule
733 8005275841 Rhizobium sp. N4311 Isolate Nodule
734 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
735 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
736 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
737 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
738 8005321885 Rhizobium sp. R72 Isolate Nodule
739 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
740 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
741 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
742 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
743 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
744 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
745 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
746 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
747 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
748 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
749 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
750 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
751 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
752 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
753 8018176218 Rhizobium sp. N122 Isolate Nodule
754 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
755 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
756 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
757 8024501048 Rhizobium sp. H4 Isolate Nodule
758 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
759 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
760 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
761 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 60.76
Metatranscriptomes 0
Isolates 39.24

Biome Distribution

Category Percentage (%)
Aerial Root 0.27
Bulb 0
Endosphere 13.7
Nodule 29
Rhizoplane 4.24
Rhizosphere 38.64
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466970_0016669 3300044765 Bacteria 3791
2 JGI24751J29686_10000063 3300002459 Bacteria 60668
3 JGI25162J39368_1000125 3300002737 Bacteria 84782
4 JGI25152J39213_1000145 3300002773 Bacteria 48531
5 JGI25152J39213_1000768 3300002773 Bacteria 16180
6 JGI25152J39213_1004660 3300002773 Bacteria 4248
7 JGI25150J39212_1000001 3300002774 Bacteria 1318726
8 JGI25159J45721_1003064 3300002987 Bacteria 6045
9 JGI25159J45721_1011989 3300002987 Bacteria 2091
10 JGI25151J46595_10000005 3300003187 Bacteria 431598
11 JGI25151J46595_10065796 3300003187 Bacteria 1127
12 JGI25165J46597_1000495 3300003214 Bacteria 37949
13 JGI25165J46597_1000571 3300003214 Bacteria 32965
14 JGI25165J46597_1004592 3300003214 Bacteria 2910
15 JGI25153J46596_10000040 3300003215 Bacteria 165523
16 JGI25153J46596_10000532 3300003215 Bacteria 23955
17 JGI25153J46596_10002446 3300003215 Bacteria 10708
18 JGI25153J46596_10009846 3300003215 Bacteria 4387
19 JGI25153J46596_10015269 3300003215 Bacteria 3139
20 rootL2_10022068 3300003322 Bacteria 32667
21 JGI25161J50226_1000150 3300003374 Bacteria 48475
22 Ga0055535_1000677 3300003761 Bacteria 26506
23 Ga0055535_1001086 3300003761 Bacteria 16659
24 Ga0055542_1000162 3300003762 Bacteria 84417
25 Ga0055542_1001080 3300003762 Bacteria 16618
26 Ga0055529_1000566 3300003763 Bacteria 30480
27 Ga0055526_1000056 3300003771 Bacteria 110574
28 Ga0055526_1000704 3300003771 Bacteria 25324
29 Ga0055526_1006243 3300003771 Bacteria 6534
30 Ga0055526_1007064 3300003771 Bacteria 5936
31 Ga0055526_1009227 3300003771 Bacteria 4786
32 Ga0055524_1000817 3300003775 Bacteria 20599
33 Ga0055524_1000949 3300003775 Bacteria 18409
34 Ga0055524_1004394 3300003775 Bacteria 6505
35 Ga0055528_1000106 3300003790 Bacteria 67208
36 Ga0055528_1008582 3300003790 Bacteria 4354
37 Ga0055528_1009430 3300003790 Bacteria 4077
38 Ga0055540_1003098 3300003792 Bacteria 8261
39 Ga0055540_1006682 3300003792 Bacteria 4524
40 Ga0055540_1015468 3300003792 Bacteria 2219
41 Ga0055540_1028337 3300003792 Bacteria 1326
42 Ga0055531_10001921 3300003794 Bacteria 14537
43 Ga0058692_1004221 3300003856 Bacteria 4286
44 Ga0055543_1000074 3300004625 Bacteria 88424
45 Ga0065165_1000062 3300005262 Bacteria 178885
46 Ga0065165_1022312 3300005262 Bacteria 2174
47 Ga0070676_10072247 3300005328 Bacteria 2074
48 Ga0070683_100026394 3300005329 Bacteria 5229
49 Ga0070690_100213159 3300005330 Bacteria 1350
50 Ga0070670_100000245 3300005331 Bacteria 48841
51 Ga0068869_100137818 3300005334 Bacteria 1882
52 Ga0070666_10019019 3300005335 Bacteria 4428
53 Ga0070682_100060393 3300005337 Bacteria 2397
54 Ga0070687_100032140 3300005343 Bacteria 2580
55 Ga0070661_100247863 3300005344 Bacteria 1374
56 Ga0070668_100019835 3300005347 Bacteria 5065
57 Ga0070668_100115010 3300005347 Bacteria 2144
58 Ga0070675_100375499 3300005354 Bacteria 1265
59 Ga0070671_100054363 3300005355 Bacteria 3329
60 Ga0070673_100108867 3300005364 Bacteria 2295
61 Ga0070688_100059687 3300005365 Bacteria 2406
62 Ga0070667_100180094 3300005367 Bacteria 1869
63 Ga0070709_10000609 3300005434 Bacteria 20716
64 Ga0070709_10197010 3300005434 Bacteria 1424
65 Ga0070714_100010925 3300005435 Bacteria 7190
66 Ga0070714_100145955 3300005435 Bacteria 2128
67 Ga0070714_100533503 3300005435 Bacteria 1122
68 Ga0070714_100564012 3300005435 Bacteria 1091
69 Ga0070713_100015089 3300005436 Bacteria 5757
70 Ga0070713_100029260 3300005436 Bacteria 4360
71 Ga0070710_10000144 3300005437 Bacteria 32895
72 Ga0070710_10029235 3300005437 Bacteria 2955
73 Ga0070710_10038207 3300005437 Bacteria 2635
74 Ga0070710_10117997 3300005437 Bacteria 1602
75 Ga0070701_10249131 3300005438 Bacteria 1072
76 Ga0070705_100023565 3300005440 Bacteria 3308
77 Ga0070694_100144956 3300005444 Bacteria 1729
78 Ga0070663_100181343 3300005455 Bacteria 1634
79 Ga0070678_100045836 3300005456 Bacteria 3130
80 Ga0070678_100342775 3300005456 Bacteria 1282
81 Ga0070662_100068288 3300005457 Bacteria 2613
82 Ga0070662_100381323 3300005457 Bacteria 1160
83 Ga0070681_10032776 3300005458 Bacteria 5216
84 Ga0068867_100026525 3300005459 Bacteria 4161
85 Ga0070685_10017071 3300005466 Bacteria 3878
86 Ga0070706_100399483 3300005467 Bacteria 1279
87 Ga0070707_100215857 3300005468 Bacteria 1869
88 Ga0070679_100269901 3300005530 Bacteria 1655
89 Ga0070684_100365265 3300005535 Bacteria 1329
90 Ga0068853_100015579 3300005539 Bacteria 6246
91 Ga0070693_100196711 3300005547 Bacteria 1307
92 Ga0070693_100235464 3300005547 Bacteria 1207
93 Ga0070665_100003591 3300005548 Bacteria 16425
94 Ga0070665_100016020 3300005548 Bacteria 7525
95 Ga0070665_100019552 3300005548 Bacteria 6799
96 Ga0070665_100054826 3300005548 Bacteria 3998
97 Ga0070665_100087733 3300005548 Bacteria 3117
98 Ga0070665_100320289 3300005548 Bacteria 1555
99 Ga0070665_100337121 3300005548 Bacteria 1512
100 Ga0070664_100210880 3300005564 Bacteria 1736
101 Ga0070664_100360118 3300005564 Bacteria 1325
102 Ga0068854_100020459 3300005578 Bacteria 4478
103 Ga0068854_100207482 3300005578 Bacteria 1544
104 Ga0068856_100035527 3300005614 Bacteria 4885
105 Ga0068856_100422580 3300005614 Bacteria 1353
106 Ga0068856_100739364 3300005614 Bacteria 1004
107 Ga0068852_100107981 3300005616 Bacteria 2526
108 Ga0068864_100000109 3300005618 Bacteria 80156
109 Ga0068864_100040828 3300005618 Bacteria 3967
110 Ga0068864_100094523 3300005618 Bacteria 2642
111 Ga0068861_100008392 3300005719 Bacteria 7109
112 Ga0068863_100009504 3300005841 Bacteria 9484
113 Ga0068858_100020755 3300005842 Bacteria 6138
114 Ga0068858_100026065 3300005842 Bacteria 5435
115 Ga0068858_100033639 3300005842 Bacteria 4755
116 Ga0068860_100004221 3300005843 Bacteria 14730
117 Ga0068860_100016692 3300005843 Bacteria 7160
118 Ga0068860_100273722 3300005843 Bacteria 1648
119 Ga0068862_100000022 3300005844 Bacteria 214075
120 Ga0081455_10002274 3300005937 Bacteria 22913
121 Ga0081455_10096945 3300005937 Bacteria 2377
122 Ga0081455_10119834 3300005937 Bacteria 2075
123 Ga0081455_10126149 3300005937 Bacteria 2008
124 Ga0081538_10021013 3300005981 Bacteria 4785
125 Ga0081540_1000466 3300005983 Bacteria 40082
126 Ga0081540_1004934 3300005983 Bacteria 10037
127 Ga0081540_1006682 3300005983 Bacteria 8343
128 Ga0081540_1010590 3300005983 Bacteria 6230
129 Ga0081540_1014129 3300005983 Bacteria 5139
130 Ga0081540_1021891 3300005983 Bacteria 3788
131 Ga0081540_1034132 3300005983 Bacteria 2750
132 Ga0081540_1096278 3300005983 Bacteria 1288
133 Ga0081539_10030585 3300005985 Bacteria 3338
134 Ga0075365_10071338 3300006038 Bacteria 2338
135 Ga0075365_10188639 3300006038 Bacteria 1442
136 Ga0075368_10028302 3300006042 Bacteria 2165
137 Ga0075363_100015464 3300006048 Bacteria 3752
138 Ga0075363_100044594 3300006048 Bacteria 2350
139 Ga0075364_10003895 3300006051 Bacteria 8556
140 Ga0070715_10026998 3300006163 Bacteria 2290
141 Ga0070715_10039642 3300006163 Bacteria 1963
142 Ga0070716_100025095 3300006173 Bacteria 3177
143 Ga0070712_100002030 3300006175 Bacteria 12405
144 Ga0070712_100004935 3300006175 Bacteria 8253
145 Ga0070712_100028568 3300006175 Bacteria 3732
146 Ga0070712_100070714 3300006175 Bacteria 2494
147 Ga0070712_100095798 3300006175 Bacteria 2184
148 Ga0075362_10004855 3300006177 Bacteria 4860
149 Ga0075362_10024312 3300006177 Bacteria 2569
150 Ga0075369_10000419 3300006186 Bacteria 12857
151 Ga0075369_10152887 3300006186 Bacteria 1055
152 Ga0075366_10073587 3300006195 Bacteria 2037
153 Ga0075366_10079295 3300006195 Bacteria 1960
154 Ga0075370_10122257 3300006353 Bacteria 1516
155 Ga0068871_100067601 3300006358 Bacteria 2933
156 Ga0068871_100079177 3300006358 Bacteria 2718
157 Ga0068871_100449309 3300006358 Bacteria 1155
158 Ga0075431_100004254 3300006847 Bacteria 14024
159 Ga0068865_100029277 3300006881 Bacteria 3652
160 Ga0068865_100034127 3300006881 Bacteria 3412
161 Ga0099825_1044464 3300006941 Bacteria 1152
162 Ga0099822_1000686 3300006943 Bacteria 34261
163 Ga0099823_1043708 3300006944 Bacteria 3077
164 Ga0079104_1005204 3300006946 Bacteria 5266
165 Ga0079104_1008261 3300006946 Bacteria 3667
166 Ga0099826_10000010 3300006948 Bacteria 314346
167 Ga0099794_10078861 3300007265 Bacteria 1622
168 Ga0099795_10022137 3300007788 Bacteria 2094
169 Ga0105244_10013012 3300009036 Bacteria 4886
170 Ga0105240_10000201 3300009093 Bacteria 121112
171 Ga0105240_10237212 3300009093 Bacteria 2116
172 Ga0111539_10002098 3300009094 Bacteria 26633
173 Ga0105245_10020119 3300009098 Bacteria 5850
174 Ga0105245_10442189 3300009098 Bacteria 1307
175 Ga0105243_10152113 3300009148 Bacteria 1986
176 Ga0105241_10110362 3300009174 Bacteria 2200
177 Ga0105248_10032169 3300009177 Bacteria 5863
178 Ga0105248_10159725 3300009177 Bacteria 2543
179 Ga0105248_10196755 3300009177 Bacteria 2271
180 Ga0105237_10002871 3300009545 Bacteria 20954
181 Ga0105237_10003330 3300009545 Bacteria 19134
182 Ga0105237_10038704 3300009545 Bacteria 4816
183 Ga0105237_10173152 3300009545 Bacteria 2159
184 Ga0105249_10478291 3300009553 Bacteria 1288
185 Ga0099796_10014960 3300010159 Bacteria 2255
186 Ga0105239_10049987 3300010375 Bacteria 4585
187 Ga0105239_10188875 3300010375 Bacteria 2306
188 Ga0105239_10319437 3300010375 Bacteria 1751
189 Ga0105239_10327427 3300010375 Bacteria 1728
190 Ga0105239_10495397 3300010375 Bacteria 1389
191 Ga0105246_10019264 3300011119 Bacteria 4358
192 Ga0157370_10001402 3300013104 Bacteria 29902
193 Ga0171463_1005 3300013249 Bacteria 358236
194 Ga0157375_10015743 3300013308 Bacteria 6776
195 Ga0157375_10067698 3300013308 Bacteria 3569
196 Ga0163163_10022921 3300014325 Bacteria 5919
197 Ga0157380_10155714 3300014326 Bacteria 1980
198 Ga0157380_10170236 3300014326 Bacteria 1902
199 Ga0157380_10447846 3300014326 Bacteria 1239
200 Ga0182008_10002242 3300014497 Bacteria 12231
201 Ga0157379_10048312 3300014968 Bacteria 3798
202 Ga0157379_10053775 3300014968 Bacteria 3598
203 Ga0157379_10148352 3300014968 Bacteria 2115
204 Ga0157376_10191779 3300014969 Bacteria 1874
205 Ga0182007_10012038 3300015262 Bacteria 3342
206 Ga0182005_1025912 3300015265 Bacteria 1600
207 Ga0183363_1022 3300015690 Bacteria 57453
208 Ga0163161_10007287 3300017792 Bacteria 7632
209 Ga0214544_1000013 3300021320 Bacteria 228947
210 Ga0214542_1000013 3300021321 Bacteria 234019
211 Ga0214545_1000012 3300021324 Bacteria 187898
212 Ga0214545_1032757 3300021324 Bacteria 1959
213 Ga0209436_100011 3300025208 Bacteria 139405
214 Ga0209436_111532 3300025208 Bacteria 1548
215 Ga0209672_100129 3300025228 Bacteria 76300
216 Ga0209672_100829 3300025228 Bacteria 14408
217 Ga0209437_100022 3300025233 Bacteria 625694
218 Ga0209258_100088 3300025242 Bacteria 237738
219 Ga0209258_100236 3300025242 Bacteria 103319
220 Ga0207425_1000002 3300025245 Bacteria 1362590
221 Ga0207425_1001067 3300025245 Bacteria 12520
222 Ga0207425_1008952 3300025245 Bacteria 2522
223 Ga0209646_1000916 3300025246 Bacteria 9486
224 Ga0209026_1006750 3300025250 Bacteria 2736
225 Ga0209677_100174 3300025253 Bacteria 55175
226 Ga0209148_1000024 3300025254 Bacteria 669890
227 Ga0209148_1000209 3300025254 Bacteria 103316
228 Ga0209759_1001537 3300025256 Bacteria 12656
229 Ga0209129_1000002 3300025258 Bacteria 1359086
230 Ga0209129_1000615 3300025258 Bacteria 24007
231 Ga0209129_1001256 3300025258 Bacteria 14547
232 Ga0209129_1019262 3300025258 Bacteria 1293
233 Ga0209233_1000031 3300025261 Bacteria 624646
234 Ga0209233_1000217 3300025261 Bacteria 106187
235 Ga0209565_1017141 3300025263 Bacteria 1594
236 Ga0209455_1000025 3300025272 Bacteria 670673
237 Ga0209673_1000139 3300025273 Bacteria 157765
238 Ga0209673_1001266 3300025273 Bacteria 25980
239 Ga0209673_1003378 3300025273 Bacteria 9495
240 Ga0209673_1003445 3300025273 Bacteria 9322
241 Ga0209673_1004658 3300025273 Bacteria 7249
242 Ga0209673_1007214 3300025273 Bacteria 5178
243 Ga0209130_1000066 3300025284 Bacteria 192626
244 Ga0209130_1000174 3300025284 Bacteria 91725
245 Ga0209130_1008246 3300025284 Bacteria 3097
246 Ga0209676_1001350 3300025292 Bacteria 24409
247 Ga0209025_1000004 3300025294 Bacteria 1361782
248 Ga0209025_1007680 3300025294 Bacteria 7964
249 Ga0209025_1016628 3300025294 Bacteria 4318
250 Ga0209564_1000117 3300025295 Bacteria 207096
251 Ga0209564_1000225 3300025295 Bacteria 126209
252 Ga0209564_1000255 3300025295 Bacteria 113017
253 Ga0209564_1000331 3300025295 Bacteria 91919
254 Ga0209564_1019349 3300025295 Bacteria 2548
255 Ga0209758_1000006 3300025297 Bacteria 1359562
256 Ga0209758_1000861 3300025297 Bacteria 42010
257 Ga0209758_1001171 3300025297 Bacteria 33282
258 Ga0209758_1005160 3300025297 Bacteria 10281
259 Ga0209758_1013710 3300025297 Bacteria 4390
260 Ga0209758_1018751 3300025297 Bacteria 3374
261 Ga0209758_1032067 3300025297 Bacteria 2142
262 Ga0209050_1009349 3300025298 Bacteria 5032
263 Ga0209256_1000131 3300025299 Bacteria 162368
264 Ga0209256_1000299 3300025299 Bacteria 86909
265 Ga0209256_1000622 3300025299 Bacteria 48813
266 Ga0209256_1001834 3300025299 Bacteria 19799
267 Ga0209256_1003652 3300025299 Bacteria 10524
268 Ga0209256_1008343 3300025299 Bacteria 4828
269 Ga0207426_1000008 3300025302 Bacteria 848730
270 Ga0207426_1001743 3300025302 Bacteria 16555
271 Ga0207426_1006027 3300025302 Bacteria 5356
272 Ga0209051_1000643 3300025303 Bacteria 39847
273 Ga0209051_1002199 3300025303 Bacteria 14416
274 Ga0209051_1008982 3300025303 Bacteria 5209
275 Ga0209051_1023723 3300025303 Bacteria 2543
276 Ga0209051_1028555 3300025303 Bacteria 2201
277 Ga0209051_1050454 3300025303 Bacteria 1393
278 Ga0209257_1002248 3300025304 Bacteria 19802
279 Ga0209257_1029512 3300025304 Bacteria 1785
280 Ga0207655_1016122 3300025728 Bacteria 4109
281 Ga0207692_10000215 3300025898 Bacteria 19463
282 Ga0207692_10062403 3300025898 Bacteria 1934
283 Ga0207692_10239169 3300025898 Bacteria 1084
284 Ga0207692_10250894 3300025898 Bacteria 1060
285 Ga0207642_10045282 3300025899 Bacteria 1952
286 Ga0207642_10102604 3300025899 Bacteria 1439
287 Ga0207699_10001468 3300025906 Bacteria 11197
288 Ga0207699_10213023 3300025906 Bacteria 1315
289 Ga0207684_10294367 3300025910 Bacteria 1399
290 Ga0207654_10072265 3300025911 Bacteria 2053
291 Ga0207654_10197679 3300025911 Bacteria 1322
292 Ga0207707_10017493 3300025912 Bacteria 6249
293 Ga0207695_10000118 3300025913 Bacteria 237085
294 Ga0207671_10000175 3300025914 Bacteria 98920
295 Ga0207693_10009787 3300025915 Bacteria 7805
296 Ga0207693_10059070 3300025915 Bacteria 3004
297 Ga0207693_10081544 3300025915 Bacteria 2533
298 Ga0207693_10108286 3300025915 Bacteria 2180
299 Ga0207693_10138364 3300025915 Bacteria 1915
300 Ga0207662_10069500 3300025918 Bacteria 2128
301 Ga0207652_10226328 3300025921 Bacteria 1686
302 Ga0207650_10000039 3300025925 Bacteria 204737
303 Ga0207650_10074550 3300025925 Bacteria 2558
304 Ga0207659_10177955 3300025926 Bacteria 1683
305 Ga0207687_10039904 3300025927 Bacteria 3216
306 Ga0207687_10096057 3300025927 Bacteria 2171
307 Ga0207700_10005756 3300025928 Bacteria 7443
308 Ga0207664_10031599 3300025929 Bacteria 4052
309 Ga0207664_10059460 3300025929 Bacteria 3043
310 Ga0207664_10449485 3300025929 Bacteria 1150
311 Ga0207644_10246474 3300025931 Bacteria 1424
312 Ga0207644_10461318 3300025931 Bacteria 1044
313 Ga0207690_10137278 3300025932 Bacteria 1797
314 Ga0207686_10080169 3300025934 Bacteria 2127
315 Ga0207709_10064340 3300025935 Bacteria 2302
316 Ga0207669_10100007 3300025937 Bacteria 1914
317 Ga0207669_10373675 3300025937 Bacteria 1108
318 Ga0207704_10311565 3300025938 Bacteria 1210
319 Ga0207665_10007952 3300025939 Bacteria 7001
320 Ga0207665_10008176 3300025939 Bacteria 6906
321 Ga0207691_10150971 3300025940 Bacteria 2043
322 Ga0207711_10049244 3300025941 Bacteria 3607
323 Ga0207711_10137788 3300025941 Bacteria 2193
324 Ga0207711_10349814 3300025941 Bacteria 1368
325 Ga0207711_10599579 3300025941 Bacteria 1028
326 Ga0207689_10058238 3300025942 Bacteria 3178
327 Ga0207689_10070860 3300025942 Bacteria 2863
328 Ga0207689_10087113 3300025942 Bacteria 2566
329 Ga0207661_10018471 3300025944 Bacteria 5179
330 Ga0207679_10381462 3300025945 Bacteria 1236
331 Ga0207651_10047261 3300025960 Bacteria 2901
332 Ga0207651_10155936 3300025960 Bacteria 1784
333 Ga0207712_10179060 3300025961 Bacteria 1664
334 Ga0207668_10135775 3300025972 Bacteria 1884
335 Ga0207668_10150973 3300025972 Bacteria 1798
336 Ga0207668_10230983 3300025972 Bacteria 1491
337 Ga0207668_10287993 3300025972 Bacteria 1350
338 Ga0207640_10014501 3300025981 Bacteria 4540
339 Ga0207640_10084049 3300025981 Bacteria 2184
340 Ga0207703_10020070 3300026035 Bacteria 5223
341 Ga0207703_10033168 3300026035 Bacteria 4091
342 Ga0207639_10025696 3300026041 Bacteria 4273
343 Ga0207678_10089522 3300026067 Bacteria 2630
344 Ga0207678_10162826 3300026067 Bacteria 1905
345 Ga0207702_10085572 3300026078 Bacteria 2748
346 Ga0207641_10084948 3300026088 Bacteria 2756
347 Ga0207648_10310003 3300026089 Bacteria 1417
348 Ga0207676_10000035 3300026095 Bacteria 204737
349 Ga0207675_100000029 3300026118 Bacteria 109352
350 Ga0207675_100033572 3300026118 Bacteria 4781
351 Ga0207675_100089926 3300026118 Bacteria 2886
352 Ga0207675_100234025 3300026118 Bacteria 1773
353 Ga0207683_10045034 3300026121 Bacteria 3858
354 Ga0207683_10049809 3300026121 Bacteria 3668
355 Ga0207683_10206149 3300026121 Bacteria 1788
356 Ga0207698_10007770 3300026142 Bacteria 6736
357 Ga0207698_10210856 3300026142 Bacteria 1748
358 Ga0209281_1001051 3300027111 Bacteria 20858
359 Ga0209389_1000163 3300027296 Bacteria 55041
360 Ga0209371_1001722 3300027312 Bacteria 13838
361 Ga0209371_1003088 3300027312 Bacteria 8494
362 Ga0209589_1000002 3300027357 Bacteria 708598
363 Ga0209489_100002 3300027361 Bacteria 708609
364 Ga0209489_101100 3300027361 Bacteria 55041
365 Ga0209700_100002 3300027363 Bacteria 708598
366 Ga0209700_100014 3300027363 Bacteria 299349
367 Ga0209282_1000009 3300027666 Bacteria 233366
368 Ga0209588_1004478 3300027671 Bacteria 3944
369 Ga0207428_10000560 3300027907 Bacteria 43937
370 Ga0207428_10002329 3300027907 Bacteria 19020
371 Ga0268266_10022307 3300028379 Bacteria 5395
372 Ga0268266_10066111 3300028379 Bacteria 3126
373 Ga0268266_10072134 3300028379 Bacteria 2993
374 Ga0268266_10072159 3300028379 Bacteria 2993
375 Ga0268266_10074416 3300028379 Bacteria 2949
376 Ga0268266_10099972 3300028379 Bacteria 2554
377 Ga0268265_10000006 3300028380 Bacteria 466482
378 Ga0268265_10011076 3300028380 Bacteria 6093
379 Ga0268265_10163153 3300028380 Bacteria 1896
380 Ga0268265_10250613 3300028380 Bacteria 1568
381 Ga0268264_10000062 3300028381 Bacteria 302110
382 Ga0268264_10341015 3300028381 Bacteria 1423
383 Ga0265334_10049386 3300028573 Bacteria 1618
384 Ga0265336_10000816 3300028666 Bacteria 16369
385 Ga0307517_10092154 3300028786 Bacteria 2468
386 Ga0307517_10168772 3300028786 Bacteria 1445
387 Ga0307515_10138045 3300028794 Bacteria 2635
388 Ga0307515_10194014 3300028794 Bacteria 1930
389 Ga0265338_10000572 3300028800 Bacteria 64902
390 Ga0268256_1000785 3300030500 Bacteria 22910
391 Ga0268256_1003493 3300030500 Bacteria 7057
392 Ga0307511_10030724 3300030521 Bacteria 4819
393 Ga0265331_10075526 3300031250 Bacteria 1571
394 Ga0307513_10041634 3300031456 Bacteria 5067
395 Ga0307513_10069169 3300031456 Bacteria 3695
396 Ga0307509_10019301 3300031507 Bacteria 7781
397 Ga0307509_10046512 3300031507 Bacteria 4671
398 Ga0307408_100003016 3300031548 Bacteria 11633
399 Ga0307508_10085997 3300031616 Bacteria 2727
400 Ga0265314_10002700 3300031711 Bacteria 17767
401 Ga0265342_10021476 3300031712 Bacteria 4120
402 Ga0307516_10002464 3300031730 Bacteria 24733
403 Ga0307516_10260437 3300031730 Bacteria 1425
404 Ga0307405_10254827 3300031731 Bacteria 1308
405 Ga0307410_10012481 3300031852 Bacteria 4917
406 Ga0307406_10000771 3300031901 Bacteria 17969
407 Ga0307406_10044488 3300031901 Bacteria 2783
408 Ga0307406_10122943 3300031901 Bacteria 1808
409 Ga0307412_10025137 3300031911 Bacteria 3685
410 Ga0307409_100105236 3300031995 Bacteria 2352
411 Ga0307409_100134590 3300031995 Bacteria 2118
412 Ga0307416_100108681 3300032002 Bacteria 2437
413 Ga0307416_100394017 3300032002 Bacteria 1420
414 Ga0307414_10000018 3300032004 Bacteria 237060
415 Ga0307415_100255748 3300032126 Bacteria 1426
416 Ga0307510_10016774 3300033180 Bacteria 8640
417 Ga0307510_10122315 3300033180 Bacteria 2303
418 Ga0307510_10256375 3300033180 Bacteria 1233
419 Ga0373926_0112063 3300035083 Bacteria 1025
420 Ga0373923_0087281 3300035111 Bacteria 1360
421 Ga0373923_0161312 3300035111 Bacteria 1023
422 Ga0373943_0038999 3300035170 Bacteria 2286
423 Ga0373943_0111585 3300035170 Bacteria 1443
424 Ga0373942_0027848 3300035207 Bacteria 1473
425 Ga0373931_0055602 3300035691 Bacteria 2118
426 Ga0373931_0071495 3300035691 Bacteria 1895
427 Ga0373931_0262479 3300035691 Bacteria 1054
428 Ga0373935_0171166 3300035692 Bacteria 1486
429 Ga0373927_0003977 3300035695 Bacteria 10453
430 Ga0373927_0071556 3300035695 Bacteria 2244
431 Ga0373933_0051988 3300035724 Bacteria 2450
432 Ga0373947_0020723 3300035725 Bacteria 3799
433 Ga0373937_0131839 3300036401 Bacteria 2334
434 Ga0373925_0006499 3300037068 Bacteria 8594
435 Ga0373925_0043778 3300037068 Bacteria 3323
436 Ga0373925_0077902 3300037068 Bacteria 2517
437 Ga0395901_0187072 3300038443 Bacteria 2172
438 Ga0439447_000286 3300041407 Bacteria 18000
439 Ga0439461_0002294 3300041410 Bacteria 3037
440 Ga0439466_0008235 3300041411 Bacteria 3930
441 Ga0439466_0011134 3300041411 Bacteria 3331
442 Ga0439465_0002144 3300041413 Bacteria 6481
443 Ga0451807_1369558 3300041486 Bacteria 1776
444 Ga0451833_0055069 3300041491 Bacteria 1503
445 Ga0451847_0770903 3300041503 Bacteria 1845
446 Ga0451851_0373797 3300041507 Bacteria 3921
447 Ga0439431_0002340 3300041997 Bacteria 4187
448 Ga0439445_0036348 3300042004 Bacteria 1296
449 Ga0439432_063961 3300042006 Bacteria 1130
450 Ga0439449_0001954 3300042007 Bacteria 8096
451 Ga0439434_0016395 3300042435 Bacteria 2214
452 Ga0466966_0034962 3300044684 Bacteria 3248
453 Ga0466968_0040719 3300044735 Bacteria 1960
454 Ga0495603_0008522 3300046455 Bacteria 6195
455 Ga0495603_0095992 3300046455 Bacteria 1732
456 Ga0495629_0001177 3300046459 Bacteria 20634
457 Ga0495629_0059347 3300046459 Bacteria 2674
458 Ga0495638_0024226 3300046460 Bacteria 3960
459 Ga0495638_0192148 3300046460 Bacteria 1158
460 Ga0495641_0031217 3300046461 Bacteria 2547
461 Ga0495653_0061296 3300046463 Bacteria 2847
462 Ga0495605_0134187 3300046474 Bacteria 1114
463 Ga0495662_0051243 3300046476 Bacteria 1993
464 Ga0495594_0072393 3300046499 Bacteria 1917
465 Ga0495607_0012359 3300046501 Bacteria 5642
466 Ga0495583_0001798 3300046506 Bacteria 20297
467 Ga0495606_0000161 3300046507 Bacteria 117607
468 Ga0495610_0015862 3300046512 Bacteria 4360
469 Ga0495610_0021278 3300046512 Bacteria 3571
470 Ga0495610_0051177 3300046512 Bacteria 2012
471 Ga0495610_0057426 3300046512 Bacteria 1866
472 Ga0495610_0071632 3300046512 Bacteria 1615
473 Ga0495631_0077962 3300046518 Bacteria 1430
474 Ga0495643_0013947 3300046522 Bacteria 4790
475 Ga0495643_0017843 3300046522 Bacteria 4139
476 Ga0495643_0025587 3300046522 Bacteria 3338
477 Ga0495663_0026086 3300046525 Bacteria 1709
478 Ga0495666_0046736 3300046526 Bacteria 2086
479 Ga0495645_0046993 3300046543 Bacteria 3146
480 Ga0495622_0025843 3300046557 Bacteria 2743
481 Ga0495667_0155243 3300046559 Bacteria 1473
482 Ga0495668_0000002 3300046616 Bacteria 763179
483 Ga0495668_0177931 3300046616 Bacteria 1165
484 Ga0495634_0028166 3300046642 Bacteria 3902
485 Ga0495625_0003303 3300046660 Bacteria 16271
486 Ga0495625_0018451 3300046660 Bacteria 5446
487 Ga0495625_0149748 3300046660 Bacteria 1569
488 Ga0495635_0000978 3300046663 Bacteria 18814
489 Ga0495588_0003105 3300046674 Bacteria 7192
490 Ga0495669_0015704 3300046684 Bacteria 3242
491 Ga0495613_0301926 3300046689 Bacteria 1108
492 Ga0495624_0045881 3300046690 Bacteria 2780
493 Ga0495589_0171585 3300046794 Bacteria 1031
494 Ga0495660_0021283 3300046810 Bacteria 3714
495 Ga0495660_0090367 3300046810 Bacteria 1592
496 Ga0495604_0000626 3300047317 Bacteria 30413
497 Ga0495674_0092406 3300047319 Bacteria 2583
498 Ga0495674_0183477 3300047319 Bacteria 1741
499 Ga0495674_0250785 3300047319 Bacteria 1457
500 Ga0495676_0308024 3300047321 Bacteria 1066
501 Ga0495687_000521 3300047443 Bacteria 46065
502 Ga0495687_000748 3300047443 Bacteria 35192
503 Ga0495687_002186 3300047443 Bacteria 16274
504 Ga0495673_0047864 3300047469 Bacteria 1888
505 Ga0495684_0004330 3300047471 Bacteria 11092
506 Ga0495686_0077646 3300047472 Bacteria 2033
507 Ga0495686_0184387 3300047472 Bacteria 1207
508 Ga0495602_0018555 3300048088 Bacteria 6942
509 Ga0495602_0130747 3300048088 Bacteria 2003
510 Ga0496100_0002867 3300048903 Bacteria 8835
511 Ga0496100_0014569 3300048903 Bacteria 4568
512 Ga0496101_0001838 3300048904 Bacteria 12798
513 Ga0496101_0020397 3300048904 Bacteria 4536
514 Ga0496102_0048548 3300048905 Bacteria 3859
515 Ga0496102_0060614 3300048905 Bacteria 3460
516 Ga0496102_0297745 3300048905 Bacteria 1520
517 Ga0496103_0006117 3300048906 Bacteria 7190
518 Ga0496103_0016546 3300048906 Bacteria 4401
519 Ga0496103_0021882 3300048906 Bacteria 3847
520 Ga0496104_0018207 3300048907 Bacteria 6406
521 Ga0496104_0021062 3300048907 Bacteria 5981
522 Ga0496104_0070144 3300048907 Bacteria 3331
523 Ga0496104_0159562 3300048907 Bacteria 2163
524 Ga0496105_0012970 3300048908 Bacteria 6604
525 Ga0496105_0041364 3300048908 Bacteria 3798
526 Ga0496106_0000093 3300048909 Bacteria 67667
527 Ga0496106_0051678 3300048909 Bacteria 3099
528 Ga0496106_0101291 3300048909 Bacteria 2234
529 Ga0496106_0307303 3300048909 Bacteria 1272
530 Ga0496106_0519153 3300048909 Bacteria 956
531 Ga0496107_0047573 3300048910 Bacteria 3088
532 Ga0496107_0061952 3300048910 Bacteria 2709
533 Ga0496107_0106792 3300048910 Bacteria 2056
534 Ga0496107_0123725 3300048910 Bacteria 1906
535 Ga0496108_0006949 3300048911 Bacteria 9160
536 Ga0496108_0026774 3300048911 Bacteria 4759
537 Ga0496109_0069613 3300048912 Bacteria 3227
538 Ga0496109_0143251 3300048912 Bacteria 2235
539 Ga0496109_0490000 3300048912 Bacteria 1160
540 Ga0496110_0100973 3300048913 Bacteria 2586
541 Ga0496110_0215354 3300048913 Bacteria 1746
542 Ga0496110_0234946 3300048913 Bacteria 1668
543 Ga0496111_0089652 3300048914 Bacteria 2252
544 Ga0496112_0081132 3300048915 Bacteria 3207
545 Ga0496112_0132350 3300048915 Bacteria 2465
546 Ga0496112_0371258 3300048915 Bacteria 1372
547 Ga0496113_0024311 3300048916 Bacteria 4304
548 Ga0496114_0026876 3300048917 Bacteria 4714
549 Ga0496114_0206226 3300048917 Bacteria 1723
550 Ga0496115_0004235 3300048918 Bacteria 10372
551 Ga0496115_0251185 3300048918 Bacteria 1456
552 Ga0496116_0041410 3300048919 Bacteria 3160
553 Ga0496116_0069069 3300048919 Bacteria 2248
554 Ga0496117_0004844 3300048920 Bacteria 14549
555 Ga0496117_0008863 3300048920 Bacteria 9493
556 Ga0496117_0129150 3300048920 Bacteria 1535
557 Ga0496118_0004178 3300048921 Bacteria 17389
558 Ga0496118_0005397 3300048921 Bacteria 14549
559 Ga0496118_0011760 3300048921 Bacteria 8505
560 Ga0496118_0047620 3300048921 Bacteria 3320
561 Ga0496119_0000390 3300048922 Bacteria 60662
562 Ga0496119_0006421 3300048922 Bacteria 10903
563 Ga0496119_0029847 3300048922 Bacteria 3687
564 Ga0496119_0032878 3300048922 Bacteria 3451
565 Ga0496119_0085568 3300048922 Bacteria 1804
566 Ga0496120_0002913 3300048923 Bacteria 16344
567 Ga0496120_0026293 3300048923 Bacteria 3595
568 Ga0496121_0002660 3300048924 Bacteria 26794
569 Ga0496121_0002696 3300048924 Bacteria 26537
570 Ga0496121_0026649 3300048924 Bacteria 5436
571 Ga0496121_0052853 3300048924 Bacteria 3407
572 Ga0496121_0060528 3300048924 Bacteria 3114
573 Ga0496122_0000047 3300048925 Bacteria 274226
574 Ga0496122_0037604 3300048925 Bacteria 3893
575 Ga0496122_0095401 3300048925 Bacteria 2010
576 Ga0496122_0213571 3300048925 Bacteria 1114
577 Ga0496123_0000077 3300048926 Bacteria 192607
578 Ga0496123_0000393 3300048926 Bacteria 81747
579 Ga0496123_0019962 3300048926 Bacteria 5261
580 Ga0496123_0021688 3300048926 Bacteria 4982
581 Ga0496124_0029367 3300048927 Bacteria 4901
582 Ga0496124_0041508 3300048927 Bacteria 3969
583 Ga0496124_0083496 3300048927 Bacteria 2620
584 Ga0496124_0123602 3300048927 Bacteria 2064
585 Ga0496124_0281151 3300048927 Bacteria 1213
586 Ga0496125_0000105 3300048928 Bacteria 200717
587 Ga0496125_0053125 3300048928 Bacteria 3325
588 Ga0496126_0010668 3300048929 Bacteria 9604
589 Ga0496126_0040859 3300048929 Bacteria 4297
590 Ga0496126_0179249 3300048929 Bacteria 1801
591 Ga0496126_0286912 3300048929 Bacteria 1362
592 Ga0496126_0363782 3300048929 Bacteria 1181
593 Ga0495682_0097034 3300049460 Bacteria 1058
594 Ga0501031_0147246 3300049568 Bacteria 1538
595 Ga0501032_0022921 3300049569 Bacteria 4322
596 Ga0501033_0009780 3300049570 Bacteria 7366
597 Ga0501033_0033244 3300049570 Bacteria 3872
598 Ga0501033_0097200 3300049570 Bacteria 2152
599 Ga0501034_0003451 3300049571 Bacteria 18019
600 Ga0501034_0051312 3300049571 Bacteria 4159
601 Ga0501034_0098738 3300049571 Bacteria 2915
602 Ga0501034_0154722 3300049571 Bacteria 2267
603 Ga0501034_0188927 3300049571 Bacteria 2023
604 Ga0501034_0535031 3300049571 Bacteria 1082
605 Ga0501036_0090569 3300049572 Bacteria 2583
606 Ga0501036_0120847 3300049572 Bacteria 2212
607 Ga0501037_0017509 3300049573 Bacteria 5273
608 Ga0501037_0227513 3300049573 Bacteria 1310
609 Ga0501038_0082564 3300049574 Bacteria 2705
610 Ga0501038_0102082 3300049574 Bacteria 2387
611 Ga0501038_0363153 3300049574 Bacteria 1126
612 Ga0501039_0027289 3300049575 Bacteria 4390
613 Ga0501039_0191077 3300049575 Bacteria 1610
614 Ga0501042_0013985 3300049578 Bacteria 5469
615 Ga0501043_0037940 3300049579 Bacteria 3790
616 Ga0501043_0057065 3300049579 Bacteria 3066
617 Ga0501043_0168413 3300049579 Bacteria 1710
618 Ga0501046_0112978 3300049580 Bacteria 2074
619 Ga0501046_0166256 3300049580 Bacteria 1657
620 Ga0501047_0049777 3300049581 Bacteria 4045
621 Ga0501047_0054806 3300049581 Bacteria 3856
622 Ga0501047_0152148 3300049581 Bacteria 2189
623 Ga0501047_0381201 3300049581 Bacteria 1244
624 Ga0501048_0002535 3300049582 Bacteria 13973
625 Ga0501048_0039881 3300049582 Bacteria 3366
626 Ga0501069_0151525 3300049585 Bacteria 1333
627 Ga0501070_0063375 3300049586 Bacteria 3062
628 Ga0501070_0186078 3300049586 Bacteria 1708
629 Ga0501073_0017180 3300049589 Bacteria 5240
630 Ga0501074_0040694 3300049590 Bacteria 3365
631 Ga0501083_0217365 3300049744 Bacteria 1245
632 Ga0501035_0374333 3300049822 Bacteria 1188
633 Ga0501035_0377287 3300049822 Bacteria 1183
634 Ga0501044_0007532 3300049823 Bacteria 11972
635 Ga0501044_0153059 3300049823 Bacteria 2288
636 Ga0501045_0009657 3300049824 Bacteria 6751
637 nmdc:mga03683_13848_c1 3300050489 Bacteria 2974
638 nmdc:mga00v17_11869_c1 3300050491 Bacteria 4795
639 nmdc:mga0k408_117874_c1 3300050493 Bacteria 1571
640 nmdc:mga0k408_121597_c1 3300050493 Bacteria 1546
641 nmdc:mga07m45_126241_c1 3300050496 Bacteria 1479
642 nmdc:mga05p37_890_c1 3300050507 Bacteria 33690
643 nmdc:mga09592_17280_c1 3300050508 Bacteria 5909
644 nmdc:mga0qj67_17074_c1 3300050509 Bacteria 5515
645 nmdc:mga06r32_12281_c1 3300050510 Bacteria 7725
646 nmdc:mga06r32_68226_c1 3300050510 Bacteria 3435
647 nmdc:mga08y16_1184_c1 3300050511 Bacteria 25736
648 nmdc:mga08y16_31589_c1 3300050511 Bacteria 5569
649 nmdc:mga08y16_609_c1 3300050511 Bacteria 33341
650 nmdc:mga0n895_112098_c1 3300050512 Bacteria 2745
651 nmdc:mga0a205_45969_c2 3300050515 Bacteria 3753
652 Ga0495601_0002861 3300053077 Bacteria 9810
653 Ga0495612_0021342 3300053078 Bacteria 2598
654 Ga0500643_059687 3300053087 Bacteria 1073
655 Ga0500644_0024690 3300053088 Bacteria 1841
656 Ga0500644_0053889 3300053088 Bacteria 1390
657 Ga0500566_0000074 3300053094 Bacteria 48359
658 Ga0500566_0003680 3300053094 Bacteria 9155
659 Ga0500640_000535 3300053095 Bacteria 9608
660 Ga0500569_000794 3300053109 Bacteria 5544
661 Ga0500569_012100 3300053109 Bacteria 2079
662 Ga0500572_000414 3300053111 Bacteria 15011
663 Ga0500595_000348 3300053119 Bacteria 30151
664 Ga0500618_000720 3300053125 Bacteria 18953
665 Ga0500618_040919 3300053125 Bacteria 1064
666 Ga0500658_0000516 3300053134 Bacteria 16413
667 Ga0500658_0001317 3300053134 Bacteria 10046
668 Ga0500658_0152864 3300053134 Bacteria 1041
669 Ga0500559_0000683 3300053136 Bacteria 22548
670 Ga0500568_0000740 3300053139 Bacteria 23333
671 Ga0500573_0027376 3300053140 Bacteria 3278
672 Ga0500616_0000731 3300053153 Bacteria 37996
673 Ga0500616_0016056 3300053153 Bacteria 4271
674 Ga0500616_0037385 3300053153 Bacteria 2629
675 Ga0500622_0000170 3300053156 Bacteria 70088
676 Ga0500633_0004866 3300053160 Bacteria 3130
677 Ga0500638_021318 3300053162 Bacteria 3060
678 Ga0500637_0000110 3300053178 Bacteria 29626
679 Ga0500637_0022523 3300053178 Bacteria 3433
680 Ga0500661_002499 3300055283 Bacteria 3470
681 Ga0501082_0014164 3300060353 Bacteria 6863
682 Ga0501082_0121908 3300060353 Bacteria 2260
683 2509380292 2509276019 Bacteria 6802256
684 2509442533 2509276033 Bacteria 7180565
685 2509446221 2509276033 Bacteria 7180565
686 2510302723 2510065057 Bacteria 6649661
687 2510894308 2510461076 Bacteria 8618824
688 2510899333 2510461076 Bacteria 8618824
689 2511181789 2510917028 Bacteria 6185411
690 2511497775 2511231052 Bacteria 6974333
691 2513569987 2513237084 Bacteria 7231967
692 2513571651 2513237084 Bacteria 7231967
693 2513578687 2513237085 Bacteria 7695351
694 2513584568 2513237086 Bacteria 7265287
695 2513616418 2513237091 Bacteria 6900273
696 2513630130 2513237093 Bacteria 7545552
697 2513671705 2513237098 Bacteria 9902361
698 2513680213 2513237098 Bacteria 9902361
699 2513869657 2513237138 Bacteria 7368160
700 2513873237 2513237139 Bacteria 8737671
701 2513883885 2513237140 Bacteria 7076289
702 2513902011 2513237143 Bacteria 6664116
703 2513923868 2513237146 Bacteria 7166346
704 2513923876 2513237146 Bacteria 7166346
705 2514015491 2513237161 Bacteria 8871253
706 2514015492 2513237161 Bacteria 8871253
707 2514019424 2513237162 Bacteria 7468464
708 2515111880 2515075009 Bacteria 7288508
709 2515114428 2515075009 Bacteria 7288508
710 2515643162 2515154114 Bacteria 7848616
711 2515656271 2515154116 Bacteria 7552979
712 2516896575 2516653046 Bacteria 6989037
713 2517078343 2516653085 Bacteria 7346596
714 2517406427 2517287029 Bacteria 6905599
715 2517408513 2517287029 Bacteria 6905599
716 2517894613 2517572143 Bacteria 9484767
717 2520376163 2519899620 Bacteria 6499161
718 2524436318 2524023205 Bacteria 8918781
719 2524461557 2524023209 Bacteria 6679728
720 2524469238 2524023210 Bacteria 9029266
721 2530645189 2529292951 Bacteria 6916614
722 2551681432 2551306084 Bacteria 8942552
723 2551684669 2551306085 Bacteria 7347181
724 2551708251 2551306089 Bacteria 7162724
725 2551716023 2551306090 Bacteria 7953713
726 2585203225 2582581294 Bacteria 6626667
727 2585205466 2582581294 Bacteria 6626667
728 2585226627 2582581298 Bacteria 7315509
729 2585230453 2582581299 Bacteria 6518058
730 2585280898 2582581308 Bacteria 7413247
731 2585394451 2582581866 Bacteria 6859583
732 2585404530 2582581867 Bacteria 7184437
733 2585404950 2582581867 Bacteria 7184437
734 2585526021 2585427526 Bacteria 7258840
735 2585530602 2585427527 Bacteria 7273426
736 2585549701 2585427529 Bacteria 7395659
737 2585554780 2585427530 Bacteria 7383882
738 2585824226 2585427590 Bacteria 6824633
739 2585992651 2585427633 Bacteria 6413184
740 2595452291 2593339239 Bacteria 4124669
741 2599415906 2599185170 Bacteria 7295545
742 2599415916 2599185170 Bacteria 7295545
743 2600196723 2599185352 Bacteria 7228948
744 2600196729 2599185352 Bacteria 7228948
745 2601611478 2600255279 Bacteria 5605316
746 2601748101 2600255308 Bacteria 5611129
747 2616310719 2615840626 Bacteria 7921970
748 2616553165 2615840698 Bacteria 7319877
749 2617350721 2617270735 Bacteria 9163226
750 2617378882 2617270741 Bacteria 8201522
751 2643805578 2643221557 Bacteria 7184309
752 2644064629 2643221610 Bacteria 7480339
753 2644064635 2643221610 Bacteria 7480339
754 2644106735 2643221618 Bacteria 7717186
755 2644109680 2643221618 Bacteria 7717186
756 2644148086 2643221626 Bacteria 8069654
757 2644148986 2643221626 Bacteria 8069654
758 2644196814 2643221634 Bacteria 6705461
759 2644288076 2643221651 Bacteria 4798932
760 2644289263 2643221651 Bacteria 4798932
761 2644310039 2643221655 Bacteria 7722067
762 2644312558 2643221655 Bacteria 7722067
763 2644331988 2643221659 Bacteria 7890716
764 2644336887 2643221659 Bacteria 7890716
765 2644355276 2643221664 Bacteria 7272945
766 2644377136 2643221668 Bacteria 7306521
767 2644377142 2643221668 Bacteria 7306521
768 2644419484 2643221675 Bacteria 7473456
769 2644419490 2643221675 Bacteria 7473456
770 2644452841 2643221680 Bacteria 7473610
771 2644452847 2643221680 Bacteria 7473610
772 2644540873 2643221698 Bacteria 7756764
773 2644543905 2643221698 Bacteria 7756764
774 2644616257 2643221712 Bacteria 7729434
775 2644618289 2643221712 Bacteria 7729434
776 2644636863 2643221715 Bacteria 6671032
777 2644672030 2643221723 Bacteria 7095460
778 2644672036 2643221723 Bacteria 7095460
779 2644691832 2643221726 Bacteria 7455827
780 2644691838 2643221726 Bacteria 7455827
781 2644734444 2643221734 Bacteria 5365412
782 2644747790 2643221736 Bacteria 6608466
783 2692318060 2690316117 Bacteria 6800650
784 2719385467 2718217927 Bacteria 6972593
785 2721399215 2718218423 Bacteria 6438183
786 2723845405 2721755755 Bacteria 8322773
787 2724038028 2721755809 Bacteria 6438790
788 2725949807 2724679232 Bacteria 7646494
789 2739591546 2739367651 Bacteria 6359826
790 2747948559 2747842428 Bacteria 4689383
791 2765465369 2765235802 Bacteria 5618596
792 2776272033 2775506902 Bacteria 6208009
793 2776279447 2775506904 Bacteria 5954060
794 2792624916 2791355091 Bacteria 6135441
795 2792643908 2791355094 Bacteria 7011481
796 2792644099 2791355094 Bacteria 7011481
797 2792749954 2791355123 Bacteria 8049106
798 2793061026 2791355196 Bacteria 7323613
799 2793077763
800 2793295362 2791355256 Bacteria 6798008
801 2793313829 2791355259 Bacteria 7254731
802 2805914774 2802429603 Bacteria 8777136
803 2805928110 2802429605 Bacteria 6875453
804 2805929234 2802429605 Bacteria 6875453
805 2805932509 2802429606 Bacteria 6346811
806 2819613460 2818991448 Bacteria 6772224
807 2819641096 2818991453 Bacteria 7181617
808 2824616740 2824609381 Bacteria 8672835
809 2824659768 2824653114 Bacteria 8493680
810 2824660398 2824653114 Bacteria 8493680
811 2824675966 2824671348 Bacteria 8369588
812 2824692073 2824687955 Bacteria 8360029
813 2824700319 2824696289 Bacteria 8335049
814 2824734302 2824732956 Bacteria 7810675
815 2824747858 2824746037 Bacteria 7911610
816 2824780441 2824773399 Bacteria 8360218
817 2834643351 2834641062 Bacteria 5559922
818 2838034441 2838029111 Bacteria 6603031
819 2838036025 2838035591 Bacteria 7166484
820 2838036033 2838035591 Bacteria 7166484
821 2838127842 2838122688 Bacteria 8803140
822 2838667446 2838661181 Bacteria 7385261
823 2838673391 2838668709 Bacteria 6671819
824 2838681028 2838680041 Bacteria 6545511
825 2838690323 2838686498 Bacteria 7807632
826 2838694939 2838694306 Bacteria 6853137
827 2838706138 2838701080 Bacteria 6669771
828 2838708315 2838707686 Bacteria 6619912
829 2838732080 2838729681 Bacteria 7400765
830 2838744976 2838742623 Bacteria 7396178
831 2839998168 2839993093 Bacteria 5512535
832 2840767811 2840764183 Bacteria 6358399
833 2841856034 2841851746 Bacteria 7532261
834 2841943134 2841941048 Bacteria 8688029
835 2841943135 2841941048 Bacteria 8688029
836 2841968224 2841966195 Bacteria 8673214
837 2841968225 2841966195 Bacteria 8673214
838 2841976565 2841974524 Bacteria 8931498
839 2841987939 2841983080 Bacteria 8395090
840 2842080451 2842077413 Bacteria 6508645
841 2842121070 2842118031 Bacteria 7033875
842 2842150519 2842146304 Bacteria 5957337
843 2842161203 2842156927 Bacteria 6894975
844 2842184820 2842180545 Bacteria 6888678
845 2842192749 2842192696 Bacteria 6147454
846 2842207097 2842205361 Bacteria 6340321
847 2842232402 2842229732 Bacteria 7475766
848 2842237727 2842237096 Bacteria 6620661
849 2842246818 2842243621 Bacteria 7421798
850 2842255602 2842250916 Bacteria 6579627
851 2842261081 2842257432 Bacteria 7401195
852 2842274343 2842271015 Bacteria 7807131
853 2842280210 2842278818 Bacteria 6340002
854 2842294110 2842291075 Bacteria 7076806
855 2842303137 2842298080 Bacteria 6123127
856 2842305815 2842304105 Bacteria 7023636
857 2842323868 2842317721 Bacteria 6793725
858 2842361427 2842357229 Bacteria 6485165
859 2842371491 2842370503 Bacteria 7038661
860 2842380507 2842377471 Bacteria 7140707
861 2842387578 2842384541 Bacteria 7057858
862 2842481188 2842475841 Bacteria 6603183
863 2842492600 2842489311 Bacteria 6620893
864 2842494570 2842489311 Bacteria 6620893
865 2842507901 2842502639 Bacteria 6604161
866 2842513593 2842509118 Bacteria 6850950
867 2842694626 2842694124 Bacteria 4063419
868 2842715697 2842711865 Bacteria 7155354
869 2844168015 2844163670 Bacteria 7266046
870 2844456978 2844454524 Bacteria 7952546
871 2847423432 2847417321 Bacteria 6913799
872 2847931330 2847930680 Bacteria 9342022
873 2847947139 2847939898 Bacteria 8606328
874 2849081477 2849076700 Bacteria 7039503
875 2850085713 2850079185 Bacteria 6848280
876 2852392980 2852387548 Bacteria 8025568
877 2855828591 2855825444 Bacteria 6785811
878 2855843717 2855839649 Bacteria 7135830
879 2858807038 2858800743 Bacteria 6603254
880 2858956279 2858950400 Bacteria 6783797
881 2874607705 2874604998 Bacteria 7834745
882 2876812081 2876808645 Bacteria 8824342
883 2876817473 2876808645 Bacteria 8824342
884 2879087629 2879083081 Bacteria 8587928
885 2879110485 2879110137 Bacteria 8907982
886 2879112657 2879110137 Bacteria 8907982
887 2883292924 2883291878 Bacteria 5894118
888 2887376891 2887375801 Bacteria 5334027
889 2889020903 2889016732 Bacteria 6700763
890 2889039589 2889033259 Bacteria 9099371
891 2889042432 2889033259 Bacteria 9099371
892 2893066892 2893066018 Bacteria 6158120
893 2894657141 2894652903 Bacteria 4587256
894 2896386587 2896384573 Bacteria 7700774
895 2902407475 2902405164 Bacteria 6784948
896 2902811668 2902810491 Bacteria 6794147
897 2902840751 2902837492 Bacteria 6697721
898 2903771098 2903768456 Bacteria 9749579
899 2903776277 2903768456 Bacteria 9749579
900 2904698311 2904690495 Bacteria 9412302
901 2904700655
902 2906643449 2906635258 Bacteria 8601019
903 2906651717 2906643746 Bacteria 8722424
904 2908762912 2908756301 Bacteria 8864324
905 2908778068 2908775508 Bacteria 8092255
906 2915988061 2915986958 Bacteria 6739310
907 2915998184 2915993759 Bacteria 7016183
908 2916002531 2916000859 Bacteria 6865702
909 2916007301 2916000859 Bacteria 6865702
910 2916011302 2916007675 Bacteria 6898660
911 2916020539 2916014648 Bacteria 6946486
912 2916028123 2916021584 Bacteria 6854472
913 2916032843 2916028427 Bacteria 6748433
914 2916038229 2916035215 Bacteria 6755766
915 2916044999 2916041962 Bacteria 6820487
916 2916051936 2916048683 Bacteria 6543552
917 2916059495 2916055098 Bacteria 6758838
918 2916076023 2916068649 Bacteria 6943657
919 2916077800 2916076590 Bacteria 6596108
920 2917704674 2917699015 Bacteria 7043791
921 2917742765 2917736166 Bacteria 9690793
922 2919106133 2919100787 Bacteria 7710546
923 2919120744 2919119836 Bacteria 5208557
924 2919135963 2919134579 Bacteria 4480386
925 2919467343 2919462493 Bacteria 5817112
926 2921203182 2921201388 Bacteria 6926299
927 2921208733 2921208531 Bacteria 6745326
928 2921208744 2921208531 Bacteria 6745326
929 2921213287 2921208531 Bacteria 6745326
930 2921240554 2921237296 Bacteria 6876710
931 2921245756 2921244191 Bacteria 6568419
932 2921260069 2921257292 Bacteria 6808382
933 2921268420 2921263974 Bacteria 6864552
934 2921284643 2921282425 Bacteria 6826397
935 2921290540 2921289301 Bacteria 7316391
936 2921304039 2921296804 Bacteria 7176999
937 2923559114 2923556063 Bacteria 6793593
938 2923559423 2923556063 Bacteria 6793593
939 2924148142 2924144063 Bacteria 6883928
940 2924154741 2924150972 Bacteria 7169444
941 2924163948 2924158325 Bacteria 7188855
942 2924168415 2924165586 Bacteria 7260590
943 2924177206 2924172951 Bacteria 6749356
944 2924182060 2924179722 Bacteria 6843264
945 2924186205 2924179722 Bacteria 6843264
946 2924186216 2924179722 Bacteria 6843264
947 2924188934 2924186466 Bacteria 6876637
948 2924195786 2924193448 Bacteria 6955718
949 2924202945 2924200457 Bacteria 6757188
950 2924209979 2924207177 Bacteria 6917007
951 2924221305 2924214083 Bacteria 7080103
952 2924228362 2924221636 Bacteria 7113495
953 2924233784 2924228884 Bacteria 6633132
954 2933018982 2933016740 Bacteria 6355406
955 2933022158 2933016740 Bacteria 6355406
956 2933572320 2933570622 Bacteria 7023390
957 2935773789 2935769743 Bacteria 7878163
958 2935788775 2935785616 Bacteria 7962367
959 2935795599 2935793552 Bacteria 8012592
960 2935895461 2935894831 Bacteria 6620579
961 2936386966 2936381700 Bacteria 7006523
962 2937005859 2937002841 Bacteria 6934057
963 2937014307 2937009748 Bacteria 6746052
964 2937021555 2937016420 Bacteria 6782579
965 2937023966 2937023124 Bacteria 6815156
966 2937043351 2937042894 Bacteria 6741576
967 2937056861 2937056579 Bacteria 7107896
968 2937066078 2937063883 Bacteria 7199456
969 2937075393 2937071275 Bacteria 6984483
970 2937096128 2937091812 Bacteria 6979387
971 2937105155 2937098957 Bacteria 7249374
972 2937110518 2937106411 Bacteria 6947143
973 2937118832 2937113482 Bacteria 6505872
974 2937125826 2937119839 Bacteria 6597547
975 2937131049 2937126314 Bacteria 6771275
976 2941483749
977 2941505823 2941499720 Bacteria 7599444
978 2941537389 2941531003 Bacteria 7653939
979 2945948035 2945945610 Bacteria 5951079
980 2957383012 2957382221 Bacteria 6737050
981 2957391967 2957388812 Bacteria 6778072
982 2957396255 2957395598 Bacteria 6822399
983 2957402936 2957402308 Bacteria 6741770
984 2957410708 2957408893 Bacteria 6558585
985 2957415582 2957415311 Bacteria 6991633
986 2957421338 2957415311 Bacteria 6991633
987 2957427287 2957422303 Bacteria 7172205
988 2957435281 2957430029 Bacteria 7022557
989 2957441503 2957437181 Bacteria 6568994
990 2957444489 2957443900 Bacteria 6869977
991 2957454905 2957450854 Bacteria 6765715
992 2957455915 2957450854 Bacteria 6765715
993 2957455926 2957450854 Bacteria 6765715
994 2957461801 2957457609 Bacteria 6967680
995 2957464831 2957464669 Bacteria 6568877
996 2957476835 2957471148 Bacteria 6797643
997 2957482387 2957478035 Bacteria 6756658
998 2957490015 2957484790 Bacteria 6703082
999 2957491696 2957491536 Bacteria 6695180
1000 2957501638 2957498199 Bacteria 7126688
1001 2957510260 2957505466 Bacteria 7253085
1002 2960585022 2960584000 Bacteria 6864594
1003 2960594018 2960591022 Bacteria 6622873
1004 2960598464 2960597568 Bacteria 6550735
1005 2960609531 2960603979 Bacteria 6898737
1006 2960614247 2960610863 Bacteria 6691244
1007 2960629116 2960624210 Bacteria 6875384
1008 2960642809 2960637947 Bacteria 7296468
1009 2960645646 2960645483 Bacteria 7211087
1010 2960654532 2960652885 Bacteria 7083688
1011 2960660994 2960660292 Bacteria 7041660
1012 2960669769 2960667422 Bacteria 6763020
1013 2960677817 2960674078 Bacteria 6609048
1014 2960690881 2960687367 Bacteria 6535474
1015 2961067394 2961064222 Bacteria 4749990
1016 2964610768 2964607997 Bacteria 7101408
1017 2964619287 2964615318 Bacteria 6809089
1018 2964624202 2964621998 Bacteria 6834995
1019 2964632562 2964628898 Bacteria 7083044
1020 2964640669 2964636051 Bacteria 7091832
1021 2964647965 2964643177 Bacteria 6820887
1022 2964655022 2964649959 Bacteria 6675118
1023 2964661710 2964656573 Bacteria 7100150
1024 2964666819 2964663802 Bacteria 7019362
1025 2964678007 2964670856 Bacteria 6851364
1026 2964679053 2964678106 Bacteria 6792020
1027 2964689282 2964685014 Bacteria 6839111
1028 2964696051 2964691889 Bacteria 6802758
1029 2964703224 2964698721 Bacteria 6765331
1030 2964709586 2964705432 Bacteria 7114648
1031 2964717614 2964712639 Bacteria 6695970
1032 2964725296 2964719344 Bacteria 7286602
1033 2965125418 2965119406 Bacteria 6956431
1034 2967668539 2967664464 Bacteria 6948836
1035 2967677081 2967671571 Bacteria 7021409
1036 2967684753 2967678726 Bacteria 7264382
1037 2967697825 2967693043 Bacteria 6804451
1038 2967704406 2967699805 Bacteria 6854538
1039 2967707651 2967706974 Bacteria 7186053
1040 2967720948 2967714385 Bacteria 7000047
1041 2967725179 2967721400 Bacteria 7073753
1042 2967741875 2967735183 Bacteria 6827012
1043 2967744255 2967742019 Bacteria 6794534
1044 2967750854 2967748971 Bacteria 6733771
1045 2967761685 2967755722 Bacteria 6814706
1046 2967766014 2967762386 Bacteria 6923502
1047 2967772281 2967769361 Bacteria 6587838
1048 2970023553 2970019648 Bacteria 7072033
1049 2970038256 2970033650 Bacteria 7118744
1050 2970046499 2970040964 Bacteria 6731123
1051 2970053712 2970047711 Bacteria 7088379
1052 2970058667 2970054988 Bacteria 6611507
1053 2970062416 2970061556 Bacteria 7099761
1054 2970071303 2970068827 Bacteria 7123112
1055 2970080315 2970076120 Bacteria 6697332
1056 2970085708 2970082768 Bacteria 6183754
1057 2970094745 2970088815 Bacteria 6933825
1058 2970096683 2970095765 Bacteria 6936963
1059 2970096694 2970095765 Bacteria 6936963
1060 2970097345 2970095765 Bacteria 6936963
1061 2970105844 2970102677 Bacteria 6812532
1062 2970114815 2970109326 Bacteria 6863976
1063 2970119616 2970116247 Bacteria 6501857
1064 2970134930 2970129317 Bacteria 6806560
1065 2970140950 2970136068 Bacteria 7207982
1066 2970154107 2970149975 Bacteria 6779706
1067 2970162954 2970156795 Bacteria 7168044
1068 2970164651 2970164137 Bacteria 6861252
1069 2970174317 2970170962 Bacteria 6876229
1070 2970182365 2970177841 Bacteria 6768001
1071 2970189382 2970184632 Bacteria 7054431
1072 2970194679 2970191845 Bacteria 7032787
1073 2977518792 2977516862 Bacteria 6940108
1074 2977526436 2977523885 Bacteria 6960446
1075 2977541316 2977537788 Bacteria 6929320
1076 2977557723 2977551784 Bacteria 7125765
1077 2977559566 2977558990 Bacteria 6863948
1078 2977569210 2977565890 Bacteria 6901543
1079 2977578753 2977572785 Bacteria 6763888
1080 2977584696 2977579622 Bacteria 6772100
1081 2979103287 2979100975 Bacteria 5423623
1082 2984514035 2984509177 Bacteria 5274802
1083 2984523066 2984518228 Bacteria 5277463
1084 2984542397 2984537506 Bacteria 5277481
1085 2989776234 2989771324 Bacteria 5605128
1086 2989776243 2989771324 Bacteria 5605128
1087 2996893288 2996893221 Bacteria 5823108
1088 3005422265 3005416602 Bacteria 7064308
1089 3005448779 3005445848 Bacteria 6906074
1090 3005511477 3005506211 Bacteria 6943378
1091 648740930 648276728 Bacteria 6968865
1092 8001845493 8001845381 Bacteria 5804942
1093 8003402603 8003400568 Bacteria 5535898
1094 8003996277 8003992118 Bacteria 7266902
1095 8005262879 8005258706 Bacteria 6184835
1096 8005280237 8005275841 Bacteria 6929066
1097 8005291239 8005289223 Bacteria 6634003
1098 8005301389 8005301065 Bacteria 6614431
1099 8005314531 8005307578 Bacteria 7395396
1100 8005316348 8005314921 Bacteria 7072929
1101 8005324152 8005321885 Bacteria 5795980
1102 8005462539 8005460587 Bacteria 7157962
1103 8005465119 8005460587 Bacteria 7157962
1104 8005488108 8005484373 Bacteria 6297373
1105 8005546954 8005542996 Bacteria 7077758
1106 8005651696 8005645114 Bacteria 6950293
1107 8005683438 8005682033 Bacteria 6726518
1108 8005692403 8005688590 Bacteria 6610080
1109 8006942725 8006933436 Bacteria 10410654
1110 8006969871 8006964411 Bacteria 8966052
1111 8006982448 8006973647 Bacteria 10679141
1112 8006985714 8006984368 Bacteria 9651211
1113 8016516191 8016511872 Bacteria 9921665
1114 8016586128 8016583857 Bacteria 10421953
1115 8016608704 8016603502 Bacteria 8731218
1116 8017060334 8017057580 Bacteria 10023680
1117 8018177924 8018176218 Bacteria 6896178
1118 8019546599 8019538911 Bacteria 7872763
1119 8019679898 8019678201 Bacteria 8863603
1120 8023680998 8023680758 Bacteria 7729763
1121 8023686560 8023680758 Bacteria 7729763
1122 8024501741 8024501048 Bacteria 6427847
1123 8024502242 8024501048 Bacteria 6427847
1124 8056674169 8056673599 Bacteria 7871253
1125 8056684452 8056681323 Bacteria 8472857
1126 8056691844 8056689827 Bacteria 6712655
1127 8057580853 8057575449 Bacteria 7367519
1128 Ga0466970_0016669
1129 JGI24751J29686_10000063
1130 JGI25162J39368_1000125
1131 JGI25152J39213_1000145
1132 JGI25152J39213_1000768
1133 JGI25152J39213_1004660
1134 JGI25150J39212_1000001
1135 JGI25159J45721_1003064
1136 JGI25159J45721_1011989
1137 JGI25151J46595_10000005
1138 JGI25151J46595_10065796
1139 JGI25165J46597_1000495
1140 JGI25165J46597_1000571
1141 JGI25165J46597_1004592
1142 JGI25153J46596_10000040
1143 JGI25153J46596_10000532
1144 JGI25153J46596_10002446
1145 JGI25153J46596_10009846
1146 JGI25153J46596_10015269
1147 rootL2_10022068
1148 JGI25161J50226_1000150
1149 Ga0055535_1000677
1150 Ga0055535_1001086
1151 Ga0055542_1000162
1152 Ga0055542_1001080
1153 Ga0055529_1000566
1154 Ga0055526_1000056
1155 Ga0055526_1000704
1156 Ga0055526_1006243
1157 Ga0055526_1007064
1158 Ga0055526_1009227
1159 Ga0055524_1000817
1160 Ga0055524_1000949
1161 Ga0055524_1004394
1162 Ga0055528_1000106
1163 Ga0055528_1008582
1164 Ga0055528_1009430
1165 Ga0055540_1003098
1166 Ga0055540_1006682
1167 Ga0055540_1015468
1168 Ga0055540_1028337
1169 Ga0055531_10001921
1170 Ga0058692_1004221
1171 Ga0055543_1000074
1172 Ga0065165_1000062
1173 Ga0065165_1022312
1174 Ga0070676_10072247
1175 Ga0070683_100026394
1176 Ga0070690_100213159
1177 Ga0070670_100000245
1178 Ga0068869_100137818
1179 Ga0070666_10019019
1180 Ga0070682_100060393
1181 Ga0070687_100032140
1182 Ga0070661_100247863
1183 Ga0070668_100019835
1184 Ga0070668_100115010
1185 Ga0070675_100375499
1186 Ga0070671_100054363
1187 Ga0070673_100108867
1188 Ga0070688_100059687
1189 Ga0070667_100180094
1190 Ga0070709_10000609
1191 Ga0070709_10197010
1192 Ga0070714_100010925
1193 Ga0070714_100145955
1194 Ga0070714_100533503
1195 Ga0070714_100564012
1196 Ga0070713_100015089
1197 Ga0070713_100029260
1198 Ga0070710_10000144
1199 Ga0070710_10029235
1200 Ga0070710_10038207
1201 Ga0070710_10117997
1202 Ga0070701_10249131
1203 Ga0070705_100023565
1204 Ga0070694_100144956
1205 Ga0070663_100181343
1206 Ga0070678_100045836
1207 Ga0070678_100342775
1208 Ga0070662_100068288
1209 Ga0070662_100381323
1210 Ga0070681_10032776
1211 Ga0068867_100026525
1212 Ga0070685_10017071
1213 Ga0070706_100399483
1214 Ga0070707_100215857
1215 Ga0070679_100269901
1216 Ga0070684_100365265
1217 Ga0068853_100015579
1218 Ga0070693_100196711
1219 Ga0070693_100235464
1220 Ga0070665_100003591
1221 Ga0070665_100016020
1222 Ga0070665_100019552
1223 Ga0070665_100054826
1224 Ga0070665_100087733
1225 Ga0070665_100320289
1226 Ga0070665_100337121
1227 Ga0070664_100210880
1228 Ga0070664_100360118
1229 Ga0068854_100020459
1230 Ga0068854_100207482
1231 Ga0068856_100035527
1232 Ga0068856_100422580
1233 Ga0068856_100739364
1234 Ga0068852_100107981
1235 Ga0068864_100000109
1236 Ga0068864_100040828
1237 Ga0068864_100094523
1238 Ga0068861_100008392
1239 Ga0068863_100009504
1240 Ga0068858_100020755
1241 Ga0068858_100026065
1242 Ga0068858_100033639
1243 Ga0068860_100004221
1244 Ga0068860_100016692
1245 Ga0068860_100273722
1246 Ga0068862_100000022
1247 Ga0081455_10002274
1248 Ga0081455_10096945
1249 Ga0081455_10119834
1250 Ga0081455_10126149
1251 Ga0081538_10021013
1252 Ga0081540_1000466
1253 Ga0081540_1004934
1254 Ga0081540_1006682
1255 Ga0081540_1010590
1256 Ga0081540_1014129
1257 Ga0081540_1021891
1258 Ga0081540_1034132
1259 Ga0081540_1096278
1260 Ga0081539_10030585
1261 Ga0075365_10071338
1262 Ga0075365_10188639
1263 Ga0075368_10028302
1264 Ga0075363_100015464
1265 Ga0075363_100044594
1266 Ga0075364_10003895
1267 Ga0070715_10026998
1268 Ga0070715_10039642
1269 Ga0070716_100025095
1270 Ga0070712_100002030
1271 Ga0070712_100004935
1272 Ga0070712_100028568
1273 Ga0070712_100070714
1274 Ga0070712_100095798
1275 Ga0075362_10004855
1276 Ga0075362_10024312
1277 Ga0075369_10000419
1278 Ga0075369_10152887
1279 Ga0075366_10073587
1280 Ga0075366_10079295
1281 Ga0075370_10122257
1282 Ga0068871_100067601
1283 Ga0068871_100079177
1284 Ga0068871_100449309
1285 Ga0075431_100004254
1286 Ga0068865_100029277
1287 Ga0068865_100034127
1288 Ga0099825_1044464
1289 Ga0099822_1000686
1290 Ga0099823_1043708
1291 Ga0079104_1005204
1292 Ga0079104_1008261
1293 Ga0099826_10000010
1294 Ga0099794_10078861
1295 Ga0099795_10022137
1296 Ga0105244_10013012
1297 Ga0105240_10000201
1298 Ga0105240_10237212
1299 Ga0111539_10002098
1300 Ga0105245_10020119
1301 Ga0105245_10442189
1302 Ga0105243_10152113
1303 Ga0105241_10110362
1304 Ga0105248_10032169
1305 Ga0105248_10159725
1306 Ga0105248_10196755
1307 Ga0105237_10002871
1308 Ga0105237_10003330
1309 Ga0105237_10038704
1310 Ga0105237_10173152
1311 Ga0105249_10478291
1312 Ga0099796_10014960
1313 Ga0105239_10049987
1314 Ga0105239_10188875
1315 Ga0105239_10319437
1316 Ga0105239_10327427
1317 Ga0105239_10495397
1318 Ga0105246_10019264
1319 Ga0157370_10001402
1320 Ga0171463_1005
1321 Ga0157375_10015743
1322 Ga0157375_10067698
1323 Ga0163163_10022921
1324 Ga0157380_10155714
1325 Ga0157380_10170236
1326 Ga0157380_10447846
1327 Ga0182008_10002242
1328 Ga0157379_10048312
1329 Ga0157379_10053775
1330 Ga0157379_10148352
1331 Ga0157376_10191779
1332 Ga0182007_10012038
1333 Ga0182005_1025912
1334 Ga0183363_1022
1335 Ga0163161_10007287
1336 Ga0214544_1000013
1337 Ga0214542_1000013
1338 Ga0214545_1000012
1339 Ga0214545_1032757
1340 Ga0209436_100011
1341 Ga0209436_111532
1342 Ga0209672_100129
1343 Ga0209672_100829
1344 Ga0209437_100022
1345 Ga0209258_100088
1346 Ga0209258_100236
1347 Ga0207425_1000002
1348 Ga0207425_1001067
1349 Ga0207425_1008952
1350 Ga0209646_1000916
1351 Ga0209026_1006750
1352 Ga0209677_100174
1353 Ga0209148_1000024
1354 Ga0209148_1000209
1355 Ga0209759_1001537
1356 Ga0209129_1000002
1357 Ga0209129_1000615
1358 Ga0209129_1001256
1359 Ga0209129_1019262
1360 Ga0209233_1000031
1361 Ga0209233_1000217
1362 Ga0209565_1017141
1363 Ga0209455_1000025
1364 Ga0209673_1000139
1365 Ga0209673_1001266
1366 Ga0209673_1003378
1367 Ga0209673_1003445
1368 Ga0209673_1004658
1369 Ga0209673_1007214
1370 Ga0209130_1000066
1371 Ga0209130_1000174
1372 Ga0209130_1008246
1373 Ga0209676_1001350
1374 Ga0209025_1000004
1375 Ga0209025_1007680
1376 Ga0209025_1016628
1377 Ga0209564_1000117
1378 Ga0209564_1000225
1379 Ga0209564_1000255
1380 Ga0209564_1000331
1381 Ga0209564_1019349
1382 Ga0209758_1000006
1383 Ga0209758_1000861
1384 Ga0209758_1001171
1385 Ga0209758_1005160
1386 Ga0209758_1013710
1387 Ga0209758_1018751
1388 Ga0209758_1032067
1389 Ga0209050_1009349
1390 Ga0209256_1000131
1391 Ga0209256_1000299
1392 Ga0209256_1000622
1393 Ga0209256_1001834
1394 Ga0209256_1003652
1395 Ga0209256_1008343
1396 Ga0207426_1000008
1397 Ga0207426_1001743
1398 Ga0207426_1006027
1399 Ga0209051_1000643
1400 Ga0209051_1002199
1401 Ga0209051_1008982
1402 Ga0209051_1023723
1403 Ga0209051_1028555
1404 Ga0209051_1050454
1405 Ga0209257_1002248
1406 Ga0209257_1029512
1407 Ga0207655_1016122
1408 Ga0207692_10000215
1409 Ga0207692_10062403
1410 Ga0207692_10239169
1411 Ga0207692_10250894
1412 Ga0207642_10045282
1413 Ga0207642_10102604
1414 Ga0207699_10001468
1415 Ga0207699_10213023
1416 Ga0207684_10294367
1417 Ga0207654_10072265
1418 Ga0207654_10197679
1419 Ga0207707_10017493
1420 Ga0207695_10000118
1421 Ga0207671_10000175
1422 Ga0207693_10009787
1423 Ga0207693_10059070
1424 Ga0207693_10081544
1425 Ga0207693_10108286
1426 Ga0207693_10138364
1427 Ga0207662_10069500
1428 Ga0207652_10226328
1429 Ga0207650_10000039
1430 Ga0207650_10074550
1431 Ga0207659_10177955
1432 Ga0207687_10039904
1433 Ga0207687_10096057
1434 Ga0207700_10005756
1435 Ga0207664_10031599
1436 Ga0207664_10059460
1437 Ga0207664_10449485
1438 Ga0207644_10246474
1439 Ga0207644_10461318
1440 Ga0207690_10137278
1441 Ga0207686_10080169
1442 Ga0207709_10064340
1443 Ga0207669_10100007
1444 Ga0207669_10373675
1445 Ga0207704_10311565
1446 Ga0207665_10007952
1447 Ga0207665_10008176
1448 Ga0207691_10150971
1449 Ga0207711_10049244
1450 Ga0207711_10137788
1451 Ga0207711_10349814
1452 Ga0207711_10599579
1453 Ga0207689_10058238
1454 Ga0207689_10070860
1455 Ga0207689_10087113
1456 Ga0207661_10018471
1457 Ga0207679_10381462
1458 Ga0207651_10047261
1459 Ga0207651_10155936
1460 Ga0207712_10179060
1461 Ga0207668_10135775
1462 Ga0207668_10150973
1463 Ga0207668_10230983
1464 Ga0207668_10287993
1465 Ga0207640_10014501
1466 Ga0207640_10084049
1467 Ga0207703_10020070
1468 Ga0207703_10033168
1469 Ga0207639_10025696
1470 Ga0207678_10089522
1471 Ga0207678_10162826
1472 Ga0207702_10085572
1473 Ga0207641_10084948
1474 Ga0207648_10310003
1475 Ga0207676_10000035
1476 Ga0207675_100000029
1477 Ga0207675_100033572
1478 Ga0207675_100089926
1479 Ga0207675_100234025
1480 Ga0207683_10045034
1481 Ga0207683_10049809
1482 Ga0207683_10206149
1483 Ga0207698_10007770
1484 Ga0207698_10210856
1485 Ga0209281_1001051
1486 Ga0209389_1000163
1487 Ga0209371_1001722
1488 Ga0209371_1003088
1489 Ga0209589_1000002
1490 Ga0209489_100002
1491 Ga0209489_101100
1492 Ga0209700_100002
1493 Ga0209700_100014
1494 Ga0209282_1000009
1495 Ga0209588_1004478
1496 Ga0207428_10000560
1497 Ga0207428_10002329
1498 Ga0268266_10022307
1499 Ga0268266_10066111
1500 Ga0268266_10072134
1501 Ga0268266_10072159
1502 Ga0268266_10074416
1503 Ga0268266_10099972
1504 Ga0268265_10000006
1505 Ga0268265_10011076
1506 Ga0268265_10163153
1507 Ga0268265_10250613
1508 Ga0268264_10000062
1509 Ga0268264_10341015
1510 Ga0265334_10049386
1511 Ga0265336_10000816
1512 Ga0307517_10092154
1513 Ga0307517_10168772
1514 Ga0307515_10138045
1515 Ga0307515_10194014
1516 Ga0265338_10000572
1517 Ga0268256_1000785
1518 Ga0268256_1003493
1519 Ga0307511_10030724
1520 Ga0265331_10075526
1521 Ga0307513_10041634
1522 Ga0307513_10069169
1523 Ga0307509_10019301
1524 Ga0307509_10046512
1525 Ga0307408_100003016
1526 Ga0307508_10085997
1527 Ga0265314_10002700
1528 Ga0265342_10021476
1529 Ga0307516_10002464
1530 Ga0307516_10260437
1531 Ga0307405_10254827
1532 Ga0307410_10012481
1533 Ga0307406_10000771
1534 Ga0307406_10044488
1535 Ga0307406_10122943
1536 Ga0307412_10025137
1537 Ga0307409_100105236
1538 Ga0307409_100134590
1539 Ga0307416_100108681
1540 Ga0307416_100394017
1541 Ga0307414_10000018
1542 Ga0307415_100255748
1543 Ga0307510_10016774
1544 Ga0307510_10122315
1545 Ga0307510_10256375
1546 Ga0373926_0112063
1547 Ga0373923_0087281
1548 Ga0373923_0161312
1549 Ga0373943_0038999
1550 Ga0373943_0111585
1551 Ga0373942_0027848
1552 Ga0373931_0055602
1553 Ga0373931_0071495
1554 Ga0373931_0262479
1555 Ga0373935_0171166
1556 Ga0373927_0003977
1557 Ga0373927_0071556
1558 Ga0373933_0051988
1559 Ga0373947_0020723
1560 Ga0373937_0131839
1561 Ga0373925_0006499
1562 Ga0373925_0043778
1563 Ga0373925_0077902
1564 Ga0395901_0187072
1565 Ga0439447_000286
1566 Ga0439461_0002294
1567 Ga0439466_0008235
1568 Ga0439466_0011134
1569 Ga0439465_0002144
1570 Ga0451807_1369558
1571 Ga0451833_0055069
1572 Ga0451847_0770903
1573 Ga0451851_0373797
1574 Ga0439431_0002340
1575 Ga0439445_0036348
1576 Ga0439432_063961
1577 Ga0439449_0001954
1578 Ga0439434_0016395
1579 Ga0466966_0034962
1580 Ga0466968_0040719
1581 Ga0495603_0008522
1582 Ga0495603_0095992
1583 Ga0495629_0001177
1584 Ga0495629_0059347
1585 Ga0495638_0024226
1586 Ga0495638_0192148
1587 Ga0495641_0031217
1588 Ga0495653_0061296
1589 Ga0495605_0134187
1590 Ga0495662_0051243
1591 Ga0495594_0072393
1592 Ga0495607_0012359
1593 Ga0495583_0001798
1594 Ga0495606_0000161
1595 Ga0495610_0015862
1596 Ga0495610_0021278
1597 Ga0495610_0051177
1598 Ga0495610_0057426
1599 Ga0495610_0071632
1600 Ga0495631_0077962
1601 Ga0495643_0013947
1602 Ga0495643_0017843
1603 Ga0495643_0025587
1604 Ga0495663_0026086
1605 Ga0495666_0046736
1606 Ga0495645_0046993
1607 Ga0495622_0025843
1608 Ga0495667_0155243
1609 Ga0495668_0000002
1610 Ga0495668_0177931
1611 Ga0495634_0028166
1612 Ga0495625_0003303
1613 Ga0495625_0018451
1614 Ga0495625_0149748
1615 Ga0495635_0000978
1616 Ga0495588_0003105
1617 Ga0495669_0015704
1618 Ga0495613_0301926
1619 Ga0495624_0045881
1620 Ga0495589_0171585
1621 Ga0495660_0021283
1622 Ga0495660_0090367
1623 Ga0495604_0000626
1624 Ga0495674_0092406
1625 Ga0495674_0183477
1626 Ga0495674_0250785
1627 Ga0495676_0308024
1628 Ga0495687_000521
1629 Ga0495687_000748
1630 Ga0495687_002186
1631 Ga0495673_0047864
1632 Ga0495684_0004330
1633 Ga0495686_0077646
1634 Ga0495686_0184387
1635 Ga0495602_0018555
1636 Ga0495602_0130747
1637 Ga0496100_0002867
1638 Ga0496100_0014569
1639 Ga0496101_0001838
1640 Ga0496101_0020397
1641 Ga0496102_0048548
1642 Ga0496102_0060614
1643 Ga0496102_0297745
1644 Ga0496103_0006117
1645 Ga0496103_0016546
1646 Ga0496103_0021882
1647 Ga0496104_0018207
1648 Ga0496104_0021062
1649 Ga0496104_0070144
1650 Ga0496104_0159562
1651 Ga0496105_0012970
1652 Ga0496105_0041364
1653 Ga0496106_0000093
1654 Ga0496106_0051678
1655 Ga0496106_0101291
1656 Ga0496106_0307303
1657 Ga0496106_0519153
1658 Ga0496107_0047573
1659 Ga0496107_0061952
1660 Ga0496107_0106792
1661 Ga0496107_0123725
1662 Ga0496108_0006949
1663 Ga0496108_0026774
1664 Ga0496109_0069613
1665 Ga0496109_0143251
1666 Ga0496109_0490000
1667 Ga0496110_0100973
1668 Ga0496110_0215354
1669 Ga0496110_0234946
1670 Ga0496111_0089652
1671 Ga0496112_0081132
1672 Ga0496112_0132350
1673 Ga0496112_0371258
1674 Ga0496113_0024311
1675 Ga0496114_0026876
1676 Ga0496114_0206226
1677 Ga0496115_0004235
1678 Ga0496115_0251185
1679 Ga0496116_0041410
1680 Ga0496116_0069069
1681 Ga0496117_0004844
1682 Ga0496117_0008863
1683 Ga0496117_0129150
1684 Ga0496118_0004178
1685 Ga0496118_0005397
1686 Ga0496118_0011760
1687 Ga0496118_0047620
1688 Ga0496119_0000390
1689 Ga0496119_0006421
1690 Ga0496119_0029847
1691 Ga0496119_0032878
1692 Ga0496119_0085568
1693 Ga0496120_0002913
1694 Ga0496120_0026293
1695 Ga0496121_0002660
1696 Ga0496121_0002696
1697 Ga0496121_0026649
1698 Ga0496121_0052853
1699 Ga0496121_0060528
1700 Ga0496122_0000047
1701 Ga0496122_0037604
1702 Ga0496122_0095401
1703 Ga0496122_0213571
1704 Ga0496123_0000077
1705 Ga0496123_0000393
1706 Ga0496123_0019962
1707 Ga0496123_0021688
1708 Ga0496124_0029367
1709 Ga0496124_0041508
1710 Ga0496124_0083496
1711 Ga0496124_0123602
1712 Ga0496124_0281151
1713 Ga0496125_0000105
1714 Ga0496125_0053125
1715 Ga0496126_0010668
1716 Ga0496126_0040859
1717 Ga0496126_0179249
1718 Ga0496126_0286912
1719 Ga0496126_0363782
1720 Ga0495682_0097034
1721 Ga0501031_0147246
1722 Ga0501032_0022921
1723 Ga0501033_0009780
1724 Ga0501033_0033244
1725 Ga0501033_0097200
1726 Ga0501034_0003451
1727 Ga0501034_0051312
1728 Ga0501034_0098738
1729 Ga0501034_0154722
1730 Ga0501034_0188927
1731 Ga0501034_0535031
1732 Ga0501036_0090569
1733 Ga0501036_0120847
1734 Ga0501037_0017509
1735 Ga0501037_0227513
1736 Ga0501038_0082564
1737 Ga0501038_0102082
1738 Ga0501038_0363153
1739 Ga0501039_0027289
1740 Ga0501039_0191077
1741 Ga0501042_0013985
1742 Ga0501043_0037940
1743 Ga0501043_0057065
1744 Ga0501043_0168413
1745 Ga0501046_0112978
1746 Ga0501046_0166256
1747 Ga0501047_0049777
1748 Ga0501047_0054806
1749 Ga0501047_0152148
1750 Ga0501047_0381201
1751 Ga0501048_0002535
1752 Ga0501048_0039881
1753 Ga0501069_0151525
1754 Ga0501070_0063375
1755 Ga0501070_0186078
1756 Ga0501073_0017180
1757 Ga0501074_0040694
1758 Ga0501083_0217365
1759 Ga0501035_0374333
1760 Ga0501035_0377287
1761 Ga0501044_0007532
1762 Ga0501044_0153059
1763 Ga0501045_0009657
1764 nmdc:mga03683_13848_c1
1765 nmdc:mga00v17_11869_c1
1766 nmdc:mga0k408_117874_c1
1767 nmdc:mga0k408_121597_c1
1768 nmdc:mga07m45_126241_c1
1769 nmdc:mga05p37_890_c1
1770 nmdc:mga09592_17280_c1
1771 nmdc:mga0qj67_17074_c1
1772 nmdc:mga06r32_12281_c1
1773 nmdc:mga06r32_68226_c1
1774 nmdc:mga08y16_1184_c1
1775 nmdc:mga08y16_31589_c1
1776 nmdc:mga08y16_609_c1
1777 nmdc:mga0n895_112098_c1
1778 nmdc:mga0a205_45969_c2
1779 Ga0495601_0002861
1780 Ga0495612_0021342
1781 Ga0500643_059687
1782 Ga0500644_0024690
1783 Ga0500644_0053889
1784 Ga0500566_0000074
1785 Ga0500566_0003680
1786 Ga0500640_000535
1787 Ga0500569_000794
1788 Ga0500569_012100
1789 Ga0500572_000414
1790 Ga0500595_000348
1791 Ga0500618_000720
1792 Ga0500618_040919
1793 Ga0500658_0000516
1794 Ga0500658_0001317
1795 Ga0500658_0152864
1796 Ga0500559_0000683
1797 Ga0500568_0000740
1798 Ga0500573_0027376
1799 Ga0500616_0000731
1800 Ga0500616_0016056
1801 Ga0500616_0037385
1802 Ga0500622_0000170
1803 Ga0500633_0004866
1804 Ga0500638_021318
1805 Ga0500637_0000110
1806 Ga0500637_0022523
1807 Ga0500661_002499
1808 Ga0501082_0014164
1809 Ga0501082_0121908
1810 2509380292
1811 2509442533
1812 2509446221
1813 2510302723
1814 2510894308
1815 2510899333
1816 2511181789
1817 2511497775
1818 2513569987
1819 2513571651
1820 2513578687
1821 2513584568
1822 2513616418
1823 2513630130
1824 2513671705
1825 2513680213
1826 2513869657
1827 2513873237
1828 2513883885
1829 2513902011
1830 2513923868
1831 2513923876
1832 2514015491
1833 2514015492
1834 2514019424
1835 2515111880
1836 2515114428
1837 2515643162
1838 2515656271
1839 2516896575
1840 2517078343
1841 2517406427
1842 2517408513
1843 2517894613
1844 2520376163
1845 2524436318
1846 2524461557
1847 2524469238
1848 2530645189
1849 2551681432
1850 2551684669
1851 2551708251
1852 2551716023
1853 2585203225
1854 2585205466
1855 2585226627
1856 2585230453
1857 2585280898
1858 2585394451
1859 2585404530
1860 2585404950
1861 2585526021
1862 2585530602
1863 2585549701
1864 2585554780
1865 2585824226
1866 2585992651
1867 2595452291
1868 2599415906
1869 2599415916
1870 2600196723
1871 2600196729
1872 2601611478
1873 2601748101
1874 2616310719
1875 2616553165
1876 2617350721
1877 2617378882
1878 2643805578
1879 2644064629
1880 2644064635
1881 2644106735
1882 2644109680
1883 2644148086
1884 2644148986
1885 2644196814
1886 2644288076
1887 2644289263
1888 2644310039
1889 2644312558
1890 2644331988
1891 2644336887
1892 2644355276
1893 2644377136
1894 2644377142
1895 2644419484
1896 2644419490
1897 2644452841
1898 2644452847
1899 2644540873
1900 2644543905
1901 2644616257
1902 2644618289
1903 2644636863
1904 2644672030
1905 2644672036
1906 2644691832
1907 2644691838
1908 2644734444
1909 2644747790
1910 2692318060
1911 2719385467
1912 2721399215
1913 2723845405
1914 2724038028
1915 2725949807
1916 2739591546
1917 2747948559
1918 2765465369
1919 2776272033
1920 2776279447
1921 2792624916
1922 2792643908
1923 2792644099
1924 2792749954
1925 2793061026
1926 2793077763
1927 2793295362
1928 2793313829
1929 2805914774
1930 2805928110
1931 2805929234
1932 2805932509
1933 2819613460
1934 2819641096
1935 2824616740
1936 2824659768
1937 2824660398
1938 2824675966
1939 2824692073
1940 2824700319
1941 2824734302
1942 2824747858
1943 2824780441
1944 2834643351
1945 2838034441
1946 2838036025
1947 2838036033
1948 2838127842
1949 2838667446
1950 2838673391
1951 2838681028
1952 2838690323
1953 2838694939
1954 2838706138
1955 2838708315
1956 2838732080
1957 2838744976
1958 2839998168
1959 2840767811
1960 2841856034
1961 2841943134
1962 2841943135
1963 2841968224
1964 2841968225
1965 2841976565
1966 2841987939
1967 2842080451
1968 2842121070
1969 2842150519
1970 2842161203
1971 2842184820
1972 2842192749
1973 2842207097
1974 2842232402
1975 2842237727
1976 2842246818
1977 2842255602
1978 2842261081
1979 2842274343
1980 2842280210
1981 2842294110
1982 2842303137
1983 2842305815
1984 2842323868
1985 2842361427
1986 2842371491
1987 2842380507
1988 2842387578
1989 2842481188
1990 2842492600
1991 2842494570
1992 2842507901
1993 2842513593
1994 2842694626
1995 2842715697
1996 2844168015
1997 2844456978
1998 2847423432
1999 2847931330
2000 2847947139
2001 2849081477
2002 2850085713
2003 2852392980
2004 2855828591
2005 2855843717
2006 2858807038
2007 2858956279
2008 2874607705
2009 2876812081
2010 2876817473
2011 2879087629
2012 2879110485
2013 2879112657
2014 2883292924
2015 2887376891
2016 2889020903
2017 2889039589
2018 2889042432
2019 2893066892
2020 2894657141
2021 2896386587
2022 2902407475
2023 2902811668
2024 2902840751
2025 2903771098
2026 2903776277
2027 2904698311
2028 2904700655
2029 2906643449
2030 2906651717
2031 2908762912
2032 2908778068
2033 2915988061
2034 2915998184
2035 2916002531
2036 2916007301
2037 2916011302
2038 2916020539
2039 2916028123
2040 2916032843
2041 2916038229
2042 2916044999
2043 2916051936
2044 2916059495
2045 2916076023
2046 2916077800
2047 2917704674
2048 2917742765
2049 2919106133
2050 2919120744
2051 2919135963
2052 2919467343
2053 2921203182
2054 2921208733
2055 2921208744
2056 2921213287
2057 2921240554
2058 2921245756
2059 2921260069
2060 2921268420
2061 2921284643
2062 2921290540
2063 2921304039
2064 2923559114
2065 2923559423
2066 2924148142
2067 2924154741
2068 2924163948
2069 2924168415
2070 2924177206
2071 2924182060
2072 2924186205
2073 2924186216
2074 2924188934
2075 2924195786
2076 2924202945
2077 2924209979
2078 2924221305
2079 2924228362
2080 2924233784
2081 2933018982
2082 2933022158
2083 2933572320
2084 2935773789
2085 2935788775
2086 2935795599
2087 2935895461
2088 2936386966
2089 2937005859
2090 2937014307
2091 2937021555
2092 2937023966
2093 2937043351
2094 2937056861
2095 2937066078
2096 2937075393
2097 2937096128
2098 2937105155
2099 2937110518
2100 2937118832
2101 2937125826
2102 2937131049
2103 2941483749
2104 2941505823
2105 2941537389
2106 2945948035
2107 2957383012
2108 2957391967
2109 2957396255
2110 2957402936
2111 2957410708
2112 2957415582
2113 2957421338
2114 2957427287
2115 2957435281
2116 2957441503
2117 2957444489
2118 2957454905
2119 2957455915
2120 2957455926
2121 2957461801
2122 2957464831
2123 2957476835
2124 2957482387
2125 2957490015
2126 2957491696
2127 2957501638
2128 2957510260
2129 2960585022
2130 2960594018
2131 2960598464
2132 2960609531
2133 2960614247
2134 2960629116
2135 2960642809
2136 2960645646
2137 2960654532
2138 2960660994
2139 2960669769
2140 2960677817
2141 2960690881
2142 2961067394
2143 2964610768
2144 2964619287
2145 2964624202
2146 2964632562
2147 2964640669
2148 2964647965
2149 2964655022
2150 2964661710
2151 2964666819
2152 2964678007
2153 2964679053
2154 2964689282
2155 2964696051
2156 2964703224
2157 2964709586
2158 2964717614
2159 2964725296
2160 2965125418
2161 2967668539
2162 2967677081
2163 2967684753
2164 2967697825
2165 2967704406
2166 2967707651
2167 2967720948
2168 2967725179
2169 2967741875
2170 2967744255
2171 2967750854
2172 2967761685
2173 2967766014
2174 2967772281
2175 2970023553
2176 2970038256
2177 2970046499
2178 2970053712
2179 2970058667
2180 2970062416
2181 2970071303
2182 2970080315
2183 2970085708
2184 2970094745
2185 2970096683
2186 2970096694
2187 2970097345
2188 2970105844
2189 2970114815
2190 2970119616
2191 2970134930
2192 2970140950
2193 2970154107
2194 2970162954
2195 2970164651
2196 2970174317
2197 2970182365
2198 2970189382
2199 2970194679
2200 2977518792
2201 2977526436
2202 2977541316
2203 2977557723
2204 2977559566
2205 2977569210
2206 2977578753
2207 2977584696
2208 2979103287
2209 2984514035
2210 2984523066
2211 2984542397
2212 2989776234
2213 2989776243
2214 2996893288
2215 3005422265
2216 3005448779
2217 3005511477
2218 648740930
2219 8001845493
2220 8003402603
2221 8003996277
2222 8005262879
2223 8005280237
2224 8005291239
2225 8005301389
2226 8005314531
2227 8005316348
2228 8005324152
2229 8005462539
2230 8005465119
2231 8005488108
2232 8005546954
2233 8005651696
2234 8005683438
2235 8005692403
2236 8006942725
2237 8006969871
2238 8006982448
2239 8006985714
2240 8016516191
2241 8016586128
2242 8016608704
2243 8017060334
2244 8018177924
2245 8019546599
2246 8019679898
2247 8023680998
2248 8023686560
2249 8024501741
2250 8024502242
2251 8056674169
2252 8056684452
2253 8056691844
2254 8057580853

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

121

332

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zo2-assembly1.cif.gz_B aidc, a dizinc quorum-quenching lactonase 0.9178 25 308
7y7u-assembly1.cif.gz_B dimeric structure of a quorum-quenching metallo-hydrolase, lrsl 0.8911 26 306
1p9e-assembly1.cif.gz_A crystal structure analysis of methyl parathion hydrolase from pseudomonas sp wbc-3 0.8852 15 308
4zo2-assembly1.cif.gz_B aidc, a dizinc quorum-quenching lactonase 0.8849 25 308
5hif-assembly1.cif.gz_B crystal structure of a reconstructed lactonase ancestor, anc1-mph, of the bacterial methyl parathion hydrolase, mph. 0.8774 12 308
ID Description Score Start End Superfamily
4zo2A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9165 25 308 3.60.15.10
4zo2A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8866 25 308 3.60.15.10
6c2cA00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8693 9 308 3.60.15.10
4xukA00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8623 23 308 3.60.15.10
4le6E00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8619 15 308 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A4R3QI76-F1-model_v4 Metallo-beta-lactamase superfamily protein 0.9863 155 308
AF-A0A4R3QI76-F1-model_v4 Metallo-beta-lactamase superfamily protein 0.98 155 308
AF-A0A2X1GGK9-F1-model_v4 deleted 0.978 141 308
AF-A0A2S8MNA1-F1-model_v4 deleted 0.9772 105 241
AF-W6S4J1-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9767 225 308

Map